(data stored in ACNUC7421 zone)

EMBL: CP000032

ID   CP000032; SV 1; circular; genomic DNA; STD; PRO; 491611 BP.
XX
AC   CP000032;
XX
PR   Project:PRJNA281;
XX
DT   17-DEC-2004 (Rel. 82, Created)
DT   28-MAY-2015 (Rel. 124, Last updated, Version 12)
XX
DE   Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence.
XX
KW   .
XX
OS   Ruegeria pomeroyi DSS-3
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Ruegeria.
OG   megaplasmid
XX
RN   [1]
RP   1-491611
RX   DOI; 10.1038/nature03170.
RX   PUBMED; 15602564.
RA   Moran M.A., Buchan A., Gonzalez J.M., Heidelberg J.F., Whitman W.B.,
RA   Kiene R.P., Henriksen J.R., King G.M., Belas R., Fuqua C., Brinkac L.,
RA   Lewis M., Johri S., Weaver B., Pai G., Eisen J.A., Rahe E., Sheldon W.M.,
RA   Ye W., Miller T.R., Carlton J., Rasko D.A., Paulsen I.T., Ren Q.,
RA   Daugherty S.C., Deboy R.T., Dodson R.J., Durkin A.S., Madupu R.,
RA   Nelson W.C., Sullivan S.A., Rosovitz M.J., Haft D.H., Selengut J., Ward N.;
RT   "Genome sequence of Silicibacter pomeroyi reveals adaptations to the marine
RT   environment";
RL   Nature 432(7019):910-913(2004).
XX
RN   [2]
RP   1-491611
RX   DOI; 10.1128/AEM.02580-06.
RX   PUBMED; 17526795.
RA   Moran M.A., Belas R., Schell M.A., Gonzalez J.M., Sun F., Sun S.,
RA   Binder B.J., Edmonds J., Ye W., Orcutt B., Howard E.C., Meile C.,
RA   Palefsky W., Goesmann A., Ren Q., Paulsen I., Ulrich L.E., Thompson L.S.,
RA   Saunders E., Buchan A.;
RT   "Ecological genomics of marine Roseobacters";
RL   Appl. Environ. Microbiol. 73(14):4559-4569(2007).
XX
RN   [3]
RC   Publication Status: Online-Only
RP   1-491611
RX   DOI; 10.1186/1944-3277-9-11.
RX   PUBMED; 25780504.
RA   Rivers A.R., Smith C.B., Moran M.A.;
RT   "An Updated genome annotation for the model marine bacterium Ruegeria
RT   pomeroyi DSS-3";
RL   Stand Genomic Sci 9:11-11(2014).
XX
RN   [4]
RP   1-491611
RA   Moran M.A., Buchan A., Gonzalez J.M., Heidelberg J.F., Whitman W.B.,
RA   Kiene R.P., Henriksen J.R., King G.M., Belas R., Fuqua C., Brinkac L.,
RA   Lewis M., Johri S., Weaver B., Pai G., Eisen J.A., Rahe E., Sheldon W.M.,
RA   Ye W., Miller T.R., Carlton J., Rasko D.A., Paulsen I.T., Ren Q.,
RA   Daugherty S.C., DeBoy R.T., Dodson R.J., Durkin A.S., Madupu R.,
RA   Nelson W.C., Sullivan S.A., Rosovitz M., Haft D.H., Selengut J., Ward N.L.;
RT   ;
RL   Submitted (21-OCT-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [5]
RC   Protein update by submitters
RP   1-491611
RA   Rivers A.R., Smith C.B., Moran M.A.;
RT   ;
RL   Submitted (26-NOV-2013) to the INSDC.
RL   Marine Science, University of Georgia, 325 Samford Dr., Athens, GA 30602,
RL   USA
XX
DR   MD5; f69d3b80459a33a8891a64eb8c856c2c.
DR   BioSample; SAMN02604003.
DR   EnsemblGenomes-Gn; EBG00001207982.
DR   EnsemblGenomes-Gn; EBG00001207983.
DR   EnsemblGenomes-Gn; SPOA_tRNA-Phe-1.
DR   EnsemblGenomes-Gn; SPOA_tRNA-Thr-1.
DR   EnsemblGenomes-Tr; EBT00001777125.
DR   EnsemblGenomes-Tr; EBT00001777126.
DR   EnsemblGenomes-Tr; SPOA_tRNA-Phe-1-1.
DR   EnsemblGenomes-Tr; SPOA_tRNA-Thr-1-1.
DR   EuropePMC; PMC3165705; 21742885.
DR   EuropePMC; PMC4127530; 25157246.
DR   EuropePMC; PMC4334477; 25780504.
DR   EuropePMC; PMC4809877; 27065955.
DR   EuropePMC; PMC5348524; 28352252.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF01727; SAM-SAH.
DR   StrainInfo; 118527; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..491611
FT                   /organism="Ruegeria pomeroyi DSS-3"
FT                   /plasmid="megaplasmid"
FT                   /strain="DSS-3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:246200"
FT   gene            1..798
FT                   /locus_tag="SPOA0449"
FT   CDS_pept        1..798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0449"
FT                   /product="phytanoyl-CoA dioxygenase family protein"
FT                   /note="identified by match to protein family HMM PF05721"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97580"
FT                   /db_xref="GOA:Q5LLM2"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLM2"
FT                   /protein_id="AAV97580.1"
FT                   /translation="MPHPLVTPEMIETFQRDGVVLIRGLFADHVETLRAGVAANMAAPG
FT                   PYASDNRKEGHTGLFFDDYCNWERIPEFREVIETSPAAEVAAELMQSKTVQMFHDHVLV
FT                   KEPGTSMATPWHQDGPYYFVEGRQTVSFWSPLDAVSEATLRCVAGSHRWEKEVLPTRWV
FT                   SEEGFFADEGQYMPVPDPEAEGMRIVEFEMAPGDAVAFDYRTLHGARGNRSTARRRAFS
FT                   LRLLGDDARYVERPGRTSPPYPGHDMVPGQRLREDWFPVLLKR"
FT   gene            complement(872..1777)
FT                   /locus_tag="SPOA0001"
FT   CDS_pept        complement(872..1777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0001"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97142"
FT                   /db_xref="GOA:Q5LLM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLM1"
FT                   /protein_id="AAV97142.1"
FT                   /translation="MPDRQISKAGWTGMEYASFDHFLKTGGAALAKGPVAMIFVEDDVE
FT                   LATTMRHHIQCGFKSVLALMPDAFTLPPDVESRVHRIPFDCGPRLAVTNAINRIIAAAP
FT                   GIWMYYCFNAEYLFYPFCETRSIGEMLAFHGEERRDAMLTYVIDLYADDLGAFPIGVSL
FT                   DRAFLDKSGYYAQARKEPETGHPRERQLDFFGGVRWRYEEHIPKDSRKIDRIALFRSAP
FT                   GLHLQPDHTFDDQEYNTYACPWHHNLTAAICSFRTAKALKKNPGSTFEIQSFRWHNSTP
FT                   FEWHSRQLLDLGLMEPGQWF"
FT   gene            1804..3192
FT                   /gene="miaB"
FT                   /locus_tag="SPOA0002"
FT   CDS_pept        1804..3192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="SPOA0002"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF01938; match to protein
FT                   family HMM PF04055; match to protein family HMM TIGR00089;
FT                   match to protein family HMM TIGR01574"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97143"
FT                   /db_xref="GOA:Q5LLM0"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLM0"
FT                   /protein_id="AAV97143.1"
FT                   /translation="MHCKRRPNPVEAAADPAKAKARPMSDPKKLFIKTYGCQMNVYDSE
FT                   RMAEALGGQGYVETQSAEDADMILLNTCHIREKAAEKVYSELGRFKGLKAAKPDLKIGV
FT                   AGCVAQAEGEEIMRRQPLVDLVVGPQSYHRLPELEAKTRAGEKALDTDFPEEDKFEKLK
FT                   GRPKAKRGPTAFLTVQEGCDKFCAFCVVPYTRGAEVSRPADRILREANELVERGVREIT
FT                   LLGQNVNAYHGAGPNGDMTLAGLIWELDKIDGLERIRFTTSHPNDMADDLIEAHGTCAK
FT                   LMPYLHLPVQAGSDKILKRMNRSHTAESYLRLIERIRAARPDIVMSGDFIVGFPEETEA
FT                   DFQDTLDLVEQVRYGYAYSFKYSTRPGTPAAERAQVDPAEADDRLQRLQAVITRHQREI
FT                   QDGMVGREVSVLFEKPGRQPGQMVGKSEYLHAVHVQDPGLEAGQIARVRIVASGANSLA
FT                   GELA"
FT   gene            complement(3205..3774)
FT                   /locus_tag="SPOA0003"
FT   CDS_pept        complement(3205..3774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0003"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97144"
FT                   /db_xref="GOA:Q5LLK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLK6"
FT                   /protein_id="AAV97144.1"
FT                   /translation="MRLPHPASRQRDCRTIGNRCAQGSELHPFWLTIEGDHPPSEAASA
FT                   TLPDRLASSRRPLSGTGAPSSAVWRWYIFLVRRGGIDMKAYLRAGAVLALTAVVATSPE
FT                   AQQRPTKPGSDVHNITISCFRGPTSSVIWDRPNAVFVEDLVRMGYTYPEAHAIGERICR
FT                   DEWGVGQHDYMRSSLLQIVAKTPPSH"
FT   gene            4026..4568
FT                   /locus_tag="SPOA0004"
FT   CDS_pept        4026..4568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0004"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97145"
FT                   /db_xref="GOA:Q5LLK5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLK5"
FT                   /protein_id="AAV97145.1"
FT                   /translation="MAAALATVLALTGLTTAPATAQSTRTVIGERYVPTIWVDPDGCEH
FT                   WVMDDGAEGFMTPHVRRDGTPVCRRGALCGTMPADQFFATDSYRISSEGQARLRQFFQE
FT                   TGANGYIITGHTDSRASDAYNLRLSVNRANSVARVGRATGARIVDVRGYGERDPRVPNT
FT                   SAANMAQNRRVEIICVN"
FT   gene            4579..4872
FT                   /locus_tag="SPOA0005"
FT   CDS_pept        4579..4872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0005"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97146"
FT                   /db_xref="GOA:Q5LLK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLK4"
FT                   /protein_id="AAV97146.1"
FT                   /translation="MKLIKGIALLAALGGLAACEATDKTRDRGIDAKDLSQLKAGIWVD
FT                   PTGCQHWIIDDGLEGYLSQRMDRNGKPVCDDSLPKGVATGPFKKGSNIVDAI"
FT   gene            5010..6020
FT                   /locus_tag="SPOA0006"
FT   CDS_pept        5010..6020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0006"
FT                   /product="PhoH family protein"
FT                   /note="identified by match to protein family HMM PF02562"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97147"
FT                   /db_xref="GOA:Q5LLK3"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLK3"
FT                   /protein_id="AAV97147.1"
FT                   /translation="MAISALTPPQDSSTPAELQLEFPDNRLLIDLCGEHDRHLVLIEQV
FT                   LGVQIVRRGNLLSVLGEDGARDRAAEVLEALYERLQSGRPVEGADVDRELRMGRGEEAK
FT                   DTPAEDQLEMFLGGRIEIKTRKKPVEPRTDAQKAYVKSLFENELAFGIGPAGTGKTYLA
FT                   VAVGVSMFINGLVDRIVLSRPAVEAGEKLGYLPGDMKDKVDPYMQPLYDALNDFLPGKQ
FT                   VAKLIEEKKIEIAPLAFMRGRTLANAFVVLDEAQNATTMQMKMFLTRLGEGSRMVITGD
FT                   RSQVDLPRGVTSGLSDAERLLKPVPGISFNYFTSKDVVRHPLVAAIIEAYEADTG"
FT   gene            6034..6411
FT                   /locus_tag="SPOA0007"
FT   CDS_pept        6034..6411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0007"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97148"
FT                   /db_xref="GOA:Q5LLK2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLK2"
FT                   /protein_id="AAV97148.1"
FT                   /translation="MIRIAGFVAAVLTLVWALVHAFVGGAETATPLLHSALPEVARGTG
FT                   WLVWQFMTGLLLVMSAMLAWGTRARNAALLWAASAQAAMLALLGIVLVPAIGMSYGLLP
FT                   QGWLFLPVALLGVVAARGAAR"
FT   gene            6408..6905
FT                   /locus_tag="SPOA0008"
FT   CDS_pept        6408..6905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0008"
FT                   /product="putative protein TIGR00043"
FT                   /note="identified by similarity to SP:Q8YEA4; match to
FT                   protein family HMM PF02130; match to protein family HMM
FT                   TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97149"
FT                   /db_xref="GOA:Q5LLL4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLL4"
FT                   /protein_id="AAV97149.1"
FT                   /translation="MTLDLTLEDPRWTILPPLADRAISATLAQMGLDPELCEISLLGCD
FT                   DARITALNAEFREKPSPTNVLSWPAEDLAAETPGGTPLAPEPDFTGAVPLGDIAIAFDT
FT                   CQREADAAGKPIADHVTHLIVHGLLHLLGYDHIRDEDATLMEGLETRILGNLGIDDPYT
FT                   ME"
FT   gene            6939..7826
FT                   /locus_tag="SPOA0009"
FT   CDS_pept        6939..7826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0009"
FT                   /product="hemolysin, putative"
FT                   /note="identified by similarity to GB:AAC62436.1; match to
FT                   protein family HMM PF00571; match to protein family HMM
FT                   PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97150"
FT                   /db_xref="GOA:Q5LLL1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLL1"
FT                   /protein_id="AAV97150.1"
FT                   /translation="MGDIEGSSSAAQSAQPEETGETNADKTGFFTRIMDAFSSGESQQE
FT                   PTLGGASAAPVPVPGILNLRRMRVEDVAIPTAEIVSVPLTVSKEELVHVFRDSGMTRIP
FT                   VYENTLDTPLGFVHLKDFALTHGFNGNSTQFDLRSMLRPLLFVPPSMPIGVLLAKMQTE
FT                   RRHMALVIDEYGGVDGLLTIEDLIEQVVGEIEDEHDTDEAQTWVKERPGCYIAQARTPL
FT                   DEFETEIGRSLTNHEDVDEEEIDTLGGLVFMLSGRVPARGEVVPHPDGVEFEVIDADPR
FT                   RIKRLRVMIPDAAE"
FT   gene            7823..9340
FT                   /gene="cutE"
FT                   /locus_tag="SPOA0010"
FT   CDS_pept        7823..9340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /locus_tag="SPOA0010"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00795;
FT                   match to protein family HMM TIGR00546"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97151"
FT                   /db_xref="GOA:Q5LLL3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLL3"
FT                   /protein_id="AAV97151.1"
FT                   /translation="MSLLAGWYLWQRMMLALGLGAVAALGLAPMSLWLATIGALLALPA
FT                   LFLASPGWRQAAWTGWAFATGYFGHALAWIVEPFLVDVARHGWMAPFALVLMAGGLALF
FT                   WAAAFALAAAPARGPERRVMLLVLTLSLAEMARGYVFTGFPWAGLAQIWVETDAALLLA
FT                   WTGPHGLALATLAAVLPPGVALARGLGGRALLLRCVPALALGLAILAVDGARVPLEGSG
FT                   KVVRLVQPNAPQHQKWDPDWYPLFLERQIRFTAAGTAPDLVVWPESALPYWLDDAGPVL
FT                   ERIAAAARGTPVLLGANRAEGPRIYNALALIGAGGRIEATYDKHHLVPFGEYVPLGDLL
FT                   EQFGISGFATRSGRGFSAGPGPVTLAIPGIGAALPLICYEAVFPRDARGTAERPRLLVQ
FT                   ATNDAWFGTWAGPYQHLAQARMRAIEQGLPMVRVANTGVSAMIDPQGRITAALALGREG
FT                   YLDVDLPPALAPTVYGRTGDLPLLVTLLVLLAAAARIQGRNLLPNSD"
FT   gene            9429..10610
FT                   /gene="metK"
FT                   /locus_tag="SPOA0011"
FT   CDS_pept        9429..10610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="SPOA0011"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by similarity to SP:P04384; match to
FT                   protein family HMM PF00438; match to protein family HMM
FT                   PF02772; match to protein family HMM PF02773; match to
FT                   protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97152"
FT                   /db_xref="GOA:Q5LLL2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLL2"
FT                   /protein_id="AAV97152.1"
FT                   /translation="MSRQNYIFTSESVSEGHPDKVCDRISDAVLDAFLTEEPEARVACE
FT                   TFATTNRVVIGGEVGLSDQAKLREYMGRIDQIARDCIKDIGYEQDKFHHETVEITNLLH
FT                   EQSAHIAQGVNAAEGKDEGAGDQGIMFGYATTETPALMPAPIQYSHAILRRLAEVRKNG
FT                   TEPALGPDAKSQLSVIYRDGMPVGVSSLVLSTQHLDPDLTSADIRAIVEPYIREVLPEG
FT                   WLSADTVWHVNPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRS
FT                   AAYAARYLAKNVVAAGLADKCTIQLSYAIGVSKPLSIYADTHGTGDIAPAAIEKAIDTV
FT                   MDLTPRGIRTHLGLNKPIYERTAAYGHFGREPEADGGFSWERTDLAEALKKAV"
FT   gene            10680..11192
FT                   /locus_tag="SPOA0012"
FT   CDS_pept        10680..11192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0012"
FT                   /product="DNA topology modulation kinase FlaR, putative"
FT                   /note="identified by similarity to PIR:S70846"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97153"
FT                   /db_xref="GOA:Q5LLL0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLL0"
FT                   /protein_id="AAV97153.1"
FT                   /translation="MQRIMVIGGPGSGKSTLGRKLGARLGLPVVHMDPIYWLGDWVERD
FT                   KAEAMRMAKEVADGSQWVFEGNHFASMAYRAERADLIVFLDMPRVLRMWRILWRSLRYY
FT                   GRTRPDMGPNCPERFNRAFLKFCWTYDREGRLRALGFVDDWRDRRRVRILTSRRQVAAF
FT                   LVEIDRQ"
FT   gene            11344..12009
FT                   /locus_tag="SPOA0013"
FT   CDS_pept        11344..12009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:S61210"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97154"
FT                   /db_xref="GOA:Q5LLK9"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLK9"
FT                   /protein_id="AAV97154.1"
FT                   /translation="MRQFARYTLIAALTLGSALMAHAEEDDLVFRVDGETLVYDTTRGD
FT                   EAGGTDDIEVAHVDRLLALLRQNPEIRVLDLNSTGGSLYAGREMARIVLDFDLDTLVSG
FT                   ECFSSCVRIFLAGAGRRMLLGAKIGFHQTTWSPGSVEEYYNANRDSDGWGTPFDFASWV
FT                   YEDTQTEVHDDLIYMIDRGVDAEFAVRTKGVRADDSWYPSRLELTRAGVLRERLRDAE"
FT   gene            12070..12783
FT                   /gene="trmB"
FT                   /locus_tag="SPOA0014"
FT   CDS_pept        12070..12783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="SPOA0014"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97155"
FT                   /db_xref="GOA:Q5LLK8"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLK8"
FT                   /protein_id="AAV97155.1"
FT                   /translation="MSKTTPDRPRRNFYGRIKGKTLKPNQRTYLDEDLTPLAPGPVSWQ
FT                   DNPTRQPLDLNALFGGRETWLEIGFGGGEHLVHQAASNPGIGIIGAEPYINGVAMLLGK
FT                   IRAAGGDNVRVHPGDVRDLFDVLPAQSISRAFLLYPDPWPKKRHHRRRFVTPEHLEPLA
FT                   RVLKPGAIFRVATDIPDYVRQTLEEVPRAGFEWLAERPADWRQPWGDWISTRYEQKALR
FT                   EGRVPHYLTFRRLEG"
FT   gene            12930..14276
FT                   /gene="aroA"
FT                   /locus_tag="SPOA0015"
FT   CDS_pept        12930..14276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="SPOA0015"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01356"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97156"
FT                   /db_xref="GOA:Q5LLK7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLK7"
FT                   /protein_id="AAV97156.1"
FT                   /translation="MSGHGTPIPMTSHPCGPLSGVAEVPGDKSISHRALILGAMAVGET
FT                   RITGLLEGEDVLDTAKAMRAFGAEVTRHADGSWSVHGVGVGGFAEPEQVIDCGNSGTGV
FT                   RLIMGAMATSPISATFTGDASLNKRPMARVTDPLALFGAQAVGREGGRLPMTIVGAADP
FT                   VPVRYEVPVPSAQVKSAVLLAGLNAPGQTVVIEKEATRDHSERMLAGFGAEVTVEDTDE
FT                   GRVITLTGRPELKPQVIAVPRDPSSAAFPVCAALITPGSDVLVPGIGLNPTRAGLFTTL
FT                   REMGADLTYENERTEGGEPVADLRARYSPDMKGITVPPERAASMIDEYPVLSVVAANAQ
FT                   GVTMMGGVKELRVKESDRIDAMARGLRANGVTVEEGDDWWAVHGLGIGKVPGGGTCESF
FT                   LDHRIAMSFMVMGMGAQAPVSVNDGSPIATSFPIFEPLMGGLGAKLERA"
FT   gene            14273..14890
FT                   /gene="cmk"
FT                   /locus_tag="SPOA0017"
FT   CDS_pept        14273..14890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="SPOA0017"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="identified by similarity to SP:P43892; match to
FT                   protein family HMM PF02224; match to protein family HMM
FT                   TIGR00017"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97157"
FT                   /db_xref="GOA:Q5LLM6"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLM6"
FT                   /protein_id="AAV97157.1"
FT                   /translation="MTFTVAIDGPAAAGKGTISKAVAAHFGFAHLDTGLLYRAVGRRTL
FT                   EGEAAETAARDLRTEDLERDDLRTAQVAQAASKVAVIAEVRAALVDFQRAFARRAGGAV
FT                   LDGRDIGTVICPEAEVKLFVTASAEVRAERRYLELTAKGQDTTRAAVLADVRERDARDA
FT                   DRATAPMKPAEDAVLLDTSTMDIPTALAAAIAEIERKMPAKG"
FT   gene            complement(14942..15421)
FT                   /locus_tag="SPOA0018"
FT   CDS_pept        complement(14942..15421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0018"
FT                   /product="YHS domain protein"
FT                   /note="identified by similarity to PIR:E82434; match to
FT                   protein family HMM PF04945"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97158"
FT                   /db_xref="GOA:Q5LLM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLM5"
FT                   /protein_id="AAV97158.1"
FT                   /translation="MKTFALTALIAALPMLAAPAFAADEVNVSNGISAGGAPLAAHGVD
FT                   LVTLVRDGNPVEGFANYSATIDGASYYFTSEENLKEFQAEPARYLPQHGGFCSYGVAVG
FT                   KKFDGDPDKYVLADGKLFLFLNAATRDKFLEDVAGTTATADGNWAKIKHVAVGDL"
FT   gene            complement(15573..16718)
FT                   /locus_tag="SPOA0019"
FT   CDS_pept        complement(15573..16718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0019"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97159"
FT                   /db_xref="GOA:Q5LLM4"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLM4"
FT                   /protein_id="AAV97159.1"
FT                   /translation="MLFALILLTLPALIIWLAARIPALDRIGVVPLTFATGFALALSLD
FT                   LSAFTQIQTTLQEVSVALALPLILFAANLRRALTEARGAGLAMALSLVSVCVASLLGVL
FT                   LFQGRVENLPQVAGMAVGAYTGSGVNMGAIKSATGASDALFLTMVTYDIVFSIGYMLVI
FT                   VLVGQRLAGLILPPFVPHSQGDHEANTSHIADDSARGYARLIQRSGLAGSALAFGAAGL
FT                   CVGVAVALSGLLPETWSGTATILLITTFGLLGAFVPRLHASTTSFHLGMYLILIFCLSS
FT                   ATLLDLSVLSGMNWALGGYFAFILLGAMALHALLCRLFGIDRDTYLVASGAAIMSVPFI
FT                   PVICGALRNRALLVPGIAIAILGYAVGNYLGVVVASLAAGM"
FT   gene            complement(16728..17900)
FT                   /locus_tag="SPOA0020"
FT   CDS_pept        complement(16728..17900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0020"
FT                   /product="alanine racemase domain protein"
FT                   /note="identified by similarity to GB:BAA31547.1; match to
FT                   protein family HMM PF01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97160"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLM3"
FT                   /protein_id="AAV97160.1"
FT                   /translation="MSEAYFQKLQAALIAAGRQLPTLVVDTERLAANMAAVRRMTAPSL
FT                   ALRVVEKSLPAPDLLRVVIAGLETNRLMSFHLPFVQQAAAAFPEADILLGKPMPVGAVA
FT                   GTSPTLDAQVHWLIDSPERLAEYAALAAQSDRALRICLEVDIGLHRGGFSLARAGEFAA
FT                   ALTRLRDDPNLHLTGLMGYEPHIARLPRLIASRARALDAARAAYARFHALTVQTLGAGT
FT                   AAKLIYNTGGSTTFMLYDGSGPETELALASALVKPTDFDLPALEALQPAAFIAAPVLKT
FT                   VERPEIPMAPGLSRVLRLMGRSPERACFIYGGNWLADPCHPAGARRSALFGHSSNQEMY
FT                   DLPANSTLKPGDFLFFRPRQSEALFLQFGDIAVFDGTAITDWWPVWHETH"
FT   gene            complement(17893..19326)
FT                   /locus_tag="SPOA0021"
FT   CDS_pept        complement(17893..19326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0021"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM TIGR01409; match to protein
FT                   family HMM TIGR01679"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97162"
FT                   /db_xref="GOA:Q5LLJ7"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ7"
FT                   /protein_id="AAV97162.1"
FT                   /translation="MTLTRRKLLGYGALAGLAVPAAMQAHWLSRDFTRPDYSPDIPPAP
FT                   PGRQVWRNWSGYQVATPQQIYAAASEEELATRIAAWPGRIRPVGSGHSFSALVPSQDMI
FT                   LDTGRLSGLISVDAAAGMATFGAGTRLRQAAMLAADHGLGFANLPDIDVQTLAGSFSTA
FT                   THGTGRGLQAMHGCITGFRLITADGTARDVTRDSNPDLFDAGRVSLGTLGVITRYTLKL
FT                   EPSYALNRRLFILPTDEAITRMHDLAAAHRNFEFYVLPNLGYAAVITHDLYEGEIAGRV
FT                   PSEDEDWIATLKDLRDILGWWPWLRRRAFGAYVALEVPADGVLEDTTDEYWKLLSTARA
FT                   TRMNEMEYHLPEDRAQEAVRAVVAALESRKESFFPMEVRFTGQDDAWLSPFNDGTRVSV
FT                   AVHKLASEPLDMLFGTVEPIMRAYGGRPHWGKLHSLNAPDLVALYPDFDRFAALRARLD
FT                   PAGKFLNPHTAALFGAGDV"
FT   gene            complement(19323..19700)
FT                   /locus_tag="SPOA0022"
FT   CDS_pept        complement(19323..19700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0022"
FT                   /product="cytochrome c5"
FT                   /note="identified by similarity to SP:P11732; match to
FT                   protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97161"
FT                   /db_xref="GOA:Q5LLJ6"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ6"
FT                   /protein_id="AAV97161.1"
FT                   /translation="MRALILLISALVLAALWWWLSGADAPAEPEATDIARAETQRPTDP
FT                   ELAAIYERSCMACHALVEAQAPLTGFVPAWAAREKERGAHGLLLSARNGFGNMPAMGLC
FT                   LDCSDEQLAALIAFMSGEGQQ"
FT   gene            complement(19700..20356)
FT                   /locus_tag="SPOA0023"
FT   CDS_pept        complement(19700..20356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0023"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97163"
FT                   /db_xref="GOA:Q5LLJ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ5"
FT                   /protein_id="AAV97163.1"
FT                   /translation="MVPTETDTPMHTRATPKQARARQRVADILDAASALLAERPPGDLN
FT                   TSLIAERAGVPVSSIYRYFPTLRDLLDELSARAAGDLRQHFIETIAATEGEPDLVLRIR
FT                   RTLEGIRVFMAEHPYYRGLLLLLASLRGVQSVEDDDNAELVGFLADRWARGLDGFTGGD
FT                   PQVVATTAVQIALTLEDRMARQTSPALEAQYHEEMVRALDAYLSLYLRRDTEEES"
FT   gene            complement(20444..21244)
FT                   /locus_tag="SPOA0024"
FT   CDS_pept        complement(20444..21244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0024"
FT                   /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase,
FT                   putative"
FT                   /note="identified by similarity to SP:P42270; match to
FT                   protein family HMM PF01689"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97164"
FT                   /db_xref="GOA:Q5LLJ4"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ4"
FT                   /protein_id="AAV97164.1"
FT                   /translation="MTPEQHADAAARLIKAEETGRQIGLLSLAYPGMDMDDAYAIQQAL
FT                   AAHKQTAGRHVIGWKIGLTSKAMQYALNIDIPDSGILFDDMAFDDGATVPKGRFIQPRV
FT                   EAEIAFVMKEPLGGAYVTRADVLAATDYVAPSLEILDTRILRVDPETGHARNVCDTISD
FT                   NAANAGVVLGKQRHAPDAFDLRWVGALTFRNGEIEETGLGAGVLNDPVESVVWLARRMA
FT                   QYGQVIEPGHIVLSGSFIRPVECPPGTRIEADFGPFGAVSVHFA"
FT   gene            complement(21241..22092)
FT                   /locus_tag="SPOA0025"
FT   CDS_pept        complement(21241..22092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0025"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97165"
FT                   /db_xref="GOA:Q5LLJ3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ3"
FT                   /protein_id="AAV97165.1"
FT                   /translation="MKFATIAAERQELYGIIRDEGFVALSPDFPRWPDLRAVIAAGGLH
FT                   DLAKAAMGRAVTHSDFTYLPPVPNPGKIICVGVNFPDRNAEYKDGSAAPKYMSLFPRFA
FT                   SSFVGHGQPLIRPPENHTLDYEGEMAVVIGKGGRRIRAEDAYDHIAGLSVCNEGTIRDW
FT                   VRHAKFNVTQGKNWDRSGAIGPWMVPFTHPAQIDAARITTRVNGELRQDDALANMIFSV
FT                   REEIAYISTFTTLNPGDIIVTGTPTGAGARFDPPRYLKPGDVVEVEVTGVGTLVNGVED
FT                   EV"
FT   gene            complement(22119..22970)
FT                   /gene="hpcB"
FT                   /locus_tag="SPOA0026"
FT   CDS_pept        complement(22119..22970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpcB"
FT                   /locus_tag="SPOA0026"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /EC_number="1.13.11.15"
FT                   /note="identified by similarity to SP:Q05353; similarity to
FT                   GB:CAB65144.1; match to protein family HMM PF02900"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97166"
FT                   /db_xref="GOA:Q5LLI8"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLI8"
FT                   /protein_id="AAV97166.1"
FT                   /translation="MGEIVLAAKCTHVPTMLMSEQEGPVKGKRQAAIDGHLEIARRARA
FT                   LGADTVVICDTHWVINAGFHINANSRFQGLFTSNEFPQFIQNMPYDYEGNPGLGDAIAK
FT                   EASARGAYTLAHHLDSLELEYGTLVPMRFMSREHKMKVVSVAAWCTVHDHDESRIVGEA
FT                   IRAAVEASNSKVLLVASGSLSHKIWPNKDYAANNGTFTISSEFNRQMDLHVLEMWKRGD
FT                   HATFLKMLGDYARFCCGEGSMHDTAMLYGALGWDSYDKPCEVVTEYFPSSGTGQTNVIF
FT                   PV"
FT   gene            complement(23017..24525)
FT                   /gene="hpcC"
FT                   /locus_tag="SPOA0027"
FT   CDS_pept        complement(23017..24525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpcC"
FT                   /locus_tag="SPOA0027"
FT                   /product="5-carboxy-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.60"
FT                   /note="identified by similarity to SP:P42269; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97167"
FT                   /db_xref="GOA:Q5LLJ2"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ2"
FT                   /protein_id="AAV97167.1"
FT                   /translation="MPDLSTRLADLDRHLQRFRRDGVMNRIGGQDVPGGAGRFDSISPV
FT                   DRSVICSVARGDAADMDAAARAAHAAFPAWRDMPATERRAILIRIAEGIEARAEEIALC
FT                   ECWDTGQAWRFMSKAALRGAENFRYFADQVVQARDGQHLKSPTLMNITTRVPIGPVGVI
FT                   TPWNTPFMLSTWKIAPALAAGCTVVHKPAELSPLSARLLIEIAEEAGLPPGVLNLVNGF
FT                   GEDAGKALTEHPLIKAVAFVGESRTGSLIVKQGADTLKRVHLELGGKNPVIVFDDADTE
FT                   RALDAVIFMIYSINGERCTSSSRLLVQDTIREEFEARLVERVNNIKVGHPLDPTTEIGP
FT                   LIGEEHFAKVTSYFDIARQDGATVAAGGEVVGDQGYFVRPTLFTGANNRMRIAREEIFG
FT                   PVLTAIPFSTEEEALQIANDTPYGLTGYLWTNDLTRALRFTDKLEAGMIWVNSENVRHL
FT                   PTPFGGVKASGIGRDGGDWSFEFYMEQKHIGFATGQHKIQRLGA"
FT   gene            24898..26241
FT                   /gene="nqrA"
FT                   /locus_tag="SPOA0028"
FT   CDS_pept        24898..26241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrA"
FT                   /locus_tag="SPOA0028"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, A subunit"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by match to protein family HMM PF05896;
FT                   match to protein family HMM TIGR01936"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97168"
FT                   /db_xref="GOA:Q5LLJ1"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ1"
FT                   /protein_id="AAV97168.1"
FT                   /translation="MQNFRLKKGLDLPVKGAPVQTIHPGPAIGSVAVLGADYLGLKPRM
FT                   LVQEGDEVRRGTPLLCHKDAPEAMMVAPVTGRVAAINRGARRVLQSVVIEVTDAADPGL
FT                   DFATTGNGKTREGLTEKLCAAGLWTAFRTRPYSKMPVPGDTPNAIFVTAMDSEPLAADA
FT                   ATIIADAGSAFASGLAAVALLSDGPTWLCHKPGDAIPGGDVAGVSVATFDGPHPAGLAG
FT                   THIHFLAPLTSDKSVWTIGYQDVIAIGRLLETGHLDPSMVIALSGPAAREPRLIRTIMG
FT                   ASTGDLTTAEISVDAPVRVISGSILSGRQAEGPFAYLGRFARQVTLIEEDRKQHTLGWI
FT                   LPMPSKFAVQPVLGSAFSRKLYALTSNLNGGRRAMVPTGTFEELMPQDYLPTQLLRALL
FT                   VMDTDTAQALGALELDEEDLGLVGFACPAKYEYGLALRDSLSKIEKEG"
FT   gene            26246..27454
FT                   /gene="nqrB"
FT                   /locus_tag="SPOA0029"
FT   CDS_pept        26246..27454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrB"
FT                   /locus_tag="SPOA0029"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, B subunit"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by match to protein family HMM PF03116;
FT                   match to protein family HMM TIGR01937"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97169"
FT                   /db_xref="GOA:Q5LLJ0"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ0"
FT                   /protein_id="AAV97169.1"
FT                   /translation="MGLRNFFDRIEPNFTKGGKYEKLFPIYEMVESFIYTPKTVTTAAP
FT                   HARSYVDMKRIMTYVVIATIPAILWGMWNTGYQANSAIAMLGADAATGWRIAILQALGI
FT                   SLDAANPLANVAHGFLYFLPIYLTTLIVGGIWEVVFATVRGHEVNEGFLVTSMLYTLIM
FT                   PASAPLWQVALGISFGVVIGKEVFGGTGKNFLNPALVGRAFLYFAYPANMSGDSVWTPV
FT                   DGFSGATALAVSAADGYQQLATNGITWMDAFYGTIQGSFGETSTLACLIGLAFLLMTKI
FT                   ANWRLIVGSMAGMIGFSLLLNVIGSDSNPMFAMPWYWHLVLGGYAFGLAFMVTEPVSAS
FT                   HTNTGRYIYGALIGVMVVLIRVINPAFPEGMMLAILFGNVFAPLIDYFVVQANIKRRAR
FT                   RHV"
FT   gene            27447..28250
FT                   /gene="nqrC"
FT                   /locus_tag="SPOA0030"
FT   CDS_pept        27447..28250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrC"
FT                   /locus_tag="SPOA0030"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, C subunit"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by similarity to PIR:S65528; match to
FT                   protein family HMM PF04205; match to protein family HMM
FT                   TIGR01938"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97170"
FT                   /db_xref="GOA:Q5LLI9"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLI9"
FT                   /protein_id="AAV97170.1"
FT                   /translation="MSETQSKGLIARFLAAPPDSVGKTIFVAVAVCLVASMIVSSAAVA
FT                   LRPVQEVNKLKDKQMNILQVAGLFEPGQNVAEAFKAFEPQVLELTTGRFTDQFDAATFD
FT                   DKAAANDADLSRALDDDPAGIGRQALYRTVYLLRDEAGGIDKVILPIHGYGLWSTLYGF
FT                   IAVEENGNDIFGLQFYQHGETPGLGAEVDNPRWKAMWNGKKLRDDAGDLQITVAKSQPA
FT                   AGADFYVDALAGATLTSVGVDNLVRFWMGEQGYAPFLEALKAGEI"
FT   gene            28250..28903
FT                   /gene="nqrD"
FT                   /locus_tag="SPOA0031"
FT   CDS_pept        28250..28903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrD"
FT                   /locus_tag="SPOA0031"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, D subunit"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by similarity to SP:P77179; similarity to
FT                   PIR:S65529; match to protein family HMM PF02508; match to
FT                   protein family HMM TIGR01939"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97171"
FT                   /db_xref="GOA:Q5LLL9"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLL9"
FT                   /protein_id="AAV97171.1"
FT                   /translation="MSQTKKELLIDPLVDNNPITLQVLGICSALAVTSSLQVAFVMALA
FT                   VTFVTAFSSFFISILRNQIPSSIRIIVQMVIIASLVILVDQILKAYAFEISKTLSVFVG
FT                   LIITNCIVMGRAEAFAMKNPPVASFIDGFGNGLGYGLILMLVGVIRELFGSGSLFGVTI
FT                   LQTVNNGGWYVPNGLLLLPPSAFFVIGLLIWAFRTWKPKQIEEREFKIQSVEAH"
FT   gene            28903..29511
FT                   /gene="nqrE"
FT                   /locus_tag="SPOA0032"
FT   CDS_pept        28903..29511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrE"
FT                   /locus_tag="SPOA0032"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, E subunit"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by similarity to SP:Q8DBJ2; match to
FT                   protein family HMM PF02508; match to protein family HMM
FT                   TIGR01940"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97172"
FT                   /db_xref="GOA:Q5LLL8"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLL8"
FT                   /protein_id="AAV97172.1"
FT                   /translation="MEGLISLAVKAVFVENLALSFFLGMCTFIAVSKKISTALGLGISV
FT                   MVVQAITVPANNLLLNTLLKPGALAWAGFPDVDLTFLGLISYIGVIAAMVQILEMILDK
FT                   YFPPLYNALGIFLPLITVNCAILGGSLFMVERDYNFAEATTYGLSSGFGWALAITAMAG
FT                   VREKLKYSDVPDGLQGLGITFITAGLMAMAFMSFSGVKL"
FT   gene            29524..30744
FT                   /gene="nqrF"
FT                   /locus_tag="SPOA0033"
FT   CDS_pept        29524..30744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrF"
FT                   /locus_tag="SPOA0033"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, F subunit"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by similarity to SP:Q56584; match to
FT                   protein family HMM PF00111; match to protein family HMM
FT                   PF00175; match to protein family HMM PF00970; match to
FT                   protein family HMM TIGR01941"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97173"
FT                   /db_xref="GOA:Q5LLL7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLL7"
FT                   /protein_id="AAV97173.1"
FT                   /translation="METFSLGVVLFTLIVIALVGVILMARSRLVSTGNVNITINGEKTI
FT                   SVPAGGKLLQTLAAEKLFVPSACGGGGTCAQCRVKIHSGGGSILPTEESHITKREAACG
FT                   DRLSCQVAVKQDMDIEVPEEVFGVKKWRCKVRSNDNVATFIKALVLELPEGENVNFRAG
FT                   GYIQIEAPAHQLAYTDFDVQDEYREDWDRFNLWQYKSVVNEPVERAYSMANYPEEKGII
FT                   MLNVRVASPPPGSSDIPAGKMSSYIFNLKPGDEVTISGPFGEFFARDTDKEMVFIGGGA
FT                   GMAPMRSHIFDQLKRLKSKRKISFWYGARSKKEMFFVEDFDMLAAENPNFEWHVALSDA
FT                   QPEDDWKGYTGFIHNVLFEEYLKNHPAPEDCEFYMCGPPIMNQSVINMLLELGVDREDI
FT                   MLDDFGG"
FT   gene            complement(30859..31383)
FT                   /locus_tag="SPOA0034"
FT   CDS_pept        complement(30859..31383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0034"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97174"
FT                   /db_xref="GOA:Q5LLL6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLL6"
FT                   /protein_id="AAV97174.1"
FT                   /translation="MAPSSYQAPTRGDKAEKTTYSQSASSNLAQSQSTVADLLGGKGEA
FT                   VFSVRPGDTIGQVVGVLKDKRIGAVLVTDQNGALLGILSERDIVRRMADTPGQTLPQQA
FT                   EGLMTRAVQTCAPDETLNVVLKRMTEGRFRHLPVMRDGKLCGMITIGDVVNFRLRELEY
FT                   EALKMKQMIVG"
FT   gene            31290..31679
FT                   /locus_tag="SPOA0035"
FT   CDS_pept        31290..31679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0035"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97175"
FT                   /db_xref="GOA:Q5LLL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLL5"
FT                   /protein_id="AAV97175.1"
FT                   /translation="MTGPGSNWPTGYRSSSRPCRHVSGPDMRMGPWAGSPACLLRLTPI
FT                   LPGHPDPQRANRPQPGQNRSPPMFDTLYLTPASAALIFFMVVVCGHGYRKSWKAEPPAP
FT                   RWHLWAYGLPAAIGLLTLAFLPLKG"
FT   gene            31686..32771
FT                   /gene="apbE"
FT                   /locus_tag="SPOA0036"
FT   CDS_pept        31686..32771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbE"
FT                   /locus_tag="SPOA0036"
FT                   /product="thiamin biosynthesis lipoprotein ApbE"
FT                   /note="identified by similarity to SP:P41780; match to
FT                   protein family HMM PF02424"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97176"
FT                   /db_xref="GOA:Q5LLK1"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLK1"
FT                   /protein_id="AAV97176.1"
FT                   /translation="MTPPRRWPMPQQRNIRGWPMVRWLALPVALMLSGCLFEAEPEVVK
FT                   LSGDTMGTTYHITAIGADLDAEALGAAVEVTLAAVNAKMSNWDPKSEVSTFSARTDTAP
FT                   MPVSPEFVTVIGAANQVHAQSGGKFDITLGPLIELWGFGPRKPEDPIPSDAEIASALQG
FT                   VGQARLLTLDTAGGTLAKARPETGINLSAIAKGYGVDAVAETLRGFEIDDYMVEIGGDL
FT                   VTRGKNDKGEAWRIGIERPDRGAQTVQLVVPISDYGMATSGDYRNYFEHQGQRYSHILD
FT                   PVTGRPVTHRTTSVTVIADSAMMADAWATAMLVLGLDQGLKVAEAHKLAVFFIERDAQD
FT                   GAEAYMTAQSSAFADLLNAAD"
FT   gene            32792..33028
FT                   /locus_tag="SPOA0037"
FT   CDS_pept        32792..33028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0037"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC95347.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97177"
FT                   /db_xref="GOA:Q5LLK0"
FT                   /db_xref="InterPro:IPR007495"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLK0"
FT                   /protein_id="AAV97177.1"
FT                   /translation="MTTFLLAFFLLMIVMLGMSLGVMLMGKRIKGSCGGLNAISGADRC
FT                   VVCSKEIDPDSPLRDRLQCPRARKMAERLQDAD"
FT   gene            complement(33041..34216)
FT                   /locus_tag="SPOA0038"
FT   CDS_pept        complement(33041..34216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0038"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97178"
FT                   /db_xref="GOA:Q5LLJ9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ9"
FT                   /protein_id="AAV97178.1"
FT                   /translation="MAPTDQHDQLVLSIYDAALDPGKWPELLTRIARYAGGIGAMIFEV
FT                   ETPGDQPHLLASHFSDTYQIDLVEGYLNQHNDLEIADQAVFARHSRATDDIQLIPDSVL
FT                   AASEAELLARPNQKTMMQYGIRYRCGALLNKDQLFHDRFSMQFGSDASDDLPQRLARAS
FT                   RLLPHIAKALSIGRPIQAVQKRHQTVLNALDKLDVGFCVLDERMNVIAGNEEFRRQSEE
FT                   SGVFRRDPQGKLSFRSDDDLSRARTLLGDPQQHGRFGARPRKEALEADHQSDARIGDAL
FT                   CIDISPLHKAREIGEQALDGFLLMSTDTSRTYRLEMPTIAALFDLSEAECAVFELMAEG
FT                   KTNKQIAEERGRSLDTINSQVKSILSKSNCDNRTQAIRMATNISSGFLVRD"
FT   gene            34623..36542
FT                   /locus_tag="SPOA0039"
FT   CDS_pept        34623..36542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:A83386"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97179"
FT                   /db_xref="GOA:Q5LLJ8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLJ8"
FT                   /protein_id="AAV97179.1"
FT                   /translation="MISKHVIGMALACGLVALAAPEAQAQSGWSVCRDVECLDQGWNDA
FT                   QRRWWYTTTQGSRLLPLSWMRALEQPGDGDGAIRAFLDRAYMDELGYIANPDPVHNPEG
FT                   LPLGWVVDQDKTLSADLMCDTFPETCDALTMREPWVGLTCSACHTNEITHQGRRLRVEG
FT                   APTLADFQRMEEDLLQALKDTVADRDRFDRFARGVLGADQSIDGRESLELQLNEQIVWQ
FT                   QALADKNAAPKVRYGHARLDAQGHILNKVALTIRHPNQITNVLADAPASYPHIWNTSQQ
FT                   DQLQWNGIAPRMARIRLLGENTELGALVRNTSEVIGVFAHLETDKSKVLRGYPSSARVR
FT                   ELVSLERQLESLQSPRWPEDMLGAIDWDLAAQGREVFTRKIDGESCADCHSHMAPGDTS
FT                   SKMEISMTPLTELGTDVFTTCNTFLHRSKSGNFGGQLVDTKFTRIDRDEDYTRLMLVNA
FT                   TVGTIRGKLFEVLAAILGKDDRPSGIRTESSLVTEYLPGVSDAKKKADAEECLTQEHPL
FT                   LAYKARSLNGIWATAPYLHNGSVPTLYDLLLPARMRNVATALDAELPEDAATRPEVFGV
FT                   GSREFDPVKVGFVSELDQNPFTFRARGEDGEPIPGNFNAGHDYGTAGLSEEDRRALVEY
FT                   LKTL"
FT   gene            complement(36767..37060)
FT                   /locus_tag="SPOA0040"
FT   CDS_pept        complement(36767..37060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0040"
FT                   /product="crcB family protein"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97180"
FT                   /db_xref="GOA:Q5LLI7"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLI7"
FT                   /protein_id="AAV97180.1"
FT                   /translation="MSSRITHDLPLATLVVNVLGTLLLGFWLGQPETGGPDIEHGRRLI
FT                   LGFCGGFTTFSSFAYQTLDLHRTRSIATAAGNILASVTLCALAFLMGTYLSG"
FT   gene            complement(37126..37506)
FT                   /locus_tag="SPOA0041"
FT   CDS_pept        complement(37126..37506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0041"
FT                   /product="crcB family protein"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97181"
FT                   /db_xref="GOA:Q5LLI6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLI6"
FT                   /protein_id="AAV97181.1"
FT                   /translation="MRQKAGSYLAVFAGGAIGSVLRELLGFQLPGLSFLTATFGINIAA
FT                   CFLLGWLYAIRHRLHPHLLHLGAVGFCGGLSTFSSFVLELDQLTRMDGWSIGLTAMTLE
FT                   IAAGLAAAILGEALGRGREARR"
FT   gene            complement(37538..38389)
FT                   /locus_tag="SPOA0042"
FT   CDS_pept        complement(37538..38389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAR21632.1; match to
FT                   protein family HMM PF05853"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97182"
FT                   /db_xref="GOA:Q5LLI5"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLI5"
FT                   /protein_id="AAV97182.1"
FT                   /translation="MDTPANKPCIICVAITGSVPTKADNPAVPITVSEQVESTQEAFEA
FT                   GAAIAHCHVRNDDGTPSSDPDRFARLTEGLHTHCPGMIVQFSTGGRSGAGQARGGMLPL
FT                   KPDMASLSVGSNNFPSRVYENPPDLVDWLAAQMRSYRVTPEIEAFDLSHILRAIDMHGR
FT                   GLLYGKLYVQFVMGVKNAMPADREVFDFYVRMMRTRAPQAEWCAAGIGANQLTVNEWAI
FT                   AAGGHTRTGLEDNIRLDRQTLAPSNAALVRRSVELCDKYQRPVASWQQAREILGLPAAA
FT                   RN"
FT   gene            complement(38404..39024)
FT                   /gene="pcaG"
FT                   /locus_tag="SPOA0043"
FT   CDS_pept        complement(38404..39024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="SPOA0043"
FT                   /product="protocatechuate 3,4-dioxygenase alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="identified by similarity to GB:AAR21645.1; match to
FT                   protein family HMM PF00775"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97183"
FT                   /db_xref="GOA:Q5LLI4"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLI4"
FT                   /protein_id="AAV97183.1"
FT                   /translation="MVQKLDYLKETPSQTAGPYVHIGLAPGAAGFDIYERELGWDIAGP
FT                   NAAGARIRVEGRVIDGTGSPVKDVLIEVWQANAAGIHAHPEDPGQVEEGFRGWGRVITD
FT                   FETGDWGFDTVKPGPVPGRNGAMQAPHLTLWIVARGINIGLNTRLYFSDEAEANAADPV
FT                   LNLIEWENRRATLIANRDERDGKPLYRFDIHLQGPQETVFFDI"
FT   gene            complement(39088..39816)
FT                   /gene="pcaH"
FT                   /locus_tag="SPOA0044"
FT   CDS_pept        complement(39088..39816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="SPOA0044"
FT                   /product="protocatechuate 3,4-dioxygenase beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="identified by similarity to GB:AAR21644.1; match to
FT                   protein family HMM PF00775"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97184"
FT                   /db_xref="GOA:F7IWM1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:F7IWM1"
FT                   /protein_id="AAV97184.1"
FT                   /translation="MPKPGEFYQRDRAWHPPAHVHDYKTSVARSPRQALISLENTVSEI
FT                   TGPVFGHGDIGAGDNDLIHNYAQAGHSALGERILLHGRIFDENSRPLPHTLVEIWQANA
FT                   GGRYRHKKDTYLAPIDPNFGGCGRTLTDENGYYYFRTVKPGAYPWRNWVNSWRPAHIHM
FT                   SIFGTAFAQRLITQLYFEGDPLIHACPIVNTIPDPAAIDRLIAPLDMNAAIPFDCLAYR
FT                   FDVVLRGRRSTLFENRLEGN"
FT   gene            complement(39861..40238)
FT                   /gene="pcaC"
FT                   /locus_tag="SPOA0045"
FT   CDS_pept        complement(39861..40238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="SPOA0045"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="identified by similarity to SP:P20370; match to
FT                   protein family HMM PF02627"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97185"
FT                   /db_xref="GOA:F7IVF1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVF1"
FT                   /protein_id="AAV97185.1"
FT                   /translation="MSERYDNGMKVRRRVLGDAYVDRAEAGKTAFEAPFQTLITEGAWG
FT                   TVWASDGISDRERSMLTLALLAALGNFDEIPMHIRATARTGASKQDVLEAFQHVAIYAG
FT                   VPRANQALKLARQTYDEMEAD"
FT   gene            complement(40261..41430)
FT                   /gene="pobA"
FT                   /locus_tag="SPOA0046"
FT   CDS_pept        complement(40261..41430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="SPOA0046"
FT                   /product="4-hydroxybenzoate hydroxylase"
FT                   /EC_number="1.14.13.2"
FT                   /note="identified by similarity to GB:AAR21642.1; match to
FT                   protein family HMM PF01360; match to protein family HMM
FT                   PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97186"
FT                   /db_xref="GOA:F7IWD7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:F7IWD7"
FT                   /protein_id="AAV97186.1"
FT                   /translation="MRTQVVIVGGGPSGLLLGQLLHRKGIDTVVLERQSRAHVLGRIRA
FT                   GVLEVGFVNLMREAGVAERMDREGFVHHGTILAHGEEQIRISFEELIGRHVVVYGQTEV
FT                   THDLYEARDRVGGKSVFNAEGVTIHDADSDAPYVTYTANGTEHRIDCDYVAGCDGFHGV
FT                   SRQTIPTGIRKEFEQVYPFGWLGLLSETPPVSDEVLYSLSDRGFALCSMRNATLSRYYI
FT                   QCALSDKVADWSDDAFWAEFRQRLPRAVAERLVTGPSIEKSIAPLRSFVCEPMRWGRLF
FT                   LCGDAAHIVPPTGAKGLNTAASDIHYLYHALVQVFESGETEGIERYSEQALARIWKTQR
FT                   FSWWMTKLLHRFPEQSEFDLRIQRAELEFLRDSRDAQTVLAQNYVGLPY"
FT   gene            41523..42440
FT                   /gene="pcaQ"
FT                   /locus_tag="SPOA0047"
FT   CDS_pept        41523..42440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaQ"
FT                   /locus_tag="SPOA0047"
FT                   /product="pca operon transcriptional activator PcaQ"
FT                   /note="identified by similarity to GB:AAR21641.1; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97187"
FT                   /db_xref="GOA:F7IU51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:F7IU51"
FT                   /protein_id="AAV97187.1"
FT                   /translation="MIDRRIKFRHIQCFVEIAREGSLKTAAAKLFLTQPAMSKTLKELE
FT                   EITGTTLMRRSRAGVELTKPGEVFLHFARMSLASLQQGLDGIETEGRRQRETLSVGALP
FT                   SVAAYLMPGAVSEFSRLAPHALLRIQDGPHGYLIERLRLGALDLVIGRMGPPETMQGLS
FT                   FTQLYQEQVVFVVRPGHPLLAAPDLARVADWPVIYPPPGAAIRPLVEQMLIANGIGEFP
FT                   NRLETVSGAFGRVHARRSDAVWIISRGVVANEIAEGRLVALPFGTELTRGPVGLMTRPD
FT                   RPESAVAQLFALALRNVIGAGAGA"
FT   gene            42513..42911
FT                   /locus_tag="SPOA0048"
FT   CDS_pept        42513..42911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97188"
FT                   /db_xref="GOA:Q5LLH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH9"
FT                   /protein_id="AAV97188.1"
FT                   /translation="MPRQPNRPEPIRCALRRVAGVLGALLLVLQLLVPHLAQADEGAWI
FT                   EICAEGGATWIQMPAEETGDPCPDCGDCLLCSTAMDVLTPAYGAAVEPVILIARQLTGT
FT                   DVSVAAARHRLWPETRGPPFQDKRGAMC"
FT   gene            42905..45076
FT                   /gene="nosR"
FT                   /locus_tag="SPOA0049"
FT   CDS_pept        42905..45076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosR"
FT                   /locus_tag="SPOA0049"
FT                   /product="nitrous-oxide reductase transcriptional activator
FT                   NosR"
FT                   /note="identified by similarity to SP:Q00790; match to
FT                   protein family HMM PF04205"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97189"
FT                   /db_xref="GOA:Q5LLH8"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR011399"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH8"
FT                   /protein_id="AAV97189.1"
FT                   /translation="MLITRVIRVLLTLLFLAPLPALASDLPRFLAALAPADLAPGADGF
FT                   GPLREDVPVAPVLKGGETVAWAFLTSDFVGTTGYSGKPIHVIAAIDADAVLTGVKLVEH
FT                   SEPIVLIGIPNSKMVALTEGYKGLDLKREAETGGEGHDLDIISGATVTIMVIDDSLVRA
FT                   GLKVARALGLGGLSPATPEGPRREIDMGQTGTSDWFTLSGDGSVRRMTLDIGQINAAFD
FT                   ATGDERAKRRRERGAPEDTFIDMHLALVSVPEIGRTLLGEAEYANLVNWLEPGEQAILV
FT                   LGRGAYSFKGSGYVRGGIFDRIQLIQGDSAVRFFDRQQRRLGTVAATDAPGFTELDLFK
FT                   IPADAEFDPAAPFRLQLLVQRAVGAVEKSFLTFDLGYRLPERFLLPAAAPAVVEDASDE
FT                   AAAKAALWQRIWKDRTVEIGVLSAMLLLLTATFFFQFQATMNARVFYWFRFAYLSATLF
FT                   FIGWYANAQLSVVNLMALAGSLRTGFSWDAFLLDPLVFIQWFAVAAALIFWGRGAYCGW
FT                   LCPFGALQELTNKLARALRLPQWTLPWGLNERLWPVKYMIFLGLFGLSFVSIPLAETYA
FT                   EVEPFKTAIILKFMRDWPFVVFALLLLLIGLFIERFYCRYLCPLGAALAIPARIRMFDW
FT                   LRRYKDCGNPCQTCANECPVQAIHPTGEINPNECITCLHCQVLYQSEAKCPVVIRQIKR
FT                   RARTGTVDPKLTLGHPPANHPNAKPQEAS"
FT   gene            45091..46998
FT                   /gene="nosZ"
FT                   /locus_tag="SPOA0050"
FT   CDS_pept        45091..46998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosZ"
FT                   /locus_tag="SPOA0050"
FT                   /product="nitrous-oxide reductase"
FT                   /EC_number="1.7.2.4"
FT                   /note="identified by similarity to SP:Q51705; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97190"
FT                   /db_xref="GOA:Q5LLH7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023644"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="InterPro:IPR041142"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH7"
FT                   /protein_id="AAV97190.1"
FT                   /translation="MSDHDNNLSVTRRGLLGATATGAVLASTGLGATLMTAREASAAAK
FT                   VNLEPGELDEYYGFWSSGQTGELRILGIPSMRELMRVPVFNRCSATGWGQTNESLKVLT
FT                   EGLLPETKQFLASNGKKTYDNGDLHHPHMSFTDGTYDGRYLFMNDKANTRVARVRCDVM
FT                   KCDKIIEIPNAHDIHGLRPQKYPRTGYVFANGEHEAPLVNDGQILDDPSQYVNIFTAID
FT                   GDSMEIAWQVIVSGNLDNTDCDYQGKYAFSTSYNSEMGMNLAEMTENELDHVVVFNLKE
FT                   IEAGIAAGDYQELNGVKVVDGRKGAGNNYTRYIPIPNSPHGVNAAPDKRHIMINGKLSP
FT                   TVSVIDVEKVDALFADNADPRSAIVAEPQLGLGPLHTAFDNKGNAYTTLFLDSQVVKWN
FT                   IAKAIEAYAGADVDPILDKVDVQYQPGHNSTSMGETAEADGKWLISMNKFSKDRFLNVG
FT                   PLKPENEQLIDISGDKMKVVHDGPTFAEPHDSIIVHRSKVNPVNVWDRNDPMWEDARQQ
FT                   AAADGVDLEEGAEEPIRDGNKVRVYMTSVAPTFSLEKFTVKQGDEVTIYVTNLDDVDDV
FT                   THGLCMANFGIAMEVAPQATASVTFIADRPGVHWFYCQWFCHALHMEMRGRMFVEPRGA
FT                   "
FT   gene            47002..48258
FT                   /gene="nosD"
FT                   /locus_tag="SPOA0051"
FT   CDS_pept        47002..48258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosD"
FT                   /locus_tag="SPOA0051"
FT                   /product="nitrous oxide maturation protein NosD"
FT                   /note="identified by similarity to SP:P19843; match to
FT                   protein family HMM PF05048"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97191"
FT                   /db_xref="GOA:Q5LLH6"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH6"
FT                   /protein_id="AAV97191.1"
FT                   /translation="MRWPLLIATLIASPLWAADWDVPNRAGAISETLAQAADGDTLRLA
FT                   PGIYAETLVLSRPVTLDGMGRATIDGQGTGSVITVTGPGVTLRGLTVIGSGSDHDGIDS
FT                   GIQLTKTARAPVVENNVLIGNLYGVDIHGAKDALVKGNRIEGRQDRRMNARGNGVYVWN
FT                   APGAVVEGNDIQYGRDGIFVNSSRRNLFRDNLFRDLRFAVHYMYADNSEVSGNVSIGND
FT                   LGYAVMFTSRVKVVDNVSIGDREHGVMLNYANDSVISGNVVKGAKEKCTFLYNANKNEF
FT                   TNNWFEGCGIGIHFTAGSERNRIVGNAFVGNRTQVKYVSTRWVEWSEDGRGNYWSDFAA
FT                   YDVNGDGIADAPYRPNDSMDHVLWTQPAAKLLLGSPAVQLLRWSQSAFPALLPGGVIDS
FT                   NALIKAPEPSALKKVPHDG"
FT   gene            48248..49141
FT                   /gene="nosF"
FT                   /locus_tag="SPOA0052"
FT   CDS_pept        48248..49141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosF"
FT                   /locus_tag="SPOA0052"
FT                   /product="ABC transporter, ATP-binding protein NosF"
FT                   /note="identified by similarity to SP:P19844; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01189"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97192"
FT                   /db_xref="GOA:Q5LLH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH5"
FT                   /protein_id="AAV97192.1"
FT                   /translation="MTDKALTIETLCKDRGPTRVLSDVSLHVAPGERVALLGHNGAGKS
FT                   TLIKSILGLTRIDGGSIRIGTAAPGSAQARRETAYLPEAVSFHPALTGREQLRLFARLS
FT                   GERADVSGLLERVGLADAMDRRIGAYSKGMRQRLGLAQVLLGKPRVALLDEPTSGLDPI
FT                   SRQDLYAIIDELAGQGAAVLIASHALTEVEARTDRIAILRKGVKVADDTLANLSALAGL
FT                   PIRLRVRARENADALAARLGGSRVNGASVELLCDPADKMTALRSIAAMGEAVVDVDMTP
FT                   PRLEDLYRHYAKETLQ"
FT   gene            49138..49959
FT                   /gene="nosY"
FT                   /locus_tag="SPOA0053"
FT   CDS_pept        49138..49959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosY"
FT                   /locus_tag="SPOA0053"
FT                   /product="nitrous oxide maturation protein NosY"
FT                   /note="identified by similarity to SP:P19845"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97193"
FT                   /db_xref="GOA:Q5LLH4"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH4"
FT                   /protein_id="AAV97193.1"
FT                   /translation="MTRFLAVAQTEMLILRRNRWLLVATLIMVLFALALTFAGSAPTGT
FT                   LGVDMLTVSVASMTTLSVYLAPLLALMISFDAVAGDMDRGSLPLLLSYPAGRGEILLGK
FT                   FAAHLAALAFAMTVGFGTAGAVAAWFGGAGPESLMALLRLILTSILLGAAFLALGYLLS
FT                   ATARGSAAAAGLSAGLWLVFVVLYDLGLLGAVVMDKGGTFTQSVFPWVMVANPADAFRL
FT                   WNIAATEGVAMASGMTGAAQALPVWAAPASLLIWPVLGLLLARAAFRRVEP"
FT   gene            49956..50477
FT                   /gene="nosL"
FT                   /locus_tag="SPOA0054"
FT   CDS_pept        49956..50477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosL"
FT                   /locus_tag="SPOA0054"
FT                   /product="nitrous oxide reductase accessory protein"
FT                   /note="identified by similarity to GB:AAD43477.1; match to
FT                   protein family HMM PF05573"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97194"
FT                   /db_xref="GOA:Q5LLH3"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH3"
FT                   /protein_id="AAV97194.1"
FT                   /translation="MRTLALIALIALAACKEEEAAAPPVPVDLTESALSYFCQMNVAEH
FT                   GGPKGQIHLKGHPAPLFFAQVRDMVAYLKSPEREAEITAVYVSDMGAARSWAEPGPGNW
FT                   IAADSALFVTGADVAGGMGAPELVPFATPEAAARFIARHGGQALPLNDIPDAAVLGPVD
FT                   LTQPLATPVL"
FT   gene            50513..50890
FT                   /locus_tag="SPOA0055"
FT   CDS_pept        50513..50890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0055"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97195"
FT                   /db_xref="GOA:Q5LLH2"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH2"
FT                   /protein_id="AAV97195.1"
FT                   /translation="MFKNRLILTILAAGLALPALADGDADKGKKVFNKCKACHAVGEGA
FT                   ANKVGPQLNGIIGAAAGQVEGFKYSDALIEAAAGGLVWDDESLAAFLAKPKDFMKGTKM
FT                   SFAGLKKEDEIENVIAYLQGF"
FT   gene            complement(50922..51536)
FT                   /locus_tag="SPOA0056"
FT   CDS_pept        complement(50922..51536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0056"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97196"
FT                   /db_xref="GOA:Q5LLH1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH1"
FT                   /protein_id="AAV97196.1"
FT                   /translation="MEPVQAEDEGLSPEALEAPDGETLGKMIRDARKDKGLTLEEAARS
FT                   AAIGRSTLSKIENNQTRPSFDIIRRLMQALDLETPQLFVQSGKSDISGRRDFTRKDQGE
FT                   HQVTGTYDHELLCTELTSKRMLPYISTIKARDVSEFDTWVRHRGEEFMFVLSGELTLYT
FT                   EHYRPLPMKAGDSVYYDSGMGHGCVSTSDEDARVLWVSLEG"
FT   gene            51916..53013
FT                   /gene="gcvT"
FT                   /locus_tag="SPOA0057"
FT   CDS_pept        51916..53013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="SPOA0057"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="identified by match to protein family HMM PF01571;
FT                   match to protein family HMM TIGR00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97197"
FT                   /db_xref="GOA:Q5LLH0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLH0"
FT                   /protein_id="AAV97197.1"
FT                   /translation="MTDTPKRTPLYDLHVELGGKMVDFAGWEMPVQYPMGIMGEHKQCR
FT                   EKAALFDVSHMGQVILRGDDIGAKLEKLCPQVFLTLPEGKARYGFFTNAEGGIMDDLIV
FT                   SNAGEYFFVVVNAALRHQDIPHLAAHLDGVEVTEIFDRALVAVQGPSAEDVVGRLCPAA
FT                   RDLKFMETMLGEIDGVDCRISRLGYTGEDGYEISIPEGEAIRISRLFLAHEDCEPAGLG
FT                   ARDSLRLEAGLCLYGNDIDNGTSPIEASLLWAIQKRRREEGGFPGAGRILKEIAEGAPR
FT                   KLVGIKPEGRAPARQHVEIQSLGGETIGEITSGGFGPTVGAPVAMGYVASAHAAPGEKV
FT                   NLIIRGKAQPAEIVALPFVAQNYKR"
FT   gene            53134..53499
FT                   /gene="gcvH-2"
FT                   /locus_tag="SPOA0058"
FT   CDS_pept        53134..53499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH-2"
FT                   /locus_tag="SPOA0058"
FT                   /product="glycine cleavage system H protein"
FT                   /note="identified by match to protein family HMM PF01597;
FT                   match to protein family HMM TIGR00527"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97198"
FT                   /db_xref="GOA:Q5LLG9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLG9"
FT                   /protein_id="AAV97198.2"
FT                   /translation="MTIYYSEDHEWLSVEGEIATLGITKHAADQLGEVVFIEQKEAGDA
FT                   FAQGDEIGVIESVKAASEIYAPVDGEVVEVNEELADNPGALNDSPEGDAWIYKIKLSDP
FT                   AQLDGLMDLAAYTDMIG"
FT   gene            53556..56414
FT                   /gene="gcvP"
FT                   /locus_tag="SPOA0059"
FT   CDS_pept        53556..56414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="SPOA0059"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="identified by similarity to SP:P33195; match to
FT                   protein family HMM PF02347; match to protein family HMM
FT                   TIGR00461"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97199"
FT                   /db_xref="GOA:Q5LLG8"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLG8"
FT                   /protein_id="AAV97199.1"
FT                   /translation="MAFKLTDYEAYDFANRRHIGPSPREMADMLQVIGFKTLDQLIDAT
FT                   VPPSIRQKEALDWGPAMTERDALYHMKQVASKNKVLTSLIGQGYYGTTTPAPILRNILE
FT                   NPAWYTAYTPYQPEISQGRLEALLNFQTMVSDLTGLDVANASLLDEATAAAEAMAMAKR
FT                   SSRSKANNAAFFVDKNCHPQTVAVIRTRAEPLGVDVQVGDPSELEAGAVFGAIFQYPGT
FT                   YGHVRDYTAEIAALHEHNAIAIVAADILSLALLKSPGEMGADIAIGSTQRFGVPMGYGG
FT                   PHAAYMATTDKLKRAMPGRIIGVSIDARGNKAYRLALQTREQHIRREKANSNVCTAQAL
FT                   LAVMASMYAVYHGPDGIKAIAQSVHRKTSRLAAGLEEHGFKVAPEVFFDTITVDVGPLQ
FT                   KTVIEAAVARGVNLRKVGSDRIGISLDEQTRSETIEAVWGAFGIDKKDDSVKNRAYRLP
FT                   DYALRETPYLTHPIFHKNRAEAEMTRYMRRLADRDLALDRAMIPLGSCTMKLNATIEMI
FT                   PVTWPEFANLHPFVPEDQAQGYLEMIDDLSEKLCQITGYDAISMQPNSGAQGEYAGLMT
FT                   IRNYHAAQGQGHRNICLIPTSAHGTNPATAQMVGYQVVPVRSDDHGNIDLADFRAKAEQ
FT                   HSANLAACMITYPSTHGVFEETVREVCDITHEHGGQVYIDGANMNAMVGLAQPGEIGGD
FT                   VSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAEHLPGHPEYGTAVGPVSAAPFGSPSILP
FT                   VSWAYVLLMGGAGLTQATKVAILNANYIAARLKDAYPILYTSATGRVAHECILDTRPLN
FT                   DEGGVSVDDVAKRLIDSGFHAPTMSWPVAGTLMVEPTESEPKDELDRFCEAMLSIRAEA
FT                   QQIIDGKIDPENNPLKHAPHTVRDLVGDWDRPYSREQACFPPGNLGVDKYWPVVNRVDN
FT                   AYGDRHLVCTCPPMDAYEEAAE"
FT   gene            56564..57430
FT                   /locus_tag="SPOA0060"
FT   CDS_pept        56564..57430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0060"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97200"
FT                   /db_xref="GOA:Q5LLG7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLG7"
FT                   /protein_id="AAV97200.1"
FT                   /translation="MLADLFRTANEILGAHAYRVSVHRLAAQPCADPRRWTRRTVILLG
FT                   DIRTRWSVADPLLPVLRVLLAQAPRRVLVGGAVFLLRDAGLARNCALAIHSNFCAAAAE
FT                   EGLEGLPDAPLFHSDGPVSSAVSGFAAVPLMLDLIAEDHGQVSADALRAYLGLPAPQSQ
FT                   PRSRLSLGLLQRARGDRLIERTLTLMQEHIEEPLRIGDLAGMLGVSTRKLQRQFLDLTG
FT                   EGPLAAYRALRIERAQQLLEQTNLPLTEIIAATGFGTHSNLARWMRKETGASPHILRQR
FT                   ALSGRAA"
FT   gene            complement(57490..59685)
FT                   /gene="katG"
FT                   /locus_tag="SPOA0061"
FT   CDS_pept        complement(57490..59685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="SPOA0061"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /note="identified by match to protein family HMM PF00141;
FT                   match to protein family HMM TIGR00198"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97201"
FT                   /db_xref="GOA:Q5LLG6"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLG6"
FT                   /protein_id="AAV97201.1"
FT                   /translation="MDGNDAPNAGQCPVMHGHAAGTGMRNHHWWPNQINLKVLHQHSSK
FT                   SDPMGAQFNYAEAFKSLDLDALKADLTALMTDSQDWWPADYGHYGPLFIRMTWHAAGTY
FT                   RTADGRGGGSTGNQRFAPLNSWPDNGNLDKARRLLWPIKKKYGDKISWADLLILTGNVA
FT                   LESMGFKTFGFAGGRPDIWEPEEDIYWGSEGEWLAPSDTANSRYSGARDLENPLAAVQM
FT                   GLIYVNPEGPDGNPDIVASGHDVIETFGRMAMDEAETVALVAGGHTFGKAHGNGPASAV
FT                   GPEPEAAPIEAMGLGWLSTHGSGKGADAITSGIEGAWKPHPTTWDMGYFKVLFKYDWEL
FT                   TKSPAGANIWLATNVEDEDMVEDAFDPSKKHRPMMTTADLSLRYHPKLLPHAKRFAEDP
FT                   AAFADAFARAWFKLTHRDMGPRARYLGKEVPAEELIWQDPIPAGTQIDADDAAALKAQI
FT                   LASGLSVSDMVSTAWASASTFRGSDMRGGANGARIRLAPQKDWEVNEPAKLARVLGVLE
FT                   GIQAGFSSGGKSVSMADLIVLAGCAGVEQAAKAGGHQIEVPFTSGRGDASAEQTDAESF
FT                   AVMEPVMDGFRNYQARELSTSPEEMLVDRAQLLGLSAPEMTVLVAGLRVLGANHGGSAH
FT                   GVLTNRPGVLSSDFLTNLLDMGTEWKPSGKGVYEGRDRASGAARWTATRVDLVFGSNSQ
FT                   LRALAERYAQDDAEASFVADFVAAWVKVMNADRFDLT"
FT   gene            complement(59846..60544)
FT                   /locus_tag="SPOA0062"
FT   CDS_pept        complement(59846..60544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0062"
FT                   /product="aspartate racemase"
FT                   /EC_number="5.1.1.13"
FT                   /note="identified by similarity to PIR:T08467; match to
FT                   protein family HMM PF01177; match to protein family HMM
FT                   TIGR00035"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97202"
FT                   /db_xref="GOA:Q5LLG5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLG5"
FT                   /protein_id="AAV97202.1"
FT                   /translation="MTRRVVGILGGMGPEATILLQQRLLATVRAADDADHLPLLIDMNP
FT                   QVPSRIAHLIQGTGTDPGPTLAQMARGLEQAGATALGMPCNTAHHYAPAIEAAVSIPLL
FT                   NMVSLSVARARALVAPGARVGLLASPAVRMAGVFDAALAEAQLTPLWPEDADRMLTAIR
FT                   TIKAEGPVPAARAILTAAAEELADKGAALIFVACSEFSLIADSLPSSPPVIDTVDVLAE
FT                   AIRDHTLAKP"
FT   gene            complement(60657..63092)
FT                   /locus_tag="SPOA0063"
FT   CDS_pept        complement(60657..63092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0063"
FT                   /product="FAD dependent oxidoreductase/aminomethyl
FT                   transferase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97203"
FT                   /db_xref="GOA:Q5LLG4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLG4"
FT                   /protein_id="AAV97203.1"
FT                   /translation="MKSRTRVVVIGGGIAGCSTLYHLTQEGWTDVVLVERNELTSGTTW
FT                   HSAAQVTNFGMNQTMVGLKSHSIALYKALAENPEYPINYHHGDGGIRLANTPEQMQGYR
FT                   HFTSMARGMDVHFEVIDAQECARRHPLISTENLLGGLWDPLDGDIDPAQLCQALAYHAR
FT                   KAGAEVYRNTPVTALTQHKDDTWTVHTENGDIDCDIVVNACGYRVNEVGAMMGVHHPVA
FT                   SMEHQYFLTEDIPEIVAAGHRMPLIRCPISDYYCRQEKSGLLIGFYEQDCQTWGMDGID
FT                   PNFVNALCPDDLDRVMDVLEGAFARMPALRETGIRSIVNGPITYTIDGAPLIGPIPGKR
FT                   NAFCAIGLRAGLGEGGGHGWLLAQMIVHGEACYDTWCIDPRRFTGHANVELTALKAIED
FT                   YQNEFRFHFPHEHRPAGRPAKTTPLTPVLAAEGAEFTVVNGWERVDYIKPSPEFHPSLT
FT                   FDFDEAFDVVAAEVKAVQNSVGLAEVNGFNRIEITGSGRHAFLDRMFCGSVTKRAGRVG
FT                   LGYLLNHHGMIKAEATIANLPASDRGPARVWYGSAAASEFHDMDWLSQHIQPGEDVQLR
FT                   SLTNDQTILVLAGPRARAVLSACARGDWSREAFPWLSVRECFIGFAPATVMGVSFSGEL
FT                   AYEIHIPNASLYAAYLALRKAGEAHGLTLFGARAVESMRMEKGFLHWKADLITEFDPFE
FT                   TGLSRFVKLDKGAFIGKPALLDRQSDGPRKMLVTLQIATDRAPARGGASLMVGQRVVGT
FT                   VTSGDWGHRVGMNLAYAFVDPELAEPGSEMMLDLCGDMVAARVIAPSPYDPDHARMRG"
FT   gene            complement(63234..64016)
FT                   /locus_tag="SPOA0064"
FT   CDS_pept        complement(63234..64016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0064"
FT                   /product="NG,NG-dimethylarginine dimethylaminohydrolase,
FT                   putative"
FT                   /note="identified by similarity to SP:O08557; match to
FT                   protein family HMM PF02274"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97204"
FT                   /db_xref="GOA:Q5LLG3"
FT                   /db_xref="InterPro:IPR033199"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLG3"
FT                   /protein_id="AAV97204.1"
FT                   /translation="MTDPTYEFSRAITRRPAPSVIDGLRAEDIGTPDLGRMQKAHDHYV
FT                   ATLKSTGAEVIELPPLDAYPDALFVEDTALCLPRGAVLMRPGAPSRMGEVAEMAPALRA
FT                   CYGELREIAGPGHIEGGDILVTGREILVGRSDRTDAAGVAELAGIVSDWGYTLREVFTP
FT                   PGVLHFKTDCSLLDGETILATERLDASGCFDGYRVIHTAPGEEAAANTIRFNKLVLMPA
FT                   GFPKTAEILDKAGFEVVEIDNSECAKLDGGMSCLSLRF"
FT   gene            complement(64023..65624)
FT                   /locus_tag="SPOA0065"
FT   CDS_pept        complement(64023..65624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0065"
FT                   /product="thiamine pyrophosphate-dependent enzyme"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97205"
FT                   /db_xref="GOA:Q5LLG2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLG2"
FT                   /protein_id="AAV97205.1"
FT                   /translation="MTTVGEALVAGLAARGVTCVFGIPGVHTIEMYRGLAASGIRHVTP
FT                   RHEQGAGFMADGYARVSGRPGVAFVITGPGVTNTLTAMGQARADSVPMLVVSGVNTRAS
FT                   LGRGMGHLHELPDQLGLVSQVALEAHRVSQADQLAPALGSVFDRLATGRGGPCHIEVPL
FT                   DVAGSGFDGALPAATPALPDEPEAALLDTAAARLDAARRTVILIGGGAKGMETALQALA
FT                   ERLDAPVVQTVNARGLMHGHPLTVAASPSLDAVRALISGADRVLAIGTELGPTDYDMYA
FT                   TGTMPSMAGLIRIDICDAQLARHPADLTIRGDAGATVVGLLARLPEGARTHDGASRATA
FT                   ARHAAREEIGPYMRSMVEMLEAARDAVPGALMVGDSTQPIYAGNLVYDHDRPGGWFNAA
FT                   TGFGALGYAIPAAIGAAIAAPETPVICIAGDGGAQFSLSELMVARDEALPITFVIWNSR
FT                   GYREIDMSMRAVGVEVVGCDPTPPDFAAIAAACGMPYATCAAGDPAGFAAALAEARRHA
FT                   GPTLIEIDAPYAPEQD"
FT   gene            complement(65624..66811)
FT                   /locus_tag="SPOA0066"
FT   CDS_pept        complement(65624..66811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0066"
FT                   /product="aspartate aminotransferase, putative"
FT                   /note="identified by similarity to SP:P23034; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97206"
FT                   /db_xref="GOA:Q5LLG1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLG1"
FT                   /protein_id="AAV97206.1"
FT                   /translation="MKTTAITRRLTDLGGAKWGIYLRAKAMIAKGADVISLTIGAPDVP
FT                   PPAELMDVAEAAMRAGRTTYSDGAGEPGLRAALAERYSASTGRAISADQVMCFPGTQTA
FT                   LYAVLMGVAEEGDEVLVGDPMYATYAGVIRATGADLVPVPLRPENGFRITAADIAARIT
FT                   PRSRAILLTTPHNPTGAILTPEDIAAIGDLACKHDLWIISDEVYEQLVFDGQGFSSPLA
FT                   QPDLAERVIVVSSISKSHAAPGFRSGWCIGSEAFTAALLPLSETMLFGNQPFIADMTEA
FT                   AVRNGSSVAPGMRARYAARADRLAARLNGRTCLHVLKPQAGMFAMIDVSGTGMTGEAYA
FT                   AHLLDHAGVAVMPGASFGDTIDGWVRVALTADDAAFDTACERIAAHAAEFQSEDA"
FT   gene            complement(66808..67455)
FT                   /locus_tag="SPOA0067"
FT   CDS_pept        complement(66808..67455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0067"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97207"
FT                   /db_xref="GOA:Q5LLG0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLG0"
FT                   /protein_id="AAV97207.1"
FT                   /translation="MESSRRSFTRESAEHRREALIRATLTLIGRKGVQAATVRSIAEEA
FT                   GVTLGLIRHYFDGKDELIYAAYQAHMSQLTDATMDCPRQAGEPAAHQLARIVRASLTPP
FT                   VSSPQAVGLWAGFLNMVQRDPRMAEVHSRTYYDFRDRLQALIAPALEEAGETPSPEQLR
FT                   ALAIACNAVIDGLWLEGGALPEAFDPGELVNIGLTSVGAILGLTLNDPGEEA"
FT   gene            67577..68377
FT                   /locus_tag="SPOA0068"
FT   CDS_pept        67577..68377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0068"
FT                   /product="polar amino acid uptake family ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to SP:P07109; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97208"
FT                   /db_xref="GOA:Q5LLF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLF9"
FT                   /protein_id="AAV97208.1"
FT                   /translation="MTATQKLTPEAGAASDLAGTLLIEDLHKSFGDLEVLKGVSLTANR
FT                   GDVIAIIGGSGSGKSTMLRCINFLETPSAGRIVIGGEEIQMRADGTAANRKQLERVRTR
FT                   LAMVFQSFNLWTHRTLLENVIEVPVHVLKMPRAQAIEKARALLERVGLAEKEDTYPLFL
FT                   SGGQQQRAAIARALAVDPAVMLFDEPTSALDPELVGEVLSVMRDLAAEGRTMLVVTHEM
FT                   NFAREVADHVIYLYQGRIEEQGPPAQIFGNPQSERLKQFLKSIN"
FT   gene            68410..69180
FT                   /locus_tag="SPOA0069"
FT   CDS_pept        68410..69180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0069"
FT                   /product="polar amino acid uptake family ABC transporter,
FT                   periplasmic substrate-binding protein"
FT                   /note="identified by similarity to SP:P39182; similarity to
FT                   PIR:T44454; match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97209"
FT                   /db_xref="GOA:Q5LLF8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLF8"
FT                   /protein_id="AAV97209.1"
FT                   /translation="MNFKTSLLAGLAALALSAGAAAAEEVKIGIAAEPYPPFASPDSAG
FT                   NWVGWEIEVIDAVCKAAALDCVLTPVAWDGIIPSLTGKQIDAIMASMSITEERMQTIDF
FT                   SNAYYNTPAVIVADKSLDIDASPASLAGKIIGVQASTIHQAYANAYFGDAEIRVYQTQD
FT                   EANQDLYAGRIDATQADSIAMADFVATDAGQCCEIKGNVANDEAILGKGVGAGVRKGDD
FT                   ALREALNKGIAAILADGTHEAITARYFAAPIYSE"
FT   gene            69190..69942
FT                   /locus_tag="SPOA0070"
FT   CDS_pept        69190..69942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0070"
FT                   /product="polar amino acid uptake family ABC transporter,
FT                   permease protein"
FT                   /note="identified by similarity to PIR:T44455; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97210"
FT                   /db_xref="GOA:Q5LLF7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLF7"
FT                   /protein_id="AAV97210.1"
FT                   /translation="MEGLLDLLGLAKSAELLSLSPPGWGMNLLRGLGKSLQIAFGAFGF
FT                   GLVIGLFGAYGKLYGGPVVRDLLAIYTTVVRAVPELVLILILYFVGTDLINRASEALGY
FT                   GRVEISGVAAGIWVLGVVQGAYSTEVLRGAILAVPQGQIEAARAFGMPPVMLMRRVTIP
FT                   AMLSFALPGLANLWLIATKDTALLAVVGFSELTLETRQAASSTRAYFTFFLAAGGLYLM
FT                   VTLMSSALFQLLERRSRRGQPSLKGAGR"
FT   gene            69939..70727
FT                   /locus_tag="SPOA0071"
FT   CDS_pept        69939..70727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0071"
FT                   /product="polar amino acid uptake family ABC transporter,
FT                   permease protein"
FT                   /note="identified by similarity to SP:P35114; similarity to
FT                   PIR:T44456; match to protein family HMM PF00528; match to
FT                   protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97211"
FT                   /db_xref="GOA:Q5LLF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLF6"
FT                   /protein_id="AAV97211.1"
FT                   /translation="MMRLIRPMLMPHRLVLIALAVALALWCALTLRWDWLPKYLPLAME
FT                   GLWRTVWLLAASTFLGFLLAVPLGFAQAVGPWYLAVPARVFCTLIRGTPLLLQIWLLYY
FT                   GLGSVFPQIDGIRDSVLWPYLRQAWPYALLALTLSFAGYEGEVMRGAFSGVNRGQLEAA
FT                   RSFGMPRFTLFRRIWLPQAINNVLPTLGGETILQLKATPLVATITVVEIFAVSSRVRQD
FT                   TFVIYEPLLLLALVYMVIAGLIALAFRWLENRVPTRRPGG"
FT   gene            70800..71285
FT                   /locus_tag="SPOA0072"
FT   CDS_pept        70800..71285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q8YF58"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97212"
FT                   /db_xref="GOA:Q5LLF5"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLF5"
FT                   /protein_id="AAV97212.1"
FT                   /translation="MTMSRISHIELDDSNLPPPTPEIEQERKVAIYDLLEENSFALPAR
FT                   DDRAVPEGPYRVNLSIRDKRLVFDIQTEDEEKAAEFHLSLGPFRQVVKDYFQICESYFN
FT                   AVKTLPPSQIETIDMARRGIHNEGSRVLQERLDGKAEIDTDTARRLFTLICVLHFGG"
FT   gene            71286..71747
FT                   /gene="arsC-2"
FT                   /locus_tag="SPOA0073"
FT   CDS_pept        71286..71747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC-2"
FT                   /locus_tag="SPOA0073"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="identified by similarity to SP:Q01257; match to
FT                   protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97213"
FT                   /db_xref="GOA:Q5LLF4"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLF4"
FT                   /protein_id="AAV97213.1"
FT                   /translation="MVHPLPQSVLFCCDHNAVRSPMAEGIMKKFYGTGTYVQSAGVHND
FT                   MEIDGFCIAVCQEIDVELARHRSRSFDMMQEWGDDLSSFDLVVALSPASQRRALELTRF
FT                   FHLDVEYWPIMDPTGLGETRAEKLHHYRQTRDQIIKHLKERWGEPTERS"
FT   gene            71744..72142
FT                   /locus_tag="SPOA0074"
FT   CDS_pept        71744..72142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0074"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:C97388; match to
FT                   protein family HMM TIGR02096"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97578"
FT                   /db_xref="GOA:Q5LLF3"
FT                   /db_xref="InterPro:IPR011721"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLF3"
FT                   /protein_id="AAV97578.1"
FT                   /translation="MSETVKRYFDAFNAGDVQGMLDCLSEDVAHHVNEGQIRVGKEKFA
FT                   EFCAHMNRCYKELLTDIVVFEAEGGTRAAAEFIVNGTYLQTDSGLPEAHGQTYRLPAGS
FT                   FFTLEGGKISRVTTFYNLADWVKQVSNG"
FT   gene            72135..72728
FT                   /locus_tag="SPOA0075"
FT   CDS_pept        72135..72728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0075"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:B97388"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97214"
FT                   /db_xref="GOA:Q5LLF2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLF2"
FT                   /protein_id="AAV97214.1"
FT                   /translation="MAEVTGVRALTGAALDAALEDVARLRIAVFRAWPYLYDGDLDYER
FT                   DYLQAYRNSDRAIVVGAFDGDRLIGASTGMPLADHADDFAAAFADSGLALDQVFYCAES
FT                   VLLPDYRGHGVGHRFFDLREGHARALGFAKCAFCGVQRPADHPLKPDSYRPLDAFWRAR
FT                   GYEKLPGAVAHFSWKDLDQENETDKPLQFWIRDL"
FT   gene            72753..73649
FT                   /locus_tag="SPOA0076"
FT   CDS_pept        72753..73649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0076"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97215"
FT                   /db_xref="GOA:Q5LLF1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLF1"
FT                   /protein_id="AAV97215.1"
FT                   /translation="MKIATAAYPLDWLDSWAHYEDKLAGWVSEAAGQGADLLVFPEYGA
FT                   MELSTLAGPAVAADLERSIHAVSERMEEAAALHLKLAGEYGVHVLGASAPVSTGDGRPV
FT                   NRAELYTPGGGRDHQDKQIMTRFEREDWDIVPGGPLKLFDTELGRIGVLICYDSEFPLL
FT                   GRALSEADILLVPSCTEALAGYSRVRIGAMARALENQCVSVMSSIVGNNDWSDAVDRNT
FT                   GMGGIFGPPDKGFPGTGILAEGQLNRPGWTYAEIDLTAIAHVRADGGVLNRSHWVEQDG
FT                   RAQSVTNSCLSAKAPLN"
FT   gene            73720..73938
FT                   /gene="infA"
FT                   /locus_tag="SPOA0077"
FT   CDS_pept        73720..73938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SPOA0077"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97216"
FT                   /db_xref="GOA:Q5LLF0"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLF0"
FT                   /protein_id="AAV97216.1"
FT                   /translation="MAKEDTLEFPGVVKELLPNATFRVELENGHEIIAHTAGKMRKNRI
FT                   RVLAGDKVQVEMTPYDLTKGRINYRFK"
FT   gene            73949..74527
FT                   /gene="maf-2"
FT                   /locus_tag="SPOA0078"
FT   CDS_pept        73949..74527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf-2"
FT                   /locus_tag="SPOA0078"
FT                   /product="maf protein"
FT                   /note="identified by match to protein family HMM PF02545;
FT                   match to protein family HMM TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97217"
FT                   /db_xref="GOA:Q5LLE9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLE9"
FT                   /protein_id="AAV97217.1"
FT                   /translation="MAFILGSGSPRRLDLLAQLGITPDAVRPPEIDETPAKGELPRAYC
FT                   TRISREKVAAVEAGPDDIVLCADTTVALGRRILGKPADADEAARFLRSLSGRRHRVITA
FT                   VAVRRGGRLWERDVVSQVKVKRLSEGEISAYLTTGDWQGKAGAYAIQGPAGAFVPWISG
FT                   SFSAIVGLPLAETAVLLAAAGHSKFKGDT"
FT   gene            74524..75546
FT                   /locus_tag="SPOA0079"
FT   CDS_pept        74524..75546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0079"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="identified by similarity to GB:AAQ00701.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97218"
FT                   /db_xref="GOA:Q5LLE8"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLE8"
FT                   /protein_id="AAV97218.1"
FT                   /translation="MKGRTIVLDHIAGREAAALMVDGQLDDFLIASDAPPPGTIYRARA
FT                   DRPVKGQGGMFLTTPDGPAFLRQVKGLAPGAHLLVQVTGYAEPGKAIPVTAKLLFKSRY
FT                   AIVTPGAPGLNLSRNIRDEAERDRLLEIAHEEMEGHGFGLILRSSCAEVEGEVIAEDIA
FT                   AMIAQAQQVLEDDGKDCETLIEGDGPHVLAWRDWTDPAEVVTAAGGFEDHGVLDALERV
FT                   RGIAEPLPGGGHLYIQPTRALVAVDVNTGSDTSLAAGQKANFACAKLLPRVLRIRGLGG
FT                   QITLDLAPMAKKDRRGFEAALRAALKADSEETTLAGWTPLGHYELQRKRGRVPVAEALS
FT                   "
FT   gene            75543..75725
FT                   /locus_tag="SPOA0450"
FT   CDS_pept        75543..75725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0450"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q9A5V7; match to
FT                   protein family HMM PF03884"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97581"
FT                   /db_xref="GOA:Q5LLE7"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LLE7"
FT                   /protein_id="AAV97581.1"
FT                   /translation="MTCPICGSKTAPSYRPFCSKRCADLDLAKWLNGSYAIPASSEDEE
FT                   EPLDQEAETPVAPRH"
FT   gene            75805..75879
FT                   /locus_tag="SPOA_tRNA-Phe-1"
FT   tRNA            75805..75879
FT                   /locus_tag="SPOA_tRNA-Phe-1"
FT                   /product="tRNA-Phe"
FT   gene            complement(76107..77432)
FT                   /locus_tag="SPOA0081"
FT   CDS_pept        complement(76107..77432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97219"
FT                   /db_xref="GOA:Q5LLE6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLE6"
FT                   /protein_id="AAV97219.1"
FT                   /translation="MTFDFFEGPAGSGKTFSMVAHARQLIESDALGEGQRMLALTFMNG
FT                   ARRRLTSNLNAEASFRRKFDCLTFDSFAQSLAKRRSAKLTDEMRQQAEELGQFHGPCFL
FT                   ACELLNDVEVRRWVARTYPLVLVDEAQDLDVHRQGIVLGLKECCTTVVAADSFQCLSDG
FT                   QETADFIDRLLRAGTTHTLTQSHRTNKAGLLAAALAVRNGEDIRAVLNEEAIGKTNRVH
FT                   WIGEGIELVEVPATARNSGLLAWNLAFQLRLGSDDVALLTPDSANTIIRNAIGTVASKQ
FT                   RPWPHNAFSVSWEGGDSSVADELAEAIGFPDTAPYDEVCALLEEHSAQPMVKTVIRRIR
FT                   RLQRVTGQSEFEKAQLVSFISDAVRTNTRLGFKKSAKIKAMSIHGAKNREFDRVIVLWP
FT                   QSATGSDEHKRRLLYNAMTRTKNHCTVIVLGTGRLNSAPFAP"
FT   gene            complement(77422..79263)
FT                   /locus_tag="SPOA0082"
FT   CDS_pept        complement(77422..79263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC49897.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97220"
FT                   /db_xref="GOA:Q5LLE5"
FT                   /db_xref="InterPro:IPR022602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLE5"
FT                   /protein_id="AAV97220.1"
FT                   /translation="MHIHRLKVSGLRGIQNADITLGKHSVLVGPNNNGKTTIVEALALL
FT                   LGRDRLVRRLTEHDFYQSRPIETSRILIIATISGFPENDPQHSPSWFAMGRGGVEKWLN
FT                   PATGDLAASADGEHTDLSVQIAFAARYDLQELEAETIRFFVDDEATLGDPFHDETSYTQ
FT                   ISSKTLQELGFFMVPASRTWDKWISFTSELFRRLVATLGGLPATAIRDARERLWEPEVG
FT                   QRLEEQDGLTAIVEQANSELGKLMPSSPRLRLRITGTDSNSVLESVVPHFAHGDGPTLP
FT                   SARHGTGLTSLQSLLLLMQFGKARADANKSFVLAVEEPELHIQPSQQKRLVNRLNALCD
FT                   QTIVTTHSPLVAAMFPVEATYFVDNDDGQMSVSPLSKTAPAGPTNHKQHLFFAWRQKLI
FT                   AALMHQRVLIPEGISDVAWLEALQTALELRQSWDSPEDEQSKFSTFVGVVPTDDAKIAE
FT                   THDVVRRVHHHCAILVDGDQAGRDYLAELNAADPSPSAAIIWQTDWKIEHVVAWIAEAN
FT                   LALVLPQLAEANSTAIENAAELSAFLESRKSYAPTQEITSAILMGESACRKRAAQLLNA
FT                   LCDTLLDPSVQSSPLFVRETEDGAVMPTFRFEPPDDV"
FT   gene            complement(79377..80480)
FT                   /locus_tag="SPOA0083"
FT   CDS_pept        complement(79377..80480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0083"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97221"
FT                   /db_xref="GOA:Q5LLE4"
FT                   /db_xref="InterPro:IPR025375"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLE4"
FT                   /protein_id="AAV97221.1"
FT                   /translation="MKIGGRDDFENRYMGKFRALAANYGVFVEYERDRAGRDIGLHLTQ
FT                   PDSNRDGKIVTPALIWFQMKGIMDGTLSREEYDAVEEVALDLEVAHLRFWYLNVQPTYL
FT                   ALYIESVDRFLAIDLQKWVGAHFGADILTLEQKTVRVKVAKKNELDNEFFRTVLHGNLV
FT                   PILRQSLRNENDKEIARFLRDSSVVQWLSRCQQQGIQARLTVVKWISKMRTEAYFEARE
FT                   QDGDWELFRTHWQYSMGELALAFPYVKFTPETRAEMVRYPETIEDFDGNEFQIWHESFI
FT                   AIETETGMEIDDDELEGECLLELGDGEFSFGDMGGGEIVEHRLALELNEIGVRWAETLA
FT                   VLVKAEVLSVDSEPHMVSVAPWHARDV"
FT   gene            complement(80695..80895)
FT                   /locus_tag="SPOA0084"
FT   CDS_pept        complement(80695..80895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97222"
FT                   /db_xref="GOA:Q5LLE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLE3"
FT                   /protein_id="AAV97222.1"
FT                   /translation="MTDIVTLKAICDELKIDPREARERLRSAASDAKANPELAKARKPR
FT                   TPWQWVKGSAAEKEARKALAT"
FT   gene            complement(80961..81179)
FT                   /locus_tag="SPOA0085"
FT   CDS_pept        complement(80961..81179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0085"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97223"
FT                   /db_xref="GOA:Q5LLE2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLE2"
FT                   /protein_id="AAV97223.1"
FT                   /translation="MPRMSIQSRVSRNIQRIRREKDLSQEEVAHRADIHQTYLSGVETG
FT                   KRNPSILVVERIAKALGVDVSEIFKPN"
FT   gene            complement(82940..84751)
FT                   /locus_tag="SPOA0086"
FT   CDS_pept        complement(82940..84751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97224"
FT                   /db_xref="GOA:Q5LLE1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLE1"
FT                   /protein_id="AAV97224.1"
FT                   /translation="MRQHFRVSKQMRSRNTLDAAKAQIAAGRKVILTYGIGEDGRCSCK
FT                   RDDCPSPGKHPLSKYFPNGVYSATDDIELVQKALRTHPRANLAISLAGLTVVDVDGKAG
FT                   KQAVEGLDLPKTVKVFTGRGYHLYYQGECSGGAFKGDEIDVLTGANRMVMVPPSTHPSG
FT                   KRYRYSSQSPSGMAAMPKNLSKLKPDRTQHRKEGPQTASTDLVIKSGSRNDFFFRTACF
FT                   LRRRFDDKNAVEAMLETLNNDFTEAPLSPSELRSVIQSSGNYVEDTAALFGPPKTTEPL
FT                   PMEFLYYPYIPYFGVTLLAGNPGMGKSLLVSRLIAAVTSGSPWPLSDECAPKGKVLLLS
FT                   AEDNWQRVTLGRLLEHGADISQIRMMQRFKILCPDNLEAMARYIDEERPKLVVIDTLTA
FT                   YMGSGRDMNRQNEVGEFLGRLTEIAEDAGCAVLAIGHLNKQSSEHPLFRIVGSIGFAAS
FT                   IRSALFYGTDPTDRSRFALAHGKANASELGKTIIFERFGGGRDETPVLHPVEFSDANEA
FT                   EVCRVETNSVGRPASATDSAREFILEFLSDQPVRWEAVESAVTSRSLASVGTLNVLRAD
FT                   MAKSGEIVQVGKGKSTRWKLGEPRTDE"
FT   gene            complement(85721..86923)
FT                   /locus_tag="SPOA0087"
FT   CDS_pept        complement(85721..86923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0087"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97225"
FT                   /db_xref="GOA:Q5LLE0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLE0"
FT                   /protein_id="AAV97225.1"
FT                   /translation="MKRKLTTKFIESQKPNPSKRLDFRDELMPGLVLRISTSGTKTFCL
FT                   HKRISGKMRRLTIGRFGVVSLAEARERVRKVLYEIETGRFEDRTGVEVETKPTLGDVIP
FT                   DYIEKHAKVHNRDWKRKEALLAKFAALHVKRIDEIKRADVVKACDLIHKSAPVSANRAL
FT                   AHLKHLMGWCVERGMIDASPIAGMKPLSKERSRERVLTDDELGALWTACDAEGYPFGDC
FT                   MKLLILSGQRRAEVAEMRWTELDLEKRLWTLPSQRAKNGRQHTVPITDAMIDVLRRVPR
FT                   FLGSDYVFTTTGKSPVSGFGRLKDRLDKALPEGTEPWIIHDLRRTMSTNMAMLGVPQPV
FT                   TEALLNHKTGVVSGVAAIYNVYSYTDEKCEALEQWNRHLTKMTQGHSDRLAGKMSAQFS
FT                   A"
FT   gene            87032..87712
FT                   /locus_tag="SPOA0087a"
FT   CDS_pept        87032..87712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0087a"
FT                   /product="Esterase-lipase"
FT                   /note="Novel gene detected by proteogenomics, SPOA_PG004;
FT                   similar gene identified in less than 5 other Roseobacter
FT                   strains"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0087a"
FT                   /db_xref="EnsemblGenomes-Tr:AHC32567"
FT                   /db_xref="UniProtKB/TrEMBL:V5XJP1"
FT                   /protein_id="AHC32567.1"
FT                   /translation="MLSVQVRFCRLSDGHGHFIHAFLRRLSSGERMTRSDTENLPQVTI
FT                   ARMLIAAIPGVGGSATVLLEKNLQERREARTRQYLDELAVRVRQLENSSLPGDSTVQLG
FT                   YEAARHSNEPWKPIFLASIVTARPSEIDKFLRHALIAAASDLNELEVCTLTTLALDRPE
FT                   ITIVGRFLEFRETIAKLEEESKDIESLKETALRKLELAGLASQTGEGYKISRLGEMLLG
FT                   VLSS"
FT   gene            87709..90012
FT                   /locus_tag="SPOA0088"
FT   CDS_pept        87709..90012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97226"
FT                   /db_xref="GOA:Q5LLD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLD9"
FT                   /protein_id="AAV97226.1"
FT                   /translation="MRLKVHAPVPNSIRTREEKILARFPKSSSLLNSVRSRTDRYKFGI
FT                   SDREVNKFYRFSDYKNSESFFAHKFRQFGKNYIDKTDVEIDIANSVNTIGPGTESLPPA
FT                   DRFIGLAKKFSGELLQARQLKTPYVSILTGPTGSGKTAYSKCLFSSGAQVFWANGIIPS
FT                   RVEFTKFFKAGQELSSQQILDAIHQCQTRDLLIYLCFSEVGVPSKDALEGILSSHGEYR
FT                   EHHNKIRGMVALAEGKKIDGSSFTLSEAHNIWKEQVGYFPEEVCRNILGKIKSPSFHIQ
FT                   FLVSLDGFDALKTKDFLISDRYHGPISAVADLLSDALNQVARYGGTPSSHNTNLVVFMR
FT                   DTTYARIRLELNLTPNGERRIPVRWIVPPPYKILAETIVSAVDGDVSSSVGQEGLDSFV
FT                   VNVRKNLINVLKGTSVGLSINQPISSAFSWNARHMKRHIRRICIWSLENYLISHGDQLD
FT                   ERQKSAGLSEAWLWEKTINNRALKDMAAYSVLEAFFLDDTKCLQSKFRLNSREISNFLE
FT                   GSDLVSALAAIDERPELEGLFDSIFNYMTKGLDESEGKCYPHTLVFVRILQILKFDPGI
FT                   TIEDLHDEISCFYDNISLEELRFYTICLCENEYVVFEGVENSASLDECRFFVSNFGFIL
FT                   LNKVIYSVSYFSQSLMISELIRSGFGTHFRERNFRTNEDWIANCVFNSIIAYNIVQDAE
FT                   IGERKCRQSAGKDFEKFSLCKRLRESLIWEAQRIFSRRRFSGNLEWHFNNIPEKLKPLL
FT                   GEFPNFDTLEEIWK"
FT   gene            90607..91137
FT                   /locus_tag="SPOA0089"
FT   CDS_pept        90607..91137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97227"
FT                   /db_xref="GOA:Q5LLD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLD8"
FT                   /protein_id="AAV97227.1"
FT                   /translation="MWGTHLKQKGRWWHYYRSVPREFADVERKPLISFSLKTGDFTEAK
FT                   RMAADISARLEQDWRDAKARGVSLCAQDAAEQYRAAAAVQRQFGFAPKPAADLTDEELL
FT                   ERLRLLISGQQSAPERGAVLGLTAEPQYSLSDAFDRFWDYIKDEWIRDSRDQQRVKRNI
FT                   YLGSRPIDFMLLA"
FT   gene            91354..91923
FT                   /locus_tag="SPOA0090"
FT   CDS_pept        91354..91923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0090"
FT                   /product="ISSpo7, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97228"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LM89"
FT                   /protein_id="AAV97228.1"
FT                   /translation="METLERQRGLRPDHGGPGHRKRRAQDDHDRRDLSQGTPHCVEPVR
FT                   EKGGRGRQIGRTKGGMNTKLHAVADAKGRPIGFFMSAGQVSDYTGAAALLGSLPKAGWL
FT                   LADRGYDADWFREALKDKGIKVCIPGRKSRKKAVKYDKRRYKRRNRIEIMFGRLKDWRR
FT                   VATRYDRCAETFFSAIMLAATVLFWL"
FT   gene            complement(92045..92353)
FT                   /locus_tag="SPOA0091"
FT   CDS_pept        complement(92045..92353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0091"
FT                   /product="IS3 family transposase orfA"
FT                   /note="identified by similarity to GB:AAR36473.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97229"
FT                   /db_xref="GOA:Q5LLD6"
FT                   /db_xref="InterPro:IPR009534"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLD6"
FT                   /protein_id="AAV97229.1"
FT                   /translation="MSMTMDDSIKRWTAKRKTALVIEIIQGKTTVAEASRTFDLTPSEI
FT                   EGWVEDAKRGMENSLRANPLDIREQYEKQLKDLQEAYGEAMLELRARKKLAALMVSH"
FT   gene            92502..92639
FT                   /pseudo
FT                   /locus_tag="SPOA0092"
FT                   /note="transposase, truncation; this region contains one or
FT                   more premature stops and/or frameshifts which are not the
FT                   result of sequencing error; identified by similarity to
FT                   GB:AAC43509.1"
FT   gene            93195..94682
FT                   /locus_tag="SPOA0093"
FT   CDS_pept        93195..94682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0093"
FT                   /product="FAD binding domain protein"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97230"
FT                   /db_xref="GOA:Q5LLD5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLD5"
FT                   /protein_id="AAV97230.1"
FT                   /translation="MKRFSRRAALLGAGGVAGWGLSRWLGADLPGDGGTSRITAPSGEA
FT                   WLNDASGLSATPIHEHLILQHDSGDDLIAAIRRELAEAKADGRPVNVGAARHSMGGQAI
FT                   PRNGTAITFDNGSVEIDSASQTYLVHAGARWSQVIAALDPAGWSPKVMQSNNDFGVAAT
FT                   FSVNAHGWPVPFGPMGSTVRSLRMVLPSGDLVTCSATKNADLFNLAMGGYGLVGVIVDL
FT                   EVEMVPNTRLTPTFELMDASAFGEAFRSATEDPAVTMAYGRLNVERAAFLQKALLVTYR
FT                   ETADQTDLPAAAGSGWMSHAASRLYRAQLGNETFKSFRWWNETRLGPALGSGEVTRNTL
FT                   LNEPVATLDDRNPDRTDILHEYFVGFGAFDGFLAACRDVIPASYQEFLNVTLRYVAQDD
FT                   QSALSFATEPRIAAVMSFSQELTQRAEADMARMTSALIDRMVALGGAYYLPYRPHATVD
FT                   QFTSTYPGAGDFARAKRGLDPQLVLRNNLWDNYLGQL"
FT   gene            94679..95089
FT                   /locus_tag="SPOA0094"
FT   CDS_pept        94679..95089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97231"
FT                   /db_xref="GOA:Q5LLD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLD4"
FT                   /protein_id="AAV97231.1"
FT                   /translation="MTTLQKLSLGYFLALMIAASLNYVPGLTDENGLAFGIFALDIYDD
FT                   ALHVASALWALVAGMLSHRAARSFLILFGLAYLGDGIFGFFTGFGYLDLGIFTNDPAGI
FT                   DLSLPRFLANLPHLALGGVAVWAGYRNAGQTP"
FT   gene            95089..96138
FT                   /locus_tag="SPOA0095"
FT   CDS_pept        95089..96138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0095"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB49700.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97232"
FT                   /db_xref="GOA:Q5LLD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLD3"
FT                   /protein_id="AAV97232.1"
FT                   /translation="MLLWRWTKRLALLLAVLAIGLGAPVVYVETMCRGNGLTQPYDALI
FT                   SPAHHRPESRTLLTYPEWHIVHAYEDYAKVLSSGDPHDYGFLRAIGGFWNSLCTLSRIA
FT                   PEHGGVDGGTKQMNYVIGVSFTAELALKAAYEETLGRLFAALRGPHRAPLDDLSADQAA
FT                   AYAKFLQQVPWYKWQFREDVKDLRDRPSTVLRDSERRLALGLEYRAKAAYADVIAQAVA
FT                   QVGQDELVLRMIVTGVEAGQLARYQGVRVLQERPEGIEIETPRYRALTHLIQQLAAEKV
FT                   NLVEIAGNDDILFTAISNRPAEPGALFSSERQGFGDYRHLILVKVPELAERLRLLNESG
FT                   LRLEHIHDY"
FT   gene            complement(96657..97691)
FT                   /locus_tag="SPOA0096"
FT   CDS_pept        complement(96657..97691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0096"
FT                   /product="histone deacetylase/AcuC/AphA family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97233"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLD2"
FT                   /protein_id="AAV97233.1"
FT                   /translation="MPVGGWIQPPAAAGHAESPESKRRFKSLMDVSGLTAQLSVQSAEP
FT                   VTETDMARVHSEAYLDRFKTLSDAGGGNAGEFSPFGSGSYEIAALSAGLVKRAVFDVVD
FT                   GTFDNAYALSRPPGHHAMRDGSMGFCLLANIAIAIEAARAERGLTRVAVLDWDVHHGNG
FT                   TQDIFYEREDVLTISIHQENCFPPGSGSGSERGAGAGEGANLNVNLLPGAGHQSYIDAM
FT                   DILVLPALHAFRPELIIVACGLDANNFDPLSRMTAHSGTFGYLTRAVMGAANDLCGGRL
FT                   VCAHEGGYAEAVVPFCAHEVVRTLAGVESEVVDPFRAVAEANQPPADFVAFQRQRLECF
FT                   KASL"
FT   gene            complement(97765..98703)
FT                   /locus_tag="SPOA0097"
FT   CDS_pept        complement(97765..98703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0097"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97234"
FT                   /db_xref="GOA:Q5LLD1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLD1"
FT                   /protein_id="AAV97234.1"
FT                   /translation="MTRLILALAALVLASVPYWLGGGALALVTEMLILLAIAQSWNLLA
FT                   GFGGLLSLGHHAFVAIGAYLLFAVTRDLPISPYAMIPFCGVGAALLALVLTPILFRLRE
FT                   VYFAVGMWVAAEIVKIVVSRMDYFGASSGLPLFAARRIDTSLLPSMGYWLALALTAGLC
FT                   VGLWWLGRSPWGLHVHAMRDDEIAARSLGVKTGRIKALLFILSAAGSGMAGAIGFMGSL
FT                   YVSPIAAFDINWTVYAIFICVIGGLGTIRGPVIGVMLFVALREALSASPGWNLIALGLI
FT                   AMLLMIFAPRGIDGLIPRLGNLASKRHFKEG"
FT   gene            complement(98700..99569)
FT                   /locus_tag="SPOA0098"
FT   CDS_pept        complement(98700..99569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0098"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97235"
FT                   /db_xref="GOA:Q5LLD0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLD0"
FT                   /protein_id="AAV97235.1"
FT                   /translation="MSIVIDILINGLFLGGLYALFGLGLTLIFGVMRIANIAHGEIAVA
FT                   GALALFTLGGNLPVHPLVLLPVVMVLAFGLGWLLQAQLINRVLSADPMPALLLTFGLSV
FT                   VLQNLMVEIYGADNRSIDIGTIKTAGFQIGGVTLGYLPLAIFLLALVLFGLLHLGLQHT
FT                   RLGRAIRATSQDADIVALFGIRQKRVFALVMALAAGFAALAGMLLAMRSTITPFSGAER
FT                   LLIAFEVIVIGGLGSIWASYLGGIALALVHVASFYFDPASGLLYGHLTLLLFLLLRPQG
FT                   IAGKVVTR"
FT   gene            complement(99566..100270)
FT                   /locus_tag="SPOA0099"
FT   CDS_pept        complement(99566..100270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0099"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97236"
FT                   /db_xref="GOA:Q5LLC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC9"
FT                   /protein_id="AAV97236.1"
FT                   /translation="MSMLEIENLDARYGDFQALFGISLNVRRGETIALVGANGAGKTTL
FT                   LRAIAGLGQYHAGVLRLNGRDIGSASPQELARMGISMVPEGRRLFTGMSVAENLMIGAD
FT                   LGRGGHWVRDAVFDLFPEIAVMAHRPAGLLSGGQQQMVSLGRALMTNPDLLLVDEVSLG
FT                   LAPVVVDRVYAALAQLKERKTTLVVVEQDIRRALDVSDRFYCMLSGRVALAGASAPAAF
FT                   DAVSRAYFGEAA"
FT   gene            complement(100267..100980)
FT                   /locus_tag="SPOA0100"
FT   CDS_pept        complement(100267..100980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0100"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97237"
FT                   /db_xref="GOA:Q5LLC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC8"
FT                   /protein_id="AAV97237.1"
FT                   /translation="MLEARNLSKSFGGLEVLRDVSLTVEPGICLGIMGPNGAGKSTLFD
FT                   LLMDVTRADSGTVSVAGRDVTGLDTAGRVKSGMARAFQVPRAFASLSVEQTLYLAQHAG
FT                   HGVAPQKAYDKVEAVLEITGLTAMRHQMGGALRLLDRKRLELAKALAADPQVILLDEIS
FT                   GGLTDREAAEMVTLVHRLKEAGLAVLWIEHIAHALQAASDRIMMLALGRKVIEDTPQAV
FT                   VADPQVRALYLGTPA"
FT   gene            complement(100984..102264)
FT                   /locus_tag="SPOA0101"
FT   CDS_pept        complement(100984..102264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0101"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic branched-chain amino acid-binding protein,
FT                   putative"
FT                   /note="identified by similarity to GB:CAE37397.1; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97238"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC7"
FT                   /protein_id="AAV97238.1"
FT                   /translation="MTRNQSLNRRSFLAGSAAFIGTLAAPSIVTAASKKLRIGFISPLS
FT                   GPRASFGTSDQWMVETISKHLSGGLISGGASHEVEIIVKDNQSNMNRSISVGNELLLRD
FT                   QVDMLLINDGDAAVALGEIADIHGVPTMSTMQPWQAWMFPRGSNPEQGFPWTFHFFWGA
FT                   DDAMSTFTRLWDQIDTNKVVGDFYLDNPVGNAFADPAMGLPGFIERGGYSRVDGGMFKI
FT                   DADDYSGQVSRFKEAGADIVTGFGFPPHWITFWNQAGQAGYTPKACTFAAAFLFPQAIE
FT                   AMGDRGDGMTTEVWWTPNVPFASSLTGQTARELADAWEAESNAQWVQTLGYSHALFETG
FT                   LNALVQSGAPKDRAAVRDVFASTRLDTVVGPVNFADSPIRNTARTQLAGGQWRKSSGKH
FT                   AFELVITENTLAPDIGVESETIALPQV"
FT   gene            complement(102382..103350)
FT                   /locus_tag="SPOA0102"
FT   CDS_pept        complement(102382..103350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0102"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97239"
FT                   /db_xref="GOA:Q5LLC6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC6"
FT                   /protein_id="AAV97239.1"
FT                   /translation="MNRYDLSEFVLKLMDKANTHTPLHFQKFMMDLVRDITRFDAAWWG
FT                   WSLFRGGRIAMVHTDVSDLPEDFEPRVKAQLANDPFVRTGRNLQRYARSITVAEAVTDP
FT                   SFRDFAGHFNLTQMLNGHCKVRDGRFNFFMSLYRRGAAEPFTDTENADFLAILRHIEQA
FT                   LSMSLQLDLGMRVDPNTDWALVDATGELFLSSTGFQHRAEFSATSRGRVPDLLRAAAAT
FT                   ASHVGRDGAVFTRERYSDDLWLLRLTPPNPWGDLSRREKLVANCLVQGMTMRQAAERLD
FT                   VSVNTVRNQVSSIYRKTGVENRVQLLRLANPTLTEAAPDEA"
FT   gene            103368..103862
FT                   /locus_tag="SPOA0103"
FT   CDS_pept        103368..103862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB49373.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97240"
FT                   /db_xref="GOA:Q5LLC5"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC5"
FT                   /protein_id="AAV97240.1"
FT                   /translation="MVIVHLHYIWFSRLLASLACNATGPADWRGPFQVEEDMPEALKDI
FT                   IAAKSRRFEENFARGDVPALVADYYNNDPVVIGQGVATFTGREGATQYFTGAVEAMKSA
FT                   KLTTYTIQEGEDSAIETGGVKLTPREDGAAQIDLTYVLVWQRHADGWAVHMDYFMPGVV
FT                   R"
FT   gene            103895..105283
FT                   /locus_tag="SPOA0104"
FT   CDS_pept        103895..105283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0104"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97241"
FT                   /db_xref="GOA:Q5LLC4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC4"
FT                   /protein_id="AAV97241.1"
FT                   /translation="MTIDAQAVAAASEFEVANPAGGIAGHAPNATLEDLDRAVAAAQGA
FT                   FTLWSRQDDATLRAACEAVTAKIGEHAEELAQLITAEQGKPLNGLGSRWELGGAQAWAG
FT                   YTSSLALPVKILQDDDAGRVEMHRKPLGVVGSITPWNFPLMIAVWHILPALRTGNTVVI
FT                   KPSPLTPLSTLRLVELMNEVLPAGVVNVITGDDKAVNLGAAMSAHPGIRKIVFTGSCAT
FT                   GQKIMASAADSMKRLTLEMGGNDAGIVLPDVDPEAIAEGLFWGAFINNGQTCAAMKRLY
FT                   VHEDVHDAVCEALVAFARNIPVGRGDDEHAILGPVQNAVQHAKLCRLVAAAKNKGNVLL
FT                   GGESGEGLFFPPTIISGLENGDPLVDEEQFGPVLPIIRYSDLEAAIAAANNSPNGLGGS
FT                   VWSPDIDKARSVAQRLECGSVWINKHGAIQPNVPFGGIKASGLGVEFAEEGLAEYTDIQ
FT                   VVFS"
FT   gene            complement(105320..105694)
FT                   /locus_tag="SPOA0105"
FT   CDS_pept        complement(105320..105694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0105"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by match to protein family HMM PF01638"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97242"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC3"
FT                   /protein_id="AAV97242.1"
FT                   /translation="MKRREEIEKELGLDLCPIRTVLAQIGDKWSLLIILLLRDGGQRFS
FT                   EMQRAIPDISQRMLTQTLRKLERDGLVSRTVTPTIPPRVDYAITTLGRSLFAPIGAMAQ
FT                   WAVEKQPQIIEARRAFDAAG"
FT   gene            105811..106644
FT                   /locus_tag="SPOA0106"
FT   CDS_pept        105811..106644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E95217"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97243"
FT                   /db_xref="GOA:Q5LLC2"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC2"
FT                   /protein_id="AAV97243.1"
FT                   /translation="MIMSLRTTSAAAALALTALSAAADSAANKEIAVGLLEQGLAKGDR
FT                   DFIMTHVAEGYIQHNPQAADGREGLLGFVSFLETLDPPVTVNPVRVIADDNFVVIHQEA
FT                   EFFGPKVIIDVFRFEDGKIAEHWDSIQETVTETASGRSMTDGTTKITDLDKTAENKALV
FT                   TGLVKDVLMGGKIDRIDDYIAEGYMQHNPFVPDTREGLKGFVAYLGENNISFWYSELHL
FT                   VVAEGNFVFTQAEGVYDGTPTAFYDIWRIEDGMIVEHWDTVQPIPTEFAHENGMF"
FT   gene            complement(107348..108241)
FT                   /locus_tag="SPOA0107"
FT   CDS_pept        complement(107348..108241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0107"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97244"
FT                   /db_xref="GOA:Q5LLC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC1"
FT                   /protein_id="AAV97244.1"
FT                   /translation="MPLPIRDLYTFFVVARAGAMQAAAHELGVTPGAISQRIRSIEDRY
FT                   GKRLFVRSRDGVSLTASGKALWKEVKSAFAQIETSHNRHIGKDGKTILRISAAPTFAHS
FT                   FLVSNLASFNEDHPGIRFNIETEDRLADLRSEPIDLAIRHGLGDYAGLRSEWLCAPELI
FT                   VVGSPALLESQHPVKEPEDCLRFTLLPDETGLDWALWFEAHRVNAVAPSYGTAFKDGFL
FT                   TVKAASRGQGLALINDIYVREELADGRLVQLLPGSWPTKFAYYAVALPETFDRPAVKAF
FT                   VKWLCAACAVEQMHQK"
FT   gene            108335..109549
FT                   /locus_tag="SPOA0108"
FT   CDS_pept        108335..109549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0108"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97245"
FT                   /db_xref="GOA:Q5LLC0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLC0"
FT                   /protein_id="AAV97245.1"
FT                   /translation="MRAPTINQNWTIVLFGFLALSLAFSARAALGLIMPVWQAEFGWSS
FT                   GYISGVGAAALIVMAGVAPFAGRLVDTRGPGLALNLGMGLLGVGCAVVAAMSSKWMFIV
FT                   GFAGFGAVGFGIVATHVVATAVTRSFDRNAGLAIGIATSGATGGQFLIVPLIAALLAFA
FT                   SWRWSFGALSVMSLALVPCIRASLPPRVETDGGGDGDARTTMAADFVTIVRLPAFHILF
FT                   WSFLICGFTTTGVIETHLLPFASFCGFPPVPSATAYGVLSLVNLFGMIAAGWLTDRMNR
FT                   PLLLGAIYALRALTFVFLSNLPGMPIEMLFAFALFFGAVDYATVPVTASLVASHVGLKV
FT                   MGLAMGMISAGHAIGGAMGAMAGGYLFDQTGNYDLLWTASLWLAIGAGVMVMFLRERGR
FT                   QPAGA"
FT   gene            complement(110630..111106)
FT                   /locus_tag="SPOA0451"
FT   CDS_pept        complement(110630..111106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0451"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by similarity to SP:P55740; match to
FT                   protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97582"
FT                   /db_xref="GOA:Q5LLB9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:3E6M"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB9"
FT                   /protein_id="AAV97582.1"
FT                   /translation="MTEARKIPKPSFPYGSPGELNSFLPYLLTRITHIWSSELNQALAS
FT                   EKLPTPKLRLLSSLSAYGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDADQR
FT                   KRTVVLTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILKGKTDY"
FT   gene            complement(111099..111572)
FT                   /locus_tag="SPOA0452"
FT   CDS_pept        complement(111099..111572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0452"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by similarity to GB:BAC48674.1; match to
FT                   protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97583"
FT                   /db_xref="GOA:Q5LLB8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:3BOQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB8"
FT                   /protein_id="AAV97583.1"
FT                   /translation="MGEAATKSDRQQNQTRLWLNILRLHGLVFGDLNRQLLDETGLSLA
FT                   KFDAMAQLARNPDGLSMGKLSGALKVTNGNVSGLVNRLIKDGMVVKAMSADDRRSFSAK
FT                   LTDAGLTTFKQASEAHNRILAELLRAVSDQDMVEASAALRGILESMQTGASLD"
FT   gene            complement(111593..112039)
FT                   /locus_tag="SPOA0109"
FT   CDS_pept        complement(111593..112039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97246"
FT                   /db_xref="GOA:Q5LLB7"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB7"
FT                   /protein_id="AAV97246.1"
FT                   /translation="MDDFPDDMWSTRTKFRHGQCDPAGIVYTPNFFDVFNRAIEEWFDD
FT                   ALQIPYQDVIGRRRIGLGYVAASATFFTPFMMGDEAEAFVAVDKIGTKSYTLSVHLVKD
FT                   QREAVRGTLTTVTTNLDAHQSTEIPDDILEALLTYAEAYKLDKD"
FT   gene            complement(112090..113661)
FT                   /locus_tag="SPOA0110"
FT   CDS_pept        complement(112090..113661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0110"
FT                   /product="indolepyruvate oxidoreductase, IorB subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97247"
FT                   /db_xref="GOA:Q5LLB6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB6"
FT                   /protein_id="AAV97247.1"
FT                   /translation="MKDDTVKLPLRPEADATDRPLSIAIVAMGGQGGGVLTNWIVELAE
FT                   CQGWIAQSTSVPGVAQRTGATIYYVEMMKPGRHGQRPVLAQMPTPGDVDVVIAAEYMEA
FT                   GRSILRGIVTPDRTTLIASDHRSLSTIEKMAPGEGIADSGAVTDAIGIVAKRRIVFDMN
FT                   RMAVENGSVISSALFGSLSASGALPFPREDYHAVIQKSGKGVAASIRTFDAAVAQVEAG
FT                   EKGEAPGTLEQRDTMPAALPRSLANPRANALLQRLRTDLPVEVQAMAYLGLKKVVDFQD
FT                   AAYGEEYLETLAEIAEKDRAAGGDNRGFTFTNTAAKYLANAMAYDDIFRVADLKTRAER
FT                   RRRIEDDLKLSEGQIFGTTEFMHPRLEELSSALPAGLAGWLRGKRELYAWLDRRVDKGR
FT                   RVRTYSLPGFLMLFFLAGLKRLRRRSLRHAEETEHRTRWLTEATGALQSNYDLAVSILK
FT                   VRRLIKGYSDTHARGHSKFDKVMQTIRSISQRDDAAMWADRLLRSALKDGDGDNLDGTI
FT                   KTIQSF"
FT   gene            complement(113658..115832)
FT                   /locus_tag="SPOA0111"
FT   CDS_pept        complement(113658..115832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0111"
FT                   /product="indolepyruvate oxidoreductase, IorA subunit,
FT                   putative"
FT                   /note="identified by similarity to SP:O07835; match to
FT                   protein family HMM PF02775"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97248"
FT                   /db_xref="GOA:Q5LLB5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB5"
FT                   /protein_id="AAV97248.1"
FT                   /translation="MAERSFAKEVEHLKLGEGDVFRGEGILAITKALLQSGISYVGGYQ
FT                   GSPISHLMDVLADANDILDDLGVNFQSSANEATAGAMLSASVMYPLRGAVAWKSTVGTN
FT                   VASDALANLASGGVTGGAMVIVGEDYGEGSSIMQERTHAFAMKSQMWLLDPRPDQECMV
FT                   GLIEKGFELSEASNTPVLLQVRVRSCHMTGEFVCKDNVRPDFTLKDAMNSPKRDLDRIV
FT                   LPPAAYEHEVEKIERRLPAAIDFVTENKLNEFFGPTGKDKSGKTGLIVQGGMYNSTIRA
FT                   LQFLGLSDAYGNSKLPIYVMNVCYPTIPSEIEAFCEGLDAVLVVEEGQPEFIEQSITTN
FT                   ISRLRKPTEVHGKKYLPMAGDYTVTALTKGIGQFLEDYEASLLGNRAPAPDPVPILTNP
FT                   AVAALKDVVPPRPPGLCTGCPERPIFTAMKLVFEELGEHHVSADIGCHLFSILPPFNIG
FT                   ATTMGYGLGAASSAAFNVKGAKRSISIMGDGGFWHNGLTSGIGHAVFNKHDGVFLIIDN
FT                   YYSSATGGQDILSSRAFNKRRTTNNSIVDAVKGVGAKWVRQIDRTYDVNRMRAVLIEAL
FT                   TTDAEGPKIIVASSECMLNKQRRVKPQVAKALKAGKRTVKERFGVDEDVCTGDHACIRL
FT                   SGCPSLSVKELDDPLRDDPVASIDTTCVACGNCGEVADAAVLCPSFYRAEVIHNPSSWD
FT                   RFKSSFTLPAITYLQKRRARRAVNFEEAAR"
FT   gene            115948..117462
FT                   /gene="feaB"
FT                   /locus_tag="SPOA0112"
FT   CDS_pept        115948..117462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feaB"
FT                   /locus_tag="SPOA0112"
FT                   /product="phenylacetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.39"
FT                   /note="identified by similarity to SP:P80668; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97249"
FT                   /db_xref="GOA:Q5LLB4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB4"
FT                   /protein_id="AAV97249.1"
FT                   /translation="MQVARPDSLVSQILPAVADYLDSPAKLLLGGTSTAASDGRTMDVF
FT                   NPATGKKLAEVPWGGAAEIDLAVKAAQAALEGDWSRMRPVERQRVLLNLADLIEANGEE
FT                   LAQLETLNNGKSVMLSRLVEVGNSSNYLRYMAGWSTKIEGSTIDVSIAVPPGAKYQAYT
FT                   RKEPVGVVGAITPWNFPLNMAIWKLAPALACGNTVVLKPAEETPLTSLRLGELCLEAGL
FT                   PPGVVNVVSGTGAEAGAALTAHPGVNKLTFTGSTEVGKIIGIQAMRDMKRVTLELGGKA
FT                   PMVMFDDMDLDQLSEAARIGILFNSGQTCCAGTRIYAQRGIYDRICETMANVVGALSVG
FT                   SGLDPANAINPMVSAKHQAHVSACIAGGVEEGATPLLDTGAYDGEGYFVRPQIFTDVRQ
FT                   DMRIMQDEVFGPVFTITPFDDPDEAIRMANDTRYGLGASIWTTNLNTMHRYVPQLQAGT
FT                   VWVNSHNVPDANMPFGGYKQSGIGREHGRAALDAYLETKSVCIAVR"
FT   gene            117468..118856
FT                   /locus_tag="SPOA0113"
FT   CDS_pept        117468..118856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0113"
FT                   /product="aminotransferase, class III"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97250"
FT                   /db_xref="GOA:Q5LLB3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB3"
FT                   /protein_id="AAV97250.1"
FT                   /translation="MTTTQHTPTPRDNFLRENNGRHQIHPMTHPLIIENRPPRIIVKGE
FT                   GSYVTDIDGKTYVDGVGGLWNVNVGHNRPEVKAAITAQMEEISYYSSFAGTVTPPSIEL
FT                   SAKIMEMTADEDMARVLFSANGSDAVETALKLSRQYWKLEGEPERTGFISLKQGYHGIQ
FT                   FGGTSVNGSTLYRSAYGPLLPGCYQVDSPWTYRNPYSEDPEELAEAVITQIDRLIQHQG
FT                   AHTIAAFIAEPVQGAGGIIVPPASFWPRLRQVLDKYGILLISDEVVTGFGRTGAMFGAR
FT                   GWGVKPDIMCFAKGITAGYIPLGATVINERVFAAWQKGIDPTGFIMHGYTATGHALGCA
FT                   AANATLKIVEDEDLPGNAGRMGQRLMEGLKDIPNWSSLVGEVRGKGLMVGLDLVADKDT
FT                   REPIDPGKGQGEMVATFARDEGVIVRPAGPVIIISPPLTLSEKETDKIVDALIKALRRY
FT                   EEEK"
FT   gene            118859..119893
FT                   /locus_tag="SPOA0114"
FT   CDS_pept        118859..119893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0114"
FT                   /product="nitrilase family protein"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97251"
FT                   /db_xref="GOA:Q5LLB2"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB2"
FT                   /protein_id="AAV97251.1"
FT                   /translation="MLPLQDFPKFTAAAVQASPVFLDAHKTAQKAVDLIAEAAGNGAEL
FT                   VVFPEVFIPGYPYWNWITDPVTGGAWFEKLVRASVFADGPEIDVIRDAARAHGCHVVMG
FT                   LNERSPVSLGALYNTLLFIGPDGEVIGKHRKLVPTWAEKLTWTGGDGSSLKVYDTAIGP
FT                   LGGLACGENTNTLARFTLLAQGELVHTASYISLPVAPPDYDMAEAIKLRSMSHSFEGKV
FT                   FTVTATSTVSEEIIEAMEQVRPNARELLQRKSSAYSGVIGPDGREVVTGLIDDEGIVYA
FT                   EIDLGKCIQPKQMHDITGHYNRFDIFDLRVNQRRQTPVALSGAAVTFTNEHEQADGSTE
FT                   PASE"
FT   gene            119912..121036
FT                   /gene="gtdA-2"
FT                   /locus_tag="SPOA0115"
FT   CDS_pept        119912..121036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtdA-2"
FT                   /locus_tag="SPOA0115"
FT                   /product="gentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.4"
FT                   /note="identified by similarity to GB:CAA12267.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97252"
FT                   /db_xref="GOA:Q5LLB1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:3BU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB1"
FT                   /protein_id="AAV97252.1"
FT                   /translation="MAPTEIKPEDDILGRARVRDTPELEAYYDDLAKIETGALWTVAND
FT                   IEPWEPTPKSAPVHWKWSDLRREVLRAIDLVRPEDAGRRVVYLRNPQRKDVSAACGWLF
FT                   SGIQTMKAGERAGAHRHAASALRFIMEGSGAYTIVDGHKVELGANDFVLTPNGTWHEHG
FT                   ILESGTECIWQDGLDIPLTNCLEANFYEVHPNDYQTTDIPLNDSPLTYGGPALLPQLDK
FT                   WDKPYSPLLKYSWEPTYEALLNYAKASDGSPYDGLILRYTNPQTGGHPMLTMGASMQML
FT                   RPGEHTKAHRHTGNVIYNVAKGQGYSIVGGKRFDWSEHDIFCVPAWTWHEHCNTQERDD
FT                   ACLFSFNDFPVMEKLGFWAEQALEDNGGHQIVAD"
FT   gene            121054..121971
FT                   /locus_tag="SPOA0116"
FT   CDS_pept        121054..121971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0116"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97253"
FT                   /db_xref="GOA:Q5LLB0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLB0"
FT                   /protein_id="AAV97253.1"
FT                   /translation="MKLVTYRDSAAGEGRLGVVVDGQVVDVEWLGEAAGEALPDSMLDL
FT                   IDMGPDALAAITRALDATNAARPAGLAVPEENVRLLAPIPRPRKNIFGIGLNYVEHVAE
FT                   SAKSLDTSKELPKEPVVFSKPPTSVIASGEGIQHNAAMTQQLDWEVELAVIIGKRATRI
FT                   AKDNAMSHVFGYSVINDVSARDNRRAGQWIFSKGQDTFCPFGPAIITADDVPDPHNLDL
FT                   WLTKNGVEKQRSNTRHLLFDIPTLIADISSGITLEPGDIIATGTPAGVGAGRDPQEWMW
FT                   PGDVIECGVDGIGVLRNPVVKIGD"
FT   gene            121973..122749
FT                   /locus_tag="SPOA0117"
FT   CDS_pept        121973..122749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0117"
FT                   /product="Asp/Glu/hydantoin racemase family protein"
FT                   /note="identified by match to protein family HMM PF01177"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97254"
FT                   /db_xref="GOA:Q5LLA9"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="InterPro:IPR028615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA9"
FT                   /protein_id="AAV97254.1"
FT                   /translation="MSAIQDNMHKTLRIGQIVPSSNLTMEREIPAMMRAREAQFPERFS
FT                   FHSSRMRMKKVTKEELKAMDHDSDRCALELSDGAVDVMGYACLVAIMSMGKGYHRESQA
FT                   RLHQVTVDNGHPAPVVSSAGALVDGLHLMGAKRISIVTPYMRPLTNLVAEYIEAEGVEV
FT                   SDSIALEIPDNLEVAAQDPTNLLEIYKRVNLKNIDALVLSACVQMPSLAAIQKVEDECG
FT                   IPVLSASVATTHQMLKSLGLHAEVKGCGALLSGAYA"
FT   gene            122787..123326
FT                   /locus_tag="SPOA0118"
FT   CDS_pept        122787..123326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0118"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97255"
FT                   /db_xref="GOA:Q5LLA8"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA8"
FT                   /protein_id="AAV97255.1"
FT                   /translation="MTRLKTFQELFRRDRRPGDLVFAYIFLGFCLFLLFNLRDQAQWLD
FT                   NAKTVAQPAFWPTVAVVGMTLFAGLHLVGSLVSPRIPGRLKEGAFWIRSGEYVVYFLIY
FT                   VWCVPIVGYLLSTIVFAVFLTIRLGYRSKQALGFAAFFGFAVVLVFRAGLQVKIPPGQI
FT                   YEHLPDAIRTFAMVYL"
FT   gene            123338..124879
FT                   /locus_tag="SPOA0119"
FT   CDS_pept        123338..124879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0119"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01970"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97256"
FT                   /db_xref="GOA:Q5LLA7"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA7"
FT                   /protein_id="AAV97256.1"
FT                   /translation="MEAILGGIQILLSWQVLVALLVGSVGGVIIGAIPGVGAAVAIAIL
FT                   LPATFAFEPIVGLTILLGIYGSSMYGGSIPAILLNTPGTPVNALTTYDGYPMTKRGQAH
FT                   RALSLAYSASFFGGIFAIICLILLAPVLAWIAPNFGSREIFLAALLGIILVILAHRGQI
FT                   MAAGMMAFFGIFLSTVGLESAKYTHRFTFGQDWLTGGINLIVIVLGLFAVSQALMLLLE
FT                   QEKEPESARVEGSLWGGFAELLGLKRVASVASSLGVMMGTIPGVGEFTAQFLSYTYAQK
FT                   TSKTPEAFGDGSPEGLVASECANNAVPAAAMIPLLALGVPGEALTAMMLSVFYVHNVIP
FT                   GPQLFQNELDFVMALYMAMLLLNVIVIIFLLSSTNLLLKITQIPTRFLGMMILVLSFVG
FT                   VYSMRNSAVDCAMAAGFGIFGLILKRLNLPIVPIILGVVLGAIMEVKLRSAMARIEEPL
FT                   DWFNRPISVILILLILFVIGNHYRALILEHRSRLQKAADGEPEDAAEGKVAPEGF"
FT   gene            125015..125953
FT                   /locus_tag="SPOA0120"
FT   CDS_pept        125015..125953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0120"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC94333.1; match to
FT                   protein family HMM PF03401"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97257"
FT                   /db_xref="GOA:Q5LLA6"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA6"
FT                   /protein_id="AAV97257.1"
FT                   /translation="MKKLFSALALGASLMGTAAVAEYPEKPVEFVIPFPPGDLEDLLTR
FT                   IIADEFQDTYGVPAAVVNKPGGGGGPFPGAVSVANAPADGYTIGSFVIGVPVVGPTIGI
FT                   PDLQPDPFEPIGIFLTYPFVVAAKGDAPYSTMEELATHAKDNSVLFGHFGERSIPRRHM
FT                   IAVSRQLGFEFSSEAAFDALDCNTLASGDADVISTTAQLIFPCLDNLKILASATNERIS
FT                   IMPDVPTMGEIAPELDLSTWNGLFVHKDTPADVREKIEAVAIKALNSDAAKELAANTGA
FT                   VIYWKSAQEAKAQIESDIKVLKIIDDLVAGN"
FT   gene            126010..127668
FT                   /locus_tag="SPOA0121"
FT   CDS_pept        126010..127668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0121"
FT                   /product="sulfatase family protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97258"
FT                   /db_xref="GOA:Q5LLA5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="PDB:4UPI"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA5"
FT                   /protein_id="AAV97258.1"
FT                   /translation="MTQNRNILWIMCDQLRFDYLSCYGHERLNTPNIDKLAKRGVRFTN
FT                   AYVQATVCGPSRMSAYTGRYVRSHGSTQNGIPLRVGEPTLGDHLRDVGMRNVLIGKTHM
FT                   RPDLDGMKRLGIDPDSEIGARVGEGGFDAFDRDDGVHPTGYRKKEPAYNDYLRHAGFQA
FT                   ENPWEFWANSAEGKGGENQSGWLLTHADKPARVPEEHSETAYMTRRAMEFMEAAEKDGR
FT                   PWCAHLSYIKPHWPYIVPAPYHDMFGPDDVKPAVRSDEELKAAHPLFKAMTEEVYSRNF
FT                   ARDEVREKVIPAYMGLIKQIDDQLGQLFAFMQERGLDENTMIVFTADHGDYLGDHWMGE
FT                   KYLFYEAAAKVPLIIYDPSDKADATRGTVSDALVEMIDLAPTFVDYAGGVPPMHILEGK
FT                   SLLPLLHDDDSSWDRQYVFSELDYSNLPARLKLGRDIQDCRATMVFDGRYKLVEVMGFA
FT                   PILFDLEVDPDELKDLGRDPSAEEVRQRLTSALDAWHRNTRQRITKSDAAYRALDPVLR
FT                   ESDPDLMAGVIIGYWDEDEVEAEKRRIARILGENS"
FT   gene            complement(128113..129045)
FT                   /locus_tag="SPOA0122"
FT   CDS_pept        complement(128113..129045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0122"
FT                   /product="ISSpo9, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97259"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA4"
FT                   /protein_id="AAV97259.1"
FT                   /translation="MSRPTPPTYKTRNWPAYNKALKRRGSLTIWFDPAMTWDAAPTGKR
FT                   GRQPDYSDAAVQTCLTMKVLFGMALRQTTEFVESLLGLIDLDWAVPDFSTLSRRQKTLK
FT                   VNIPYRGSDGPLHLLIDSTGIKVEGEGEWNARKHGGTKRRVWRKIHIGIDEKSLEIRAA
FT                   EFTTSEIGDAPMLPELLDQIPPEQEIGSVTADGAFDTRKCHEAIAARGAAAIIPPRKNA
FT                   KPWKPDTAGAIARNEILRTSKRVGRTIWRLWSGYHRRSRAETKMHCVKLLGQRLTARDF
FT                   DRQVAEFQLRVAVLNGFTALGTPITDAMG"
FT   gene            129275..132235
FT                   /locus_tag="SPOA0123"
FT   CDS_pept        129275..132235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ60231.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97260"
FT                   /db_xref="GOA:Q5LLA3"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA3"
FT                   /protein_id="AAV97260.1"
FT                   /translation="MRRQFRCLRPGQSAEMALGGMTKITWQSSESFEVEEAGTHHVRRG
FT                   GLGQGADDPLTGLFAQPEVRKVFEVVEAQRHVVRPTKRSAGPNEIAVRLDVDDGADYIL
FT                   AVRHPSGAIQFIGGQEIGAGGKRSNSALRTRRTRNYAIEFRAPISFYAEKDVRRGIVGD
FT                   IKDAVVDAIVIKVKDFIAKKTVDLAEAAIWKLLGREPGMKQLSIENGRLNLAPVSGRIK
FT                   PGPNGRALLFIHGTFSTTDGSFGDLASAEFFGELARTYGNAIYGFDHYSVSVTPEKNAS
FT                   DILKTLPSGGIDCDVVTHSRGGLVLRTLNERQGDLSQGKRFRLQRAALVACPNEGTQLA
FT                   TPDRWQGTLGWLANLLDLFPPNPITSNAALVMHWVTWFAKVGVAAAEGLDAMNMTGAQI
FT                   RQLQSPPSPAPGQYSALVSNCEPNGKLWARALDLGIDWFFDEANDLVVPTSGGWRIDRV
FT                   PDFIPKDQIGAYGPGGNIPAGPRQVTHISFFDRAETLQFVLRALSGAPQHLPELDLARA
FT                   LPVSRSADGAVLPAMAEEVEPQVAELPAFETVLHRAEAAAPRKAPARRLAAHPNSSVFE
FT                   LIVLDPEQITRMGFPRVEEEEAEDGHGTPFLYAAYGGARVMVPFYLKKAHLPPKTGNET
FT                   EDKRLKSMAAEMGQRWGKLFGFHRRVQSVLDGNPRARELSPDELRIFGELLFETLLPQE
FT                   VRRLYDVARSREHDKLFVIFTSMIHWVFDMPWEFARDPERGTYLATEDVHFIRNVLTQT
FT                   PVEKLSPRESLKILIATSEPRDQRRVSATEEIAKLRKAITELQRDGLIEFEIRKNATPR
FT                   NLHHEIATGNYDVVHFIGHGYWNTKSGESGLVLEDETGNSRPLGGRPLREILSGRGIRL
FT                   VFLNACDTGRSRRASGVETTSLAGVAQDLFGRGVPNVVANQFPVGDNAAVAFARTIYEY
FT                   LAHGKTIAQSVREARISANYEKDGQSMDWAIPVAYARDPEDRLVVERKAAGGDGLG"
FT   gene            132272..135232
FT                   /locus_tag="SPOA0124"
FT   CDS_pept        132272..135232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:A82083"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97261"
FT                   /db_xref="GOA:Q5LLA2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA2"
FT                   /protein_id="AAV97261.1"
FT                   /translation="MRFRVFAVLSFAVLVALAGTGVPQAQSVSEAPYSISRFRLDDFST
FT                   PILHRNETASGSLEIFFVVPQFQVPEGKERQFLTEMVDNYWRGLAVVPGSGTAPVGIVS
FT                   SANSVVLSANNTTMESIKTHSELVWNVESFGDVQVLGEEVAAQDGVSLSLFYQAVPVRV
FT                   VHRSDTNADPSSITRASNAISLQYRVFDNTKLGALIGGFAGLLAAWVYFYLRTIRRIRD
FT                   RGRASLRLQELQTRLEKAELRAERLTDQPERQSTSIPPLDVPRPPVPPALLDALADKTA
FT                   MVAFGSGASAQAGLPTSHELILRLVDRFDTQISDRLRQNIQYATSANEEGVVEPDRFSA
FT                   IVEALSDQVSRPALIEAVQDIFADMRRNTGFYETLSRIGWSGALSLVWDDMADENFLAA
FT                   NPPFLRLNPEDTDEMRQAIKAGEKLLLRGWGGLTEASGENIVLTFEEFRKLLEERPEFG
FT                   RQLTLLLQTRTFLFLGLSPISLREYLTALNPYLEVTQGRHFALVPASYENELFVRPLEQ
FT                   YGIELLEYDPAGDHAQVKNFIDDLLQQARNLGQYRQPEEDRANPLAWQPLTRLELENIG
FT                   PFNTLEIDLPTGRIPNDTAEVHGEPWTIITGENGMGKTVILRAIALVLSASDPLVAARA
FT                   GSLLKLGKQSGRVTLSVGTRKIEVRLVRDRKVIVTSRQISPLAAGQFLVLGFPALRGAP
FT                   SGEPAGPRELDEQPPGPQDVYPLVLGSVDDRMLNLKQWIVNVLSAARGGDAKNRRLAET
FT                   LDSIVSQIMPGGVVGFAPLSEANVLKLSIRTPGDGGVEREVPFEQLSQGMSAIFNWVGV
FT                   LLQRLHDISGEDEDPSKVAATVIVDEIDVHLHPEWQRRVVTLVKDIFPNVQVIASTHSA
FT                   LIVSSVTADEVRIFRRIDDGEFQLVRPTRETYGRSATDLMQGEALGVQNARTVDFDEKV
FT                   VEYLDLRKLASRNPDQEDRYQDLRSELQDANWAGISEEPAPVVTAEDIQRLSQKYF"
FT   gene            135246..136139
FT                   /locus_tag="SPOA0125"
FT   CDS_pept        135246..136139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97262"
FT                   /db_xref="GOA:Q5LLA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA1"
FT                   /protein_id="AAV97262.1"
FT                   /translation="MHRLDPNYTSEALKKLIEIGQEKAKELIDAFEEDPASVEVGTFYT
FT                   KFKDDLIACQNGNCAYCEQLVSGHPGDVEHYRPKNRVTLDSGKVLTIKHPKHGEMNHPG
FT                   YFWRAYSWDNLFLSCGDCNKARYHSDQDGRTKFGKQDRFDILGKRAVDPCDDLNDELPL
FT                   LVHPVDGDPQKDLTLDGENLYQAHNDRGQYTIDLLGLNRRADLIERRSVALERGQLVVW
FT                   EFLDAVKNEKAKKQMEKAELLQKIIDGSIEFLSAYRLGLFGELKKLDDLGVDLKIGELV
FT                   QKVLKTGGDPSADAPR"
FT   gene            complement(136399..137124)
FT                   /locus_tag="SPOA0126"
FT   CDS_pept        complement(136399..137124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0126"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97263"
FT                   /db_xref="GOA:Q5LLA0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LLA0"
FT                   /protein_id="AAV97263.1"
FT                   /translation="MSKRTTLITGGNSGIGAAIGQALLERGEAVVSLGLEMPEDRHNDL
FT                   HGYTADLTDADATAEVALRICKDHQIDALVHNAGLILPNLLEDADPADVLTLAQLHLAA
FT                   PMALTQAALPGMVERGAGRVVFISSRSLQGMPTRSAYSATKAGINGLARTWALELAPKG
FT                   ITVNVIAPGPVLTDNFWAIVPKDGEQQQKIANGIPVRRIGTSDDIANAALFFLDDKAGF
FT                   VTGQVLFVCGGTSLAGLSG"
FT   gene            complement(137121..137912)
FT                   /locus_tag="SPOA0127"
FT   CDS_pept        complement(137121..137912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0127"
FT                   /product="cyclase family protein"
FT                   /note="identified by match to protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97264"
FT                   /db_xref="GOA:Q5LL99"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL99"
FT                   /protein_id="AAV97264.1"
FT                   /translation="MTQTPLAALSQALITGGVECIDLTNTLSPDFPVIVLPAEFGQCAP
FT                   FRMEKVSRYDDNGPAWYWNNISMNEHTGTHFDAPAHWVTGKDLPSNTVDAVPVQDFVAP
FT                   AVVIDISDEAAADEDFVVTRAFLEDWEARHGKIPDRHWIALRTDWYKRVGTPDYLNLKE
FT                   DGAHSPGPDGGAMDFLVHQRNCIGLAVETVGTDAGQAFHFDPPLPAHSILHGNGRYGLQ
FT                   CLTNLDKLPTFGALIVACPLKIEGGSGSPLRVIALVERAQA"
FT   gene            complement(137909..139147)
FT                   /locus_tag="SPOA0128"
FT   CDS_pept        complement(137909..139147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0128"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01796"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97265"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL98"
FT                   /protein_id="AAV97265.1"
FT                   /translation="MTDPLQRPRRKDPLRRTTLGHVPPRLRSRAAMEMATHAAQGRFVL
FT                   QTCESCDRATYPPRDRCPNCWGELVWREQDAGGQVAAETTIRHSTDTYFRNHMPWRIGT
FT                   VRLDAGPTAIVHLHGEAGVGDRVNMVLKLDRGGNPALFAMPRGDVPNMQDDPQFRSFTA
FT                   DPKHRRVLVTDGRTDTGQAIARALLDAGAAKVFVGDCAPLMRFAGKQQLAALDGAELVP
FT                   LDVTDTHSVGNLAAQLGGRIDIVINTAGQVREGGVAFGAKLSDLQAGLDTGVVGLMRLA
FT                   QAFGPALGARSDDGVNSAAAFLDVVPVSGLSGQSGYSGTAASAAARLSLLSGFRGEMQK
FT                   AGIRVMSVLTGPVDDAWHQRLPQPKTAPSHLARTVVAALRDGQEISCAGDVAKDLFARW
FT                   RADPLLTMREENR"
FT   gene            complement(139144..140319)
FT                   /locus_tag="SPOA0129"
FT   CDS_pept        complement(139144..140319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97266"
FT                   /db_xref="GOA:Q5LL97"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL97"
FT                   /protein_id="AAV97266.1"
FT                   /translation="MGMQARYDGVAVCAPITVPYVRFSPESAHWWTGAALRALGQKTGL
FT                   NAGDIDGFCFASFSSAPDTVVGMVQHLGLSPRWMDHIPTGGASGIMALRRAARAVQCGD
FT                   AEVVACVAADTNQIDSYRQTLAGFSRFSQDATYPYGFGGPNATFALITDNFMRQFGTTR
FT                   ETFGKLCVAQRENALSNPLALMKKPLTIEHYMNARPISDPVHLFDCVMPCAGAEAFLVT
FT                   TPDKAEQLGLSTARILSTIERHNAFADDTVQFRGGWERDQEALWDRAGCGPGDVQCVQV
FT                   YDDYPVIVAMQLADLGFCSKPGLNDFIAANEFTISGSLPLNTNGGQLSAGQAGAAGGFQ
FT                   NVTEGLRQILQCPLGEQVSDAHRALVSGFGLVNYDRGTCTGAAVLQREALR"
FT   gene            complement(140319..141938)
FT                   /locus_tag="SPOA0130"
FT   CDS_pept        complement(140319..141938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0130"
FT                   /product="AMP-binding enzyme family protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97267"
FT                   /db_xref="GOA:Q5LL96"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL96"
FT                   /protein_id="AAV97267.1"
FT                   /translation="MRRMNKTVFGRFTETAHRRGDAPFLHVLEETAVIYGIPAGDISYG
FT                   EMGARIADWADRLSLAGFGHGHRVGLLLQNRPVFLEIWLALNSLGASVVPINPDLRLAE
FT                   LEYMVAHSEMALAIVLPERHQEMSEAVANAGSEALVITSDTDIPPAPAPSTPTVDLGPE
FT                   TECALLYTSGTTGRPKGCILTNEYFLHSGDWYAETGGYISLRRDAERMLTPLPLFHMNA
FT                   MAVSVMAMITTGGCLTMLDRFHPRSWWEAVRKSGATVVHYLGVMPPMLMGAEPSEADRD
FT                   HDVRFGFGAGVDPKLHAAFEERYGFPLIEAWACTETGSGGVISAHEEPRKVGTSCFGRP
FT                   CDNVAVRVVDDSGQDVAPGQPGELLVRRAGDNPRYGFCAGYLKNPEATEELWKGGWLNT
FT                   GDVVLQDEDGSLHFVDRKKNVIRRSGENIAAVEVESILNRHPDIRISAAAAYSDDLRGD
FT                   EVAVFLILENGGGDEAKAVEIVTWALGQMAYYKVPGWIAFVEDLPLTATQKILRGKLKS
FT                   LLEDTAARSGFIDTRHLKKRQQ"
FT   gene            complement(141940..142413)
FT                   /locus_tag="SPOA0131"
FT   CDS_pept        complement(141940..142413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0131"
FT                   /product="aromatic 1,2-dioxygenase, beta subunit"
FT                   /note="identified by match to protein family HMM PF00866"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97268"
FT                   /db_xref="GOA:Q5LL95"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL95"
FT                   /protein_id="AAV97268.1"
FT                   /translation="MTPETLIDFVYDEAATLDEMRWEDWLALFHEDGRYWMPLEWQQQD
FT                   PILQPSLMYEDQLLLTVRVERLSGERTFSQKPKSRCHHLLQRPRVLSLGEGDGIFRLRT
FT                   SFIYTETRGDNLERYSGWVSHKLVEVDGALKIKLKRVDLINFDAPFGNLQLFI"
FT   gene            complement(142410..143750)
FT                   /locus_tag="SPOA0132"
FT   CDS_pept        complement(142410..143750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0132"
FT                   /product="aromatic 1,2-dioxygenase, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM PF00848"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97269"
FT                   /db_xref="GOA:Q5LL94"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL94"
FT                   /protein_id="AAV97269.1"
FT                   /translation="MDRYRGNAEAVKNLVRGHAVHRDVYVDKEVFDLEMEQLFPNSWVY
FT                   VGHESQLKDPGDYITSKIGHQPILISRHKNGTIHVLHNRCPHKGVKIASEPCGNTGKFF
FT                   RCPYHAWSFKTDGSLLAIPLKKGYEGTGFDNDRAKDGLPRVENVHIYRGFIFARLSDTG
FT                   LSFEDYFGDSLSTIDNMVDRSPKGEVEIIAAPIRYMHTCNWKMLVDNQTDTCHPMVAHE
FT                   SSAGTAVSVWEREKHRFTETPMAVQLYAPFMSPYEFYESAGIRVWPNGHGHSGVSGSIH
FT                   QDYDDVDGYLEMMVEAYGETRAREILGDIRHNTLYFPNVMVKGPVGILRNFIPVAVDRT
FT                   LVESWAFRLVGAPDKIYERALMYNRFINAPTSIVGHDDLEMYERAQEGLLSDANEWINL
FT                   RRLYEEGEPEDVTEVVNGTSERQMRNTFYAWRKFMVQGMEQKQEVSA"
FT   gene            complement(143773..144717)
FT                   /locus_tag="SPOA0133"
FT   CDS_pept        complement(143773..144717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0133"
FT                   /product="oxidoreductase FAD-binding domain/oxidoreductase
FT                   NAD-binding domain/2Fe-2S iron-sulfur cluster binding
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97270"
FT                   /db_xref="GOA:Q5LL93"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL93"
FT                   /protein_id="AAV97270.1"
FT                   /translation="MPSVAAEVIAVSSETRDIKRFILKPQDQGLCTWEAGAHLRVVVSD
FT                   GSTRAYSLLRLPDLSDDQIALGVLLEAKSAGGSKFMHALKPGDMVKVSDAANQFPLGGH
FT                   EEHAVLIAGGIGVTPILSMASDLVAADRSFEMHYAGRTEGALSFVPELKAICGDALHIH
FT                   YDDQPSAMNIQAILENTPTGSHVYFCGPSGMIEAVKRTAKELGWSDERIHFELFATAAD
FT                   ESQNTAFDIEVSDTGQIIHVPADKSIIEALEEAGLDPLYDCQRGDCGICQCDVIEGIPD
FT                   HRDVILSDAEKASNTVMQICVSRSKTPKLVLDL"
FT   gene            145949..146518
FT                   /locus_tag="SPOA0134"
FT   CDS_pept        145949..146518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0134"
FT                   /product="ISSpo7, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97271"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LM89"
FT                   /protein_id="AAV97271.1"
FT                   /translation="METLERQRGLRPDHGGPGHRKRRAQDDHDRRDLSQGTPHCVEPVR
FT                   EKGGRGRQIGRTKGGMNTKLHAVADAKGRPIGFFMSAGQVSDYTGAAALLGSLPKAGWL
FT                   LADRGYDADWFREALKDKGIKVCIPGRKSRKKAVKYDKRRYKRRNRIEIMFGRLKDWRR
FT                   VATRYDRCAETFFSAIMLAATVLFWL"
FT   gene            complement(147302..147376)
FT                   /locus_tag="SPOA_tRNA-Thr-1"
FT   tRNA            complement(147302..147376)
FT                   /locus_tag="SPOA_tRNA-Thr-1"
FT                   /product="tRNA-Thr"
FT   gene            147504..147659
FT                   /locus_tag="SPOA0136"
FT   CDS_pept        147504..147659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97272"
FT                   /db_xref="GOA:Q5LL91"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL91"
FT                   /protein_id="AAV97272.1"
FT                   /translation="MAEQKNPSKSKSAPADREDRLKAALKANLARRKAQAKARTAQDGA
FT                   DHNKKG"
FT   gene            147666..148931
FT                   /gene="murA"
FT                   /locus_tag="SPOA0137"
FT   CDS_pept        147666..148931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="SPOA0137"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="identified by similarity to SP:P28909; match to
FT                   protein family HMM PF00275; match to protein family HMM
FT                   TIGR01072"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97273"
FT                   /db_xref="GOA:Q5LL90"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LL90"
FT                   /protein_id="AAV97273.1"
FT                   /translation="MDSILVTGNGPLNGQIPIAGAKNACLTLMPATLLSDEPLTLTNAP
FT                   RLSDIKTMTLLLQSLGAEVSSLQDGKVLAMSSHDLTSHTADYDIVRKMRASNLVLGPML
FT                   ARLGQAVVSLPGGCAIGARPMDLHIEALEALGAEIELRDGYLHAKAPGGLKGAVHEMRF
FT                   ASVGATENMVMAATLAKGTTVLKNAAREPEIVDLVRCLRAMGAQIEGEGTSTIEIQGVD
FT                   RLHGATHQVVTDRIELGTYMLAPAICGGEVELLGGRLDLVGAFVEKLDAAGIDVAETDK
FT                   GLKVSRRNGRVSAVNVTTEPFPGFPTDLQAQMMALLCTAEGTSVLEEKIFENRFMHAPE
FT                   LTRMGARIEVHGGTATVRGVERLKGAPVMATDLRASVSLILAGLAAEGETLVSRVYHLD
FT                   RGYEHVVQKLEAVGARIERIKG"
FT   gene            148931..149407
FT                   /locus_tag="SPOA0138"
FT   CDS_pept        148931..149407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAK24320.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97274"
FT                   /db_xref="GOA:Q5LL89"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL89"
FT                   /protein_id="AAV97274.1"
FT                   /translation="MSDATFKDGREAPLNLGAEDGDDLKIISTLVQDAVFPITEMSWRP
FT                   GTRRFALLLNRFRWEDRTAAEQRGRGYERVQSLLVIDSVLGVASQGIDRSDTDTVLSLL
FT                   SVTFEPETDGAGQILLTLAGDGAIRLTVEALDVTLKDVTRPYLAPSRQAPHHSD"
FT   gene            149467..149946
FT                   /locus_tag="SPOA0139"
FT   CDS_pept        149467..149946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0139"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97275"
FT                   /db_xref="GOA:Q5LL88"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL88"
FT                   /protein_id="AAV97275.1"
FT                   /translation="MRRATLFDLFDMSRVLTRSISQLCTADHGGDAEAIARWCANKTPQ
FT                   ALRAQMMDEGAEFWLLTRAGQIAAVGALAEIDQTAGTGRVTLNYVDPACRGQGASAALL
FT                   AGLEARLSEQGIERGLLTSTATARDFYLSRGWRPDGPPRRGRWILGHPMAKTLAP"
FT   gene            complement(149971..151794)
FT                   /gene="glmS"
FT                   /locus_tag="SPOA0140"
FT   CDS_pept        complement(149971..151794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="SPOA0140"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by similarity to SP:Q56213; match to
FT                   protein family HMM PF00310; match to protein family HMM
FT                   PF01380; match to protein family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97276"
FT                   /db_xref="GOA:Q5LL87"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL87"
FT                   /protein_id="AAV97276.1"
FT                   /translation="MCGVVGVAGVGDAQKEILGMLTNLEYRGYDSSGMAVLSNGRLHVV
FT                   KRQGALSELKKELAKPSVPLHGSSGIGHTRWATHGAPSDINAHPHLSSDGKVAIVHNGI
FT                   IENYKPIKEQLLDDGYVFQSETDSEVIANLAAKLYQECGAGSYRQVLSRLQSRLVGAYA
FT                   VVIQFADAPDLIGGIRNECPLNYIQNDGQSAISSDLSSLVSYGRDVFCLKDKQCVILGN
FT                   EGVEVFDESGAESEAIAITINWSVEKARKDGYDTFLQKEIHEEPAAAQAFCREIRNHRA
FT                   ALDAYLKQHSFTKIVVVACGSASFSAIFAEALARQFELPVDVISEVGSEMRYNPPIISS
FT                   TTLVLAISQSGETADTIGAVKAAKQKGAQVVAFVNVAGSTLEFVSDLVLPLSAGPEISV
FT                   PSTKTVTNMFLAVYFFLDAMRQALSGARDESWFTSAEDFRAALAEMVGREREFRSIADR
FT                   ISGYQSCFAIGRGVDFSIAKETALKFKETSYLHCEAMNAGEFKHGSISLIEYGMPVLCI
FT                   LTDQAQRKKMVSNINEVRARGAQCIVISDLQPTEIEDAEAMTVITVPAVGPVWNTILTL
FT                   VVAHYISFLIGTLRGIDVDRPRNLAKSVTVE"
FT   gene            152200..152550
FT                   /locus_tag="SPOA0141"
FT   CDS_pept        152200..152550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0141"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:C95361"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97277"
FT                   /db_xref="GOA:Q5LL86"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL86"
FT                   /protein_id="AAV97277.1"
FT                   /translation="MHITKFAEGGQFEPRKIAAALRTSAEEVAMTVGLGKDALQRRARI
FT                   NSDKTQRRLRELVEVLNKVEPRFGSELMAYAWYRSEPLPGFDGRTAMQLVQEGKVQQVL
FT                   DYVDAVDAGVFA"
FT   gene            152550..153062
FT                   /locus_tag="SPOA0142"
FT   CDS_pept        152550..153062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0142"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB54840.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97278"
FT                   /db_xref="GOA:Q5LL85"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL85"
FT                   /protein_id="AAV97278.1"
FT                   /translation="MPLRHGRYRGPLYRALNPVYAREPLSGRGAERYGGRFNARGIPAL
FT                   YTALDPASALREANQVGSLQPTILVSYRADLGPVFDSRDTGELEQRGVSARMLADPGWR
FT                   QAMLDGREVPTQDFARGLVADGYVGLLVQSHAKGASDSDLNIVLWRWAGDGCTLGVIDE
FT                   ENRLGRM"
FT   gene            complement(153574..154419)
FT                   /locus_tag="SPOA0143"
FT   CDS_pept        complement(153574..154419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0143"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97279"
FT                   /db_xref="GOA:Q5LL84"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL84"
FT                   /protein_id="AAV97279.1"
FT                   /translation="MATEKRKRGRPKSFADKSEQNTNQSLDRAIDILECLASARGLALS
FT                   EVAERLDLAPATVYRALHTFESRRLTEIDPETQTWHIGPDLFRLGSAFLLRSSLVERAR
FT                   PVLRKLMEVTGETANIGIERDGEILFLSQVETQSNIRAFFQPGTRAPLHASGIGKALLS
FT                   QYDRARIDRLLPEMRLEQFTMKTRFDKEQLLSELDLIHRRGWALDDEERTHGMRCVAAP
FT                   ITDFTGEAIGGISVSGPSDRMPDARLTEIGNIVRDAALDLSRRLGAPLSVSIRPSTDEA
FT                   "
FT   gene            154606..155796
FT                   /locus_tag="SPOA0144"
FT   CDS_pept        154606..155796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0144"
FT                   /product="serine--glyoxylate transaminase, putative"
FT                   /note="identified by similarity to SP:O08374; match to
FT                   protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97280"
FT                   /db_xref="GOA:Q5LL83"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL83"
FT                   /protein_id="AAV97280.1"
FT                   /translation="MSFQNPVFIPGPTNIPESLRKACDMPTIDHRSPLFGQILHPARAG
FT                   VRAVLKSETAEIFIFPSTGTGGWETALTNTLSAGDGVLAARNGMFSHRWIDMCQRHGLA
FT                   VEVVETPWGEGLPADRYEEILAADTHHRIKAVLATHNETATGVRSDIAAVRRALDKAGH
FT                   PALLFVDGVSSIGSMDFRFDEWRVDVAVTGSQKGFMLPAGLAIVGFSAKAMEATATGTL
FT                   PRTFFDVHDMARGYANNAYPYTPAVGLMNGLNQACRMLLDEGLENVFARHHRIAEGVRA
FT                   AVHAWGLELCAASPDLYSDTVSAIRTPEGFNATDIVTHAASKYGVAFGVGLGEVAGKVF
FT                   RIGHLGSLTDVMTLSGIATAEMCMADLGLDIGLGSGVAAAQEYFRSHSATSLLAAA"
FT   gene            155809..156762
FT                   /locus_tag="SPOA0145"
FT   CDS_pept        155809..156762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0145"
FT                   /product="pyridoxal-phosphate dependent enzyme"
FT                   /note="identified by match to protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97281"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL82"
FT                   /protein_id="AAV97281.1"
FT                   /translation="MYIPTFEDMLAAHARIEPHIRRTPVRVSDYLNELTGAQLFFKCEN
FT                   FQEPGAFKIRGATNAVFGLDDAQAAKGVATHSSGNHASCLSYAAMLRGIPCNVVMPSTA
FT                   PQAKKDTVRRYGGVITECAPSTSAREETFARVQAQTGGDFVHPYNDPRVIAGQGTCARE
FT                   LMEQTDGLDIVVAPIGGGGMISGTCLTLSTLAPETRVIAAEPEQADDAYRSFKAGHIIA
FT                   DDAPKTIADGLLVPLKDLTWHFVSNHVAEIYTASEQEIIEAMKLTWKHLRVVMEPSSAV
FT                   PLATILKNRKAFAGKRVGVIITGGNVDLDKLPWMNG"
FT   gene            156768..157931
FT                   /locus_tag="SPOA0146"
FT   CDS_pept        156768..157931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0146"
FT                   /product="threonine aldolase, low-specificity"
FT                   /EC_number="4.1.2.5"
FT                   /note="identified by similarity to GB:BAA31547.1; match to
FT                   protein family HMM PF01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97282"
FT                   /db_xref="GOA:Q5LL81"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL81"
FT                   /protein_id="AAV97282.1"
FT                   /translation="MKDMTNLDNFEVGFDIPAKPGMDAAEIQTPCLVLDLDALERNVKK
FT                   MGDYAKAHGMRHRVHGKMHKSVDVAKLQERLGGAVGVCCQKVSEAEVFVRGGIKDVLVS
FT                   NQVRDPLKIDRLAQLPKLGSRIIVCVDDLANVADLSAAALRHGTELEVLIEIDCGAGRC
FT                   GVGTTQDVVAIARAVDAAENLKFTGIQAYQGAMQHLDKYEDRKAKLDIAIEMVESAVQG
FT                   LKAVGLDPELVSGGGTGSYYFEANSGVYNELQCGSYAFMDADYGRILDQNGQRIDKGEW
FT                   ENAMFILTQVMSHAKADKAIVDAGLKAQSVDSGLPFVHGRDDVEYIKCSDEHGVVADPN
FT                   GVLKVGDKLRLVPGHCDPTANVHDWYVGVRGGKVECVWPVSARGKAY"
FT   gene            158076..158954
FT                   /locus_tag="SPOA0147"
FT   CDS_pept        158076..158954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0147"
FT                   /product="ornithine cyclodeaminase/mu-crystallin family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02423"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97283"
FT                   /db_xref="GOA:Q5LL80"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL80"
FT                   /protein_id="AAV97283.1"
FT                   /translation="MAAGTARNFPVIREAIGHADALYGFKSGFDRQALNLGLKSGGYWP
FT                   GNADKGLTNHQSTVFLFDADTGRCQAVVGGNLLTALRTAAASSVSIKHLARQDAKVIGM
FT                   IGAGHQAKFQLRAALEQRNFEKVIGWNLHPEMLVNLQEVADEAGLPFEAVELDGMREAD
FT                   VIITITSSFDAILKADQVSPGTHIACMGTDTKGKQEVDPQLLVMADVFTDEVAQSISIG
FT                   EAQHAVAHGLIQAADVAQIGAVINGTNPGRTSDAQITLFDGTGVGLQDLAVAATVVERA
FT                   RAAGAGTEIAF"
FT   gene            complement(159056..160213)
FT                   /locus_tag="SPOA0148"
FT   CDS_pept        complement(159056..160213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0148"
FT                   /product="membrane protein, major facilitator transporter
FT                   family"
FT                   /note="identified by similarity to SP:P43531"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97284"
FT                   /db_xref="GOA:Q5LL79"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL79"
FT                   /protein_id="AAV97284.1"
FT                   /translation="MRDHVSRAILASALFAATYAVNLQAPLYAVYAGNSGVGAAAVTVA
FT                   FAAYVAGLMPTLILLGGLSDRIGRRLPIALALCLGAAGTALLAVVPTWPSLVLARLLLG
FT                   VSTGLATTAGTAYMAELFGADRTRQATLLVTSATSLGFGGGALATGLCLSLGGPSVMPA
FT                   SFVALFVAAPLLALAVLGLPRADTPHPVALLRLPVFPAGSWQFGAALALAWSATGMTIA
FT                   VVPLQLAAQGLGAYTGMVIFLAIFVGFLSQPLARRLGNRVALSVGFVLVPTGFVTLLLG
FT                   VWTQSIGLVLAGTAITSAASYGFTYLASLAEFALRAPDNRARAAAGLFVYAYVGFSLPT
FT                   IGSGALADRFGLLPAMTVFAALLVTLTWAVAWRGAKVAELRQPAQ"
FT   gene            160318..161634
FT                   /locus_tag="SPOA0149"
FT   CDS_pept        160318..161634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0149"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97285"
FT                   /db_xref="GOA:Q5LL78"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL78"
FT                   /protein_id="AAV97285.1"
FT                   /translation="MKYSKLVETLAARIKAGEIRPGTRLKTHRAFAEEHGVALATATRV
FT                   YNTLKQRGLIVGEGGRGMFVRQPEVPPTLGIEQPEEAPGIDLVFNMPGDPGDGEVLRAG
FT                   LRGLAGRGDLNALLRYQPHGGVLAERRVIANYLSPRLGKIEPERLFITSGAQHGLSVVA
FT                   FGLLKRGDGIATDPLTYPGFRAVVGLRDLELHPVPGQLGSMDPLALLRVCAKTRLRALY
FT                   LMPSVHNPLGTVMDEYSRRAIVAIARHHDLLIFEDGAYDFLETDPPPSFLELAPERTVY
FT                   IGGVSKVLATGLRLGYVVVPPDLAGALSMAIRATTWNTPALITALVTQWIEDGTIGHFE
FT                   QTRRAAGARAQAICRACLGHHDFSAHRNAGFAWVPLPGRLRAEEVVARLANRGIAVSTA
FT                   KPYAVGPTTPNALRLAFGGLNDALLRSSLTTISTVLDMA"
FT   gene            complement(161659..162696)
FT                   /locus_tag="SPOA0150"
FT   CDS_pept        complement(161659..162696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0150"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97286"
FT                   /db_xref="GOA:Q5LL77"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL77"
FT                   /protein_id="AAV97286.1"
FT                   /translation="MNRATLSMQNTHAPVTPCGWLVAALLEAGVPLAEIEAWLGQRLPP
FT                   DHRDRTVLPSEQYFRLFEWGAGVTANPDLGIQIAAHLTSRDFGLLGYLLENSDSLGTWL
FT                   HHLTTYNAVFSQDAEISVMRAQGSVVVGYSPVPVAGFTPLQDIWSSIGMIVHAIRVATR
FT                   CDWYPARCRFSTPCPADTSALEALLGPELHFDHKTNQIELPVRDLDLAIPGADPVLLEI
FT                   LKRQADGIVATLRQQEEIVSRLRLMITAHLAEGGFDTVRAARALNMSVRKLHRTLAERG
FT                   TSFRNLRNEVLGETARAHLADPGIQITEIAHRLGFSETSAFTRAFKALEGMTPRDFRAR
FT                   SLGKT"
FT   gene            162796..163413
FT                   /locus_tag="SPOA0151"
FT   CDS_pept        162796..163413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0151"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97287"
FT                   /db_xref="GOA:Q5LL76"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL76"
FT                   /protein_id="AAV97287.1"
FT                   /translation="MIFRAFSVLVLPVALLAASAADADGAALYAESCAGCHGETGQGNG
FT                   ELRAPALAALDAGYLIRQVGHFRSGVRQVNPDNDMAVAMVELLPDVSEADTAEIASYLA
FT                   SLPLPVLEDDNDPPGFRSRGLYSGCISCHGARAQGIEALNAPRLARQYGWYLAEQLDAF
FT                   RVGRRGAHPEDDPGRQMKAMADAIGSEADIAALVSYIATLDP"
FT   gene            163457..164533
FT                   /locus_tag="SPOA0152"
FT   CDS_pept        163457..164533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0152"
FT                   /product="di-heme cytochrome c peroxidase family protein"
FT                   /note="identified by match to protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97288"
FT                   /db_xref="GOA:Q5LL75"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL75"
FT                   /protein_id="AAV97288.1"
FT                   /translation="MADEITLAETCPPSFQLLADGTCELVTLYQFYDSPPQHGGLRARL
FT                   DPPANRYTPQQIDLGRYLFFDPILSSGGDLSCASCHDPAQGLSDGRKRGLGVTELNRST
FT                   PSLWNVGFASSLMWDGRAETLEQQALLPLFNPAEMAANADGIETALNAAPGYVSLFQTA
FT                   FGKSPSLETTAIALAAFQSSLISLNSRYDRYAHGDATALNPQEIRGMNAFRGFVARCSQ
FT                   CHIPPLFTDFELAVVGAPADERGFADPGAGALAADPARLGAFKTPTLRNITRTAPYFHA
FT                   GQFDTLKGVVDFYNNTAGHAAPEGQDLRIHWHVHMTDGPKLSAGTVADIVAFLGALEDE
FT                   SLMPRRPDTLPSGLLPQD"
FT   gene            164552..165628
FT                   /locus_tag="SPOA0153"
FT   CDS_pept        164552..165628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0153"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97289"
FT                   /db_xref="GOA:Q5LL74"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL74"
FT                   /protein_id="AAV97289.1"
FT                   /translation="MTGYGKTFALLGTCATLLGPPLSAQTGSVLSDLQNEEVQARYRAA
FT                   AAERIACPRIEGDAALMAAFAKDAASKWDRAAMGCATEYGARAMEALSLPTNLIWAVAT
FT                   FRTDNIETHLQVLGAHLDYFEVLDKSYSAHYQGIEMATELGLRWEQARERSETLMTRID
FT                   PLVPKLTEARLLRAAYLLASTLRETPPEVQNTAVAAALEDLQIAIAENPEALDGLGPLL
FT                   LGQVLAVLPEFLGGDILAAIDLLEQAHALNPTDLSVHHTLVEAYLGERETDKALALLRH
FT                   AASIDPSTENPQDYADEMKYLGGLALRAGAPDLARQMAGHRSAILAAHPQLDPRKEMAA
FT                   LGHGGADPLTGKKPDDLN"
FT   gene            165646..167022
FT                   /locus_tag="SPOA0154"
FT   CDS_pept        165646..167022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97290"
FT                   /db_xref="GOA:Q5LL73"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR022442"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL73"
FT                   /protein_id="AAV97290.1"
FT                   /translation="MKNTGILRGAVIASLLGSTAMAAELTVPSGGDIQAIVDLAAPGDT
FT                   ILVEPGAYHQSVYVDKPHITLRGLRKGDAWALLDGEMKLNDGIIASGHSIVIDGFKVTG
FT                   YKGNGIMTQGANNFEISNNYVEGAFYGIFPQFGRNGLVVGNTVTGAEDAGIYVGMSDNV
FT                   DVIDNVAFGNVMGIEFENTRNALMAGNHVYDNAAGITLTLVPGLPVKDAHSQVIRDNRI
FT                   IGNNHENFAPASSIAAGVPSGTGILVVGPDNITIVDNEIADNDNVGVFVADLITFGMDS
FT                   DPKLDPYSDGVRVLGNTWRNNGENMNGMLADMLTATGRTGIEVLAMGKGRDSCVLPADG
FT                   VDTLGTNRWQDCADENSAALVTARIEGGADEPVYTREQKGRLTYLAVCTGCHAYDSVLH
FT                   GPSVQSIQALYDGDPSGMVNYISNPVRKRDGFPEMPPQTYLGEETLDAIARYILEELGQ
FT                   "
FT   gene            complement(167176..171612)
FT                   /locus_tag="SPOA0155"
FT   CDS_pept        complement(167176..171612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0155"
FT                   /product="type I secretion target repeat protein"
FT                   /note="identified by match to protein family HMM PF00092;
FT                   match to protein family HMM PF00353"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97291"
FT                   /db_xref="GOA:Q5LL72"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL72"
FT                   /protein_id="AAV97291.1"
FT                   /translation="MTIETVLSHTTFTGYTAAQRTILENALRDMYANSATGKILLDKVT
FT                   AALPLDIKFVAGEAQAFRGTGRVELDFAAVANLAYFDANGKGVAVEIEHVLRHELVHAL
FT                   QGIGDSPRGTTSTDSAKGPTLVFEKAINDEMSKSNRLSYEGVDSDTAIIPGTDYTGGAA
FT                   IDLALARSGNEDTSGNNPATNDLLWGRGNGSNYFKSGNGTDYLYGNGGNDVLEGGGGND
FT                   SVNGGTGTDRAVFSGNCSDYTITSNANGTITIADNRANSPDGTDTLKDVEYARFADGEM
FT                   NLTTGEFACPGQNVVIVIDKTGSMSNDIAAAKAAAIEIANALFGTTEKPVASTLAIVTY
FT                   WDSNTVTNLSFTKHDSVADRKAAALAALNNLSTSTSGMTENLNTALLHAINGNAGTWDT
FT                   RNKSNKIIVFTDEDADDPHLRAEVVSKALAADIAVPPPPVGNAVPLQSAIEQVQGTNFV
FT                   DYTDTPFSDPYGAAPLQILPVVIGNSSTANSDLESLADQTNGQVFNASTSDPSQAAQNV
FT                   IAAINASSGTDGDDSLTGDDNPNSIGGLAGNDTISGAGGNDTLSGGPGDDVLNGGAGDD
FT                   SLRGNAGYDTVDGGADTDTVVVNANSTDVNIIGSSDPITIQSPDGDVVISNVEFVRFLD
FT                   RTMAVSTLATLTTVNTFGGRGDDSMDGDANGNRLWGREGNDTVNGNGGNDTLNGGLGND
FT                   AVNGGEGADQLSGGGGNDTLDGGDGTDTAVFDLTSASASVDGPDDALRVDTGQGIVTLR
FT                   NIEFVRFTDRTFNLTDLQALRDQTLIGTPGNDTLRGSYGNDTILGLDGDDELDGGLDND
FT                   VLNSGEGQDTLLGGPGDDLLRVTQTIAPTVVDNTVSNPVSNPMTLPENWSLDAFGDVAD
FT                   PTTVPHQTLAITGSDETQEAFRFTATAGQIWTFDIDGADFDTVLALYDNNGTQITSNDD
FT                   SSTSNGAGGSTSGRDSFIQHTFAADGTYIIALQRYGGGTISSTQMATLNISATGVTVPP
FT                   VTTTDANLLDGGADNDTLEGGGGDDTLIGGLGDDSMTGGAGSDTAILATSQQFVSGQNV
FT                   TGGVQLTSSQGVDFLGSDIEFVQFNDGTLTLAQAAALAGTVPSAINGTNAGEAVDGTTA
FT                   TEIINGLEGADWISPGGGSDTVDGGPGNDMLSFFNLPDTPGRTNLDYRLTIDMGAGTAV
FT                   SHDGAERIQFANIERLTGTIFADHITGSSSDDYIRGLGDYDWIVATEGADTIDGGNGQD
FT                   MISFLEWQNTDPNTISDAFTPNGAPPTGAQATGVLVNLANPTQNTNLASGLTLVSVERV
FT                   TGSARQDVFYGDDGQNDFRGLGDFDWFVSSDGGRERYYGGDGVDTVTYFNAPGAVTANL
FT                   RNGAVVNGNESGYGTQGWAARDLYFEIENLVGSNFGDHLTGSADRNQLSGLDGDDFLFG
FT                   FGNIDYLKGGAGNDTIDGGGSSDYALFDGDLVDYTLTRTAENRVTVVGPDGNDSLIDVE
FT                   YFRFDDQDVRIWDLPLV"
FT   gene            complement(171697..172530)
FT                   /locus_tag="SPOA0156"
FT   CDS_pept        complement(171697..172530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0156"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97292"
FT                   /db_xref="GOA:Q5LL71"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL71"
FT                   /protein_id="AAV97292.1"
FT                   /translation="MAGEAKGMIGPRLLSGLVLVLGFLGTELVAKGECNEDGGWKMTVS
FT                   AASGDILNSVSNQREADENTLALAGQHRDLLEAALTAAGQRGASADIFVVTAPAFTDAT
FT                   AGPVSWPPAGAQLASPWLTMSRTGTGRLTLTLFVSDLRVIADGALQARGAAPADYRTGP
FT                   GWRSMTFSCLAQAAESYVSHVSASQPPESWVAGQECVPPTFAGPMAWLFRSAPQNFFAP
FT                   FDMTVMKRIEAARGSSTAFYEALYRALIRHGVALLASEAGSGDAWWHDALREVTE"
FT   gene            complement(172937..173923)
FT                   /gene="cuyZ"
FT                   /locus_tag="SPOA0157"
FT   CDS_pept        complement(172937..173923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cuyZ"
FT                   /locus_tag="SPOA0157"
FT                   /product="presumed sulfite exporter, CuyZ"
FT                   /note="inducibly transcribed; Denger et al., Biochem J.
FT                   (2006) 394:657-664"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97293"
FT                   /db_xref="GOA:Q5LL70"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL70"
FT                   /protein_id="AAV97293.1"
FT                   /translation="MVSALKSRWDTHFGGILLVCVVAAAATFLSEHYGAPAMLFALLIG
FT                   MAFHFLHRDAAFAPGLDFSAKTLLRFGVGLLGLRLSIGDVESIGYGAVGAVGGFVLATL
FT                   ACGAMLSYLFGRRMAFGLLAGGSVAICGASAALAIASVLPARADREQDTLFVVIGVTAL
FT                   STIAMIAYPILFASLGMSDLQSGFLIGATIHDVAQVVGAGYSISDEAGVIATFVKMVRV
FT                   ALLPVVMLVVMFSFRGAQSQRVTLPWFLVMFIVLAVLANAGVVPQVVIDAIGTLSRWCL
FT                   VIAISALGVKTSLATIAHVKPSYGVILVVETLFLLAIAIGFVLLGGV"
FT   gene            complement(173964..174983)
FT                   /gene="cuyA"
FT                   /locus_tag="SPOA0158"
FT   CDS_pept        complement(173964..174983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cuyA"
FT                   /locus_tag="SPOA0158"
FT                   /product="L-cysteate sulfo-lyase, CuyA"
FT                   /note="catalyzes the formation of pyruvate, sulfite and
FT                   ammonium ion from cysteate; Denger et al., Biochem. J.
FT                   (2006) 394:657-664"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97294"
FT                   /db_xref="GOA:Q5LL69"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LL69"
FT                   /protein_id="AAV97294.1"
FT                   /translation="MHLARYPRRFIAHLPTPLERLDRLTAELGGPEIWIKRDDCTGLST
FT                   GGNKTRKLEFLMAEAELQGADMVMTQGATQSNHARQTAAFAAKLGMDCHILLEDRTGSN
FT                   NANYNNNGNVLLDHLHGATTEKRPGSGLDMNAEMEKVAEKFRADGRKVYTIPGGGSNPT
FT                   GALGYVNCAFEMLNQFNERGLKVDHIVHATGSAGTQAGLITGLQAMNAQIPLLGIGVRA
FT                   PKPKQEENVYNLACATAEKLGCPGVVAREDVVANTDYVGEGYGIPTESGLEAIRMFAEL
FT                   EAILLDPVYSAKGAAGFIDLIRKGHFKKGERVVFLHTGGAVALFGYDNAFDYSGRWVA"
FT   gene            175095..175997
FT                   /gene="cuyR"
FT                   /locus_tag="SPOA0159"
FT   CDS_pept        175095..175997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cuyR"
FT                   /locus_tag="SPOA0159"
FT                   /product="CuyR"
FT                   /note="transcriptional regulator, LysR family, presumably
FT                   for cysteate degradation; identified by match to protein
FT                   family HMM PF00126; match to protein family HMM PF03466;
FT                   Denger et al. Biochem. J. (2006) 394:657-664"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97295"
FT                   /db_xref="GOA:Q5LL68"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL68"
FT                   /protein_id="AAV97295.1"
FT                   /translation="MQLDWIDDILAVIDTGSLAAAAERRLLTQPAFTRRVRGIEERIGA
FT                   ALFDRSRKPVAVLPGVLALEPDLRELSGRLRRLQQDLRVSAEDARRGVTLVCQHAITTT
FT                   ISPRIVRDLTASQDISVRVRSGNRDECLMLLLSGEADFAVAYEVPGERDPMLPQAFDRA
FT                   ELETDLLVPVHAPGLEAAGARTAMPVIGYPPDVFLGQVFDRFVAPRLPAGFTYEVRAET
FT                   ALTLAACEYALGGIGVAWLPLTLVAPHLAAGRLCRADGLPEQPLTVTLMRLSGASARRG
FT                   DRSWLMLCGQPGVSSGPKD"
FT   gene            complement(176064..177386)
FT                   /locus_tag="SPOA0160"
FT   CDS_pept        complement(176064..177386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0160"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="identified by match to protein family HMM PF06808;
FT                   match to protein family HMM TIGR00786"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97296"
FT                   /db_xref="GOA:Q5LL67"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL67"
FT                   /protein_id="AAV97296.1"
FT                   /translation="MESSFVLLFMFTSLVAFMLSGAGLAFVLGAIAFISTILLWGPAAL
FT                   IVAVLNTFETMTSEALMAIPLYVLMASILQKSAIIDALYDAMETWFSRLNGGLAVGTIA
FT                   ICTILAAMTGVVGAAVAAMGILALPSMLSRGYHPPLALGAICAGGTLGILIPPSVVTIV
FT                   YAITAQISIGQMFAAGIVPGLMLAGSYMAYVLVRTWFNPALAPKPVHLKPIPLAVKLGK
FT                   LKSLILPALVVIGVLGSIYAGIATPTEAAAVGVLGAMLSALVTGKLRLSVLSDAATDTL
FT                   RVTAMILWITIGARAFISVFVATGGADSILTFVETLEASRWVVLGAMVLILIFLGLFLD
FT                   EIGIILLCVPVFLPIVDTLGFDPLWFGVLFMITAQMAYITPPFGYTLFYLKGVLPEGIG
FT                   IGQVYRGVIPFFLIQVAILILFALFPALVTWLPELLTQNAR"
FT   gene            complement(177386..177877)
FT                   /locus_tag="SPOA0161"
FT   CDS_pept        complement(177386..177877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0161"
FT                   /product="TRAP dicarboxylate transporter, DctQ subunit"
FT                   /note="identified by match to protein family HMM PF04290"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97297"
FT                   /db_xref="GOA:Q5LL66"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL66"
FT                   /protein_id="AAV97297.1"
FT                   /translation="MTSLARRITALNHNLFMCARWLVFIIALMMLWEVLSRYFLEHPTS
FT                   WAPEFATLIFGPFFLLGGPYLLHLGGHVAVDVLSARAQGRLATGLRLAGLVLAAAFGII
FT                   LLWFSLPLVLQSYQYGETSYSAWNPVLWPAKAFLPLSALLLVLQAIADAIDIFAEEIHA
FT                   "
FT   gene            complement(177943..178977)
FT                   /locus_tag="SPOA0162"
FT   CDS_pept        complement(177943..178977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0162"
FT                   /product="TRAP dicarboxylate family transporter, DctP
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF03480;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97298"
FT                   /db_xref="GOA:Q5LL65"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL65"
FT                   /protein_id="AAV97298.1"
FT                   /translation="MTNLNRRNALQLGAVALAAPAILTGGAARAQGVTQWRMQALWGGG
FT                   TTPMLYEEKFCARVLELTGGTLEITPFSGGQIVPPAQAFDAVRGGAFQMMKTFDGYTAG
FT                   KIPAHGFSSTVPFGFPEPDQYEAWFYERGGLDLARESYAAAGLTYVAPTVYGEEPIHSK
FT                   VEIREIADLKGLKGRFVGLASAVMADFGVAVSPLPTSEVYSALDKGLIDVADRGDIKAN
FT                   YEEGIHEVAKYLILPGVHQPTTATSYIANTGAYEALDNQQKAALAVAAREVSGALRQDI
FT                   LVSNGEYLRKFADAGVEIIDFDPADVVQGRERAVESWAKAATDDLSKRMMESQMALMQE
FT                   LRLL"
FT   gene            complement(179002..180303)
FT                   /gene="mvaA"
FT                   /locus_tag="SPOA0163"
FT   CDS_pept        complement(179002..180303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaA"
FT                   /locus_tag="SPOA0163"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number="1.1.1.88"
FT                   /note="identified by similarity to SP:P13702; match to
FT                   protein family HMM PF00368; match to protein family HMM
FT                   TIGR00532"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97299"
FT                   /db_xref="GOA:Q5LL64"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL64"
FT                   /protein_id="AAV97299.1"
FT                   /translation="MTGKTGHIDGLNSRIEKMRDLDPAQRLVRVAEAAGLEPEAISALA
FT                   GNGALPLSLANGMIENVIGKFELPLGVATNFTVNGRDYLIPMAVEEPSVVAAASYMARI
FT                   ARENGGFTAHGTAPLMRAQIQVVGLGDPEGARQRLLAHKAAFMEAADAVDPVLVGLGGG
FT                   CRDIEVHVFRDTPVGAMVVLHLIVDVRDAMGANTVNTMAERLAPEVERIAGGTVRLRIL
FT                   SNLADLRLVRARVELAPETLTTQGYDGADVARGMVEACALAIVDPYRAATHNKGIMNGI
FT                   DPVVVATGNDWRAIEAGAHAYAARTGHYTSLTRWELANDGRLVGTIELPLALGLVGGAT
FT                   KTHPTARAALALMQVETATELAQVTAAVGLAQNMAAIRALATEGIQRGHMTLHARNIAI
FT                   MAGATGADIDRVTRVIVEAGDVSVARAKQVLENT"
FT   gene            180424..181809
FT                   /locus_tag="SPOA0164"
FT   CDS_pept        180424..181809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0164"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97300"
FT                   /db_xref="GOA:Q5LL63"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL63"
FT                   /protein_id="AAV97300.1"
FT                   /translation="MKKIDRVIESIQSRITEGRLKPGQKLPSIRQAVDEFGVSKNTVIE
FT                   AYERLSARGLIRSVHGAGFFVCASTPAPLSKATQPAHIVEAVDRLTLLTAQLDQEKLPV
FT                   RVGDGRPPQSWMNDALPLRMKGNIFKNFVGDPSGYGGVSGHLQLRELIAARSNRADMSV
FT                   HPDQIVTTFGANHALDLIIRRYLEPGDVVLVDDPGYYPLLGKFKLAKIRAIGVPRTPTG
FT                   PDLDVMETLAAAHGPKMFFTQSTCQNPTGSSMSLPVAHGVLQVAQRFGLMVIDNDPFTD
FT                   LPGNAGVPLSALDAFNSVIAISSFSKLLSASFRVGYVIARPEVARELTELKLLTVVNSS
FT                   RFSEMVIAELIKSQRYGRHLNKLVNRLEEARRDYHRKVRKLGLDVFCAQETGYYSFLQL
FT                   PHTVDEGQLVRKASAAGIMLAPGRLFAVDENPARPALRINVTRADDPRFYRFLKRQVID
FT                   GQV"
FT   gene            complement(181865..182800)
FT                   /locus_tag="SPOA0165"
FT   CDS_pept        complement(181865..182800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0165"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97301"
FT                   /db_xref="GOA:Q5LL62"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL62"
FT                   /protein_id="AAV97301.1"
FT                   /translation="MNLQQLAVFREVMETGSVSAAARNLGRTQPAVSASLKALEVNLGI
FT                   ALFEREGRRLVPVPEAHYLLSEAAEILARVNTTEMNLVGMRNRTRGSLSVVGMPGPSVY
FT                   LLPDFVSRFGSKADDLKISLSTRSSPQILNLIAAQAFDVGFCDLGFCDMSAEDLNSSLY
FT                   HTKTIMSDCLCALPAQHPLAGRAVIDARQLSGERMGVLAGTHSTNRDTRAAFEQAGAVF
FT                   NPRVEAQYFIPLLRFVEAGQICTVLDPLSAETYKRMNGGEVGIWFARFLPSVRFGYSIV
FT                   TPKQRPLSLLAQDFVDGWSDHVREIIADHS"
FT   gene            182941..183951
FT                   /locus_tag="SPOA0166"
FT   CDS_pept        182941..183951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0166"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="identified by similarity to SP:P12920; match to
FT                   protein family HMM TIGR02122"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97302"
FT                   /db_xref="GOA:Q5LL61"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL61"
FT                   /protein_id="AAV97302.1"
FT                   /translation="MGLQKYFIGAALATLVSAGSVAAQDPTFFRIGTGSAGGTYFPIGG
FT                   TIANGISAPPGSRPCEEGGQCGVPGLIAIAQSTTASVYNNTAVQNGELEAGLAAADVTR
FT                   DMYLGEGKFEGKIHEKLRVIANLYPEDLHLVLPKGVTINNLGDLKGKRVGIGQAGSGTQ
FT                   VAVLQMLENWGVTRDNIEEAELNLAQSSERLADGQLDAYFYAAGWPVAAVVQLASTKGL
FT                   ELHSFTEEDMKVINDIIPAYIPSKIPAGVYEGLDYVVNTPAVSALLVVSSDLSEELVYG
FT                   ITKAMWNDNTRNLLDNGHAKGKLITLETALGGMDNLGVPLHPGAERFYREAGLLK"
FT   gene            184036..186249
FT                   /locus_tag="SPOA0167"
FT   CDS_pept        184036..186249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0167"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="identified by match to protein family HMM PF06808;
FT                   match to protein family HMM TIGR02123"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97303"
FT                   /db_xref="GOA:Q5LL60"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL60"
FT                   /protein_id="AAV97303.1"
FT                   /translation="MTDATSQKTDTLTAEELAAIEEKYDESAATRPVSPGFARFLKVVA
FT                   LSFATYHYLTAGFALPTDHWHMGWHLSGLFILTYALFPAIRTRGTYDLKTGLMHYGGVP
FT                   YLDILLMGLGVASALYLGFAWRGVPWLGIEEQTFRMGNPNGYDMLFGSILIVLVLDIAR
FT                   RTLGWVLPAIICVFMAYALFGPVFPGILQHPGVKIRTFVSSMYFPQEGIFGVTLWVVST
FT                   IVFHFVLFGVIAQRTGLGQLFIDNATILAGRYTGGPAKVSVVSSAFFGTISGSSVANTV
FT                   STGALTIPNMKRLGYPGHFAGGVEAAASAGGQITPPIMGAAAFIMAEFLEVPYTTIVIA
FT                   AIFPALLHYVGVFSVVHLMARRLNLQGLSKEMLPRLGAVWREGWANMVPLVGLLVVLFS
FT                   GYTPYMSAFCGISLAIVTGMARRSAPVTLAYPAAFIAFVVWKCTGGGFDLPMSALLVAL
FT                   TLLGSLNPQERIRLPQMAETFETGVKYALAVGAAAAAVGIVVGVINTTGVGFRVGFMVT
FT                   QSAGELGASLHSLLSFGRFELFSVTDITLFISLIFIAVACILMGAGIPTTALYIMLVSV
FT                   AQPALAQLGVPPIASHMFVLYYGVVAEITPPVCTSAYAAAAIANSNPFRTGISAFTLGL
FT                   GKIVAPMAFVYAPVLLIVSQTGFDLWTFSYTATSCILGVICLSVAVVGYWLAPMGALFR
FT                   VLLAMAGLVFIAPSLQADLIAALIAAPAVLSQIVLRRRTTEAG"
FT   gene            186254..187519
FT                   /locus_tag="SPOA0168"
FT   CDS_pept        186254..187519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0168"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97304"
FT                   /db_xref="GOA:Q5LL59"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL59"
FT                   /protein_id="AAV97304.1"
FT                   /translation="MSEEITVLGAGIVGICTALSLIERGLKVTLIDRDAPGQATSFGNA
FT                   GVISPWSVIPQSMPGMWKKVPGMMLDPVGPLAVSPTYLPRLAPWGMRFLAEGREARVRA
FT                   VSAAMEFLNRDCIDLYRRHLKGTGHEGLIRDSYYVHAYRDASAARLDTLDTELRRRAGA
FT                   EVERIDAADLRALEPALSPDFTAAVLIKGQARALSPGQLGAVLADKFQQLGGRLRQTSV
FT                   QSLHRQDDGGWLCRTDQGDLKAAKIVLAMGVWSARLLSPLGVHIPLEAERGYHVTFTKP
FT                   GITLNHSVMDAEMKFVASSMTDGLRVAGTAEFAGLDAALNKRRLDGLVRLACRLSPDLT
FT                   AEPHATWSGQRPSLPDSLPCIGEVEGLPGLVAAFGHSHYGLMMAPKTGELVADIVTGRM
FT                   ANTDLSPYKATRFKRFWPVSNT"
FT   gene            complement(187676..188389)
FT                   /locus_tag="SPOA0169"
FT   CDS_pept        complement(187676..188389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0169"
FT                   /product="MOSC domain protein"
FT                   /note="identified by match to protein family HMM PF03473"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97305"
FT                   /db_xref="GOA:Q5LL58"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL58"
FT                   /protein_id="AAV97305.1"
FT                   /translation="MSRTGPLMTEPTLNARIDGIFLGSVAERWPGRPPSAIGKTAVGGC
FT                   REINEFGFIGDAQADLDHHGGHDKAIHHYPSDHYPSWIAEGQIPAEAVPAAFGENIVSV
FT                   GITETNICIGDRLRLGTAIVEVSQGRQPCWKVSEHTGNAKMAYLFQKTGRTGWYYRVLE
FT                   PGQVSPGDQISLIERHHPEWTVETVTRARLTRRITSKDAAALAELVVLAEGWRSAFARM
FT                   AAGETHEDTDARLIG"
FT   gene            complement(188365..188907)
FT                   /locus_tag="SPOA0170"
FT   CDS_pept        complement(188365..188907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0170"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97306"
FT                   /db_xref="GOA:Q5LL57"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL57"
FT                   /protein_id="AAV97306.1"
FT                   /translation="MSKEYHIRELIMRLARLDVSESWAEDLNPAQRAVLEYLSRANKFS
FT                   RSPSHVAAFLGTTRGTISQTFKALLQKNYVTEKRSQSDKRVISFDLTQKGRALLARPRL
FT                   LISGLESLDSSEQNALLSTLQSTLNSLLEQNKGQPFGLCKECRHFTSSNGGGYCNLLSE
FT                   KLAPPETEQICHEQDPL"
FT   gene            188994..189755
FT                   /locus_tag="SPOA0171"
FT   CDS_pept        188994..189755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91536.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97307"
FT                   /db_xref="GOA:Q5LL56"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL56"
FT                   /protein_id="AAV97307.1"
FT                   /translation="MKTTSGFALAALVLSAASATAGGDHANHAIKQEGAIKSAVDGGKV
FT                   AAFDILAAHAHRTGNVVTFHMTTNGKAGENVPAATGAVGGSDVWTYVWPTSLEPSAVGF
FT                   EEGTGILAMAATSHPDFDDTPLYDENLDGDPANDGVIWHSHWVVLTPTEECGTGALAVR
FT                   DIPEGATPKLPATWPGFPIFLDSPGFSPVFDGPEITVKAAFNSDIELGGVSYDGVTSAL
FT                   KVNANVHSPLLCVVDVFDVASGNLSLPGKIE"
FT   gene            189812..190042
FT                   /locus_tag="SPOA0172"
FT   CDS_pept        189812..190042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91595.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97308"
FT                   /db_xref="GOA:Q5LL55"
FT                   /db_xref="InterPro:IPR021111"
FT                   /db_xref="InterPro:IPR038125"
FT                   /db_xref="PDB:2OYY"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL55"
FT                   /protein_id="AAV97308.1"
FT                   /translation="MSETWLPTLVTATPQEGFDLAVKLSRIAVKKTQPDAQVRDTLRAV
FT                   YEKDANALIAVSAVVATHFQTIAAANDYWKD"
FT   gene            190045..190572
FT                   /locus_tag="SPOA0173"
FT   CDS_pept        190045..190572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0173"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD84048.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97309"
FT                   /db_xref="GOA:Q5LL54"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:3EYT"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL54"
FT                   /protein_id="AAV97309.1"
FT                   /translation="MKAPELQIQQWFNSATDLTLADLRGKVIVIEAFQMLCPGCVMHGI
FT                   PLAQKVRAAFPEDKVAVLGLHTVFEHHEAMTPISLKAFLHEYRIKFPVGVDQPGDGAMP
FT                   RTMAAYQMRGTPSLLLIDKAGDLRAHHFGDVSELLLGAEIATLLGEAAPSVQKQAGTPQ
FT                   GDANCDNDGCTV"
FT   gene            190647..191114
FT                   /locus_tag="SPOA0174"
FT   CDS_pept        190647..191114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0174"
FT                   /product="MOSC domain protein"
FT                   /note="identified by match to protein family HMM PF03473"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97310"
FT                   /db_xref="GOA:Q5LL53"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL53"
FT                   /protein_id="AAV97310.1"
FT                   /translation="MSWKGIVIGLHIAPRSFLPMKTVPQLELVANVGITGDRYASEDGY
FT                   YSDRPEEGRQITLFEAETLEALKRDCGIDLAADEHRRNVTTRHVPLNHLVGQRIRIGDC
FT                   LLEATRLSTPCRHIEQITGKDIFEPLLHRSGLHARILEGGIIRAGDTICPA"
FT   gene            191127..192059
FT                   /locus_tag="SPOA0175"
FT   CDS_pept        191127..192059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0175"
FT                   /product="oxidoreductase FAD-binding domain/oxidoreductase
FT                   NAD-binding domain/2Fe-2S iron-sulfur cluster binding
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97311"
FT                   /db_xref="GOA:Q5LL52"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL52"
FT                   /protein_id="AAV97311.1"
FT                   /translation="MVKPIHRVTTVIKETRDIAPGVRLLRLSDPDGWDLPPFSPGAHIH
FT                   IHLPDGLVRPYSLCGDAADRSSYFIAVQKEPDGRGGSRQVHALQQGERILVSLPKNLLP
FT                   LTNAPHVILIAGGIGITPFMPMIHEMSRQGRTFELHYASRQSDAAFLPELEALCAGRMT
FT                   RYDAERGQRLRLDDVISAIDATGHLYCCGPERMIGELLAKTGHMRDRVHVEYFGVSADV
FT                   GQQAYEIRLARSSRTVPVKQGQTMLEALRAADVDVSASCEGGICLECKTRYLEGTPVHR
FT                   DITMPKSERDTHLTPCVSGCAGASITLDL"
FT   gene            192016..192447
FT                   /locus_tag="SPOA0176"
FT   CDS_pept        192016..192447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM38898.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97312"
FT                   /db_xref="GOA:Q5LL51"
FT                   /db_xref="InterPro:IPR021439"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL51"
FT                   /protein_id="AAV97312.1"
FT                   /translation="MFQAARVRRSPWTCRLVTKATPMTDPAQPILFLLRPDFLDPATGD
FT                   GAFFCPHCLRLEGLLSIYPVLRHSLQICYVDFPKPRGALAQLAGAESQSCPQLVLPAGD
FT                   DELSGRWSVAGAADARRIENTADIEDYLILRYGLSDRHP"
FT   gene            complement(192528..193220)
FT                   /locus_tag="SPOA0177"
FT   CDS_pept        complement(192528..193220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0177"
FT                   /product="hydrogen peroxide-inducible genes activator,
FT                   putative"
FT                   /note="identified by similarity to SP:P11721; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97313"
FT                   /db_xref="GOA:Q5LL50"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL50"
FT                   /protein_id="AAV97313.1"
FT                   /translation="MSGLSLRDLEYIQSIAQEGHFGAAAVGCGVSQPAISQQVLKLEAR
FT                   LGFAIFERQGKHVSLTPSGAQFLRKAEVVLAGARELLDMSVGLSDNLEGELRVGVISTL
FT                   GPYLLPLVLGSIKSRYPQIRLRLSEEPTTVLEQMLADRELDAILIATEPKHQHLETAGL
FT                   FFEPFALACPADHGRTPGQPVAWADVRGAELVLLSEEHCLRDQTMAQQRSAGQIPGKIR
FT                   RISRVSNG"
FT   gene            193336..194207
FT                   /pseudo
FT                   /locus_tag="SPOA0179"
FT                   /note="catalase, authentic frameshift; this gene contains a
FT                   frame shift which is not the result of sequencing error"
FT   gene            complement(194488..194853)
FT                   /locus_tag="SPOA0180"
FT   CDS_pept        complement(194488..194853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0180"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97314"
FT                   /db_xref="GOA:Q5LL49"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL49"
FT                   /protein_id="AAV97314.1"
FT                   /translation="MKTFMLSGLVIAGLACSAQADGDPEEGKKVFKKCAACHAIEEGKN
FT                   KVGPSMFGVWERPAGAVEGFKYSQPMAEAGYTWDEEHLAGFLAAPKKYLPGTKMTFPGV
FT                   KKEEQLADLLAYLKTLQ"
FT   gene            complement(194918..195736)
FT                   /locus_tag="SPOA0181"
FT   CDS_pept        complement(194918..195736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0181"
FT                   /product="transporter, FNT family"
FT                   /note="identified by match to protein family HMM PF01226"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97315"
FT                   /db_xref="GOA:Q5LL48"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL48"
FT                   /protein_id="AAV97315.1"
FT                   /translation="MSYADTVLGFARIARAKAEHLNADPLGFVILTLKAGAYVGAGILL
FT                   IFSVGQGVDASIRPIVMGASFGIALTLVVFAGAELFTGHTMYMMHGVLTGRASIRDLAR
FT                   CWCASWAGNLAGAILLAAIFVIGGGGLILAAGDEALLYKVAAKKMHGTAPELFAKAILC
FT                   NWLVCLALWTSARARDDVTKCVLIFWCLYAFIAAGFEHSVANMTVFSVALLSNHPDGIS
FT                   IAGAIWNLTWVTLGNTFAGAVIMGFGYWGAASRPSFSDTGIEKSAHGKPE"
FT   gene            complement(195733..196302)
FT                   /locus_tag="SPOA0182"
FT   CDS_pept        complement(195733..196302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0182"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97316"
FT                   /db_xref="GOA:Q5LL47"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL47"
FT                   /protein_id="AAV97316.1"
FT                   /translation="MTRCVLAAPAFFTALALRWGAAESPIQHVLIQMPLLVLAGALLAW
FT                   NLKARRDWALPLFILALSVFLFWMLPRSVDWALTRAGEVAKLVSLPLLLGVPLRLSWPW
FT                   LGPVLRGFLQANALSMLGVLGFLYIHAPIRICNSYLVSDQQDLGVGFLIAAAGLTCLWV
FT                   CPVLFGQAEQDASPPWSFPGAKDLKS"
FT   gene            complement(196299..196898)
FT                   /locus_tag="SPOA0183"
FT   CDS_pept        complement(196299..196898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0183"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97317"
FT                   /db_xref="GOA:Q5LL46"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL46"
FT                   /protein_id="AAV97317.1"
FT                   /translation="MLRPALASVLAAVIGGGFLWYATDGAQAFTSEAARRLDVARSPRP
FT                   VPAVRLEDMNDRTIALTPQNGEVVLVEFIYTVCGDICQIAAGDFAAIRDKLRAQGADVR
FT                   LISVSFDPLRDTPEQMRIYGENHDADGNIWTVARPALDDLEALLTLFGVTVIPDEWGGF
FT                   QHNAAIHVIDGEGRFSAVFDTDAVAAVVDRVAGEPS"
FT   gene            complement(196898..198328)
FT                   /locus_tag="SPOA0184"
FT   CDS_pept        complement(196898..198328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0184"
FT                   /product="heme-copper respiratory oxidase family"
FT                   /note="identified by similarity to SP:P33518; match to
FT                   protein family HMM PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97318"
FT                   /db_xref="GOA:Q5LL45"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL45"
FT                   /protein_id="AAV97318.1"
FT                   /translation="MTTAHTPQAGAVKLTMILSGAVFALMMIFGLAMRAAQAQWIELDP
FT                   AIFYQLLTAHGAGMVGTAALSGAAILWYFCGRHLTLSAGIFWAFLGLFLLGVVLILSAI
FT                   FLGGFGGAWTFLFPLPANSGGAWGPAAAAAFMLGYTSIGVGFLLYYLELGRRIRARYGN
FT                   LTRALGWSLILGKADDDVPPPTIIAATSVTIFNSIGIVLGAAVLVASLVHLLVPGFEVN
FT                   ALLAKNLIYFFGHVFINASIYMAVTAVYEILPEYTGRPWKSNRVFAIAWNVVLIFVMAV
FT                   YWHHLLQDVVMPPWMLVVGQLVSYFSGIPLIAVTAFSTFLYIRGSKMTWDLASSLLVLS
FT                   VAGWSIGSIPASIDGMISVNKVMHNTMWVPGHFHTYLLLGEVAMAFGFMAWLVRGKAIS
FT                   EMVGLDRVAFYTYLAGASGFILVFLFSGAASIPRRWAVHYEDWLTHDRIGTAFGALVVM
FT                   GTLLFVLRFVARLGRSDG"
FT   gene            complement(198329..198838)
FT                   /locus_tag="SPOA0185"
FT   CDS_pept        complement(198329..198838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0185"
FT                   /product="cytochrome c oxidase,ba3-type, subunit I,
FT                   putative"
FT                   /note="identified by similarity to SP:P98052"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97319"
FT                   /db_xref="GOA:Q5LL44"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL44"
FT                   /protein_id="AAV97319.1"
FT                   /translation="MQSNVLLISLVLMAAMAVVFYVAARASDGPEPGPRANSKRTGLIW
FT                   AMLVVGVLVSVGTLRPWPHALASTDDTINVAITSGQWWWEIDTVEIPAGKPVNFSVTTE
FT                   DVTHGLGIYNADMRLLTQVQAIPGYTTEITYTFDEPGQYEILCMEYCGIAHHEMVNEFE
FT                   VVSVEE"
FT   gene            198944..199426
FT                   /locus_tag="SPOA0186"
FT   CDS_pept        198944..199426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0186"
FT                   /product="Rrf2 family protein"
FT                   /note="identified by match to protein family HMM PF02082;
FT                   match to protein family HMM TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97320"
FT                   /db_xref="GOA:Q5LL43"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL43"
FT                   /protein_id="AAV97320.1"
FT                   /translation="MQISKFSDYALRILIHLATSEGGLMSTREIADLQQLPFNHLAKIS
FT                   QWLTHEGYVESVRGRHGGMRLALPPDAISIGGLLRKSERGTPLVECMKEGGGCCVMTPA
FT                   CGLLPILIEAQEAFFHSLDGSTLQDVLSGNRGMQNLIRALGVRSKYDPGSAAVQDA"
FT   gene            complement(199725..200597)
FT                   /gene="ccoP-2"
FT                   /locus_tag="SPOA0187"
FT   CDS_pept        complement(199725..200597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoP-2"
FT                   /locus_tag="SPOA0187"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by similarity to GB:AAC72074.1; match to
FT                   protein family HMM PF00034; match to protein family HMM
FT                   TIGR00782"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97321"
FT                   /db_xref="GOA:Q5LL42"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL42"
FT                   /protein_id="AAV97321.1"
FT                   /translation="MSVKEKDPVTGTALTGHEWDGITELDTPVPWAARWALWVSIAIAA
FT                   LFWVFYPSFPLVTDYAKGLVGYSSRAEVGRVLAEADAQRAMNFAPFANGDIAALAGDTA
FT                   LETRYSDAISKLYADNCSACHRVDLAGQTGFPNLRDAHWLWSGAPEEIEYTIRHGINAA
FT                   DEDTRVSQMPAFGTDQLLDRQQIEDVTEFVLSLSEGDHNAVAAGRGQNVFAENCAGCHG
FT                   DDGRGGLESGAPDLGDAAWLYGGSRDDIHDSIYRGRQGVMPAWKNRLDDKQIRMLTLYL
FT                   LWQADNAGN"
FT   gene            complement(200588..200755)
FT                   /gene="ccoQ-2"
FT                   /locus_tag="SPOA0188"
FT   CDS_pept        complement(200588..200755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoQ-2"
FT                   /locus_tag="SPOA0188"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit IV"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by similarity to GB:AAM76066.1; match to
FT                   protein family HMM PF05545"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97322"
FT                   /db_xref="GOA:Q5LL41"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL41"
FT                   /protein_id="AAV97322.1"
FT                   /translation="MTHDAVLVFSKTWGAIYLLVVFVAAVLWTYWPSRRGLYDEAAQSP
FT                   LQKDEDRPCR"
FT   gene            complement(200752..201483)
FT                   /gene="ccoO-2"
FT                   /locus_tag="SPOA0189"
FT   CDS_pept        complement(200752..201483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoO-2"
FT                   /locus_tag="SPOA0189"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by match to protein family HMM PF02433;
FT                   match to protein family HMM TIGR00781"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97323"
FT                   /db_xref="GOA:Q5LL40"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL40"
FT                   /protein_id="AAV97323.1"
FT                   /translation="MSTAHQKLERHSIAFAMMILFVASIGGIVEIAPLFTIENTVEEVE
FT                   GMRPYTPLELAGRDIYVREGCYACHSQMIRTLRSDVERYGHYSLAAESMYDHPFQWGSK
FT                   RTGPDLARIGGKYSDDWHVAHLEDPRALVPGSVMPGYAFLSATRLDTGHLPAALEALRR
FT                   AGVPYTDAQIATAEQAAGWQADAEQAYESELQELFGDNVQLRDFDGRPGELTEMDALVA
FT                   YLQVLGTLVNFDTLDPEEINR"
FT   gene            complement(201488..203110)
FT                   /gene="ccoN-2"
FT                   /locus_tag="SPOA0190"
FT   CDS_pept        complement(201488..203110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoN-2"
FT                   /locus_tag="SPOA0190"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by similarity to SP:P98055; match to
FT                   protein family HMM PF00115; match to protein family HMM
FT                   TIGR00780"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97324"
FT                   /db_xref="GOA:Q5LL39"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL39"
FT                   /protein_id="AAV97324.1"
FT                   /translation="MPRKLTFEDLAVLLALSAVMLTGIAILGWGVPTVYVMHGWLIAGA
FT                   AGWGLIWMINRATDPAQDVPHAYNDKATKFGVVATFIWGVIGFAVGDILAWQLAIPDLN
FT                   GDMSWSNFGRLRPVHTTAVIFGFGGNALIATSFYVVQRTSRARLASETLPWLIFWGYNL
FT                   FMLLSVSGYLAGITQSKEYAEPEWYADLLLVVVWVGYLTLYLRTLARRAEPHIYVSNWY
FT                   YLGFIVVIAMLHIVNNLAVPVSIAYPKSYSLFAGVQDAMTQWWYGHNAVGFLLTAGFLG
FT                   MLYYFLPKAVNRPVYSYRMSIIGFWGITFLYLWAGSHHLHYTALPDWVQYLGTSMSIIL
FT                   LVPSWASVFNGILTINGAWDKVRTDPAVRFMMVAILFYGLTTFEGSFMAIRPVNSLSHY
FT                   TDWTVGHVHAGALGWVAFITFGAMYKMVPWIWRRDGIYSERLEAWHFWLALTGTLIYVG
FT                   AMWNSGMTQALMWQTYDADGALYYSFLDSVLAMHPYYAARAIGGLLYLIGALIGAYNIY
FT                   MTISGPKRETTRKSGPLARQPAE"
FT   gene            complement(203113..203904)
FT                   /locus_tag="SPOA0191"
FT   CDS_pept        complement(203113..203904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0191"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97325"
FT                   /db_xref="GOA:Q5LL38"
FT                   /db_xref="InterPro:IPR018692"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL38"
FT                   /protein_id="AAV97325.1"
FT                   /translation="MANIDYSRARIISDPAPATIVRWLVAGWRDFCLNRTYSLLYGGGL
FT                   VLFGWALILLLFRNGLAWALLPMLAGGVLVGPVVTVGLYRVASGKTRVAAKGQITLVGI
FT                   ILMVFAMAWIRAATILFAIVYGLKPFEGFVATLSLLLSTSSGWVLLVSGTLVGGLFAAL
FT                   GFAVSAFSLPMLVERDIDGFSAMGLSFNATTQNFRLTVLWGMTIAALTALGILTGFLGL
FT                   VIIFPLLGYATWHAYDDLFRQGGGAKPQPGSEHVRIVGEEV"
FT   gene            complement(203945..204364)
FT                   /locus_tag="SPOA0192"
FT   CDS_pept        complement(203945..204364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97326"
FT                   /db_xref="GOA:Q5LL37"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL37"
FT                   /protein_id="AAV97326.1"
FT                   /translation="MSGSSLRPHQLFDITRTEIDQVVRRFYAEVRAHDVLGPVFNSAVT
FT                   DWPEHEDKISGFWAGAILREPGYFGNPMQVHIANPNIRSEHFPVWLDLFQKVLEQELTG
FT                   DVASAFSLLAQRIGKGLSMGIENFRQPDGAAPNLT"
FT   gene            complement(204477..204896)
FT                   /gene="cycJ"
FT                   /locus_tag="SPOA0193"
FT   CDS_pept        complement(204477..204896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycJ"
FT                   /locus_tag="SPOA0193"
FT                   /product="cytochrome c-type biogenesis protein CycJ"
FT                   /note="identified by similarity to SP:P45401"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97327"
FT                   /db_xref="GOA:Q5LL36"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LL36"
FT                   /protein_id="AAV97327.1"
FT                   /translation="MASLKKSRRVRLILFSGVALVSATALIGYAMRDGIQFFRTPTEVA
FT                   TDPPAANEVLRIGGMVEHGSLVRDGANFSFRVTDGETSFPISYVGIVPDLFREGEGTIA
FT                   TGSVIGGVFRATEILAKHDEVYMPSELAEMEALRD"
FT   gene            complement(204899..206140)
FT                   /gene="hemA-2"
FT                   /locus_tag="SPOA0194"
FT   CDS_pept        complement(204899..206140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA-2"
FT                   /locus_tag="SPOA0194"
FT                   /product="5-aminolevulinic acid synthase"
FT                   /EC_number="2.3.1.37"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF02490; match to protein
FT                   family HMM TIGR01821"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97328"
FT                   /db_xref="GOA:Q5LL35"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL35"
FT                   /protein_id="AAV97328.1"
FT                   /translation="MLNAPDYSSHFEDALQDLRDTGNYRVFQEHNRLVGRFPLSQVMGE
FT                   DGPRTITVWCSNDYLGMGQHPVVRGAMKSAIDTYGAGSGGTRNISGNHGPIVALEQELA
FT                   TLHGKEAGLVFGCGYLANLATLATLGRLLPDCVMISDELNHASMIQGVLASKAEKRIFR
FT                   HNDVAHLEEILSELAADRCKVVAFESVYSMDGDIAPIAEIIRVSKKYGALTYIDEVHAV
FT                   GMYGATGAGVAEREGLAGQIDIIQGTLAKAYGVIGGYVTANAEIIDAIRSHANGFIFTS
FT                   APPPTVVAGALASVRHLRDSTSERESLHRKAVLLRALLKDARIPFMDAPSHIVPVMVGD
FT                   PFKCKQLSDLLLERHAIYVQPINHPTVPKGTERLRITASPLHSDGMIHGLVSALVDCWR
FT                   DLQIGWATPLGSGR"
FT   gene            complement(206169..207119)
FT                   /locus_tag="SPOA0195"
FT   CDS_pept        complement(206169..207119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0195"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM30460.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97329"
FT                   /db_xref="GOA:Q5LL34"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL34"
FT                   /protein_id="AAV97329.1"
FT                   /translation="MADIFTLILVTTVFAGILLPLLRPGSDRDLGAGLEDTDPSKQWEA
FT                   ERARLIEQMQDNDIALAEGRIGVVLYGDTSSRLTAEANRFVDRLRKMRPLVQRPGSPQS
FT                   RSTGDGISFLSAAAVVVAALGVHFAANVNDLDMTVSPHATGAIPLAAASDEVRDPVMAS
FT                   LGPDGAPNIAEMVGRLEERVYDGNPTEDDIQMLLRSYRVLERGEDAIEVLQIAAERFPG
FT                   NVQFKMMLLRGRLQDPEFDPSEDLVRTVETVLQQEPDLLEAHWYRGLIQARQGRHEAAR
FT                   ETLMTLRPKLSANPRAAGAVDALLAQLETTTQSDN"
FT   gene            complement(207119..207571)
FT                   /gene="cycL"
FT                   /locus_tag="SPOA0196"
FT   CDS_pept        complement(207119..207571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycL"
FT                   /locus_tag="SPOA0196"
FT                   /product="cytochrome c-type biogenesis protein CycL"
FT                   /note="identified by similarity to SP:P45406; match to
FT                   protein family HMM PF03918"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97330"
FT                   /db_xref="GOA:Q5LL33"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL33"
FT                   /protein_id="AAV97330.1"
FT                   /translation="MKRLMLILALIVMSFPAGAASVSEDPTEPRVRDLAVLLRCPVCQS
FT                   ENILDSHSSTAREMLVILRERIAEGMSDAEIFEFFRTRYGDYVLLSPPMTGPGRIVWLV
FT                   PAGLVLLGLGVFMLILARHKRRAARELKDSVLMSPLDASGLKGMEL"
FT   gene            complement(207568..208134)
FT                   /gene="dsbE"
FT                   /locus_tag="SPOA0197"
FT   CDS_pept        complement(207568..208134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbE"
FT                   /locus_tag="SPOA0197"
FT                   /product="thiol:disulfide interchange protein DsbE"
FT                   /note="identified by similarity to SP:P33926; match to
FT                   protein family HMM TIGR00385"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97331"
FT                   /db_xref="GOA:Q5LL32"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL32"
FT                   /protein_id="AAV97331.1"
FT                   /translation="MTIEVDMPRKKGGLEWKLPLLAALVGLPLLLGIGLTRDPNRIPSA
FT                   LVGKSMPAFEIPYLQRAGMLNSAEHAGKPMLLNFWASWCTTCRVEHPKLVELGVRSQLS
FT                   DEFSILGINYRDDPARAAGFLNREGHFGYPSGYDERGRLGIDFGVYGMPETFFIDADGV
FT                   VQARHAGPVTDKVLAKYLPLIGVDP"
FT   gene            complement(208131..210131)
FT                   /gene="cycK"
FT                   /locus_tag="SPOA0198"
FT   CDS_pept        complement(208131..210131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycK"
FT                   /locus_tag="SPOA0198"
FT                   /product="cytochrome c-type biogenesis protein CycK"
FT                   /note="identified by similarity to SP:Q00500; match to
FT                   protein family HMM PF01578"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97332"
FT                   /db_xref="GOA:Q5LL31"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL31"
FT                   /protein_id="AAV97332.1"
FT                   /translation="MIETSIELGQFAVSLALILSVFGCFQAVLAARSGAASRLVSARNA
FT                   IFANFVLATIGCAVLIQAFVTSDFSVAYVAQNSNRDLPMLYKVTAMWGAHEGSLLLWLW
FT                   YLTLFSAAAVWLHWRDYPKSMPWVIATLAAIQLGFLAFVVFLSNPFLTLTPMPGNGRDL
FT                   NPLLQDPGLAFHPPVLYLGYVGFAVPFAFAIASLIRGQTGVEWVTVVRRWVLFAWTALT
FT                   SGIICGGYWAYYELGWGGYWAWDPVENASLMPWLTGTALLHSMMVQDKRGMFRAWNVFL
FT                   VVTTFLLTLLGTFLVRSGVLTSVHAFAVDPGRGAYMLGFMTVAMVVGYGLIILRADRLQ
FT                   DDGGISSLLSREAAILGNTVLLLVVTATVMAGTLFPLVVEVFSDAKISIGAPYYNKVIV
FT                   PIMVALVFLLGLGPSVPWRQMSAKRFVGRFRLPLAFAGLTAVAAVLVSEAGIITLAAIF
FT                   AVGFAGFASLADIASAIAARRRVMEQGVLRATGDVLTHSRQRIGALIIHFGVVMIGAGM
FT                   IASGLFQTTQTVAMRIGDRAEAGGYTLTLRELQDTGSANYNARVARFSISRDGELLFEM
FT                   APEKRFYPVREMATTEIAIRSSLAGDLYMVMGDEDGQGTVVVRIFWNPLVNWIWLGWLV
FT                   LLLGALLSLSKPSRRAARSRTPEPIEGVPAE"
FT   gene            complement(210138..211616)
FT                   /locus_tag="SPOA0199"
FT   CDS_pept        complement(210138..211616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0199"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97333"
FT                   /db_xref="GOA:Q5LL30"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL30"
FT                   /protein_id="AAV97333.1"
FT                   /translation="MQVVLRIDEKDTRTLQQQVFHQIRALILEGRLRSGDPVPASRELS
FT                   QQLGVSRNTVLIAYEHLLSEGYLESRANVGTFVSSALPEMSMSTLTSPANDQPSEPSGQ
FT                   SPAPACMPLLEHSVISPNRKKDTVDFWVGRSDGSAFPAREWRRILDTKLRHAKGQLSEY
FT                   HDPRGLREFRQALADHIGPTRGVLAKPEDVVCVGGSQDGLALIARAFSRTFRTFIHEDP
FT                   CYLGARAVFSNFSYDTVAVPVDRDGLRVDLLPETGRSLLYVTPSHQYPTGVTLSLERRL
FT                   QLLQWAERTDSIVIEDDYDGDFRYEGTPLTALRGLDRAGRVIYLGTFSKSFGPAIRIGY
FT                   LVSTAELSDAFAMWKGILSNGQPWLEQAAMADFITGGSFRRHLRRIRSTYMARRDLLAR
FT                   ELTTRIPGTSIHGMRGGMHISARLPKGICAETLQKAAAEHRIAIYRARDCGAWLSPSNT
FT                   DFDDLLVLGYAAVSDRNIRKAVDVLAHAAEQQSG"
FT   gene            complement(211718..212725)
FT                   /locus_tag="SPOA0200"
FT   CDS_pept        complement(211718..212725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0200"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD86250.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97334"
FT                   /db_xref="GOA:Q5LL29"
FT                   /db_xref="InterPro:IPR030891"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL29"
FT                   /protein_id="AAV97334.1"
FT                   /translation="MYRLLPSRTIAVLLSVIVPMAVAGIFFFSRGGSVADNTPDPYAYK
FT                   VAEEELSEETRQLAGMIEGAQAKIYDLTVPETDLALARAEVIELPGGRDLIVGWQSRVT
FT                   EPVLRSDIKPSEEIALITALKSHLPEDAVVLAMPDLSDRLSQFAPSHYPLAAMAGQQAY
FT                   RAPAGTEDTVLRMEKRWLGERSETEQPELFRDFIDAMVAEDAYGLARLQVMAGGSEAYI
FT                   ALHVRDSFDVGITAPDKILVGLKDFPGGTHAHDVTRQVKTWIADQDYAAYTVSQIGDDT
FT                   IRSYFLADAKDKATLLGQLLPFNTARVGLVPGAKLVFQTGGYWVYRIDPVAATN"
FT   gene            complement(212759..214345)
FT                   /locus_tag="SPOA0201"
FT   CDS_pept        complement(212759..214345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0201"
FT                   /product="hydroxylamine oxidoreductase"
FT                   /EC_number="1.7.2.6"
FT                   /note="identified by similarity to SP:Q50925"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97335"
FT                   /db_xref="GOA:Q5LL28"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012138"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL28"
FT                   /protein_id="AAV97335.1"
FT                   /translation="MMAAKLNFLNKIRPALCVLFSALLITPARAEIPDALYTALGLDKD
FT                   VAPNVLYDALVKRYRDPEQGAGEGAFADLWEPIPFSAYMAPQNFYQGPDLDIEVSRTEC
FT                   VECHESVTPGWVHSWENSVHGNLDEIRGLDASDSRHYKQELIGQVETNLHSMGLLEEGQ
FT                   RLNDVGCIDCHMGVGVESGNHKTDLYMPDAASCGQCHVQEFAERESERDTLDWPQDQWP
FT                   DGRPSHALSYIANVETAIWAGMEQREVAAGCTMCHTTQNTCNSCHTRHEFSAAEARKPE
FT                   ACSTCHNGVDHNEFENFMLSKHGVIYNASGDEWDWELPLAQAFEQGGQTAPTCQTCHME
FT                   YEGEYGHNLVQKVRWGFNPMPEIADNLDHPWFEERKESWVATCTQCHSESFARSYLDVM
FT                   DQGTIDGIELVKEAKVIMQGLYDDGMLTGQTTNRPAPPAPDEDAPGGFFGFFASQGNNP
FT                   TAIDVEYAEMWEQHIMKHFKGLAHVNPGGFTYSNGWAKLIRSLARIKDADTTLREKADM
FT                   LARIKKLEEGN"
FT   gene            214950..216251
FT                   /gene="hisD-2"
FT                   /locus_tag="SPOA0202"
FT   CDS_pept        214950..216251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD-2"
FT                   /locus_tag="SPOA0202"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="identified by match to protein family HMM PF00815;
FT                   match to protein family HMM TIGR00069"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97336"
FT                   /db_xref="GOA:Q5LL27"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LL27"
FT                   /protein_id="AAV97336.1"
FT                   /translation="MPQFLDSRQPDFETAFTALLGAKREDSPDVDAVVAGIIADVRARG
FT                   DAAVIELTERFDRVALTPQSLRFSTEEIAQAVDEVPAPERAALELAAARIRAYHERQMP
FT                   QDADWTDDTGARLGWRWSAVSAAGLYVPGGLASYPSSVLMNAIPAKVAGVGRLAIAVPT
FT                   PDGQVNPLVLLAAQISGVDEVYRIGGAQAIAALAYGTDTIAPVDKITGPGNAFVAAAKR
FT                   RVFGKVGIDMIAGPSEILVIADRDNDPDWIALDLLSQAEHDESAQSILITDDAAFGRAV
FT                   AEAVDKRLETLERRAIAGVSWRDFGAVITVSDLDEAAALSNRIAPEHLELCVSDPEALA
FT                   ARTIHAGAIFLGQYTPEAIGDYVGGPNHVLPTARSARFSSGLSVMDFLKRTTMSRMTPE
FT                   ALRAIGPAAAQLARSESLEAHGLSVQARLDRLNG"
FT   gene            complement(216248..219547)
FT                   /locus_tag="SPOA0203"
FT   CDS_pept        complement(216248..219547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97337"
FT                   /db_xref="GOA:Q5LL26"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL26"
FT                   /protein_id="AAV97337.1"
FT                   /translation="MRQALIDLAQELSAVCGCYEPDALCDALGVEDRPDLRHDVLGALS
FT                   RGVTEVLCPVPEASPRYGWMLAPDPRAAALRRFLTRAQLDQALELAPTPWQDDLFGQVL
FT                   HQLLAGAQVEVARPKGSDNETRLLTHLRHNAAILDAVQFARAVPALDARALETLESEAK
FT                   RQIQEVQKWRDLVIVLPRRHFGYDNIRRRLSHFLRGKTKDTRPLLLTGTGGIGKSAVLA
FT                   RLLQDWQTRRDAPITVILDFDRPQLKTGAPFQIAREILNQIAVGVTRTLDPPEAAANVS
FT                   KQLRMRRAMLSSTDLMGEVRDHGAQADFLESQLPGWFRGDWTHGLRSQPIALAFDSFEA
FT                   VDRQGGEVVRLILAVEEQFRRELPGLRCVLSGRAEPLEGEELDDRFGPSSRRITLDGLS
FT                   VEAGAQLIEEEDRRLSEEDQQRKGIDRPPVLTDETLRRTVSRLLKGHPLALLIFVKYAR
FT                   THDGDIADLIADLEEDGAGAFRSEFAHRFLYERILDRIDDPELRSLAHPGLVLRQINTD
FT                   LIRFVLAVPCLGLPEGTVLPEGRAEALRKKLENEYWLVDPGEPPFDLRHRADVRRMMVA
FT                   GLFAGPREADTAADHKRKARLREDALAVCSAARDYFRLGPPDGSDEGARQRWQAMDPEM
FT                   RNLHALYYEAFLSPRDVPEFDAQTARALDLSLGEDLETLPAAWRARVNVLLGRVLSKEE
FT                   AFDLGDDLRELAEKQEFTSAAQHGLSTADEDFTTVSEASESRAGDPLGVRAHEDVYRPD
FT                   GSDWRSASRLSRDIQRAFAAARFAEVADLAPRYFEALEFRSNKEIAEDHADAMQRGYWR
FT                   HPMWQCLLVAGSGVETSAMAQAASVFLDSADHQRALPGVIAFIAQQTDPMQRHKELDVL
FT                   QGADFKSYVDAYRMSGSILDGWLGRKTALMASGRGVPLSGKPISRSPRALSLAAGRAGR
FT                   AEEEFGALFEAAPDLAGRLEKFWAHGAPGISDITDLYRQFGEEEDLTRLLASEALPQTD
FT                   LAFRMFRGLNPDLYPPLRRILEEQEGEVVLRLAEALAQRARHWPEELRMSALSGYSRNQ
FT                   SATLVEVADQCGELGTLCACLAEFDSRAGTVREMFDSLSAWFFPFARDLEI"
FT   gene            complement(219959..221563)
FT                   /locus_tag="SPOA0204"
FT   CDS_pept        complement(219959..221563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97338"
FT                   /db_xref="GOA:Q5LL25"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL25"
FT                   /protein_id="AAV97338.1"
FT                   /translation="MTEQDWTEERLISCVLGVVRGLHFARPQLRGWYDGWLAARRLPGA
FT                   PVSFAHAMVVTGRGGGLNPARDGDALCLALAALGGPQAVADCFAAAVSAGLFDIGASDP
FT                   LPVHRRQLAQKMISALGLKRAHATLQRANTEALVDETAFWTDPGNILPGIILGRRRLCR
FT                   VEALNEMGDRVTGSGFLIGAFDGADQFPRDQGYDRPAAGAGRSADPLRLFRDNRHRRGQ
FT                   GRGVRRGRGLVDRPQRDRAQTGRGLRLGQAGQAARLAARGRWVLGLCCDPADRRAGSAT
FT                   GLVRSGAGNAGRAEWGLDPASSGFGGTHDHRRQGGLWPTAPAAVVSSGDYGAWLLGRAG
FT                   AGPEWSTGGAALSGARGPDPSARCPSSSRAQRGGPAHRRRRRSGSQGGAGQAGRDPRPQ
FT                   PGGGLSGRAPTGLWPRRLHRRARAAVEGRPPHSARACGIPRGGGGHPPGQKLFGRDPAR
FT                   ALCRARTPSYRVSRRRRTGRCLSHGLRYAGQLCPRCGGQPARGTRHHHPGLCQTAGVEV
FT                   HAAGQRPAGRPHGLDPA"
FT   gene            complement(221560..224325)
FT                   /locus_tag="SPOA0205"
FT   CDS_pept        complement(221560..224325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0205"
FT                   /product="serine protease, subtilase family"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97339"
FT                   /db_xref="GOA:Q5LL24"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL24"
FT                   /protein_id="AAV97339.1"
FT                   /translation="MLDLLKAAARVATPTGQEALPTDILSFTLEYPEPVTAEAARGAIA
FT                   ALLEGDRFDLFPATQADDDMLILQFPGVPIEQSPGYLFAEAAALKEALDLVSVTPDILP
FT                   PFTDAESVPPPVENVGDVIWDLCRAHTPPLADRNWALRLIKADRAMSRFGVTGAGQRIG
FT                   QPDTGVAAHHELKHGVDKARGYNFVDNTPDPTDPLLPSMGSPGHGTGTASVVISRRSGR
FT                   VNGSAPRASLVPLRTNNAVVIGSWAPVARALDHARAQGCRIVTMSLGSGFAPRLIRRAV
FT                   ARAVSADMILLAAAGNCVRFVTYPAFDRNVIAVAGVDHAGRRWRGSCRGPEVDIAAPAE
FT                   NVHVARRRPGETDLSDVTDTGQGTSFAVALTAGVAALWLEHHGWTALRQEARRRGLPLQ
FT                   ELFRAALRQSANAPAGWDHSQMGAGIVDAEALLALDPADIMVGAAPESAGPAELLFGAD
FT                   FDAGGLQAEAEYLAFDWRLRERPEASATVENAMREMPSPALAALLGDRQPLGEPGLVLA
FT                   PAAPPAPLDRAFRRLAAGRGGTTESAADLSYEASVDRLRGEGLDTVMETVNELFQARAE
FT                   SAPDLVDTDMQAEAADKIRQAVQSHLDPDRDVRLSPGEVGFALEALVKLSGRPAIRVQA
FT                   DGSELFDPLLGTWRADLLTAVSRWQPLVRAVGRIDARNPQGVWVHVGTGFLLADGLVMT
FT                   NRHVIDAFAEPMPEENGQRPFKLRFPVSIIFDPDAADETTRYTLTEVATAGGARIGRTV
FT                   NMARLDMALMRIDPDNGHAPPPDPIDRGLISTTDLALTKILVAGYPAEPRNVRGPDPRQ
FT                   DQDTYLAFWARLGELYGDRYGVKYISPGMIEARPGAVTGDPRGWAFSHDATTLPGNSGS
FT                   AILSLHNPGQLCGLHFGGQSLETNLAHDIQAVLGMGDGAFATGLLNGQGE"
FT   gene            224583..225284
FT                   /locus_tag="SPOA0206"
FT   CDS_pept        224583..225284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0206"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97340"
FT                   /db_xref="GOA:Q5LL23"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL23"
FT                   /protein_id="AAV97340.1"
FT                   /translation="MRPTSRNALPPLETVLAGVSLLAGLEAEILSRFAADLELVTVHTG
FT                   QTVMEQGETSTEMYVVVRGRLVGLLLSPNGKEVAFTEITAGRYFGELSALDGRPRSLTI
FT                   SAAETTVLARMPAQRLLDWMAREPRLAHNLAIDLAERNRVLTERVFGLVVHDVDKRVRA
FT                   LLIQQAQAARQLKPGGVLDPSPTHDAIANYIGATREAVSRVMARLSAAGVIETGRRRLE
FT                   IADIEQLFEGL"
FT   gene            complement(225279..228305)
FT                   /locus_tag="SPOA0207"
FT   CDS_pept        complement(225279..228305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0207"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="identified by match to protein family HMM PF00211;
FT                   match to protein family HMM PF00536; match to protein
FT                   family HMM PF06498"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97341"
FT                   /db_xref="GOA:Q5LL22"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL22"
FT                   /protein_id="AAV97341.1"
FT                   /translation="MSRTIGSVTSWLADIGLEVYAERFEQADIDLEVLEHLSDQDLTDL
FT                   GVTSLGHRRKILARIADMRDAESIVAPPAPVEEDQSERLYLTVVFCDLVGSTQLAHTLG
FT                   EERFTDLLGEFYRAVDGAVDRYGGHVAQYHGDGVLIYFGYPQALEDAALRGVMAACESC
FT                   RQVGAIAVPGALPMQVRVGVASGPVVIGDRQLSQNARGGRAYGAVVNLAARLQAEAQPG
FT                   GVVVSDTTAALVKHHFDLNFLGLRHLKGIDEPAPVYAVEARRTPDLGVALLARPNRVPF
FT                   VNRRSELARLSACWNAVAMGAFNLITVAGEHGIGKSRLVGEFLDRLRREDRPVRHVNCP
FT                   QQGRDTPYGAFRLLLDHDPNLPAATALLAELEAVPKATQAERRQRRARVIGLLADHFGQ
FT                   TESGPKVLWIDDLQWADPSTIEVLLTLASRRPPGLMLIVSARNALPDQRLMKVDGLVPI
FT                   SLGLMSPEHTNSIVREVLGDVQGAEALVAPLVARAEGIPVFAEELALEMRARLAGPEDV
FT                   DAENLPDMSVPSSLQQSLQARIRRLVRARPLLRLVASIGREAPVPLLRDLWSGPGSIEE
FT                   ALDELIAAGLAELHLARDSQHENRLILRHQILQDCAYDIILTRDRERIHTAIAEALARR
FT                   RAAGQAVEPTLMADQLERAGRLRPAAELWAEAGRAAAAQSADAEAVALFRRALALVPRI
FT                   GATEGDWSDQFEADTLLALFPALIGAKGYRAAGEDVLNRINALIERTGGSQRVFSTMFF
FT                   RWIDICVQGDIDAGHEFAAGLADIAHADPTGLHALVLDRMLGSSHMFRGEFDDARGYLD
FT                   RFLATYDPARHADPLRPFGATDNHATVLCCVAAIEAFTGTPETTRAATAAALAAARATE
FT                   LTHTLCHTLTFGAAFPAAIRRDWSQFRIHASELRQLAQEKELAFWLVYARMLTGIGDIA
FT                   AGRVDEGQAEYAYGSNVLGAQGFEFLQPTFRVIHALAEEAAQRDGPSGDLASLERAVRS
FT                   GERWMLPECLRLKERWGAS"
FT   gene            complement(228322..229908)
FT                   /locus_tag="SPOA0208"
FT   CDS_pept        complement(228322..229908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0208"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="identified by similarity to SP:P43485; match to
FT                   protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97342"
FT                   /db_xref="GOA:Q5LL21"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL21"
FT                   /protein_id="AAV97342.1"
FT                   /translation="MLWYDSRAQRLRERSAVWAQNQKTDPDFDGLPPKYAEELQKNILG
FT                   TVVLPGDPEYDTDRMLSNPRFSAYPQVIVYCEVETDVAECLRVARALSMAVVVRSGGHS
FT                   TAGFSSQNGFLIDVSRMNDVCISPEALRAWVGPGTNFGKFNAKLLPYDLHTPGGACPDV
FT                   CVGGYMQGGGYGFTARIFGMNCDQVEEIRVMMTDGRIVHANAELNPDLFWAVRGGTGSN
FT                   FGVLLGVKYRLYRGSTFAGFSVRWSMQTDAGVQDTATSLAWLQENFMRTGAPDTMGYQM
FT                   IWAFEGPEGQAKEPVLLMRGMYRGTREELQEKLAPVLALPGATLQAIYDPQQYIDLNRI
FT                   LLSEPYEVPEFPADMTPMPPPEAKISRYVAKPIDAAGWKALLDYFRTSPSPYTIAAMEI
FT                   YGGAIARMPKGENAFFHRDVYCDLFFDVFWLTEQEKETMLAFIAGWEAAFAPHWTGQSY
FT                   QNYPSPDNPGFADEYWGDTYWLLRLIKHKYDPINLLRFPQSIQPLEWHPPGPGFPPGFR
FT                   GFEDPIQAIAG"
FT   gene            complement(230029..231330)
FT                   /locus_tag="SPOA0209"
FT   CDS_pept        complement(230029..231330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0209"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="identified by similarity to GB:AAQ59009.1; match to
FT                   protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97343"
FT                   /db_xref="GOA:Q5LL20"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL20"
FT                   /protein_id="AAV97343.1"
FT                   /translation="MDLLTVNDRPGQYPPSYYAAHASTLDPFPRAAGALTCDVCVVGGG
FT                   FTGLSAALHLAQRGYDVVLLEAQRVGFGASGRNGGQVGQGQRLDQQELEKMLGRDHAHA
FT                   LWQVARQSVDLVRDLAASDLVHADFHPGIIHADHRERFVSHSHDYVRHMHEEYGYTAIR
FT                   ALDRDEMRHLVASDAYHGGSIYDDAGHIDPLELVLGLARMAVAAGVRIFERSKVSTLTE
FT                   GDPALLRTDDAEITARHVVMGCNGYLGRLDDRVAARVMPINNYIIATEPLGPERQEALI
FT                   RNNHAVADSKFVINYFRFSDDHRLLFGGTESYGYRFPSDIAAKVRKPMLEIFPQLADVR
FT                   IDHAWGGTLGITMNRMPHFERLSGNVLSLSGFSGHGVALATLAGQIAAETIAGQAERFD
FT                   LMARVPGRPFPGGPALRTPLLILAMLWFSLRDRL"
FT   gene            complement(231416..232255)
FT                   /locus_tag="SPOA0210"
FT   CDS_pept        complement(231416..232255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0210"
FT                   /product="integral membrane protein"
FT                   /note="identified by similarity to GB:BAC71325.1; match to
FT                   protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97344"
FT                   /db_xref="GOA:Q5LL19"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL19"
FT                   /protein_id="AAV97344.1"
FT                   /translation="MSAGIVAIILSAALLHAIWNAIVKSAADRTTMLGLVASGHVLAGA
FT                   VMVTLLPLPAPESLPYILLSTVIHFGYYYMLGQAYRHGDLSVVYPIARGIVPALVALWA
FT                   LLLLGETLPAQAWVGIATIAAGIQLSSWSALRHGVGRAALGFAVGTGLCISAYSVVDGI
FT                   GVRLSQNTLSYWAWGAFLHIFIAGFVAIRKRGTLAGLKPKVWATGILGGLVSMAAYGLV
FT                   LYAKNFAPLGAVSALRETSVIFAALIGFVFLGEGNWKRRLGAAALMAAGVALIGTAG"
FT   gene            complement(232257..233939)
FT                   /locus_tag="SPOA0211"
FT   CDS_pept        complement(232257..233939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0211"
FT                   /product="Na/Pi-cotransporter family protein"
FT                   /note="identified by match to protein family HMM PF02690"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97345"
FT                   /db_xref="GOA:Q5LL18"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL18"
FT                   /protein_id="AAV97345.1"
FT                   /translation="MAIFSFLISLAGATMLLLFAVRMVRTGIERAYGSSFQRVMTGNNG
FT                   VMRAGAVGLVMAVVLQSSAAVALLTSGFAGAGLMGFGQGLAIVLGGDLGSALVIQILSY
FT                   RLDWLVPLLLAVGGWLFVKTEQRKARQFGRILMGIAFILISLRFLREAMDPIRDSAFLP
FT                   AIADYLARDYVTAFIVGGALAFVMHSSVAAILMCVTLVQIGAIPFSAGLSLVLGANFGS
FT                   AFIPVWLSRGMTMPARRIPFANLALRGTWAVLCLFAVNLALRNGFAPGPHGGQELVYAH
FT                   LAFNASLLVLALPFCNLLAAPFARLLPDPAQPVDADTLARPASSLDPAHIGSPAQAVSS
FT                   LKRELLRMADLVEAMFRPVLGLYRDGDKTRIKAVQSLDKEVNACLSGIRRYVAALPADQ
FT                   IGREAARSARDMLEYAVRLETAGDVVAGRLCVLAGDLRKTGNQFSKEGWSELQHMHETI
FT                   LANMKLASNVLISDDLESARLLSLEKTELKRAERSSRKRHFRRLQNGEVQSFDTSDCHL
FT                   ETLRALREFNSHISAVAYPILYANGQLLETRLIETLPATQDED"
FT   gene            complement(234160..234417)
FT                   /locus_tag="SPOA0212"
FT   CDS_pept        complement(234160..234417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0212"
FT                   /product="nitric oxide reductase F protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97346"
FT                   /db_xref="GOA:Q5LL17"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL17"
FT                   /protein_id="AAV97346.1"
FT                   /translation="MRAFLCDPLSRAWLALLGLSLAGALLTLAPVPQALIGSGVLILAL
FT                   IKARLILSRYLELGQSPAWMRGIGTVLTGFVLLLLALSLL"
FT   gene            complement(234422..234925)
FT                   /locus_tag="SPOA0213"
FT   CDS_pept        complement(234422..234925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0213"
FT                   /product="nitric oxide reductase E protein, putative"
FT                   /note="identified by match to protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97347"
FT                   /db_xref="GOA:Q5LL16"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL16"
FT                   /protein_id="AAV97347.1"
FT                   /translation="MWVLILSELLVFGAGLVALLAVRLSDPAGFAEAQDHLYRTGAALN
FT                   TVVLVTSGFLAACALRWRRSGRRARARWALLLAAGLGALFLVIKGAEFAGKAAQGISYD
FT                   THPFFMFYYLLTGFHAAHVLAGVAILLLVAWRDAPRNIEAGAQFWHMVDLVWVLLYPVV
FT                   YLAG"
FT   gene            complement(234967..236889)
FT                   /gene="norD"
FT                   /locus_tag="SPOA0214"
FT   CDS_pept        complement(234967..236889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norD"
FT                   /locus_tag="SPOA0214"
FT                   /product="nitric oxide reductase D protein"
FT                   /note="identified by similarity to GB:AAC45374.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97348"
FT                   /db_xref="GOA:Q5LL15"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL15"
FT                   /protein_id="AAV97348.1"
FT                   /translation="MVQIDFEPWEPEETIGKLWHSLASRLDAPLVHEGAAVDLSEVAGR
FT                   LAVLFRGLGGSAGVELRPVSPEISRHRLSWRRRLGTEAEALPRASFDGEVLRLPDRLAV
FT                   FPMRAANGALYVWLAAAAAHAGTRVEEDDPLRADLRALSAARAMVAATLADAPGLRPLY
FT                   AELCKGLLQQRDLPNLPPAEAAVEELIRLMLGDPQPLSARAAQFQAMDETLTAPHGYQP
FT                   FRPVPLWPELRAVALSEHHEAESRDTEGPPEDSGEKTHRARRRKSDMAARHDSFILHKF
FT                   EAILSWAEFLNLNRRVDDDDPDNAKKAADDQDEIGLGQISKAPPTRLKLHLDLAPEDVD
FT                   RERLSGRVLYPEWDVRTGAYLTDHVNVLTSEAEIRDGAEAFTHDPATARRIRAVKRQFE
FT                   ALRPGRMMTRGHLDGDQLDIEAAVRGHLDRLANGEGSERIWMQSRPVARDLAVSILLDV
FT                   SRSTESAVSGRAVIDIEREALAALAWGLDACGDDFAIHAFSSLKRARVYVQRCKGFGEM
FT                   MSPQVEARIASLRPGFYTRLGAAIRHASADLAGQGRKRRLLLVITDGKPNDLDHYEGRH
FT                   GIEDTAMAVREARRAGQSVFGVTIDKSGKSWFPRMFGQGGFAVIPDPNRLTLALPQIYR
FT                   QLVGA"
FT   gene            complement(236898..237713)
FT                   /gene="norQ"
FT                   /locus_tag="SPOA0215"
FT   CDS_pept        complement(236898..237713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norQ"
FT                   /locus_tag="SPOA0215"
FT                   /product="nitric oxide reductase Q protein"
FT                   /note="identified by similarity to SP:Q51664"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97349"
FT                   /db_xref="GOA:Q5LL14"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL14"
FT                   /protein_id="AAV97349.1"
FT                   /translation="MQMDGSKHMGTGAADAPFYLAQGDECDIFTAAYDNNLPVLLKGPT
FT                   GCGKTRFVAHMAAKLGRPLYTVACHDDLAAADLIGRYLLKGGETVWVDGPLTRAVREGA
FT                   ICYLDEVVEARKDVTVVLHPLTDDRRILPIDRTGEELEAMPGFMLVASYNPGYQNILKT
FT                   LKPSTRQRFISLEFDFPAPELEARVVSQESGLPLERCKPLIRLAGKLRGLKGQDLEEGV
FT                   STRLVVYAATLIAQGMPTERAILAAMVEPLTDDEDIKRGLLDLTTAVFG"
FT   gene            complement(237713..239080)
FT                   /gene="norB"
FT                   /locus_tag="SPOA0216"
FT   CDS_pept        complement(237713..239080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="SPOA0216"
FT                   /product="nitric oxide reductase, large subunit"
FT                   /EC_number="1.7.2.5"
FT                   /note="identified by similarity to GB:AAC45372.1; match to
FT                   protein family HMM PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97350"
FT                   /db_xref="GOA:Q5LL13"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL13"
FT                   /protein_id="AAV97350.1"
FT                   /translation="MKYESQKIALVYFAVAMGLFAIQVLGGLLAGWIYVAPNTLSELLP
FT                   FNIVRMLHTNSLIVWLILGFFGAAYFLIPEEAEREIHSTKLAYIQLAILVLGTLGVVVT
FT                   YVFNLFEGHWLLGKEGREFIEQPKWVKAGIVVAALIFLYNVSMTVLKGKKTAITNILLL
FT                   GLWGLALLFLFSFYNPSNLALDKQYWWYIVHLWVEGVWELIMASILAYLMLKLTGVDRE
FT                   VVEKWLYVIVAAALFSGILGTGHHYYWIGTPGYWQWIGSIFSSLEVIPFFAMMAFAFVM
FT                   VWKGRRDHPNKAALLWSLGCATLAFFGAGVWGFLHTLHGVNYYTHGTQITAAHGHLAFF
FT                   GAYVSLNLAIFSYAMPILLNRDPYNQVLNMASFWLMSSGMVFMTFVLTFAGTIQTHLQR
FT                   VLGEYFMDVQDQVAIFYWMRFGSGLVVVIGALLFIYAMWVPRREIIERGTAETPAE"
FT   gene            complement(239096..239548)
FT                   /gene="norC"
FT                   /locus_tag="SPOA0217"
FT   CDS_pept        complement(239096..239548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="SPOA0217"
FT                   /product="nitric oxide reductase, small subunit"
FT                   /EC_number="1.7.2.5"
FT                   /note="identified by similarity to SP:Q51662; match to
FT                   protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97351"
FT                   /db_xref="GOA:Q5LL12"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL12"
FT                   /protein_id="AAV97351.1"
FT                   /translation="MREVMTKSMARNIFYGGSLFFILIFLALSAHSHMYIRSTSTNAET
FT                   LTASVADGKHVWEKHACINCHSILGEGAYFAPELGNVMTRWGVQDDPDAAFEMLKGWME
FT                   AQPTGIEGRRQMPRFDLSDTEMRNLSDFLLWTNTIDTQGWPPNDAG"
FT   gene            239774..240742
FT                   /locus_tag="SPOA0218"
FT   CDS_pept        239774..240742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0218"
FT                   /product="magnesium transporter, CorA family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97352"
FT                   /db_xref="GOA:Q5LL11"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL11"
FT                   /protein_id="AAV97352.1"
FT                   /translation="MRAHSLTPICIFDFEDGRAIPVAEDWPAAAPASGAGFRWLHLDLS
FT                   DPASADWLHAHIPPVAASALAQAETRPRCDPLADGILLNLRGVNLNPGSAREDMVSLRL
FT                   WVTPALVVTARIRRIRATDELRQQSDSGRGPGSVALFLSELLHGLSHRIETVSLELDDR
FT                   TDGIEEEALQGAGDMHDRLSALRLTVIKLRRYLHPQREALDALLRNEAGLFDSAGLVLL
FT                   REAVDRTRRTIEELDATRDRLAAVQDQIASEQVRLLGRNSFVLSVVAAVFLPLGFLTGL
FT                   FGVNIAGMPGTGTPLAFWLLAGASALLGLAIVLLFRLLKWL"
FT   gene            complement(240753..241925)
FT                   /locus_tag="SPOA0219"
FT   CDS_pept        complement(240753..241925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0219"
FT                   /product="NnrS, putative"
FT                   /note="identified by match to protein family HMM PF05940"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97353"
FT                   /db_xref="GOA:Q5LL10"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL10"
FT                   /protein_id="AAV97353.1"
FT                   /translation="MTALARLFSEGYRVFFLAAGLYGLFAGAIWVLYLAGDGPALAQVP
FT                   SQWHAHEMVFGYATAALGGFFLTAVPSWTGAPGARQGFIALAAGMWLAGRLAVWYAGVL
FT                   PPVWVAVLDLAFLPVLSLKIVTQLLKRPKPQNLMFLLFLAYLWAADLWLHLDWIGTGYG
FT                   DTETGLRAGLAVLCALISVLGGRITPAFTRNAMKRAGVAETLWPVSRAPLERAAVVLAL
FT                   LLPGMVLGGAPAGLSGAVALAFGAVQALRLMRWGGLWCLSQPILWALHLALAMLAAGMI
FT                   LWGLAGLGLGSELAALHLLGIGCVGGMTLAVMSRAALGHSGRPLVAPGPMVLGYGLMAA
FT                   AALTRWAGSGFEALYLPAMLLAAALWTAAFATYLAAMWPALIGPRAGAAG"
FT   gene            242141..243835
FT                   /gene="nirS"
FT                   /locus_tag="SPOA0220"
FT   CDS_pept        242141..243835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirS"
FT                   /locus_tag="SPOA0220"
FT                   /product="cytochrome cd1 nitrite reductase"
FT                   /EC_number="1.7.2.1"
FT                   /note="identified by similarity to SP:P24474; match to
FT                   protein family HMM PF00034; match to protein family HMM
FT                   PF02239"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97354"
FT                   /db_xref="GOA:Q5LL09"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL09"
FT                   /protein_id="AAV97354.1"
FT                   /translation="MALGLAAPMVAAQDSHGSDAGAAYQPSMTTLGALNLEIPGRREGD
FT                   PVMTQEEYNIGNKIYFERCAGCHGVLRKGATGKPLTTDITRDVGYEYLRDFITYGSPAG
FT                   MPNWGTSGEMSEEEIDIMARYILLDPASPPEFGMAEMRETWKVLVAPADRPTEKMNDID
FT                   IDNLFSVTLRDSGQVALIDGASYKIHAVIDTGYAVHISRISASGRYLFVIGRDALVNMI
FT                   DLWMETPATVAQIKVGSEARSIETSKFKGFEDMYAIAGSYWPPQYVIMDGDTLEPLKIK
FT                   STRGMVYDDQSYHPEPRVASIVASHFNPEFIVNVKETGKILMIDYSDIKNLKVTEIEAE
FT                   RFLHDGGFDSSKRYFLVAANARGKVAVVDTKDSTLTALVETGGQTPHPGRGANLMHPTY
FT                   GPVWATSHLGDETVALIGTDPEGHPDNAWKVVQTLYAQGGGSLFVKSHPTSEHLYVDAP
FT                   LNPDAEISGSVAVFKLGDLAQEEPEYTVLPIVEWAEIGEGQPRVVQGEFNQEGNEIWFS
FT                   VWNAKDLESAIVVVDDKTLELKAVIKDPRLITPTGKFNVYNTRADVY"
FT   gene            243923..244696
FT                   /gene="nirE"
FT                   /locus_tag="SPOA0221"
FT   CDS_pept        243923..244696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirE"
FT                   /locus_tag="SPOA0221"
FT                   /product="nitrite reductase heme biosynthesis E protein"
FT                   /note="identified by similarity to SP:Q51701; match to
FT                   protein family HMM PF00590; match to protein family HMM
FT                   TIGR01469"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97355"
FT                   /db_xref="GOA:Q5LL08"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL08"
FT                   /protein_id="AAV97355.1"
FT                   /translation="MTPAGHVHLIGAGPGDPDLLTLRALRLLQEAQVVVYDRLVDPRIV
FT                   AMAPEGARMIPVGKSPKCHPVPQDRINRILLDEARAGHVVARLKGGDPMIFGRGSEEAA
FT                   FLMAHGVRVDYAPGITAAQGASSATGVPLTHRGLATGVQYVTGHRQAGQVLDLDWKRLA
FT                   DPDTTLVVYMGVANIGQIAIGLMTENLPATTPVLAISRATTPGERRLLSRLDRIAADAR
FT                   AEALEAPTLFIIGKVVSLYAQQPVTDLLEQAVAHG"
FT   gene            244716..245048
FT                   /gene="nirC"
FT                   /locus_tag="SPOA0222"
FT   CDS_pept        244716..245048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirC"
FT                   /locus_tag="SPOA0222"
FT                   /product="cytochrome c55X"
FT                   /note="identified by similarity to SP:Q51702"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97356"
FT                   /db_xref="GOA:Q5LL07"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL07"
FT                   /protein_id="AAV97356.1"
FT                   /translation="MQAGTALGTGKALLTIAAFLATTAFAAETLDPDALRRLVQQDCGS
FT                   CHGLTLKGGLGPDIRPEALGHFDREVLTGVILDGIPDTAMPPWRPLLTEEEAEWIARYL
FT                   QDPEAR"
FT   gene            245045..246190
FT                   /gene="nirF"
FT                   /locus_tag="SPOA0223"
FT   CDS_pept        245045..246190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirF"
FT                   /locus_tag="SPOA0223"
FT                   /product="cytochrome cd1 nitrite reductase"
FT                   /EC_number="1.7.2.1"
FT                   /note="identified by similarity to SP:Q51480; match to
FT                   protein family HMM PF02239"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97357"
FT                   /db_xref="GOA:Q5LL06"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL06"
FT                   /protein_id="AAV97357.1"
FT                   /translation="MKPLVLTLVAALMAGTAGAQTVATGDLGLVIERATGSVLLVDQSE
FT                   RAALARIEGLGDLSHASLVYSPDERFAYVFGRDGGLTKLDITTRQIVNRVLQSGNAIGG
FT                   AISDDGRLVAVSNYDPGGVRVFDADTLEMVADIPTGGKTIGLVDAPGRRFVFTVWDTGE
FT                   TWIADFTSPEPMLTTIPGMGKNPYDALITGNGRTYITGLFGEDGLSALDLWDETPQPIR
FT                   VLPGYGRGQQEMPVYKMPHLEGWALTGREFVLPAVGHAQVLWVDADTLTETGRTATHGQ
FT                   PVFAMARPDGRQVWVNFAHPLNDTIQVIDTVSKEVIHQFKPGPAVLHMEFTPRGHEVWI
FT                   SVRDAGKVMVYDTRTFEKLREIEADSPSGIFFTVRAHRTGL"
FT   gene            246196..247188
FT                   /locus_tag="SPOA0224"
FT   CDS_pept        246196..247188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0224"
FT                   /product="nitrite reductase heme biosynthesis D/L protein,
FT                   putative"
FT                   /note="appears to be fusion of nirD and nir; Lidentified by
FT                   similarity to PIR:G83581; match to protein family HMM
FT                   PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97358"
FT                   /db_xref="GOA:Q5LL05"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL05"
FT                   /protein_id="AAV97358.1"
FT                   /translation="MCQITDPVDRALLDDWQRNFPITDRPFLGLAEQLGISEHEVITRL
FT                   ARMQAAGRITRVGATIAPGSASASTLAAVAAPEDRIEEIAGMIGAEPGVNHNYQREDDW
FT                   NLWFVATGPDRAHVDATLARIGAASGLRVLDLRLLRPFNVDLGFRMGAGAPRVPTRRAV
FT                   DASVLRPGDTDLLQALTQGLPLVPAPYAALAEGLGLTPSAAMARIALLQQAGVISRLGV
FT                   IVRHRALGWSSNAMVVWDLPSERIDSAGPTLAAHPGVTLCYERRPVPGVWPYRLYTMIH
FT                   ARSRREALAVLDSAKALPELADTPHKVLFSTRCFKQTGALIKPRKEEAA"
FT   gene            247185..247634
FT                   /gene="nirG"
FT                   /locus_tag="SPOA0225"
FT   CDS_pept        247185..247634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirG"
FT                   /locus_tag="SPOA0225"
FT                   /product="nitrite reductase heme biosynthesis G protein"
FT                   /note="identified by similarity to SP:Q52524"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97359"
FT                   /db_xref="GOA:Q5LL04"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL04"
FT                   /protein_id="AAV97359.1"
FT                   /translation="MTPDATDRRILNRMQEDLPLTAHPYAAVAAELGLTEDDLLERLAR
FT                   MKAARLITRFGPFFDAAAMGGAFCLCAMAVPEAEFESVLTKVNAHPEVAHNYERTHRLN
FT                   MWFVLATETPQGIAATADAIETETGIAVLRFPKLQEFFIGFRVAA"
FT   gene            247631..248113
FT                   /gene="nirH"
FT                   /locus_tag="SPOA0226"
FT   CDS_pept        247631..248113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirH"
FT                   /locus_tag="SPOA0226"
FT                   /product="nitrite reductase heme biosynthesis H protein"
FT                   /note="identified by similarity to SP:Q52525"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97360"
FT                   /db_xref="GOA:Q5LL03"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL03"
FT                   /protein_id="AAV97360.1"
FT                   /translation="MIDETDRRIIAAMQEGLPLVPAPFARVAADLALPEPELMERIAAL
FT                   KARGVVRRIAAAPNHYKLGMTSNGMTVWNVDDARIADLGARVGALPFVTHCYERPRALP
FT                   DWPYNLFAMVHGADRDEVEAKRAEIAALLGTACRGHDILYSTRILKKTGLRLKERT"
FT   gene            248115..249326
FT                   /gene="nirJ"
FT                   /locus_tag="SPOA0227"
FT   CDS_pept        248115..249326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirJ"
FT                   /locus_tag="SPOA0227"
FT                   /product="nitrite reductase heme biosynthesis J protein"
FT                   /note="identified by similarity to PIR:C83581; match to
FT                   protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97361"
FT                   /db_xref="GOA:Q5LL02"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023992"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL02"
FT                   /protein_id="AAV97361.1"
FT                   /translation="MFRLTEYMHQLIAPTPVRQRRPGPVKPVVIWNLTRRCNLKCRHCY
FT                   TVSADVDFPGELSHEQAMETLEDLGRFKVPAIILSGGEPLDRFDFFDIAMRARQMVPML
FT                   ALSTNGTRIHGETADRIADVGFSYVGISLDGIGATNDWFRGVEGAFADALRGVRACKAR
FT                   GIKVGLRFCLTEGTQHHLPNLLQLCDDEGVDKFYLSHLVYAGRGDKNRGEDAAHLRTRH
FT                   AMDLLLDRAWVAAAEDMPLDIVTGNNDADAGYFLDWVRRNFDAAKVAHIRAHLAAWGGN
FT                   SSGLGVANIDNLGRVHPDTYWSDYTVGNVKTAPFSQLWTGDDPMLALLRTRPRPLKGRC
FT                   GACTLKDVCGGNTRIRALQLTGDPWAEDPACYLSDAEIGVTGSDRLTVTPFRGKKHDPA
FT                   HQFF"
FT   gene            249427..250938
FT                   /gene="nirN"
FT                   /locus_tag="SPOA0228"
FT   CDS_pept        249427..250938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirN"
FT                   /locus_tag="SPOA0228"
FT                   /product="nitrite reductase protein N"
FT                   /EC_number="1.7.2.1"
FT                   /note="identified by similarity to GB:BAA12683.1; match to
FT                   protein family HMM PF00034; match to protein family HMM
FT                   PF02239"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97362"
FT                   /db_xref="GOA:Q5LL01"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL01"
FT                   /protein_id="AAV97362.1"
FT                   /translation="MLAGPVVAGPAEDYAEYCASCHGAARLGGLGPALIPETLGRMRGP
FT                   KVAAVIREGRTATQMPGFSDTLDEAAIAALAEYVKEPLAEIPAWGEGEIMASRVLDGDY
FT                   VAAAAPVWDADPMNITLVVETGDHHVSVLDGDTFDVLDRFETPFAVHGGPKFSPDGRYV
FT                   FIMSRDGWVQKYDLWSLQQVGRVRAGLNSRNIAMSHDGKWLAVANYLPMSLTLLSTEDL
FT                   SVAKVMKVTAKDGTPSRVSAVYQAPQRQSFILALKDAPEIWEVATDPDAHPVYEGFIHS
FT                   REKGMVEAIASSEGLFARRRIEISEPLDDFFFSDDYRNLIGAARDGVRGVVVNLNVGRE
FT                   IAELPLEGMPHLGSGISWARDGRRVMATPHLKEGKLSVIDTESWTRIATIETEGPGFFL
FT                   RSHENTPYFWADVFFGPNKDAMHVIDKQSLEIVRTLRPAPGKTVAHVEFTRDGKHALVS
FT                   VWEEDGAVIVYDAATLEELRRLPMKKPSGKYNVWNKITFSEGTSH"
FT   gene            250979..251170
FT                   /locus_tag="SPOA0229"
FT   CDS_pept        250979..251170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0229"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97363"
FT                   /db_xref="GOA:Q5LL00"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LL00"
FT                   /protein_id="AAV97363.1"
FT                   /translation="MLLWPAVTATVAINLFMAALMLRVLGGTPLGPVAALLWSLPLGIP
FT                   ASWLAGRWLRRLLDEAES"
FT   gene            complement(251221..252138)
FT                   /locus_tag="SPOA0230"
FT   CDS_pept        complement(251221..252138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0230"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97364"
FT                   /db_xref="GOA:Q5LKZ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ9"
FT                   /protein_id="AAV97364.1"
FT                   /translation="MVAKQISKADIHLLRVFCIVVDSQGFSNAQVALNVATSTISRQIS
FT                   ELETRLGMRLCDRGRSGFRVTEKGETVYQAAQKLFGALGEFQETVDGSRGRLFGHLALG
FT                   IIENWASNTSAPIVQALSRFTDLAPDVTIELHSLAPDDIEFAVLDGRVPIGIGVFHSPK
FT                   PGILYTKVCEERVCLYCGSGHPLFHMTNLEDEERVLRQAQFAKRAYLNEDVVAPKTRNL
FT                   PSNATAHQMEAIALLILTDKYVGYLPSYFAEEWVAKGRMKIVAGGSFDRPVSVQTATRR
FT                   GMKLNSVGRTFLDILTAEAVKQGG"
FT   gene            252309..253250
FT                   /locus_tag="SPOA0231"
FT   CDS_pept        252309..253250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0231"
FT                   /product="glycine betaine/proline ABC transporter,
FT                   periplasmic substrate-binding protein"
FT                   /note="identified by similarity to SP:P14177; match to
FT                   protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97365"
FT                   /db_xref="GOA:Q5LKZ8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ8"
FT                   /protein_id="AAV97365.1"
FT                   /translation="MENLTRWMTTTVMLSLGTSAFAADVVIGVPNWPSVRATAHVLKIV
FT                   LEDNLGLEVELQNGSNPIIFEAMDAGAMQVHPEVWLPNQSNLHNTFVKEKGTVAMNPNG
FT                   IAADQAMCVTRGTAERTGIKALSELSDPDMAAKFDSDGDGLGEIWIGAAGWASTNVEKI
FT                   RAKSYGYDQTMTLKEMDETLALAEVDAATDQDTNIAFFCYTPHHMFQLYDLVLLEEPPH
FT                   DPAQWKVAQPTDDPNWLENSSAAVAWDKAYLHIHYQAEMDPAAAAVLAKVDLTSDQVSA
FT                   MVYALIVDGMDAEAFARNWVEENADQVDSWLN"
FT   gene            253363..254415
FT                   /gene="opuAA"
FT                   /locus_tag="SPOA0232"
FT   CDS_pept        253363..254415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="SPOA0232"
FT                   /product="glycine betaine/proline ABC transporter,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.32"
FT                   /note="identified by similarity to SP:P46920; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01186"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97366"
FT                   /db_xref="GOA:Q5LKZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ7"
FT                   /protein_id="AAV97366.1"
FT                   /translation="MGTDEVIRLERVWKVFGEQAEDAIAAIQARGLSKAEVLGEFGCVV
FT                   GIANCSFSVKKGEIFCVMGLSGSGKSTMVRHINRLIEPSAGSITVLGQDVLALSPDQLR
FT                   KMRATNLGMVFQHMALLPHRTVRDNVAFPLQVRGEPKSRRWEVSQRCLEMVDLQGYEDR
FT                   FPRELSGGMQQRVGLARALASDPDVLLMDEPFSALDPLIRRQLQDQFMALSAELGKTTV
FT                   FITHDLDEAIRIGTRIAIMKDGRIVQIGTPEEIVTRPADDYVRDFVDGISKLKLVFAHS
FT                   IMVPISQYRAKHWENLDASIRVSHATDLDHLIDVSTATEQPIVITADDGTDVGVIDKPT
FT                   LLKGIQGGKA"
FT   gene            254412..255986
FT                   /locus_tag="SPOA0233"
FT   CDS_pept        254412..255986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0233"
FT                   /product="glycine betaine/proline ABC transporter, permease
FT                   protein, putative"
FT                   /note="identified by similarity to SP:P14176; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97367"
FT                   /db_xref="GOA:Q5LKZ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ6"
FT                   /protein_id="AAV97367.1"
FT                   /translation="MSDMGMQGGPVAPSTAVGDFAGQNGAYYSAAFKRIQDTTGFAWSW
FT                   NTMAALFGPIWGAARGVWGFFWMFLVLELFALVQLGRGLWGELGSQQLAKLDRALANIA
FT                   KREAQAAELQAAGDAAGAEAKLKIAENLKKVAARAQEQADLAAAEATSILLIGLALLLL
FT                   VKLLEGFYANIAYEAHYLKWRAKPQSQQAGIRTSSIVFGVVMVLAIVPLTLLRFTVTNP
FT                   DQVLARLTGGLFGDTIPVTHFPVEKEYFSALSKRGDAGFDWAADNFSDAFDGITAGIRW
FT                   FLDGLEILLLQTPWPVVMLVIVVAASRLAGLRVAIFTAASLAYLAFMGLWELSMITVAL
FT                   IGTGAILCILIGVPFGIWFGKSRRAYAIAEPVLDFMQTMPAFVYLIPIIAFFGTGKPPG
FT                   VLATLIFAMPPVVRLTALGMRGVPETTKEAAIAFGCSPWQLLFNVELPLALPSIMTGIN
FT                   QTILMSLSMVVIASLIGADGLGALILESLQYAAKGQGLLGGLAILLCAMVIDRIAQGIY
FT                   RKRVGGA"
FT   gene            256041..257039
FT                   /locus_tag="SPOA0234"
FT   CDS_pept        256041..257039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0234"
FT                   /product="agmatinase, putative"
FT                   /note="identified by similarity to SP:Q9BSE5; match to
FT                   protein family HMM PF00491"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97368"
FT                   /db_xref="GOA:Q5LKZ5"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ5"
FT                   /protein_id="AAV97368.1"
FT                   /translation="MSDPHLNSMMENLYWWGIPTLFRCPNLPPAGQDIALVGVPHSTGN
FT                   GTTERDQHLGPRALRNVSSMQRRMHGGFGLDPWSAAKIADLGDVPFPRANDNEDCIEQI
FT                   TRFFREIDAAGARPISVGGDHSITGGIIQALGCGAITRGQPVCLLHLDAHTDVFTKVDH
FT                   FLGARKSAAHWGAYLADQGKVDPGHSMQIGLRGHARTLDWLQPSYDYGYNVVTMKEFRQ
FT                   RGLADVVAQIGEVLAGRPVYITFDLDCLDPTIAPGVSNIEAGERGFDIDEAIGLLNAVR
FT                   GLNIIGGDIVCMMPTKDSPNQITALTAGAVMFEMISMVAENIANQARGAGT"
FT   gene            257036..258022
FT                   /gene="speB-4"
FT                   /locus_tag="SPOA0235"
FT   CDS_pept        257036..258022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB-4"
FT                   /locus_tag="SPOA0235"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="identified by similarity to SP:Q9BSE5; match to
FT                   protein family HMM PF00491; match to protein family HMM
FT                   TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97369"
FT                   /db_xref="GOA:Q5LKZ4"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ4"
FT                   /protein_id="AAV97369.1"
FT                   /translation="MSQKDTEFFQPVSGMDLPRFAGVPTFMRLPHVTPDHAAYDQVQIG
FT                   LVGVPWDAGTTNRPGPRHGPRQLRDLSTMIRAGNPATGVNPFALVNCADLGDVAPNPID
FT                   IMDCMDRISRFYAGLKSSGILPVTAGGDHLTTLPVLRGLASDAPVGLIQFDSHTDLFDS
FT                   YFGGNKYTHGTPFRRAIEEGLVDPRRMVQIGIRGTAYNTEDVEWGEAQGVRIIRIEEFF
FT                   DRGVADVMAEARDIVGDKPTYCTFDIDFVDPAYAPGTGTPEVGGPNSFQALQVVRELSG
FT                   LTLIGADLVEVSPPFDAQGNTAWLGASILFEMLCVCAKAISARARDA"
FT   gene            258234..259955
FT                   /gene="dctB"
FT                   /locus_tag="SPOA0236"
FT   CDS_pept        258234..259955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB"
FT                   /locus_tag="SPOA0236"
FT                   /product="C4-dicarboxylate transport sensor protein dctB"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to SP:P10047; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97370"
FT                   /db_xref="GOA:Q5LKZ3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ3"
FT                   /protein_id="AAV97370.1"
FT                   /translation="MRLRSFVFPTIATAVVAISVFKVSYGYFQSEERTKARGRLSLYQT
FT                   SVSGELERFSHLTYVLARDPVVIETANGGARRDLNIRLEAFAKQAGLDAIYLIKPDGFT
FT                   IAASNHREPGSFVGQNYAFRPYFQDALAGQQGRFYAIGATTGLPGYFIADAVHGDPETP
FT                   AGVIAIKISLTKLEESWLGSGEQVFLANQDGVVLLASDPAWRYKTLSPLSDMRRQEIKA
FT                   ARQFSGQELDPLDWAVLPDRRARIAGSERLHLVGSDLPHGWELHFFASDDQALTRSWLV
FT                   TALVVILAAIGFIAFQIQRARRVDAELRRSAREEAELRLANEQLAKEIQERMTAERRLK
FT                   RTQSELERASRLAALGRLAASVTHELGQPIAAMRNHLVATEMAGGAQTRLAANIAGLVE
FT                   RMEGITRQLKFFASSTTEEFTAIDLRDAIRVSLDLVAPNLEQSGTGVRLDLPDTPVHIR
FT                   GIRLRIEQVMTNLLRNAIDATEDSTDPMIRIRAGTDSDDAWVEIKDNGHGLGTATLADL
FT                   QEPFVTTRESGRGMGLGLAISASIVKDHDGKMSACDSDTGGAVFRVTFPLTASEDG"
FT   gene            259961..261301
FT                   /gene="dctD-2"
FT                   /locus_tag="SPOA0237"
FT   CDS_pept        259961..261301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctD-2"
FT                   /locus_tag="SPOA0237"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein DctD"
FT                   /note="identified by similarity to SP:P13632; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00158; match to protein family HMM PF02954; match to
FT                   protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97371"
FT                   /db_xref="GOA:Q5LKZ2"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ2"
FT                   /protein_id="AAV97371.1"
FT                   /translation="MEERRPYSILVIDDDKSMRLSLVDLLEAAGWQVEAIARATLVAAK
FT                   LDDNPPDVILSDIRMPGMTGLELLSSLDHASAPPLVLISAHGDIPMAVQAMRDGAYSFV
FT                   EKPYEPRRLLSILTHAAEQNRMQQDNSRLKERLIRLSGLDRILLGQTAEIVSLRQDILD
FT                   LAGTRATVLITGETGTGKELVAHALHDLGGDGQAPFLALNCAALSQDTFETEMFGIAGQ
FT                   SEGRLAKASGGTLFLDEICSCPAAVQAKLLRVLEDKQILPVGASSAIKAEFRVISATSE
FT                   DVQDAVSAGRLRQDLLFRINTVVLGLPSLRHRRDDLMLLARHFLEHYAHVYELAVPKMS
FT                   QDDMAALLAHDWPGNVRELRNVCERRVLAARRGGGSMARAIAADQQLDDVPGTLREAVA
FT                   VFERELISKAIQAHEGRMDAAAEALGIGRRTLNEKIVKLGLDKGALL"
FT   gene            261428..262441
FT                   /locus_tag="SPOA0238"
FT   CDS_pept        261428..262441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0238"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="identified by similarity to SP:P37735; match to
FT                   protein family HMM PF03480"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97372"
FT                   /db_xref="GOA:Q5LKZ1"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ1"
FT                   /protein_id="AAV97372.1"
FT                   /translation="MQNTLKGVAIAALTVSFVGEAGATEWNVSVWGKRRAFTEHVEKLA
FT                   ELVSEKTGGAFTINVSYGGLSKPKENLDGISIGAFEMAQFCAGYHADKNRAITVLELPF
FT                   LGVNTLAEEVAVSNAVYAHPAAQQEMAQWNARLLMTSPMPQYNLVGTGAPRDELAEFEG
FT                   MRVRATGGLGAAFSAVGGVPTSVPATEAYNAMESGVVDTVAFAQHAHLSFGTINKADWW
FT                   TANLNPGTVNCPVVVNIDAYEALSDDERAALDSSVDEAIAHYLTNYGALLKKWDDVLAE
FT                   KGVEKVMISDAVLEEFRAKVAGPISAKWVEDMTAQGLPGQELLDLVHATLKAARGS"
FT   gene            262516..263151
FT                   /locus_tag="SPOA0239"
FT   CDS_pept        262516..263151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0239"
FT                   /product="TRAP dicarboxylate transporter, DctQ subunit"
FT                   /note="identified by match to protein family HMM PF04290"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97373"
FT                   /db_xref="GOA:Q5LKZ0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKZ0"
FT                   /protein_id="AAV97373.1"
FT                   /translation="MAGHASVLQDGSALSRLDRALLRLERGLALISGLAVFSLMLLAVV
FT                   SVGGRNAMNAPLPGYVDWIEQAMPLIAFMGIAFVQREGGHIRMDLVIGQLKGRALWLFE
FT                   LISVLLILGLMMLLVWGSWAHFLRAFDMGAPLWSRDSSIDIGIPLWPSKLLAPVAFSVL
FT                   CLRLGLQVWGYGRAFVLGLEAPVAVPLIQDVAAQAAAEAEQLAGHDNG"
FT   gene            263144..264544
FT                   /locus_tag="SPOA0240"
FT   CDS_pept        263144..264544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0240"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /note="identified by match to protein family HMM PF06808"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97374"
FT                   /db_xref="GOA:Q5LKY9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY9"
FT                   /protein_id="AAV97374.1"
FT                   /translation="MDSIDIGLWVTGGLLVLVLTGMRVAFAAALAGLVGLVWIFWAKFG
FT                   YDPDRFGKALTVAVKTAGQVPHSKVSSQALSLIPTFILIGYLAYYAGLTRALFEAAKRW
FT                   MAWVPGGLAVSTVFATAGFAAVSGASVATSAVFARIAIPEMLAIGYNKRFAAGVVAAAG
FT                   TLASLIPPSAILVIYAIIVEQDVGKLLLAGFVPGAFSAVIYVALIVGIAVVFKSVGPPV
FT                   TGFTWRQRFASLPGALPIVFVVVIIISFVYNPFGGDAWGTPTEGGALGAFVVFCMAVFR
FT                   GMKWAEFKSALLETAKLTVMIFTIIWGVLIYVRFLGFADLPGAFSDWITSLQMSPMLIL
FT                   VCILLAYAVLGMFMDAIGMLLLTLPVVYPAVMALNGGEAVSAADSAFGMSGPMCAIWFG
FT                   ILVVKMAEFCLITPPIGLNCFVVAGVRPDLSVQDVFRGVMPFFVADAVTIALLVAFPQI
FT                   VLWLPGQV"
FT   gene            complement(264766..265689)
FT                   /locus_tag="SPOA0241"
FT   CDS_pept        complement(264766..265689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0241"
FT                   /product="gluconolactonase, putative"
FT                   /note="identified by match to protein family HMM PF03758"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97375"
FT                   /db_xref="GOA:Q5LKY8"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY8"
FT                   /protein_id="AAV97375.1"
FT                   /translation="MFGVLEGTGFETIELEFNACFIGHARVERLWTGARWSEGPAWFPA
FT                   GRYLIWSDIPNNRIMRWDETDGSVSEFRRPSNNSNGNTVDGQGRLVSCEHLARRVTRTE
FT                   HDGEITVIAEAVAGKRLNSPNDVVVKSDGSIWFTDPAYGIMMDYEGDRAESEIGACHVY
FT                   RWDPETLRVTAVATDFVKPNGLAFSADEKSLFVSDTGGTHQEGGPAHIRKLTLMPDGKG
FT                   VSGGEVFAECSNGFFDGFRLDRDGRIWSSAADGVHCLNPEGRLIGKIHIPEIVGNLCFG
FT                   GAKLNRLFIAATSSLYAVYLNVNGLK"
FT   gene            complement(265820..266860)
FT                   /locus_tag="SPOA0242"
FT   CDS_pept        complement(265820..266860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0242"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97376"
FT                   /db_xref="GOA:Q5LKY7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:3E3M"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY7"
FT                   /protein_id="AAV97376.1"
FT                   /translation="MDSRKPGHRPVTMRDVAKAAGVSRMTVSRALKKDSPISSETRERI
FT                   LKVVKDMNYVPDQVAGSLTTKRSGFVGLLLPSLNNLHFAQTAQSLTDVLEQGGLQLLLG
FT                   YTAYSPEREEQLVETMLRRRPEAMVLSYDGHTEQTIRLLQRASIPIVEIWEKPAHPIGH
FT                   TVGFSNERAAYDMTNALLARGFRKIVFLGEKDDDWTRGAARRAGFKRAMREAGLNPDQE
FT                   IRLGAPPLSIEDGVAAAELILQEYPDTDCIFCVSDMPAFGLLSRLKSIGVAVPEQVSVV
FT                   GFGNFEVSRFASPEISTVRVDPIAIGRETGSLILRLLDPKQRSPQTAQHITLPPVLEFR
FT                   PSLKNL"
FT   gene            complement(266928..268430)
FT                   /locus_tag="SPOA0243"
FT   CDS_pept        complement(266928..268430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0243"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97377"
FT                   /db_xref="GOA:Q5LKY6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY6"
FT                   /protein_id="AAV97377.1"
FT                   /translation="MINGKNLIDGVWVGSDNVAHSADLAGQSFALATKAQVNAACQAAR
FT                   RDFRAYSKTARGERAAFLRAIAEEIDKLGDEITRTGMAETGLPEMRLIGERGRTTGQLR
FT                   MFADLIEGTDYLDIRKDGALPDRAPLPRPDLRLTHKAIGPVVVFGASNFPLAFSTAGGD
FT                   TASALAAGCPVIVKGHSAHAGTADLVAQAIETAILACNMPKATFQMLQGSGREVGSALV
FT                   QHPEITAVGFTGSLAGGRELYDQCHARPHPIPFYGELGSVNPMFCLPAAMDARAAEIGA
FT                   GWAASLTMGAGQFCTNPGIAVMVKGDPADALEAACVDALRKTPEQKMLTDGIHKAFESG
FT                   VKGVSGLIEEVAGCGTAKAARSGLPALFKVTARAWMANPILQQEIFGSAGIIVLCDDVA
FT                   EMVELAEILEGQLTVTLHLDDADADLAAVLMPIVEEKAGRILANGFATGVEVCSSMMHG
FT                   GPYPASTDVRATSVGTLAIARWLRPVSYQNIPSALLPSELRE"
FT   gene            complement(268432..269346)
FT                   /locus_tag="SPOA0244"
FT   CDS_pept        complement(268432..269346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0244"
FT                   /product="dihydrodipicolinate synthase family protein"
FT                   /note="identified by match to protein family HMM PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97378"
FT                   /db_xref="GOA:Q5LKY5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY5"
FT                   /protein_id="AAV97378.1"
FT                   /translation="MSTRYTGIWPVAPTPFHDDGSLDLDGMKRVLDCLIDQGADGICIL
FT                   ANFSEQFLISDAERETLTRLCLEHVAGRVPMIVTISHFATQIAVERARFAKGLGADIVM
FT                   MMPPYHGALLKGTAQQTFDQFKAVGEVGIPIMVQDAPLSGVDLPVPLLVRMAQEIDMVR
FT                   LFKIECPRAANKLRALIEQGGAAIEAPFDGEEAITLLADLDAGATGSMTSGMIVDQIKP
FT                   VLTHYHAGRLDEATAAYGRVAMAINHENRQCGWQSCKAAMVEGGVIRSDFCRHPIDPLH
FT                   PAIRARLIDLLRPLDPLVLNWGK"
FT   gene            complement(269349..270524)
FT                   /locus_tag="SPOA0245"
FT   CDS_pept        complement(269349..270524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0245"
FT                   /product="galactonate dehydratase, putative"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97379"
FT                   /db_xref="GOA:Q5LKY4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034619"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY4"
FT                   /protein_id="AAV97379.1"
FT                   /translation="MSKIKSVRTRVWNWTGPTVPPTGNFCTNASDVLWDKGDAMSSFRF
FT                   HQWLTCEVETDDGTIGIGNAALAPTVVKKAIDDWFAPMVIGEDPFDYAYLWEKMYRRSH
FT                   AWGRKGIGMTAISAVDLAIWDLMGKLTGKPVFKLLGGRTKEKIPVYYSKLYSGPIDTMQ
FT                   AEAEEARKNNYPGYKMRFGWGPKDGMAGMRENLKRVEAVREVIGYDVDLMLECYQGWNL
FT                   DYTKRMLPKLVKYEPRWLEEPVIADDVEGYRELNAMNIVPISGGEHEFSVIGCKDLIEK
FT                   KAVSVLQYDTNRVGGITAAQKINAIAEAFQVPVIPHAGQMHNYHLTMANANCMISEYFP
FT                   VFDVEVGNELFYYIFEGDPAAVDGFLDLDDNIPGLGISITDKYLKHFEIQE"
FT   gene            complement(270521..271546)
FT                   /gene="pdxA-2"
FT                   /locus_tag="SPOA0246"
FT   CDS_pept        complement(270521..271546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA-2"
FT                   /locus_tag="SPOA0246"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by similarity to SP:P19624; match to
FT                   protein family HMM PF04166; match to protein family HMM
FT                   TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97380"
FT                   /db_xref="GOA:Q5LKY3"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY3"
FT                   /protein_id="AAV97380.1"
FT                   /translation="MSKPRIAIVPGDPSGIGPELIAKLLNDEGVLEAANVLLVGDRHLW
FT                   EQGAAQAGQEVPLNSLDPRAIPIQTGLAHLNMQTIDPSEISIGEVTVAGGTTSLRCLEK
FT                   ALDLAQAGLVDGVLFGPFNKAAMTAAGLNAEDEHKYMARYLGFAGYHSEINVLDDLMTT
FT                   RVTSHIGLKDVAANISQEGILRAVNLANDTLRKAGKARPRIAVAALNPHAGDNGKFGRE
FT                   EIDILEPAVRQAQEKQLDVTGPWPSDTVFLKAKRGEVDAVVTMYHDQGQIAIKLMGFER
FT                   GVTVAGGLPIPVATPAHGTAFDIAGQNKANVGATRQAFDLLVRMAKTHRADREAASGDT
FT                   Q"
FT   gene            complement(271543..272505)
FT                   /locus_tag="SPOA0247"
FT   CDS_pept        complement(271543..272505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM32283.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97381"
FT                   /db_xref="GOA:Q5LKY2"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY2"
FT                   /protein_id="AAV97381.1"
FT                   /translation="MSQTMMLIEKSSHCVSWYDTETGALQGRLALPDFPHEFVVDQDNH
FT                   YAYVGHYGVQNSGVEGTDGRSVIVIDIRKQEIVHRYDLGEHARPHGISLDAQGRLYVLS
FT                   EWSGHLLVKENPRAFDQGWDHVTPVGGEKPHLFALTGDGRTAYSMNLNSGDVTVLDPYD
FT                   PTRIPVSIKTGEKPEGRCLREEAGVLYTSQRISNTVAVVDTKTLQVQRIFPTPQDPCRV
FT                   YYDAKRNRLVTMNHHGGSFSVFDEATGEMLHEQKTPANPLALCIDDEAAYAYIAIDCEQ
FT                   VQRFNLDTFEVVQTFDTGKEPDVMVILPEGYSKHWEVNA"
FT   gene            complement(272618..273043)
FT                   /locus_tag="SPOA0248"
FT   CDS_pept        complement(272618..273043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0248"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAD03997.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97382"
FT                   /db_xref="GOA:Q5LKY1"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY1"
FT                   /protein_id="AAV97382.1"
FT                   /translation="MENTIKTRALTHKGTMKMLEAAIAEAEKIGQPQCIVIVDASGELL
FT                   AEVRMSGAKFLSRKSARSKALTASSIGAPTTNIPEAVRPFIASATGGDVTGLPGGLPII
FT                   SESTLLGGIGVGSGSGNQDIAVAKAALAAIGAETDFA"
FT   gene            complement(273143..274120)
FT                   /locus_tag="SPOA0249"
FT   CDS_pept        complement(273143..274120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0249"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="identified by match to protein family HMM PF03480;
FT                   match to protein family HMM TIGR00787"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97383"
FT                   /db_xref="GOA:Q5LKY0"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKY0"
FT                   /protein_id="AAV97383.1"
FT                   /translation="MNTLKLLAGAAAALAMSLSAAAAETTLKLAHAAPETDLQQAMSLF
FT                   FKEQVEARSNGSVKVNIFPSGQLGNDAQMIDGTRAGIIDISMVGLNNYSGLMPESAAFT
FT                   LPFMFPTRDAAYRVLDGDVGQGVLADMAQFGLKGLGFPENGYRNMTNNRGPIKAPADVA
FT                   GLQMRVNNSKALNDMFAELSANPQQIPVAELYTALETGVVDAQDHPIGVTLSFKFYEVQ
FT                   KYLSMTRHAYSPLALTMNHKAFEGLSDDEQKIVLDVAKEAVDLQRKLSIEKEDGMIADL
FT                   EAAGMTVNDDVDGAAFQAAITPVWDSFVAQHGDGLIKAILAASK"
FT   gene            complement(274138..275418)
FT                   /locus_tag="SPOA0250"
FT   CDS_pept        complement(274138..275418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0250"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="identified by match to protein family HMM PF00597;
FT                   match to protein family HMM PF06808; match to protein
FT                   family HMM TIGR00786"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97384"
FT                   /db_xref="GOA:Q5LKX9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX9"
FT                   /protein_id="AAV97384.1"
FT                   /translation="MTLALFLGVLLVSIFLGLPVAFALLLASIALMFQLDTFSTDILAQ
FT                   SLINGVDSFPLLAIPFFLVAGEVMSAGGLSQRIVRLATSLVGHRRGGLGYVAIFTSILL
FT                   AGLSGSAVADAAALVSILYPMMKKAGYPEGHSMGLLASGGIIAPVIPPSLPLILIGVAG
FT                   GISIKSLFLGGIVPGLLMGLTLVLVWGVLMRKEDLEVAPRATAGERLRAVREGFWALLL
FT                   PVIIIGGIRFGVFTPTEAAVVAAVYAIFVSTLVYRELNLKALFHVLVSAGRATAMVMFL
FT                   VGCAMVAAWLITIAQLPQQLAAMLGPLVDHPRLLMAVIMLIVLAVGMVMDLAPTVLILV
FT                   PLLMPVVKLAGIDPVYFGLMFVINTSIGLITPPVGNVLNVVCGVGRVPMSAAVRGVAPF
FT                   ILAYLALLALFVVFPNIIITPMKFIIG"
FT   gene            complement(275421..275969)
FT                   /locus_tag="SPOA0251"
FT   CDS_pept        complement(275421..275969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0251"
FT                   /product="TRAP dicarboxylate transporter, DctQ subunit"
FT                   /note="identified by match to protein family HMM PF04290"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97385"
FT                   /db_xref="GOA:Q5LKX8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX8"
FT                   /protein_id="AAV97385.1"
FT                   /translation="MRLRCNNTGASGVRVSKTRSVGRPIHMLNWLWKSLDWLIAGLTIG
FT                   MIGLVFANVVLRYGFSSSLRPSVELSRLGLVWVVMMGAVVALRRNEHLAVTEFSETLFP
FT                   RLVPALRRIGWVVILVCVSMLFVGSFNQMNANWGNISQLTGLPSALFYLAGALSGALMI
FT                   LISVVRIFSLQAFQHELGE"
FT   gene            276053..277078
FT                   /locus_tag="SPOA0252"
FT   CDS_pept        276053..277078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0252"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97386"
FT                   /db_xref="GOA:Q5LKX7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX7"
FT                   /protein_id="AAV97386.1"
FT                   /translation="MSLKKNKKIGHKVTLTDVGELAGVSAMTVSKVLRGTGRIPEETRK
FT                   RVRLAAQELGYVTNQLASLLAGASSNMVGVLIPTARDVVYSDILSAINSELRPAGLRTF
FT                   IGESYFDSDVDFEQVSSFLSIRPAALILHGGITRKAETLKLLKKQHCPVIQIWDVENTD
FT                   FDISIGPSHVEAGRLMAEHFLSLGLERVGYVGAEMELDICAAVRANSFERTLNAHGVQL
FT                   IRSVAEDLPRQAEGGEILTRRLLDHHPTIQGIHFLNDAMALGGMRVSFERGISVPDQLK
FT                   IGGFNATSYVHSVRTRLTTISMSYQNIGRKAAQGVIALYSGEQVPQIQVEPITLERGNS
FT                   T"
FT   gene            complement(277117..278247)
FT                   /locus_tag="SPOA0253"
FT   CDS_pept        complement(277117..278247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0253"
FT                   /product="ribose ABC transporter, periplasmic
FT                   ribose-binding protein"
FT                   /note="identified by similarity to SP:P02925; similarity to
FT                   SP:P54300"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97387"
FT                   /db_xref="GOA:Q5LKX6"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX6"
FT                   /protein_id="AAV97387.1"
FT                   /translation="MATSAFCAISSAALADGGQTKLPLLELPGIEDRDYWVPGEVNVEG
FT                   KLEAMQAVVGAKAVPFAGTQAEPIQIAMIYPSADTSDFWARNYIAMTKRLEELGIQFET
FT                   TEFASRQIEHSLQSTYANQVVQDADLYDFVIFGPSELAIQADNIDKMAASEGFSTFVWA
FT                   FHTPLKDLKNQPDGWFDFSSAAGALTMCDYMLGRLGNDVTMAMNRGIPGITDDQRSGDF
FT                   KACVEEKGNWTTIYEHYGEYQREGGFEGTSLILQAYPEATVIHNANTAMAMGSVEAQIS
FT                   VGKEKEVFSTGWGGTGLELDAIRRGELDATPMRMGDDVGAATAEAIKAHLEGRSDELPF
FT                   VFLGRITVAHDQMSAEEIDALEAEAFRFSGVGALER"
FT   gene            complement(278352..279479)
FT                   /gene="rbsC-1"
FT                   /locus_tag="SPOA0254"
FT   CDS_pept        complement(278352..279479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC-1"
FT                   /locus_tag="SPOA0254"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P36948; match to
FT                   protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97388"
FT                   /db_xref="GOA:Q5LKX5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX5"
FT                   /protein_id="AAV97388.1"
FT                   /translation="MTTTTTNLQSKTLMERLEPYLAIIGPMVMIFAILLFMGVAEPARY
FT                   FRLSNLNLILLDAALYMPMAMAMTFVITQRGIDLSIGSIAALSGILMAFLIKQYGFPAW
FT                   VAMPLAIVLGATMGLINGLIITRFKVPDLIGTLAMDLVYRGLALVIAKGLVLARFPDLI
FT                   TEMGRGQIPGFIPVPVVIGLLTMALGYWALTRTHFGRYTISIGSNPEASEMTGIAVDRH
FT                   KIYAYVLMGASAALAGVMLTGKLNAIQATSAPYFNLHVIAAVVVGGTSLFGGRASMLGS
FT                   LAGVLLLSMMINALVTLRIEFFWQSVASGAVIVSSVALYTWMQKKDRDGSRSLLAGLRT
FT                   SEAQKLMKFSALLIGLLILLLAVGAGLATDPKPTG"
FT   gene            complement(279491..280252)
FT                   /locus_tag="SPOA0255"
FT   CDS_pept        complement(279491..280252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0255"
FT                   /product="sugar ABC transporter, ATP binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97389"
FT                   /db_xref="GOA:Q5LKX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX4"
FT                   /protein_id="AAV97389.1"
FT                   /translation="MSDQPLVRMRGITKRFGGVTALQDVDLEAYSGEVLAIVGDNGAGK
FT                   STLIKILTGVYQATEGEIFLDGKRLEMSSHSDAIKVGIDAVYQTLALADHLTPANNMFL
FT                   GNELTKRVLGIPMLDNRRMKSEATRILDERLGVRLRSMDVQTDSLSGGQRQAVAIARAV
FT                   YHEDLRLLVMDEPTAALGPQETARTLKLIKSLRDQGLAVILISHSLDDVFEVADRVHVQ
FT                   RRGRAVGVVNTAQSSVQEVLGLIVGAQDAAA"
FT   gene            complement(280380..281426)
FT                   /locus_tag="SPOA0256"
FT   CDS_pept        complement(280380..281426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0256"
FT                   /product="ribose ABC transporter, periplasmic
FT                   ribose-binding protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97390"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX3"
FT                   /protein_id="AAV97390.1"
FT                   /translation="MLKRTFMAVSTAALLSGLGVPVFAETPFDGPTTGPAAAEGKSIVV
FT                   VAGDLKNGGILGVTNGVKEAVEAIGWELRILDGAGSIQGRTAAIGQAMALRPDGIIING
FT                   FDAVEQQAALEGVVSASIPMVAWHSGPKIGCDAPGGIFANVSTDAMTVSEVAAKWAMEE
FT                   GGSNVGAVIFTDSTYQIAIDKADRIKETIEAMGGTVLEYVDTPIADTSSRMGPLTTSLL
FT                   QKYGDQWTHALAINDLYFDFMGPALASAGIKSADGPQAGSAGDGSEAAFQRIRSGNYQA
FT                   ITVAEPLNLQGWQLVDELNRAIQGEACSGYVTTPALVTKDGLEKLGESNQFDPDSPYRQ
FT                   AYQAIWGN"
FT   gene            complement(281449..282468)
FT                   /gene="rbsC-2"
FT                   /locus_tag="SPOA0257"
FT   CDS_pept        complement(281449..282468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC-2"
FT                   /locus_tag="SPOA0257"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P36948; match to
FT                   protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97391"
FT                   /db_xref="GOA:Q5LKX2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX2"
FT                   /protein_id="AAV97391.1"
FT                   /translation="MQSLESNALEPTKAELKNASSRTRLLRLLPVYGLVILTAFLILLF
FT                   SILLPNTFPTILNLRAIISDKAIIALLSLGAMIPMAAGRIDLTVGYGIVLWHILAISLQ
FT                   TLYGLPWPIAVALVLALGLLTGFLNGLLVEVAKIDSFIATLGTGTVLYALALWHTGGRQ
FT                   MVGALPDSFYAINGTFVFGLPITGFYVLGITVAMWLVLEYTPVGRYLYAIGANQRAAQL
FT                   NGIPTRKFVIGAFMSSGFITAFAGVLLASKLRIGQASVGLEFLLPALVGAFLGSTTIKP
FT                   GRVNVWGTIIGVTILAVGISGIQQFGGSFWVEPMFNGVTLLIAIGIAGYAQRRKGAKK"
FT   gene            complement(282480..283985)
FT                   /gene="rbsA"
FT                   /locus_tag="SPOA0258"
FT   CDS_pept        complement(282480..283985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="SPOA0258"
FT                   /product="ribose ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P36947; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97392"
FT                   /db_xref="GOA:Q5LKX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX1"
FT                   /protein_id="AAV97392.1"
FT                   /translation="MSGALQSNLFFDGIQKHFGGTYALRDVSLNIERGEIVALLGENGA
FT                   GKSTLIKILGGIHKPDEGRVLIDGQAYEHRPGGFGERQSVAFIHQDLGMIEWMTVAENI
FT                   ALALGYSRKAGLISWRSVDAFAQQALDKVGCDIDPTTRVQDLSRTEKSLVAIARALAVD
FT                   CDFLVLDEPTASLPADEVERLFEALRPLKQQGVGMIYVSHRLDEIFQIADRVAVLRDGE
FT                   LVGMRSISHTTPEELVFMIVGRKTRQVIKPQAAPGDTILDVQELQVDAAGPVDFKLRRN
FT                   EIIGLVGLRGAGHEHVSRALFGCEPFSGSVSLNGQVPDLTSPQGALSSGIGLVARDRTA
FT                   ESVAMSLTIRENTFLNPAAVGRSLFSFLTPRQETALAEQIGSDVALSPNDQSMAIESLS
FT                   GGNQQKVVIGRWLETKRQLLICEDPTAGVDVGAKAEIYALLNTALEEGVGIIVVSTDFE
FT                   EVAAICHRAIVFSQGKIAGELTGTELTTENLIQVASASNVATN"
FT   gene            284124..285167
FT                   /locus_tag="SPOA0259"
FT   CDS_pept        284124..285167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0259"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97393"
FT                   /db_xref="GOA:Q5LKX0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKX0"
FT                   /protein_id="AAV97393.1"
FT                   /translation="MSSTQNKPNKNNKVSLAQIAKAAGVSKMTASRVLRDEGGFSESTR
FT                   ARVMAEIDRLGYVPNRLATVFAGDQRSTFVGVSIPELGNEIFAQVLEGIDRKLGAFGHQ
FT                   TVLGMTEHALEQEEKWLETVLSWQPAGLIVTGRSHTPKSIQLLSGAGIPLVEIWDFNSS
FT                   PLDMSVGLNHFDSGYSMGRYLTGLGYRQFGYVGTSHDTANAASARLAGYAKVIGDSGGS
FT                   LKKQLLLKDAPGFYTGYYGTEQLLAANSDVEVIYYQNDNMAVGGLNYCQKRGLSIPGDI
FT                   GIAGWGDLPIASILPYRLTSTAVPHLRIGMIAAEMVLSQINGEARRRSQDVGFTLIPGS
FT                   TVRSQLE"
FT   gene            complement(285382..286890)
FT                   /locus_tag="SPOA0260"
FT   CDS_pept        complement(285382..286890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0260"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97394"
FT                   /db_xref="GOA:Q5LKW9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKW9"
FT                   /protein_id="AAV97394.1"
FT                   /translation="MFKPHGRHLIAGKWVDGDDSFSSEPAHGPSHRFAVGRVADVDAAA
FT                   TAAENAFWSFASSTRAARADLLTAIADEIDACGGAITEIGTQESGLPEARLIGERGRTT
FT                   GQLRLFATHILKGDYLDRRHDAALPDRQPLPRPDLRMIQRPIGPVAVFGASNFPLAFST
FT                   AGGDTAAALAAGCPVVVKAHGAHPGTSEIVAEAVKAAIERCGFHPGVFGLIQGGNRQVG
FT                   AALVQHPLIKAVGFTGSLGGGRALFDLCAARPEPIPFFGELGSVNPMFIFAGALANRGS
FT                   AIAQGWAGSLTMGAGQFCTNPGVAVMLAGPNADAFAQSAAEALAQVAPQTMLTDGIAEA
FT                   YRAGQRRMGAATGVRELLSTPCDQRSAAPSLYATTAKAWLANEELAEEVFGPLGMIVTA
FT                   DSVEEMLAIARDLQGQLTCTVHVDAEDAAAATRFMPVLERKAGRILANGFPTGVEVSDT
FT                   MVHGGPYPASTNFGATSVGTLSIRRFLRPVCYQDMPEGLLPADL"
FT   gene            complement(286995..287675)
FT                   /locus_tag="SPOA0261"
FT   CDS_pept        complement(286995..287675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0261"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97395"
FT                   /db_xref="GOA:Q5LKW8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKW8"
FT                   /protein_id="AAV97395.1"
FT                   /translation="MGGKRAIKRQSLPDVIADDIRERILNGDLTEGMTIRQEALAEEYT
FT                   VSRMPVREALKRLDAEGLVQLTNNLGATVTKHSLDEISEIFDLRILIEVDLFRRAIPVM
FT                   AKADIERCERILEAMESSYDADDVAKWGALNYKYHAALYAPARRSLTNDVLQRVNLQSD
FT                   RYVRMHLSVMRQRDPARKEHRELLELAQAGKVDEACALLTRHISQTKQNLLTLMAAKRA
FT                   SDTA"
FT   gene            complement(287856..289097)
FT                   /locus_tag="SPOA0262"
FT   CDS_pept        complement(287856..289097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0262"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97396"
FT                   /db_xref="GOA:Q5LKW7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKW7"
FT                   /protein_id="AAV97396.1"
FT                   /translation="MEGRDIIVVGAGIIGISTALRLQSCGFKVQVLDRAGVAGEASAAS
FT                   AGAFAFADVVPLATPGIMKKAPKWLLDPLGPLSVPPAYALKIAPWMLRFWRASWRDRFA
FT                   AALDAQARLNGFAKEALERQIAEVDGEPFMQRDGQLQLYEGAREFHASLEGWEHRRRRG
FT                   VMFVHLHSPEAIAEIQPGLAPRFTHAGYTPDWLNTVDPRRWAEHLAHRFQQRGGVIGSA
FT                   DVRSIERHGAGAKLKTAAGDILASRVVVAAGAWSHHLARTLGDRFPLETERGYNTTLPA
FT                   GAFNLRTHLTFSGHGFVVSRINGGVRVGGAVELGGLDLPPNFKRADILLQKAARFLPGL
FT                   TTQGGQRWMGFRPSMPDSLPVIGASARLPNVVYAFGHGHLGLTQSAATAELVADLVSDR
FT                   VPALPMAPYAPSRF"
FT   gene            complement(289097..290407)
FT                   /locus_tag="SPOA0263"
FT   CDS_pept        complement(289097..290407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0263"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /note="identified by match to protein family HMM PF06808;
FT                   match to protein family HMM TIGR00786"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97397"
FT                   /db_xref="GOA:Q5LKW6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKW6"
FT                   /protein_id="AAV97397.1"
FT                   /translation="MAPLLMFAALFVLVFAGVPVAFSLIIIAVVFGYTVFGDLIFLQLY
FT                   GPLLSTASNFVLAAIPLFIFMGAVLERSGIARRLFHALQLWLGGFPGGLSLSTIAMCAI
FT                   FAAASGVVGAVEIVVGLMAIPPMMKAGYRNDLIAGTICAGGSLGTIIPPSVIVVVYASI
FT                   AQLSIGQLFAASIMPGFLMVVFFVGYILIRSLRNPADAPPLPIHDRAIPLKEKMTISLT
FT                   AMLPPLALIVMVLGSLLAGIASATEAAAVGAAGTLLLTLMFRELTLKLVMDSLGVTLRI
FT                   TAMIMLIVAGGTMFTSIFAVTGGGGLVRDAVESIGYGNFGIIAFFLTVVFFSGFVLDWV
FT                   SIVLIFVPIFAPIVKSAGIDPIWFAMMVLVVIQTSYLTPPMAPSIFYLRSIAPRSMTYG
FT                   QMYRGVLPFVGAQMLVLVVIVFFPATVTWLPSILVGL"
FT   gene            complement(290411..290944)
FT                   /locus_tag="SPOA0264"
FT   CDS_pept        complement(290411..290944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0264"
FT                   /product="TRAP transporter, DctQ family"
FT                   /note="identified by match to protein family HMM PF04290"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97398"
FT                   /db_xref="GOA:Q5LKW5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKW5"
FT                   /protein_id="AAV97398.1"
FT                   /translation="MIPFQTLCERFSKALGFLGRMAIFSLIVAMLYEVVARYAFGAPTL
FT                   WAFDISYMLNGSIFLLGAAYSLQEDAHVRIDFLSQRFPLRIQQLLNGAVYLLVMAPITF
FT                   AFTWVAATKALKAFSTGEVESVSPWAPLVWPFYGVIALGLIAFALQFVVEALKYLSGQK
FT                   QPGTAESEITELEI"
FT   gene            complement(291001..292065)
FT                   /locus_tag="SPOA0265"
FT   CDS_pept        complement(291001..292065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0265"
FT                   /product="TRAP transporter, DctP family, putative"
FT                   /note="identified by match to protein family HMM PF03480"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97399"
FT                   /db_xref="GOA:Q5LKW4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKW4"
FT                   /protein_id="AAV97399.1"
FT                   /translation="MKISSFLTAGALALALSGPALAAEVEWKMTAGVGEGSFLYQNFME
FT                   RFVGNVATLTQGRVEITSFGAGVLAPAFKAYEVVQDGIVEAGHSTPSYLVNQDATNAIF
FT                   ASFPGGMSAEATLHWVYEGGGEEMLQTFRREEMGLHSIVVGIGTSEIMAHSNVKIETVE
FT                   DLAGLKYRTSGAFAAVLQNEFGGVPTVVPGNEIYTLLQRKGVDAIEWSTPGANITEGFH
FT                   EVAPYMIMPGVHQPSFLWEVFVKQETWDALPADLQTLITAAAKLTTYEGYTRFGDSDVK
FT                   AMADFRNTNVELVVMARAESEKIREAGRNWAQTQAKTQSEAGSRRMQDILDSYLAYQSN
FT                   WAANSGYLVRDGAE"
FT   gene            complement(292150..293091)
FT                   /locus_tag="SPOA0266"
FT   CDS_pept        complement(292150..293091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0266"
FT                   /product="proline racemase, putative"
FT                   /note="identified by similarity to GB:CAB71312.1; match to
FT                   protein family HMM PF05544"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97400"
FT                   /db_xref="GOA:Q5LKW3"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LKW3"
FT                   /protein_id="AAV97400.1"
FT                   /translation="MHVIDSHTGGEPTRVILSGGPHLGSGPLSERAARLARESRAFYRS
FT                   VMLEPRGQPAMVGALLVEPVDPDCITGVIFFDAEAVLGMCGHGTIGLTVTLAHMGRIRA
FT                   GTHKIETPVGIVEVCLSDANTVTITNIESRRVHRARQVDVDGFGPVTGDVAYGGNWFFI
FT                   VDPSPIPIERTNIRALSDAALAIRTAVIANGIGGEEGQPIDHVIFYEMSPRSAVHSRSF
FT                   VFCPDGTYDRSPCGTGSSARLACLAAEGLLNAGEEIIQESVIGSTYRLSYQPGPNGGVI
FT                   PKITGQAHVMAESTLHFHTDDPYRNGICHAPQ"
FT   gene            complement(293082..294038)
FT                   /locus_tag="SPOA0267"
FT   CDS_pept        complement(293082..294038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0267"
FT                   /product="dihydroxydipicolinate synthase family protein"
FT                   /note="identified by match to protein family HMM PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97401"
FT                   /db_xref="GOA:Q5LKW2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKW2"
FT                   /protein_id="AAV97401.1"
FT                   /translation="MSNIFTGTMPALMTPCRADRTPDFDALVRKGTEMIAAGMSAVVYC
FT                   GSMGDWPLLSDEQRMEGVERLVKAGIPVIVGTGAINTRSATAHAAHAQAVGAAGLMVIP
FT                   RVLSRGSSLVAQKNHFKSILSAAPELPAVIYNSPVYGFATRADLFFALRSEHPNLIGFK
FT                   EFGGKDDLRYAAEHITSQDDQVTLMVGVDTEVFHGFVNCGATGSITGIGSALPKEALLL
FT                   ASLSQKAAAGHPEARKRALELEDALGILSSFDEGTDLVLFYKYLLVLNGEEEYRLHFNE
FT                   TDALSDAQRNYCEQQYALFRTWFAEWSKQGGVLAECM"
FT   gene            294459..295271
FT                   /locus_tag="SPOA0268"
FT   CDS_pept        294459..295271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0268"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97402"
FT                   /db_xref="GOA:Q5LKW1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKW1"
FT                   /protein_id="AAV97402.1"
FT                   /translation="MQERLIRLLEAIAGAANPPNATDLAQLTGLPRATIYRNISSLVDC
FT                   GFVEVTDCGSRYVLGMRFVKIALTGKSDMHVINAVSAMMQQVVKTSGETGFLARYRGGR
FT                   VDLIHIETPADPSLSYIYPGLGPRPAHACSSAKAIAAFITPELRDELLDIQPMRFNQNT
FT                   ITDPDQIQRELNQVRRYGYAICDGEIDEGVSSVAVPINVDRLGAIFSMGVVGPSNRIKP
FT                   MVQNRILPVLSAEAVRAAAAIQHCSVVDAETTNAEALADAREGLNKTH"
FT   gene            295294..296604
FT                   /locus_tag="SPOA0269"
FT   CDS_pept        295294..296604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0269"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB65016.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97403"
FT                   /db_xref="GOA:Q5LKW0"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LKW0"
FT                   /protein_id="AAV97403.1"
FT                   /translation="MKRREFGALAAGALAMGLPFRAFADETCQSPYMPKITGQEEFVYV
FT                   WTLGVEGMGDEQDKLVTIDLRPGSATRGQVINSVSVGGRNEAHHGGFSADRRFFWTGGL
FT                   DTNRIFIFDVHSDPSNPKLHKTIDTFVKDSGGVVGPHTFFALPGSMMITGLSNDDDHGG
FT                   RTALVEYNDDGEYVATYWMPTADDMQGAVAVGDAVADGYGYDIRALIRKNVMLTSSFTG
FT                   WSNYMMDFGQMLQDAEAMKRFGNTIVQWDLHTRQPKKVFNVPGAPLEIRFPWGSNANYA
FT                   FSTTALTSQLWLIYEDDAGEWQAKAVADIGNPADIPLPVDISIAADDQTLWINSFMDGK
FT                   TRLFDISDPHKPFQIYEKVIDRQVNMVSQSWDGKRVYFSSSLLANWDKKGKDDAQYLKA
FT                   YNWDGKELVEDFAVDFYELGLGRAHIMRFGSSALYSS"
FT   gene            296672..297382
FT                   /locus_tag="SPOA0270"
FT   CDS_pept        296672..297382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:G81801"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97404"
FT                   /db_xref="GOA:Q5LKV9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV9"
FT                   /protein_id="AAV97404.1"
FT                   /translation="MRKRFLLSGLTLVAAATVVGWQVWSPVPPARPSPMSSVFEASDAY
FT                   QFDPPAPGSYRLNRIKRAPDGRVLDIAGTEHSLHDLTRGKISLVSFVYLTCGDVNGCPL
FT                   AMSVFFDVHDASGDLPGLNEDVQLLTISFDPARDTVEAIEAFAYPITSDEQAGDKLNWQ
FT                   VLTTSGPQELRPILDGYGQVVDRSEDQETISHLLRLFLVDRQGDIRNVYGLGFLDPRLL
FT                   LTDIETLLMEEAGA"
FT   gene            297379..298593
FT                   /locus_tag="SPOA0271"
FT   CDS_pept        297379..298593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0271"
FT                   /product="methylamine utilization protein MauG, putative"
FT                   /note="identified by similarity to SP:Q49128; match to
FT                   protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97405"
FT                   /db_xref="GOA:Q5LKV8"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV8"
FT                   /protein_id="AAV97405.1"
FT                   /translation="MIRALATVLALIAPAALAGDYGTALPAPISAETCPADPESWTKAA
FT                   LERSLTAQLGLPLVPHPADNPPTEAKIELGRKLFFDRRLSINRTMSCAMCHVPEQGFAN
FT                   WELATAIGVEGRSVKRNAPSVINVGFLTPLFHDGRDPALETQFVAPLVARNEMANPSIG
FT                   HVVAELNRLPDYRRLFDAAFAAPASLDRIGQAFGAYQRSLTLGNSAFDRWYYGGDETAL
FT                   DAAAQRGFALFSGTAGCASCHVIETDHALFTDQAFHDTGYGRMREERRQNPPASHPVQV
FT                   APGVVHQVDFSRIRSVSAPREADLGRYEVTEDPADRWTFRTPGLRNLAVTAPYMHDGAL
FT                   TTLGDVLEFYNAGGAGHPGQDARIRPLGLSPDELADIQAFLMALTSEGLDCLVAEARSH
FT                   PPDNF"
FT   gene            298624..299736
FT                   /locus_tag="SPOA0272"
FT   CDS_pept        298624..299736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0272"
FT                   /product="glutathione-dependent formaldehyde dehydrogenase"
FT                   /note="identified by similarity to SP:P45382; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97406"
FT                   /db_xref="GOA:Q5LKV7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV7"
FT                   /protein_id="AAV97406.1"
FT                   /translation="MRTRAAVAVEAGKPLEVMEVNLEGPKAGEVLVEIKATGICHTDEF
FT                   TLSGADPEGLFPAILGHEGAGVVLEVGEGVTSLKPGDHVIPLYTPECRQCEYCLSGKTN
FT                   LCQAIRTTQGKGLMPDGTTRFSMLDGTPILHYMGCSTFSNHTVLPEIALAKVRPDAPFD
FT                   KICYIGCGVTTGIGAVINTAKAEIGCRAVVFGLGGIGLNVIQGLRLAGADQIVGVDLNP
FT                   DKVAMATRFGMTDFVNPAEVEGDMVAHLVELTRGGADYSFDATGNVGVMRTALECAHKG
FT                   WGESIIIGVAPAGAEISTRPFQLVTGRVWKGTAFGGAKGRTDVPRIVDWYMDGKIEIDP
FT                   MITHTLSLDEINKGFDLMHAGESIRSVVVY"
FT   gene            300016..300510
FT                   /locus_tag="SPOA0272a"
FT   CDS_pept        300016..300510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0272a"
FT                   /product="Unknown"
FT                   /note="Novel gene detected by proteogenomics, SPOA_PG001;
FT                   similar gene identified in less than 5 other Roseobacter
FT                   strains"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0272a"
FT                   /db_xref="EnsemblGenomes-Tr:AHC32568"
FT                   /db_xref="UniProtKB/TrEMBL:V5XJ79"
FT                   /protein_id="AHC32568.1"
FT                   /translation="MRDEACCDFDFVLGDWKVRHRRLTVRLAGSDQWEEFDGTSSTRPV
FT                   LGGNGNIEDNWIDFPGGAYRAVAFRSFDKASGQWAIWWLDQRNPHHLDVPVVGRFENGV
FT                   GTFLSDDSFEGKPIKVRFIWLRQDADSCRWEQAFSTDGGASWETNWTMQFSRAAQVRPQ
FT                   A"
FT   gene            complement(300585..301151)
FT                   /locus_tag="SPOA0273"
FT   CDS_pept        complement(300585..301151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0273"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97407"
FT                   /db_xref="GOA:Q5LKV6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV6"
FT                   /protein_id="AAV97407.1"
FT                   /translation="MSNSTDEDAELGQRLRVIRERAGLSQRALAKRSGIPNSTISLIEG
FT                   GKINPSVSTLRRVLGGIPIGLSDFFAFEPEQEKASFYAAEDLTEIGKGKLSLKQVGSNL
FT                   VGRAMMILYETYQPGADTGRVMYGHEGEEGGVVLSGRVEITVGSQRKILGPGDAYYFDS
FT                   RAPHRFRQVGPETCTIVSACTPPTF"
FT   gene            301297..302574
FT                   /gene="gabT"
FT                   /locus_tag="SPOA0274"
FT   CDS_pept        301297..302574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="SPOA0274"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /note="identified by similarity to SP:P22256; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97408"
FT                   /db_xref="GOA:Q5LKV5"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV5"
FT                   /protein_id="AAV97408.1"
FT                   /translation="MKNAEIARRRDAAIARGVGMQTQIYVERAAGSEVWDVEGNRYIDF
FT                   AAGIAVVNTGHCHPRVMQAVRAQAEAFTHTCHQVLPYESYIRLAERLNDRVPGDFDKKT
FT                   VFVTTGAEAVENAIKIARAATGRPAVIAFGGAFHGRTFMGMSLTGKVMPYKTGFGAMMP
FT                   DVYHVPFPVELHGTTTDEALAGIAKLFKTDLDPGRVAAIIIEPVQGEGGFYPAPAALMR
FT                   GLRALCDSHGILLIADEVQTGFARTGHLFAMEGYDIAPDLTTMAKGLAGGLPLAAVTGR
FT                   AEVMDAAAPGGLGGTYGGNPLGIAAAHAVLDVIDEEDLCHRANELGSRLKQRLTQVRER
FT                   VPEIVDVRGPGFMIAAEFNTADGGAPNPDFANAVRAQALSRGLVLLTCGVFGNVIRFLA
FT                   PLTIPEDVFAEALEILETSILAVKGG"
FT   gene            302576..304036
FT                   /gene="gabD-3"
FT                   /locus_tag="SPOA0275"
FT   CDS_pept        302576..304036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD-3"
FT                   /locus_tag="SPOA0275"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97409"
FT                   /db_xref="GOA:Q5LKV4"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV4"
FT                   /protein_id="AAV97409.1"
FT                   /translation="MTTLALNDPGLLETRAYVNGVWIEGGARFAVQDPATGDLIAEVAD
FT                   LGAADTAAAIDAAHAAGPGWAALTGKERGAILRRWHDLMIQNADDLATILTAEMGKPWA
FT                   EARGEILYGASFLEWFAEEAKRVYGETIPGHQRDKRIVVLKQPVGVVGSITPWNFPNAM
FT                   IARKVAPALAVGCTFVARPAELTPLSALAMAVLAERAGVPAGVFNVIPSQDAAGVGAEL
FT                   CANPKVAKITFTGSTRVGRLLMQQCAPTIKKMSLELGGNAPFIVFDDADLDAAVDGAMI
FT                   AKFRNNGQTCVCANRIYVQARVYDAFADKLAAKAAQLRVGNGFDTGVTTGPLINSAAVS
FT                   KVEAHIADALAGGAEVVLGGTRAPLGGTFFAPTVLRDVTRDMLVCREETFGPLAALVRF
FT                   ESEDEVIDMANDSEFGLAAYFYSRDLARVWRMAEALESGMVGVNTGLISTEVAPFGGIK
FT                   QSGLGREGSRHGIEDYLELKYLCLGGIG"
FT   gene            complement(304052..304993)
FT                   /gene="cscK"
FT                   /locus_tag="SPOA0276"
FT   CDS_pept        complement(304052..304993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cscK"
FT                   /locus_tag="SPOA0276"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="identified by similarity to GB:AAC04474.1; match to
FT                   protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97410"
FT                   /db_xref="GOA:Q5LKV3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV3"
FT                   /protein_id="AAV97410.1"
FT                   /translation="MILCCGEALIDMIAAPTIGGGHGFLPQPGGGALNTAIALGRLGQR
FT                   VGLVTALSRDMFGQRLAEALTASHVDLSGAARVDRPTTLAFVQLRDGQPEYAFYDENSA
FT                   GRMLSATELPPLPPEASALCLGGISLACEPGADAYADLLERHGAGRVVLIDPNIRPALV
FT                   GDEARYRARLGAMIARADILRLSDEDLGWLCPDAPDLRAGARTLLALGPALVVVTRGAA
FT                   GATGYLPEGAEVSVPAPRVNVADTVGAGDTFIAGMLSALAEQGLLTPAALAGLRAEALK
FT                   PALTHGARVAALAVSRPGANPPWAHELAPPPG"
FT   gene            complement(305059..305817)
FT                   /locus_tag="SPOA0277"
FT   CDS_pept        complement(305059..305817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0277"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97411"
FT                   /db_xref="GOA:Q5LKV2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV2"
FT                   /protein_id="AAV97411.1"
FT                   /translation="MPGLPYLRAGSGPALVFVHGYLGGAAQWAQEIERFKDAFDVIAPN
FT                   LPGFGAAADRPGCASIEEMAAAVLGLLDELGIAEFLLVGHSMGGMIAQQMAADRPDAVK
FT                   RLVLYGTGPLGLMPDRFEPIDTSRERLLADGVDCTIRRIGATWFRAGAAAAAYPLLVEI
FT                   GARANPQAAMAGLGAMAAWDGRAALPRLSMPTLVLWGDCDKSYRWPQIHTLWSNIPDAR
FT                   LSVVPGTSHAVHLEKPGFFHSILADFLTEP"
FT   gene            complement(305817..307118)
FT                   /locus_tag="SPOA0278"
FT   CDS_pept        complement(305817..307118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0278"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="identified by match to protein family HMM PF06808"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97412"
FT                   /db_xref="GOA:Q5LKV1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV1"
FT                   /protein_id="AAV97412.1"
FT                   /translation="MEWYVVGLGLLGLLMLFISIGLPIPFALAAASLPFLWQIQGWKTS
FT                   IVSSELKLWGVWIDYILLAVPLFVFLGELIGKSKIGPNLYQFLHQGVRLRGSAAYGSIG
FT                   ASAGFGAVCGSSMVGALTIGGVALPEMLRLGYGKRLSSGVLAAGGTLSVLIPPSLILLF
FT                   YGIVTDQSIGDLFIAGVIPGIILVSSFVVVVLIWGILRPEDIPGSEDAAKMPMRMIVAT
FT                   VGPVMLIGLVITVAIYAGIATPTEAAAVAASLTVLLAFWVGGLTWQGFKEAIFSTMRTM
FT                   GYLGLLLSAGVLFGFVLTYYRVPQQFTELFLSFDLSPYTVLAIVLVFYIILGMFLEPVS
FT                   MTFITLPTIYPLMSAAGFDLIWFGVVYTITMEIAVLTPPVGLNLYVIQAISRDQVTIGD
FT                   VIMGCLPFIGAMILLIAVLIVAPDVALWLPEQMR"
FT   gene            complement(307118..307627)
FT                   /locus_tag="SPOA0279"
FT   CDS_pept        complement(307118..307627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0279"
FT                   /product="TRAP dicarboxylate transporter, DctQ subunit"
FT                   /note="identified by match to protein family HMM PF04290"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97413"
FT                   /db_xref="GOA:Q5LKV0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKV0"
FT                   /protein_id="AAV97413.1"
FT                   /translation="MNDGIDRLIRGVERGVVWLAGLGAVIVLVQMVWITYGVFVRYGLG
FT                   KPDRMVTEATALLLFPVAFAGLAFALREDAFPKVTMLTDQLRPGARRFFDILNHLLMLG
FT                   VGGFFAYAGVSATIRSFNSGVASEILHWPRYMFWAPGAVALVLFTLYTALRLIRLIMRP
FT                   APTGDL"
FT   gene            complement(307702..308697)
FT                   /locus_tag="SPOA0280"
FT   CDS_pept        complement(307702..308697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0280"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF03480"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97414"
FT                   /db_xref="GOA:Q5LKU9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU9"
FT                   /protein_id="AAV97414.1"
FT                   /translation="MYLNLKTATASALALACGLAAGTASAETTLRLSTYVNEADIRYAG
FT                   FTHFADLVAEKTGGSVKVEVFPSATLHGWSEGVDSVQGGVSDISWINADNRLPCYAVTS
FT                   LYPAEVSLEDQTGLDAAYAALIRDEAANAGLVPLFNSNYSYDQEWWFEEPVADIGNLDG
FT                   KLVRSIGPLVSMMIETWGGEPVFVAPKEVFQSAERGVVDGINMGVATYSSWKLWTVMPY
FT                   MVNANLFYGNIQYMMNKAKFDALSADEQAALTAAAAETEAWLQPRYEAWVDQQVGNAVM
FT                   QGGGAAVSISDDQRASLIASVKPKWDETVNAACGGELADSIRALLASHAP"
FT   gene            308914..309798
FT                   /locus_tag="SPOA0281"
FT   CDS_pept        308914..309798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0281"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97415"
FT                   /db_xref="GOA:Q5LKU8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU8"
FT                   /protein_id="AAV97415.1"
FT                   /translation="MDINWLRDFTCLARTLNFTRASEERNITQSAFSRRIKSLENWLGI
FT                   PLIKRSTYPVQLTEAGQQFLPVAQETIASLTDIRQVLRAQEQGVTAFQRFAVLHTISVN
FT                   YLTRRIAEFEDLIPNLRVRVYSDNLRTCCQLLSDGTCDFLLYYRHQDVQPVFEEKQFAR
FT                   KDIGVELMYPVAETGAARAGGWDLDGDGRQPIPYLSYDPSSFLGTVVDQTIGTRTPPLA
FT                   IRYMDALTEAIKRRVLSGSGMAWLPESVIAEELAAGRVTIIGGPDWQAPLTLSLFCSRD
FT                   RLDETGQKVWNAL"
FT   gene            complement(309822..311339)
FT                   /locus_tag="SPOA0282"
FT   CDS_pept        complement(309822..311339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0282"
FT                   /product="long-chain-fatty-acid--CoA ligase, putative"
FT                   /note="identified by similarity to SP:P94547; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97416"
FT                   /db_xref="GOA:Q5LKU7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU7"
FT                   /protein_id="AAV97416.1"
FT                   /translation="MANPLYDRLFGAHAGQDTPFLYLPDGRVISHAAFLGQAARLAHVA
FT                   TNLGLKPGDRVAAQVEKSPEALALYAACAQAGLIFLPLNTAYTADELSYFIDNSGAALI
FT                   VCDGRNRDMLAPIAEGLGARIETLNADGSGSLTERAATMPDRFDTVARGGGDLAAFLYT
FT                   SGTTGRSKGAMLTQDNLLSNAETLAREWRFTADDVLLHALPIFHTHGLFVATNIALITG
FT                   GSMIFLPRFDLDQIIAQMPRATSMMGVPTFYTRLLGDARFTRELAQHMRLFVSGSAPLL
FT                   AETHVEFEERTGHRILERYGMTETNMNTSNPYEGARRAGTVGLPLPGVELKVTDPETGE
FT                   TLPQGEIGVIEVRGPNVFKGYWQMPEKTAAELRADGFFITGDLGFVDEQGYVTIVGRGK
FT                   DLIISGGFNIYPKELELLLDDQPGVLESAVIGVPHPDFGETPLGLLVPRPGQTPDTQAI
FT                   MATVETALARFKHPRKLIVLEELPRNTMGKVQKNILRDQFKALFEKQ"
FT   gene            complement(311439..313043)
FT                   /locus_tag="SPOA0283"
FT   CDS_pept        complement(311439..313043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0283"
FT                   /product="oxidoreductase, GMC family"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97417"
FT                   /db_xref="GOA:Q5LKU6"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU6"
FT                   /protein_id="AAV97417.1"
FT                   /translation="MDRFDFIIVGAGSAGCVLAERLSASGRHTVLLIEAGGSDRRFWVK
FT                   VPLGYGKTYDDPSVNWCYTAQSDPGLAGRAAFWPRGRVLGGSSSINAMAYVQGLPHDFD
FT                   DWETAGATGWNWQAARDTYARIETRDRPGTDGRRQLSGSGPVHVSDVGDRMHPFSEHFL
FT                   SAAAQAGWPLLDDLNGPERTGIARLQGTVRNGRRWSAADAFLRPALKRPNLFLVSNALV
FT                   ERVTLHDGAATGVEYRARGQLVRASATREVIVSAGAVNSPQLLQLSGLGPAALLQRHGI
FT                   AVARDLPQVGQGLQDHLGISYQFTATQPTLNNRLGNWPGKLAAGLRYLLTRGGPLSVPI
FT                   NQIGGFVPSTIGGRADMQVYCNPMSYSVRPDGKPDVAPMAGFLICAQPCRPSSRGAVTI
FT                   RSADPRTPPDIRPNSLSTNEDCAMAIAAGRIAQRLARTPAIRAVTREGPDIAAMSDGDL
FT                   LADFRQRAGSVYHASCTCRMGSSARDSVLDARLRVHGVAGLRVIDASSFPNVTSGNTNA
FT                   PVMMLAARGAEMILQDH"
FT   gene            313162..314052
FT                   /locus_tag="SPOA0284"
FT   CDS_pept        313162..314052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0284"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97418"
FT                   /db_xref="GOA:Q5LKU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU5"
FT                   /protein_id="AAV97418.1"
FT                   /translation="MKLPNPTWLRSFEAAARLGSFSAAADELGLTPAAVSQQMRLLEKQ
FT                   LKTTLFERLPRGVALTDMGKAYAQPVRKGLDDIQVATAGLFGTTRRRQIKVRASISCAA
FT                   LVIAPRLHGFLASHPDIDVDLSTFVWANRFQDGISDIDIRFGFGDWTDGRLTHLGHEFA
FT                   IPVCSPDYLTGFGAAPRLDHLAALHIFTIHGSESDWPRLFAQMGLAPPVAARVTRFDSS
FT                   LMALQAISAGSGLAIVLESFAQPFLERGAAVAPVPDRLAIRPAHFLVERDGGERRDEVR
FT                   AFADWICTLFQGPRP"
FT   gene            complement(314098..314883)
FT                   /gene="caiD-2"
FT                   /locus_tag="SPOA0285"
FT   CDS_pept        complement(314098..314883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD-2"
FT                   /locus_tag="SPOA0285"
FT                   /product="carnitinyl-CoA dehydratase"
FT                   /note="identified by similarity to SP:P31551; match to
FT                   protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97419"
FT                   /db_xref="GOA:Q5LKU4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU4"
FT                   /protein_id="AAV97419.1"
FT                   /translation="MSDSPVRTRRDGAIFEVTLDRPKANAIDLVTSRIMGEVFREFRDD
FT                   TDLRVAILTGGGEKFFCPGWDLKAAADGDAVDGDYGVGGFGGLQELRDMNKPVIAAVNG
FT                   IACGGGLELALSADMIIAADHATFALPEIRSGTVADAASVKLPKRIPYHIAMELLLTGR
FT                   WFDADEAHRWGLVNEIVPGTQLMERAWDLARLLASGPPLVYAAIKEIVREAEDAKFQDT
FT                   MNKITKRQLRTVDVLYSSDDQLEGARAFAEKRDPVWKGR"
FT   gene            complement(314883..315488)
FT                   /locus_tag="SPOA0286"
FT   CDS_pept        complement(314883..315488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0286"
FT                   /product="ThiJ/PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97420"
FT                   /db_xref="GOA:Q5LKU3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU3"
FT                   /protein_id="AAV97420.1"
FT                   /translation="MRKLAAVLFEGFEMLDYFGPLEMFAMFPDEIEIVAVAEHAAPVRA
FT                   SGGPAVMPDRVFADGADYDLLLVPGGRGTRREVDNPVLLDWHVAASARAELVTSVCTGS
FT                   ALLARAGLLDGRAATTNKLAFDWVASQSDKVDWRASARWVADGRFLTASGVSAGIDMSL
FT                   DALARLLGPEAAEKAAHWAEYVANRDPENDPFARMDKM"
FT   gene            complement(315492..317504)
FT                   /locus_tag="SPOA0287"
FT   CDS_pept        complement(315492..317504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0287"
FT                   /product="acyl-CoA synthetase, putative"
FT                   /note="identified by similarity to GB:BAB86294.1;
FT                   similarity to GB:CAA10043.1; match to protein family HMM
FT                   PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97421"
FT                   /db_xref="GOA:Q5LKU2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU2"
FT                   /protein_id="AAV97421.1"
FT                   /translation="MSKGLSRMFQPRSIAVIGGGAWCRQVIVQCRRMGYGGAIWPVHPK
FT                   AVEVEGYPAFARLEDLPGAPDAAFIGINRHATIEAVALLSAMGAGGAVCFASGFSEALA
FT                   EDETGGDLQAALVAAAGEMPILGPNCYGFVNALDGALLWPDQHGCSRVERGVAILTQSS
FT                   NIAINLTMQQRGLPIAYVVTCGNMAQTGQARIAMALLDDPRVTAIGLHIEGFGDLRDWE
FT                   ALAAKAHARGVPLVALKVGASEQAQQATVSHTASLAGSDAGAQALLDRLGIAPLRALPD
FT                   LLETLKLLHCNGPLTGVDIASISCSGGEASLIADMSVGSALRFPALTARQRQALRAALG
FT                   PMVALSNPLDYHTYIWRDAQAMAAAWSGMTGDGIALTFSIVDYPVTDPADWTCATQAAL
FT                   KVRAETGAPFAVVATLPELMPADVAAELMAGGVVPLMGLREALAAAEAAASLHAPDPVP
FT                   VCLPGQEDATQLLDEGAAKAALAAHGLEVPRNRTARADEAAQAVEGMCGPFAVKGVGLA
FT                   HKSEHGAVRLGVPAADVARVAAEIGTPEVLIEEMVSDAVAELLIGVIRDPAHGFVLTLG
FT                   AGGVLTELMRDTVSLLVPAARADIAAALQRLRIAPLLAGYRGKPGADMDAILRAVEAVQ
FT                   DYVLAHAGTLGEVEINPLLVAPDRAVAVDALIRLE"
FT   gene            complement(317587..318747)
FT                   /gene="acdA-3"
FT                   /locus_tag="SPOA0288"
FT   CDS_pept        complement(317587..318747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdA-3"
FT                   /locus_tag="SPOA0288"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97422"
FT                   /db_xref="GOA:Q5LKU1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU1"
FT                   /protein_id="AAV97422.1"
FT                   /translation="MHFGLSEEQEMIVSTVRSFVEKEIYPHETEVERTGEVPKEIADEI
FT                   KRKTIELGFYACNFPEEVGGAGLSHLEFALVERELGRGSMALNHFFGRPQNILMACEGE
FT                   QKERYLLPAVRGERMDALAMTEPGAGSDVRGMKCSAVRDGGDWVVNGTKHFISGADHAD
FT                   FIIVFIATGEDMTPKGPKKRITAFLVDRGTPGFTIRDGYRSVSHRGYKNMVLEFDDCRL
FT                   PDAQVLGEVDGGFAVMNEWLYATRITVATMSVGRARRVFDYALNYAAEREQFGQAIGKF
FT                   QGVSFQIADMITEIDAADWLTLAAAWRLDQGLPANREIASAKVYASEMLARVTDTTLQI
FT                   FGGMGLMDDFPIERFWRDARVERIWDGTSEIQRHIISRDLLRPLGA"
FT   gene            318870..319769
FT                   /locus_tag="SPOA0289"
FT   CDS_pept        318870..319769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0289"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97423"
FT                   /db_xref="GOA:Q5LKU0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKU0"
FT                   /protein_id="AAV97423.1"
FT                   /translation="MLLFDNFSNHCLANTVEPMRAANMLSRRPLYAWRFLTPDGAPVHS
FT                   SSGLQVAPHDRLAAGRGAMLLVMPSYGFRTLDGWPTLRALRAAAQRYPVLAGLDTGSWL
FT                   LARAGLLDGHRATIHWEELTRFAETFPQVETLRERFVLDGPRITCSGAMAAFDLILHLI
FT                   GRDHGQLLALEVAQLFMTRDSARSHDAPAGGGTRQVNRAVMVMQDTLEQPLPIAEIARR
FT                   AGCTQKTLETRMRAAFDATPQTVYRRLRLNLARKLVTETDLPVSEIATRCGYDNASALT
FT                   RAFRARFGQPPRGLRANG"
FT   gene            complement(319825..320892)
FT                   /locus_tag="SPOA0290"
FT   CDS_pept        complement(319825..320892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97424"
FT                   /db_xref="GOA:Q5LKT9"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKT9"
FT                   /protein_id="AAV97424.1"
FT                   /translation="MTRKPDPYDAAEGIAGPYDSDPVEEDDLWFLPAQEPGEDEVDPLF
FT                   PTPRAAQPLLFDPLEWRAAQDALSADLADLALGFGALDERLRAGPRQWVQRLALLEVAD
FT                   LGWWAGDRIGAERLALWTGLRLGATSEDVQALARAGWAVRRLSGGPAPDTGGWAEGLAG
FT                   FLDRSGAEGDTVPETVADLGDVMAAAAALHPATRAAMLFHCWIMLGQGPSAGLEAAVMA
FT                   ARHGAAMGRGGALFLPLALSGPGALRGAGAAEQKLTAWLRGAAQAVTAALLHLDRVAAW
FT                   SARAIEKTSDLSGRTPPALIEVLTAWPMVTAPLAEAQSGASRAAVQRNLDLFARRGLVR
FT                   EVTGQGRYRVWTAAV"
FT   gene            complement(320935..321894)
FT                   /locus_tag="SPOA0291"
FT   CDS_pept        complement(320935..321894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0291"
FT                   /product="branched-chain amino acid aminotransferase,
FT                   putative"
FT                   /note="identified by similarity to GB:AAO91868.1; match to
FT                   protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97425"
FT                   /db_xref="GOA:Q5LKT8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKT8"
FT                   /protein_id="AAV97425.1"
FT                   /translation="MTTPQPETAPRTTHDAEADARNRDILIYVDGDLVHRDEAKVSVYD
FT                   SGFMLGDGMWEGMRLYDGEWAFFDAHMDRLFNSCKAVALEIGKTPEEIRAILDRTAAAN
FT                   GMTGDAHCRLMITRGRKAKPFQHPGLSKWGPTIVAIVEHSVPSERVQGTGIRLASVPQV
FT                   RGLPHSQDPKFNSHSKLNCVIACLQAEQAGADEALMLDPHGFVNTTNACNFFIVRRGEV
FT                   WTSTGDYCMNGVTRANVITLCREAGIPVFEKNFSLYEAYGADEAFLTGTFGAQTPVAEI
FT                   DGRVIGAGGGAGPVTRRLRALYKAMVAQNVAEQKARRG"
FT   gene            322185..322844
FT                   /gene="psd"
FT                   /locus_tag="SPOA0292"
FT   CDS_pept        322185..322844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="SPOA0292"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="identified by match to protein family HMM PF02666;
FT                   match to protein family HMM TIGR00164"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97426"
FT                   /db_xref="GOA:Q5LKT7"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LKT7"
FT                   /protein_id="AAV97426.1"
FT                   /translation="MKMRDTFLKPMHPEGRKFVGIFAAITVILFLIWSVLGWIGVGLTV
FT                   WCYYFFRDPERVTPAREGLIVSPADGIVSMIEKSVPPAELGMPDQALTRISVFMSVFNC
FT                   HVNRAPIAGRIAAIAYRPGKFFNASLDKASADNERNSLCIEMADGRQIAVVQIAGLVAR
FT                   RIVCFSSTGDTLRTGERFGLIRFGSRLDVYLPEGVEPMVDLGQTMIAGETVLADLQ"
FT   gene            322880..323635
FT                   /gene="pssA"
FT                   /locus_tag="SPOA0293"
FT   CDS_pept        322880..323635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="SPOA0293"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM TIGR00473"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97427"
FT                   /db_xref="GOA:Q5LKT6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKT6"
FT                   /protein_id="AAV97427.1"
FT                   /translation="MTDPLDNEEQSKVRLIHLLPNLLTIAAICAGLTAIRFGYEGNFEM
FT                   AVRLVLVACVLDGLDGRVARFLNHSTAVGAELDSLADFVNFGVAPVLILHSWALQDFSG
FT                   IGWIAVLFYSICCVLRLARFNVSGRLDPKSAPSDFFVGVPAPAGALLVLLPLVVSFAVS
FT                   DMPVAPPAIVALHICVIGILMISRMPTYSFKNMAIDRSNAKFFLLGATILSAALLTYLW
FT                   ITLTFIILAYAGCLVWVYRSSRKLKKTKG"
FT   gene            323640..324260
FT                   /gene="pmtA"
FT                   /locus_tag="SPOA0294"
FT   CDS_pept        323640..324260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmtA"
FT                   /locus_tag="SPOA0294"
FT                   /product="phosphatidylethanolamine N-methyltransferase"
FT                   /EC_number="2.1.1.17"
FT                   /note="identified by similarity to SP:Q05197"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97428"
FT                   /db_xref="GOA:Q5LKT5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKT5"
FT                   /protein_id="AAV97428.1"
FT                   /translation="MELNAVKSSYARWAPIYDKTFGAITNVGRHAAVDYINAHDATELL
FT                   EVGVGTGLSLPNYRPGLKVTGIDFSEEMLAKARAKVESLGLGHVQSLRQMDARDLDFAD
FT                   ASFDVVAAMHIISVVPEPERVMAEMARVCKPGGLIVITNHFARDSGMLARVERFAAPFA
FT                   NLLGWHPDFEISSVLKQPDLTVIERKSLPPMGMMTFLVLQKCE"
FT   gene            complement(324468..325151)
FT                   /locus_tag="SPOA0295"
FT   CDS_pept        complement(324468..325151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0295"
FT                   /product="hydantoin racemase"
FT                   /EC_number="5.1.99.-"
FT                   /note="identified by similarity to SP:Q00924; match to
FT                   protein family HMM PF01177"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97429"
FT                   /db_xref="GOA:Q5LKT4"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKT4"
FT                   /protein_id="AAV97429.1"
FT                   /translation="MKILVVNPNTTASMTNKIARAARAVARPDTEIVAATSQAGPASIQ
FT                   GFLDVATCVPGLLEEVARHKDVDAIVIACFDDTGLDAVRTLVSVPVLGIGEAAYHAASM
FT                   IANKFSVITTLSRSVPGLENNLMRYGLAQKCARVRATDIPVLKLEEGDPATLSKIRSEI
FT                   SASIAQDNTEAIVLGCAGMADLMAQLSAEFGLPVIDGVAAGVTFAEALVNNRLGTSKIG
FT                   AYSRS"
FT   gene            complement(325158..325880)
FT                   /gene="livF-2"
FT                   /locus_tag="SPOA0296"
FT   CDS_pept        complement(325158..325880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF-2"
FT                   /locus_tag="SPOA0296"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to SP:P21630; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97430"
FT                   /db_xref="GOA:Q5LKT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKT3"
FT                   /protein_id="AAV97430.1"
FT                   /translation="MTAMLDFKDVELYYDHVYALKGVSLHVNKGETVALIGANGAGKSS
FT                   ILRAITGLAKPKSGSVTFEQARVDGTDPSAIVKRGIAMVPEGRRVFPFMSVKDNLLMGA
FT                   FTRSDKADIQKTLDNILTRFPRLKERYTQAAGTLSGGEQQMMVIGRALMAKPKLLLLDE
FT                   PSLGIAPKLVQDIARSIVAINRDEGVSVLLVEQNSRMALSISHRAYAMATGNVVIEGNS
FT                   KELLHDDRIKAAYLGGEV"
FT   gene            complement(325884..326666)
FT                   /gene="livG"
FT                   /locus_tag="SPOA0297"
FT   CDS_pept        complement(325884..326666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="SPOA0297"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to SP:P22730; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97431"
FT                   /db_xref="GOA:Q5LKT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKT2"
FT                   /protein_id="AAV97431.1"
FT                   /translation="MSPLLQVRNVTKKYGGLTANNDVSFDVAENEILSVIGPNGAGKST
FT                   LFKMISSFTSTTSGEVLYRGERISNLRPHIVARKGVVRTFQETTIFKSMTVRESVVVAQ
FT                   HLRAKASLAGYFLGSKAAKDDVSAFGKYADELLEFLGMSEIANELASNLPQGNLRALGI
FT                   AIGLATDPRVLLLDEPFAGMNHDETMNMVNLVRAVRDDRGVTVMLVEHDMPAVMTISDR
FT                   IVVLNFGEKIAEGTPAEIQNNEKVIEAYLGSVDDEIGM"
FT   gene            complement(326663..327643)
FT                   /locus_tag="SPOA0298"
FT   CDS_pept        complement(326663..327643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0298"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by similarity to SP:P22729; match to
FT                   protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97432"
FT                   /db_xref="GOA:Q5LKT1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKT1"
FT                   /protein_id="AAV97432.1"
FT                   /translation="MLGFSSKQLIGTGIFLFAIFIGVPLVIGATGRWDFYFTLTSVALL
FT                   AIASAGVWLTFYIGRINIGQGAFALIGAYVSAILVVKAGWSFWITLPAAGLFAAIVAIL
FT                   VGLPILRLRGVYFAMITLVLTQVVTLTALALPITNGAKGISNIPLPSGLSILGIPLIPD
FT                   FGAMENTKLAFYLTACILMVATYAALYRLVNSRLGHLCRSMQQNEELASSIGVNIAYIR
FT                   IVIFAISSFFGGIGGAMFGAIAQSVYPSTFVVADSVNFMLNCFLGGLGYVFGPMLGTLV
FT                   LYFGWDLLFEIGKYQMLVYSMILIAVIRFLPNGLLSVRFDKGDKK"
FT   gene            complement(327648..328517)
FT                   /locus_tag="SPOA0299"
FT   CDS_pept        complement(327648..328517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0299"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97433"
FT                   /db_xref="GOA:Q5LKT0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKT0"
FT                   /protein_id="AAV97433.1"
FT                   /translation="MEQILANGVYLGSQYAMIALGLTLIFALMNVLNFAHGQMYVIGGF
FT                   VTYTFYGQWGIPFVLALVMSCVTLAILGALIEKFLFAPVIKGSAREESTMLLAAGIAFF
FT                   LDALILLIFGEKQRGVPKIVDGVFNWDFRIIMPYDRILICVLAILSIVAFIGLMQYTKT
FT                   GRALRALAQDRTAAQLMGVNVDRYSMIGFALGAMLAGLVGGLLVTITGVNLGMGGPTSI
FT                   KAFMMVMIGGAGVISGAIWGGIILGFMEAIGLALLYQYGDITYLLIFVSLMIFLAIRPQ
FT                   GLMGKPWG"
FT   gene            complement(328607..329794)
FT                   /locus_tag="SPOA0300"
FT   CDS_pept        complement(328607..329794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0300"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic branched-chain amino acid-binding protein"
FT                   /note="Assignment partly based on membership in
FT                   branched-chain amino acide ABC transporter gene cluster;
FT                   identified by similarity to SP:P02917; similarity to
FT                   SP:P04816"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97434"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS9"
FT                   /protein_id="AAV97434.1"
FT                   /translation="MQRRSLMKAAMTAATLTAFGTTAALAENPVLKIGFVGVTSGPAAA
FT                   WGISNQRSMETRAAWINETGGYTIGGTTYDIEIVSFDDQKDPKRAIAGMERMAQEGIHY
FT                   VVGPNVDDGAAAVRPVAEANGIMYFPYAFPKELYQAPASNAVLGMVANYQSGPAIYKYL
FT                   MEKEGVETVAFIAANESDPLSQRDGGVAAAEALGLKVVSSSVTYQVDTTDFTPVLTPVM
FT                   RTQPDLLVLSGVSPANAPQLIRSARELGFQGLISTETAQDAGVLAEGAGDLANGFISVG
FT                   GASTPELASPMMNEFVKRYTEMFGEYNDESNTKVYALEYILETLKANPAAIEDVAAFQA
FT                   TMDTFEAPNPYMNGDATLRYVGMTSFGQRRQVAVPLVVNVYQDGAFETLFVAAVD"
FT   gene            330025..330744
FT                   /locus_tag="SPOA0301"
FT   CDS_pept        330025..330744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0301"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97435"
FT                   /db_xref="GOA:Q5LKS8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS8"
FT                   /protein_id="AAV97435.1"
FT                   /translation="MPSNPQQSSRATPDRPSGSDESVIVERIYKAVMEQRLAPKTKLSE
FT                   ARLCETFGVGRMRVRRALLLLSSQGIIELQSNRGAYVACPDTAEANEVFAARMLIEPPL
FT                   VRQLAQSSGNIDLTILTEHIALEDAARERKERTEIIRLSGEFHTKLAQATGNKFIFRMM
FT                   RELVTRTSLIVGLFGSSENASCPDDEHNNILKAIQSQDPEMAETLLISHLNHIQNGLDM
FT                   DMRQVPQDDLAAILGSD"
FT   gene            331140..332186
FT                   /locus_tag="SPOA0302"
FT   CDS_pept        331140..332186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0302"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97436"
FT                   /db_xref="GOA:Q5LKS7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS7"
FT                   /protein_id="AAV97436.1"
FT                   /translation="MKPVRPQPATPPALSENDRQALNDLYVRGTPENTLRAYERDLLYL
FT                   TAWKQLSFGAPLAWPEQHECALRFILDHSRDLGDATGPAREVAEALIARGLRRSLACPA
FT                   PATLNRRIASWQAFHRMKNLDSPFDSPLLKQARAKARRAAARPTAPKSRNPITRPVLEQ
FT                   LLATCRGSRRDCRDRALLMLGWASGGRRRSEIASLRVEDVSLRDFAADGIAWLMLVETK
FT                   TTRRGATPRLVLKGRAAQALVHWLEVSGIEDGPLFRPVSKSDRVLTRRLTPDAIYQIVR
FT                   HRLQLAGLPQDFASPHGLRSGFLTQAALDGAPIQAAMRLSLHRSVAQAQRYYDDVEIVE
FT                   NPATDLLG"
FT   gene            complement(332220..333317)
FT                   /locus_tag="SPOA0303"
FT   CDS_pept        complement(332220..333317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0303"
FT                   /product="replication protein, putative"
FT                   /note="identified by similarity to GB:AAN05123.1; match to
FT                   protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97437"
FT                   /db_xref="GOA:Q5LKS6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS6"
FT                   /protein_id="AAV97437.1"
FT                   /translation="MTRKRRIFDIDMPAMEDIPVGKVPDKVLDKHRRGPMATAISENAD
FT                   ALRDRQETEDRIRAENDQLAHELVRLKKEGLITDLVPLDAVHAERLTRDRAAGPDPELD
FT                   ELKTSIREIGLSNPIRVEKRADGGYELVQGMRRLSAYRALYEETGDERFARIPAGILAN
FT                   APTDDQYRRMVDENLIRKDISFAEMGALARAYAEDPANDCADVDKAVSVLFKSASYTKR
FT                   SYIRAFASLLMMLGKSLEHPNEIPRNVGVDLKRKLDGDPGLVRAVSSALLAQPGRSAAD
FT                   EVAILRGFAEGAGVPEPQARTAAPSGDKTRRAKTTFQISRPSGIAKCSASNGRIDLRYN
FT                   LDFTRIDRQKLEQAVAKLIDSLQED"
FT   gene            complement(333314..334621)
FT                   /gene="repA"
FT                   /locus_tag="SPOA0304"
FT   CDS_pept        complement(333314..334621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="SPOA0304"
FT                   /product="replication protein"
FT                   /note="identified by similarity to PIR:AI3232; match to
FT                   protein family HMM PF00991"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97438"
FT                   /db_xref="GOA:Q5LKS5"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS5"
FT                   /protein_id="AAV97438.1"
FT                   /translation="MYTHEDLSHLRNQSLKLQGWIRQQTFSPEMEKTLRRFSSWEVSEL
FT                   IFNVNQSTFRGKLVADPTLPGGEVEPDGRQRWFSLEEVNELRRRLKINRKSLMPPRPAG
FT                   KRAIRAAVANFKGGAGKSTVALHLAHAAALDGYRVLVVDFDPQATLSHSMGLTDVAEDY
FT                   TVWGIMARDLIRETERMNNRAAAAESGTTLPRRQLPASITGMGLGDLRVGDFIKPSSWS
FT                   TIDAIPSCANAAFVEFASAQYRHLNPEWSFFAAVSRYLDQIPDDAYDLILFDCPPAIGY
FT                   QSMNAVFAADMLYIPSGPGYWEYDSTTSFIGQLAEALEDLSHGFDGVLPTGKIGLPKTF
FT                   AEIRFILTRYEPGNALHQAMYEAFRKVFGHHVTDHPVEMTRAVEQSGRFLNSVYEMDYR
FT                   EMTRETWRRARGTFDNAYREFREVMLSAWSKLEDDA"
FT   gene            335100..335789
FT                   /locus_tag="SPOA0305"
FT   CDS_pept        335100..335789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97439"
FT                   /db_xref="GOA:Q5LKS4"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS4"
FT                   /protein_id="AAV97439.1"
FT                   /translation="MQIAKPVGRNASALKYDILSALAVHALAGDKHRQRLILRLSALIT
FT                   TRYNWQRNELSMGRDEIARLWSVDERTVKREMARLRTLGWVTVKRPGVRGRVSVYELDL
FT                   KQMLLDTRTSWAVIGPDFEARLDETPQAETAGNVVPLHVPPPLGESSDDPVWAQVQAAL
FT                   YGRDPELWSSWFQHLSEVERGGGRAVLMAPSRFMADYIAAQWSGRLLAAYSRIDPSIRS
FT                   IRIEAAG"
FT   gene            complement(335830..338127)
FT                   /locus_tag="SPOA0306"
FT   CDS_pept        complement(335830..338127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0306"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by similarity to SP:P46837; match to
FT                   protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97440"
FT                   /db_xref="GOA:Q5LKS3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS3"
FT                   /protein_id="AAV97440.1"
FT                   /translation="MDRIARTIAAEINARPEQVDAAVKLLDEGATVPFVARYRKEATGG
FT                   LDDTQLRTLADRLTYLRELEARRETILGSIRDQGKLTDELSLMIARAETKAQLEDIYLP
FT                   YKPKRRTKAMIARENGLEPLAEAILADRKAEPETLAQAYLSEGVPTTKDALNGARDIVA
FT                   ERLTEDATLLGELRAFLHREAMLSAKVIEGQEQAGAKFSDYFAHSEKWATTPSHRALAM
FT                   LRAQKEGVVTLDIAPDAEGAARAETMVASRLETRGSGPGDAWLRKVAGWTWRVKLSLSM
FT                   MVDLMGDLRARAQEEAIQVFARNLKDLLFAAPAGARPTLGLDPGIRTGVKAAVVDATGK
FT                   LVATDTLYPFQPKNDLRGAQASIARLIAQHGIELIAIGNGTASRETERMVADTLKLLPS
FT                   SVKAPTKVVVSEAGASVYSASELAAREFPGLDVSLRGAVSIARRLQDPLAELVKIEPKS
FT                   IGVGQYQHDVDQHRLGQMLEAVIEDVVNAVGVDLNTASAPLLAHVSGLGPGLAEAIVAH
FT                   RDMNGAFAARRDLLKVARLGPRAFEQCAGFLRIRDGKEPLDASAVHPEAYEVARRIVGA
FT                   CGRDIRQIMGHEGALKGLRAEQFVTESFGLPTVRDILAELEKPGRDPRPSFVTASFADG
FT                   VEDITDLRPGMVLEGTVTNVAAFGAFVDIGVHQDGLVHVSQLADRFVKDPHEVVKTGQV
FT                   IKVTVTEIDVPRKRIGLSMRKDGGASARQEKPARSGGPRDRSPRGPMQSGPKGGGGSGA
FT                   LGAALQDALRKR"
FT   gene            complement(338501..339977)
FT                   /pseudo
FT                   /gene="frdA"
FT                   /locus_tag="SPOA0308"
FT                   /note="fumarate reductase, flavoprotein subunit, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error;identified by similarity to
FT                   SP:Q9Z4P0"
FT   gene            complement(339974..341653)
FT                   /locus_tag="SPOA0309"
FT   CDS_pept        complement(339974..341653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0309"
FT                   /product="sulfoacetaldehyde acetyltransferase, putative"
FT                   /note="identified by similarity to SP:Q84H44; match to
FT                   protein family HMM PF00205; match to protein family HMM
FT                   PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97441"
FT                   /db_xref="GOA:Q5LKS2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS2"
FT                   /protein_id="AAV97441.1"
FT                   /translation="MTHINGGEAVYRVLKANGIDTVFGLLGGSMLELYDAMHKGREIAY
FT                   VGARDERAAGHMADAWARMTGKPGVVLGAQAGPGVVNIVTAVAEAHLAYSPMVVIAGAI
FT                   TRADQAKDTFQEVDQVALFAPICKRSVMVTDPSRLAPMLEDAIRLANTGRRGPVVLHVP
FT                   RDLFAEEIPAIYPKPLALARPGPAAPADVSAIAALLAGAVRPVIFAGGGFKWGAGRDAL
FT                   TALAETLEVPVVASTGHADVMRHGHPWFAGQAGPRGNRVASRLTKEADVMVVLGARLGF
FT                   NSTFHSNDYVGAETRIAHVDVEGAAVGRYFPAEIAAQGDARLTAEALTEAGERPNCDAW
FT                   RERFRADMDSLLAERAEEALVETLPMHPRRALGELRNTLPEDAIVTLDTGNTCLQAADR
FT                   LAHYAPMSLITPLDFGLVGFGLAAAIGAKAAAPERPVVAIMGDGAVGYTMIEIQTAISH
FT                   KLPITIVVLDNEAWGAEKAYQQEFYGGRLLGAEIESPRFDKFAELCGGKGIWVDGPGGM
FT                   GSALQEAIASGQTTVIQAKIDPGALMTLRKDLFKAPQKEAKA"
FT   gene            complement(341657..344068)
FT                   /locus_tag="SPOA0310"
FT   CDS_pept        complement(341657..344068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0310"
FT                   /product="aminomethyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97442"
FT                   /db_xref="GOA:Q5LKS1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS1"
FT                   /protein_id="AAV97442.1"
FT                   /translation="MSDTTRVTRVAIIGGGIMGVAAQFQLAENGWTDTILFEKAELTSG
FT                   STWHAAGQIAHAVGSRIAGWINKTSIETYKRVEKETGQSIGWHEVGGFRIATTDDEVDW
FT                   MKSIMGVGRLLDLPMDLVGPDEVAKGNPFYKVDNVKAAVQTYEDGHIDPSGVTMALAAA
FT                   TRARGAKIERRNQVLGASRKGDMWCLRTEKGDVLAEHVVIAAGSYANQVGEWFGLKIPS
FT                   VSCLHHYLVTDRVPEFEGRPELPVMRDNAFGGYIRQEQKSGLIGIYEGHVCPTVWEMPK
FT                   GAPWAAENELFEADYDSIGDFLMIAFDKMPILAELGIKRVVRGAITHTPDGGMLVGPSG
FT                   APNVWLSCGSSIGLAWGGGAGKVLADWMVHGETSINTRSLDPRRYGDFASDHYIVERTK
FT                   DEFMRRHDTPCPGKQFHSLRPLNRHQLYDRLAAKGAVFGEIAGWERPRYFGDVGEVEQI
FT                   GWGHQSWHENALAEAQATRATAGVIDLCAFAQFEITGTDAGKLLNRLSANRIPHKDGRM
FT                   SLNHLLTEKGRFETEITIWRINENRYFTGSPITRANPDFAWIKSHIRPGEDVQMVNRSA
FT                   DWGMLAMSGPASRRILSELTDADLSNAAFPWLSGQEITVAGVPCYALRVSFVGELGWEL
FT                   HALLNRIPELYDALFDVGSAHGLTDLGSYAFNGMRMEKAYRASGELTTDIGPFDVGLER
FT                   FVVTEGRDFIGKEALLQRDPEWELFYAELQSDDIDIHGGEPVFFRDQIVGLTTSGGYGY
FT                   TLGKSLGWLFVRKGTPRADIAVRILNETYPVTIHDAPLFDPDNLRPKAED"
FT   gene            complement(344068..346467)
FT                   /locus_tag="SPOA0311"
FT   CDS_pept        complement(344068..346467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0311"
FT                   /product="FAD dependent oxidoreductase/aminomethyl
FT                   transferase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97443"
FT                   /db_xref="GOA:Q5LKS0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKS0"
FT                   /protein_id="AAV97443.1"
FT                   /translation="MTLPSHARTVVIGGGVIGCSIAYHLAREGRKDIVVLERSKLTSGT
FT                   TWHAAGLVRRLRPSATLTRLINYSIDLYGELERETGQATGWTQTGSLTLATNTDRLTNI
FT                   KRQVSLGRAFGLEAEVVDANRAQELWPLIEVDDVIGAVWSPADGRVNPSDVALALSKGA
FT                   KARGVHLFEDTAVTGLKKKGGRISAVEVGEHVIEAEEVVIACGLWSREVAAMAGAHMPL
FT                   YACEHYYILTKPLAEVQALGPGAHLPTLNDQDAYLYARDDVEGLLVGSFEPHAKGISTK
FT                   DLPANFSFDLLDEDWDHFMPMMENALRRIPALETAEVRKLLNGPESFTLDSQFMLGESP
FT                   EVPGLFLMGGMNSTGIALAGGAGRAMAEWIIAGEPTMELNEADIRRFSPEMDVLGALEA
FT                   RIPEVLGRHYDNPYPGRAMDTARGQRRSPVHEGLVAAGARFEARGGWERALHFGGDEAH
FT                   LPLTFGIPKWRDQVAREVDACRNGAAILDQSAFGKIMVQGPDACTFLNRLCAAQMDIAE
FT                   GRIAYTQILNARGGVESDLTVQRHGPETYLMIVGAGEVVRDMKRMRETRGDFRVEFTDV
FT                   TSGYAAIGLAGTKAREVLQATTNTPVPDLKRFRFAPVEIGLARGWAGRLSFTGEEGYEL
FT                   YVPSDMAMAAHEALVAAGATHAGLFASGSLRIESGFRAFGHELTPGTTPQEAGLGAFCA
FT                   FGTGFVGQGALANAGSPKRRVVSLLFDDPNAMPIHDEPIYYDGRVVGQITSAAWSYRFG
FT                   RSVALAMINAPLDLIATQDVVTGFEVEIACTRFAASVSVKPAKEAF"
FT   gene            complement(346464..347753)
FT                   /locus_tag="SPOA0312"
FT   CDS_pept        complement(346464..347753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0312"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase,
FT                   putative"
FT                   /note="identified by similarity to SP:P24630; match to
FT                   protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97444"
FT                   /db_xref="GOA:Q5LKR9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR9"
FT                   /protein_id="AAV97444.1"
FT                   /translation="MMNQDLSTRARASLPGGVSHELRYRDPYPVFIDRAQGGEKWDVEG
FT                   RRYIDFKMGSASQMLGHCHPAIVEAIQKQAERSVFSADCHTREIEWAEWVNRLYPSADR
FT                   TRFTASGTESTMLALRLGRAYSGKDHVLRVEGHFHGWHDHALKGAKPGSDQVPSLGIPD
FT                   AINDLIHICAADPQAMESALQDDRIGTVIIEASGANYGCVPLATDTLRALHDVVRAAGV
FT                   VLIFDEIITGFRWSPGGRQARDGIVPDLTTLAKVVTGGLPGGAICGRADIMELLNNATV
FT                   RNGFGPAVSHKGTFNGSPLIAAAACAAMPLLANGEAQAQADAMAERMRDGMNAAMKRQG
FT                   VAGIAYGDSSIFHVFFGRDRLDGLGPAEIRGLPKPLVKAYRDGMLSRGVDMMAYTSGLT
FT                   SSAHTPELIDEALLAFDDTLSEMIRDGALT"
FT   gene            complement(347750..349294)
FT                   /locus_tag="SPOA0313"
FT   CDS_pept        complement(347750..349294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0313"
FT                   /product="trimethylamine methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF06253"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97445"
FT                   /db_xref="GOA:Q5LKR8"
FT                   /db_xref="InterPro:IPR010426"
FT                   /db_xref="InterPro:IPR038601"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR8"
FT                   /protein_id="AAV97445.1"
FT                   /translation="MTKTNRRRGRKDRLKQVSEPDPQPPVWPGVVGGRLKPLSPDEESL
FT                   VEEAAFKLLEDLGLSQAIPSMIEKVTTAGGTMTDDGRLLFPRTLVKWAIDGAQRGFTLC
FT                   GQRPENDLKIEAARVHMSTGGAAPGVFDLDTHAYRDSTLQDLYDAARIVDRMDNIHHFS
FT                   RPVVARDIESNALMDLNTAYACLAGTSKHVSISVTEPRNVADIARLCYAVAGGEAAFRA
FT                   RPFLTEMVCHVVPPMRFAEEACEVLELAIKAGFPVQLISAGQAGATSPATIAGSLVQAV
FT                   AETLAGLVFARLVDPEAKAIFAPKPLVADLRTGSMSGGGGEQAILMAGAAQMGRRWDLP
FT                   TSSIAGITDAKRLDAQYGAEKSLAVAMAAHAGSNIITQAAGMMSSLLGVSHAAYVTDND
FT                   MLGNILRTVRGIEATPENIAADVIAGVCRGVGHYLGEQHTFSRMKSDYFYPEIGDRRAP
FT                   RDWQDNGAKRIGDVAREKTREILSGYFPSHLPDDVDRALRKDFDIRLTRAQIGRPA"
FT   gene            349404..350270
FT                   /locus_tag="SPOA0314"
FT   CDS_pept        349404..350270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0314"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97446"
FT                   /db_xref="GOA:Q5LKR7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR7"
FT                   /protein_id="AAV97446.1"
FT                   /translation="MTASLTALRAFDAAARNGSFRAAAADLNVTPTAISHHIRGLEDQL
FT                   GVKLFRREGRDVALTDDGRRLADATNQAFGLLDNAVQSLRRSARKAVRVSAGPIFTARW
FT                   LMPRISDFWEAHREIELEVVPAIHPGARDRENVDIVIRWDRIADMGRDAVKLLELSPVA
FT                   IASEDFVAKRGPIDHPKDLLILPLLHQRNHWGWLDWFEAMGVSLADPLYGPIFEDANVL
FT                   LRGAAEGQGAIIGWLPLIDQDLAEKRVVRVFDERIAPTHGYFVDVQHNSRARVEVRAVE
FT                   DWLISQS"
FT   gene            351557..353770
FT                   /gene="icd"
FT                   /locus_tag="SPOA0315"
FT   CDS_pept        351557..353770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="SPOA0315"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="identified by similarity to SP:P50216; match to
FT                   protein family HMM PF03971; match to protein family HMM
FT                   TIGR00178"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97447"
FT                   /db_xref="GOA:Q5LKR6"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR6"
FT                   /protein_id="AAV97447.1"
FT                   /translation="MAEKMNSDILYTIVDEAPELASASFLPIIRKFVSAADITVGTPDI
FT                   SLAGRIIATFPENLTADQRQSDDLAALGELVKTPTANVIKLPNISASVPQLVAAIEELQ
FT                   NQGYDIPSYPEAPATDAEKDIRARYDAIKGSAVNPVLREGNSDRRSAKAVKSYAQKNPH
FT                   SMGEWVSTSKTKVSSMPGNDFYANEKSATITAAQAGKARIEFIGADGSVSELKKNWQLD
FT                   EGTVADATFMSVKALGAFLAEAIEDTKADGTMFSLHMKATMMKVSDPIIFGHAVKAWLA
FT                   PVFEQYGDRMAALGVNPNSGLGDLLERVKGDAEILAAIEAVKADRPAMYMVDSDKGITN
FT                   LHVPSDVIIDASMPAVIRAGGKGWDQTGAKGDTNCVIPDRCYATVYDETINFFKANGAL
FT                   DVTTAGSVANVGLMAQKAEEYGSHPTTFEAPANGTIRIVLANGDVLHSHAVEAGDIWRA
FT                   CTVKKAPIENWIQLAMDRQRLTGSEAIFWLDANRAHDAQLIAYVKPVLEAAGVADKFQI
FT                   LAPREATAQSLKTITAGKDSIAITGNVLRDYLTDLFPILELGTSAKMLSIVKLMQGGGL
FT                   FETGAGGSAPKHVQQLVEENHLRWDSMGEFCALGESLNFLADSRGNAKAGVLGRAAEAA
FT                   TQGILDFNRSPSRKVGQPDNRDSHYWFARYWAEALAAQSDDADLAAEFAPLANALADGE
FT                   QAILTELAAAQGKAADIGGYYKPSADLKAAIMRPSATLNAIIG"
FT   gene            complement(353871..355526)
FT                   /locus_tag="SPOA0316"
FT   CDS_pept        complement(353871..355526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0316"
FT                   /product="amidohydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97448"
FT                   /db_xref="GOA:Q5LKR5"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR5"
FT                   /protein_id="AAV97448.1"
FT                   /translation="MPNDTHAQTGASGPTTLFTNANVLTVDAEFSTAQAIAIRGNRILA
FT                   VGSDAEVRAAAGDDATVVDLEGKTVLPGFIDAHAHAVSGSVVDAIMDYVGMARFTTVDE
FT                   VLNHIATRAAKTPAGDWLVFRNFDPAVQEGADALTFAELDPISTDHPIFILNASGHLAY
FT                   ANSRAFEVSGLTNDVPNPPGGEFVRDADGNLTGTIKNNVAFLQIAENYPAMKQVNPVEG
FT                   LLGLLGKWSQQGLTTVSELSLGALAQSPADVQVMAAAAQSGRMTARLRAYPFYTLGTET
FT                   WDNAGVKQGDGNALARVAGYKLVADGSNQGFTGLQREPYLNREDRGLAYMEPDELTTTA
FT                   LERAGKGWHLAIHGNGDAAIDNILDTCQALADAGIDMARVRPRIEHCSILHDEQIARMK
FT                   ALGVSASFLIGHVHYWGVAMRDQVFGLEKAQLLDRCKSVEEAGVGFTLHSDFMVTDPNP
FT                   LHMIEMAVTRRTWKEPDYVLAPQERISVDSAIRAMTSEAAWQLFSDHEIGSLEPGKLAD
FT                   MVILDQDPRKVAPDEIKAIKVLETWMDGQRVFAA"
FT   gene            complement(355845..356303)
FT                   /locus_tag="SPOA0317"
FT   CDS_pept        complement(355845..356303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0317"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97449"
FT                   /db_xref="GOA:Q5LKR4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR4"
FT                   /protein_id="AAV97449.1"
FT                   /translation="MDSKDRQIIRALQQDGRMTNQDLAEKVSLSPSPCLRRLRNLEKSG
FT                   AIRGFSVDVDPAAYGLPITVFVRIRLERHNQEDVHRFETRVRQIDEVLECHIMTGAMDY
FT                   QLRVVVSDLDAYERFIRTRIHPIGGIASIDTSFVYSTVKKTAVFPRLG"
FT   gene            356420..357622
FT                   /gene="megL"
FT                   /locus_tag="SPOA0318"
FT   CDS_pept        356420..357622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="megL"
FT                   /locus_tag="SPOA0318"
FT                   /product="methionine gamma-lyase"
FT                   /EC_number="4.4.1.11"
FT                   /note="identified by similarity to SP:P13254; match to
FT                   protein family HMM PF01053; match to protein family HMM
FT                   TIGR01328"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97450"
FT                   /db_xref="GOA:Q5LKR3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006237"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR3"
FT                   /protein_id="AAV97450.1"
FT                   /translation="MTHAKGFASRAIHHAYDPLDHEGALTPPLHLTSTFAFETAEAGGE
FT                   MFAGERQGHIYSRISNPTLDLLEQRIATLEGAEAGLALSSGMGAITAVLWTLLSPGDEV
FT                   IVDKTLYGCTFSYMRHGLAKWGVTITHVDLTDPENLKTAISDKTRVVYFETPANPNMRL
FT                   VDIAAVSEIAHGASASVVVDNTYATPYLTRPIEMGADIVLHSATKYLGGHGDVVAGLVV
FT                   GGAEQISEIRLYGMKDMTGAVMAPFNAMLILRGLKTLALRMDRHCASAQVVAEWLAAHP
FT                   AVGEVHFPGLTSFSQHALANQQMAQPGAMIAFELKGGMDAGRAMMNRLNMIARAVSLGD
FT                   AETLIQHPASMTHSTYTPEERAEHGISDGLVRLSVGLEEVEDILADLAQSLDAPQVQAA
FT                   A"
FT   gene            357789..360179
FT                   /locus_tag="SPOA0319"
FT   CDS_pept        357789..360179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0319"
FT                   /product="transketolase, putative"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97451"
FT                   /db_xref="GOA:Q5LKR2"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR2"
FT                   /protein_id="AAV97451.1"
FT                   /translation="MSTPQDLSHLKTIEQRILWLSHWMIHHANHIRPKVDGIKIGGHQA
FT                   SSASMVSIMTALYFSTLRPEDRVAVKPHASPVFHAIQYLMGNLDRARMENFRGYGGVQS
FT                   YPSRTKDVDDVDFSTGSVGLGVAVTAFAALVQDYIAAKDWGQGAPMGRMVALVGDAELD
FT                   EGNVYETLQEGWKNDLRNCWWIIDYNRQSLDGIVREGLFERVEKIFDAFGWDVVRIKYG
FT                   ALQRAAFQEPGGDALRDWIDACPNQQYSALTFMGGAVWRKRLMEDLGDQGPVSALLDRR
FT                   SDDELAELMENLGGNCVATMAETFAAIDHDRPTCFLAYTVKGWGTPIAGHKDNHGGLMN
FT                   KTQFAAWQAHMGVPEGQEWEPLATVADPAALRAFLDGVPFFAKGRRRFSDARLAVPGIE
FT                   IASDREISTQAAFGKVLDDLSKGDSELAARIVTTSPDVTGTTNLGPWVNRRKLFARKDQ
FT                   ADAFIEHKIPSTAKWEFTPKGQHIELGIAEMNLMLLLGAAGLSHSLFGKRLIPVGTVYD
FT                   PFVARGLDALNYACYQDARFLLVGTPSGVTLAPEGGAHQSIGSPLIGMSQDGLAAFEPA
FT                   FADELAVIMEWAFDYLQRDGEGDPDERTWLRDETGGSVYLRLSTNPIEQPGKRVDDAFR
FT                   QGAIDGAYWLRKPGPNAEVVIAYQGAVAPEAIRAAGLLGEARRDVGVLAVTSADRLNAG
FT                   WSAAQRARARDNPAALSHIERLMGELPPHCRLVTVIDGHPATLGWLGSVAGHRTIPLGV
FT                   EHFGQTGTIGDLYRHFGIDAGAIVERVEGLTSGRPGQPARLVG"
FT   gene            360331..360708
FT                   /gene="hpcD"
FT                   /locus_tag="SPOA0320"
FT   CDS_pept        360331..360708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpcD"
FT                   /locus_tag="SPOA0320"
FT                   /product="5-carboxymethyl-2-hydroxymuconate delta
FT                   isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="identified by similarity to SP:Q05354; match to
FT                   protein family HMM PF02962"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97452"
FT                   /db_xref="GOA:Q5LKR1"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR1"
FT                   /protein_id="AAV97452.1"
FT                   /translation="MPHFIVEYSGNLEDALDIGALCEVIRATAAGIDTFPMPGIRVRAF
FT                   RADHWAIADGDPKHGFIDISIRLRAGRAPEVKQAAAAEVFEAVRAFVAPVMAQRSLALS
FT                   LEMRDIDPDLSPKTGSIRDHL"
FT   gene            complement(360699..361160)
FT                   /locus_tag="SPOA0321"
FT   CDS_pept        complement(360699..361160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0321"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97453"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKR0"
FT                   /protein_id="AAV97453.1"
FT                   /translation="MPRFPRIDAVYETHLPVRDLDRAVTFYRDVLGLELAHRHAARGLA
FT                   FLWVGGQQTGMLGLWQAGSAPMRMVLHMAFRLELEAVLAVPAALTAAGVDPLGFDGDPV
FT                   SEAVVIGWMPALTVYCKDPDGHSIEFLCPLPDAPDPDFGIGPWSRWRQR"
FT   gene            361284..362402
FT                   /locus_tag="SPOA0322"
FT   CDS_pept        361284..362402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0322"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ61367.1; match to
FT                   protein family HMM PF01170"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97454"
FT                   /db_xref="GOA:Q5LKQ9"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ9"
FT                   /protein_id="AAV97454.1"
FT                   /translation="MDKTQSYDIFLIAPPGLEQVLAEEATACGFDEPRVVPGGVETRGP
FT                   WSEVMRANLVLRGAGRVLVRIGGFPAVHLAQLDKRARKFAWGDFLRPDRPIRVEAVSRK
FT                   SKIYHAGAAKQRVERAITEELGAPISDEAEIRLMLRIERDFCTFSIDTSGEALHKRGHK
FT                   EAVGKAPMRETMAALFLRQCGFDGAEPVLDPMCGSGSFVIEAAEWAAGLMPGRSRSFAF
FT                   EQLAGFDAAQWQSMRNAAGAGGRPESLYSGSDRNAGAIDASRANATRAGVADFCAFHQR
FT                   PVSDIRPPEGRPGLVIVNPPYGARIGDQARLRSLYGSLGKVLMDRFSGWRVGLITSEMS
FT                   LARSTRLPFQAPGPVVDHGGIKVRLYQSVRLR"
FT   gene            362508..363212
FT                   /locus_tag="SPOA0323"
FT   CDS_pept        362508..363212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0323"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97455"
FT                   /db_xref="GOA:Q5LKQ8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:3FX3"
FT                   /db_xref="PDB:3H3Z"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ8"
FT                   /protein_id="AAV97455.1"
FT                   /translation="MAHEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQ
FT                   EEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPC
FT                   EVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELC
FT                   DCDTGACEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDY
FT                   AESDPADSWSKS"
FT   gene            363209..363772
FT                   /locus_tag="SPOA0324"
FT   CDS_pept        363209..363772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0324"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97456"
FT                   /db_xref="GOA:Q5LKQ7"
FT                   /db_xref="InterPro:IPR025255"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ7"
FT                   /protein_id="AAV97456.1"
FT                   /translation="MTSRVQVVLAAIDSANSADPRLDEGRPEAQLYGERMSAELARLVP
FT                   DAADVLQIAARGQHVERWKLARATYPEGRAGYLAWRRAQAVHHAEVVGRLMSEAGYGAE
FT                   EIETAGRMLRKQGIKRDPLVQALEDVICFVFLRWYFAPFAAKHSPEKVQDIVEKTARKM
FT                   SAPARARVLEEFDLPADLATAFAG"
FT   gene            complement(363781..364857)
FT                   /locus_tag="SPOA0325"
FT   CDS_pept        complement(363781..364857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0325"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97457"
FT                   /db_xref="GOA:Q5LKQ6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ6"
FT                   /protein_id="AAV97457.1"
FT                   /translation="MYRNSLMERLALDHPIIQAPMAGGGDTPEMVMAVGKAGGLGSMGV
FT                   SYLQPDRISANATRVREGSNAGFAVNLFAPLDPPPPPADPGPALDFVRPHYQALGITPP
FT                   GTVNGAEFDFEAQVEQVLDSGASVFSFAFGIMPEHVIERARQRGMLVMGTATSVAEAQA
FT                   LEAAGVDAVIAQGAEAGGHRAGFGADLTRAMVGTMALVPQVVSAVGVPVVASGGITDGR
FT                   GIAAALALGASAAQMGTAFLTTTEAGIPEAHKQAILDAKETDTTLTRAFSGRPARGIRN
FT                   RVIADGEAMPDRLLDFPYQNALTRTLRAEAAKQQNPDFLSLWAGQGLGLARRLSAAELM
FT                   QHLIEEMRAALASAARYG"
FT   gene            365032..365916
FT                   /locus_tag="SPOA0326"
FT   CDS_pept        365032..365916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0326"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97458"
FT                   /db_xref="GOA:Q5LKQ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ5"
FT                   /protein_id="AAV97458.1"
FT                   /translation="MDIADLRFFDCVARVGNMNRAAAELNTVQSNVTARIRNLEHDLGV
FT                   VLFHRHSRGVEVTAAGEVLLPYARQVMTLLGDARKAVTQDGAPEGPLSLGALETVLALH
FT                   LAPVLSEFAGAHPAVDLSIQTGTSRELVEMVLAHGVEGALVCGPVAHPDLEATPVFRED
FT                   LCIVARRDGRSLDQVLGAPGVRQLVLRLGCSYRQRLEDVLARRGVVGVRTLEFGTLDAI
FT                   RAGVAAGVGITLMPRRLVTRVWGEAGLALHPLEPGEGLVTTDYIRRKSSYVSPAQQAFL
FT                   DALTRDPPIRMAG"
FT   gene            367716..368282
FT                   /locus_tag="SPOA0327"
FT   CDS_pept        367716..368282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0327"
FT                   /product="rzcC protein, putative"
FT                   /note="identified by similarity to GB:AAF36413.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97459"
FT                   /db_xref="GOA:Q5LKQ4"
FT                   /db_xref="InterPro:IPR003996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ4"
FT                   /protein_id="AAV97459.1"
FT                   /translation="MIESETLAESQAGTRAPEPDFEPEVLAKIEKLRDHIRDSFGKVAM
FT                   AMMAIPRYRNQSLADLNHLVLDPLTRDRLAIACAPKSKGKLGDVAGFAIWASVSEPVDA
FT                   KSREQTKAGTFPIRLKAEDWTSGAINWLLDVIAPDPKTTAQVIANFGQLLKGGDLRMPP
FT                   IVARLVDKETLEKLGATPQAPSQTA"
FT   gene            368322..368957
FT                   /locus_tag="SPOA0328"
FT   CDS_pept        368322..368957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB49961.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97460"
FT                   /db_xref="GOA:Q5LKQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ3"
FT                   /protein_id="AAV97460.1"
FT                   /translation="MHYWVLGQQNTGEYSGSLNPLDGDLGHVELVDTSIDIGIKPIMQS
FT                   LVMTAGRRVKPERLPRKVSHDMSADRIDDLAMVHTYLTVSEPLRTLIEQFAPGDVQYEP
FT                   FDVVGKRDGAFQQRRYWFIPTVRLHAMDKDKTRPPLADIGYFRQSTPLEDQHIVFDASV
FT                   TDNRAIFASAEYPGILFVSDALVEAIEASGLTGARFRRRFASTASELL"
FT   gene            complement(370463..370852)
FT                   /gene="mgsA"
FT                   /locus_tag="SPOA0329"
FT   CDS_pept        complement(370463..370852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="SPOA0329"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="identified by similarity to SP:P37066; match to
FT                   protein family HMM PF02142"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97461"
FT                   /db_xref="GOA:Q5LKQ2"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ2"
FT                   /protein_id="AAV97461.1"
FT                   /translation="MLKSKPKNIALIAHDLKKRSLATWVFNNQTKLKRHNILATATTGG
FT                   IIQKHCPQLRIRVTKSGPLGGDQQIGAMIADDGIDLLIFFTDPLSPHPHDVDVKALSRL
FT                   AVVYDVPMACSGATADLIAASGYLD"
FT   gene            complement(370846..371505)
FT                   /gene="eda-2"
FT                   /locus_tag="SPOA0330"
FT   CDS_pept        complement(370846..371505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda-2"
FT                   /locus_tag="SPOA0330"
FT                   /product="2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by similarity to SP:P10177; match to
FT                   protein family HMM PF01081; match to protein family HMM
FT                   TIGR01182; 4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97462"
FT                   /db_xref="GOA:Q5LKQ1"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ1"
FT                   /protein_id="AAV97462.1"
FT                   /translation="MDSPRNLKSSRIIEICRLCPVIPVLEVEQIEQATPLAQALIAGRL
FT                   RVLEVTLRTDCALSAISEMSRVPNAIVGAGTLRTPEDVRAAKQAGASFGVSPGATDRLL
FT                   DACEETGLPLLPGAASASEVMTLLEKGYTAQKFFPAEASGGRAALRSFGGPLPLVKFCP
FT                   TGGITPEKATHYLELGNVMCVGGSWIAPTSLLRSGNWAEIETRARHASQLGGQASC"
FT   gene            complement(371484..372431)
FT                   /locus_tag="SPOA0331"
FT   CDS_pept        complement(371484..372431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0331"
FT                   /product="2-dehydro-3-deoxygluconokinase, putative"
FT                   /note="identified by similarity to SP:P50845; match to
FT                   protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97463"
FT                   /db_xref="GOA:Q5LKQ0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKQ0"
FT                   /protein_id="AAV97463.1"
FT                   /translation="MSNAELVCVGEPLFELSNVGPGKWNAGVGGDVSNVAVAAARQGTR
FT                   STMLTQLGDDDFAAEIRNSWAAEGVNDAYVRTLVGAETGMYFITHDAGEHKFEYRRSGS
FT                   AASQVRPEDLSEGVFDNAAIVHLSGISQAISASARATTDKAIAIAKKKGVKVSYDPNLR
FT                   LKLWPLEEARKVILDTVRKVDIFLPGLDDARILTGIEEPVDIVRFFADLGAPIIALTMG
FT                   DRGVLAANDGDMRFISSPKVDAVDATGAGDCFDGAFLSQLINEYSVFDAAAYAATAAAI
FT                   SIQGHGAAKSIPNREAVLALQEQCRGEIWTAPEI"
FT   gene            complement(372441..374237)
FT                   /locus_tag="SPOA0332"
FT   CDS_pept        complement(372441..374237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0332"
FT                   /product="dihydroxy-acid dehydratase, putative"
FT                   /note="identified by similarity to SP:P51785; match to
FT                   protein family HMM PF00920"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97464"
FT                   /db_xref="GOA:Q5LKP9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP9"
FT                   /protein_id="AAV97464.1"
FT                   /translation="MTDFQKKKLRSQDWFNNLEDPEMTALYLERYLNYGLTIEELTSGR
FT                   PIIAIAQTGSDLSPCNRHHVTLAQRTREAIRTAGGIALEIPVHPIQETGKRPTAMLDRN
FT                   LAYLSLVETLFGYPIDGVVLTIGCDKTTPALLMAAATVNIPAIALSVGPMLNGWHEGER
FT                   AGSGTAIWMARQKFAAGEIDAKGFLEIAAASAPSVGYCNTMGTASTMNSLAEVLGMQLP
FT                   GAAAIPAPYRERGQMAYATGLRIVEMVHEDLRPSDIMTREALENAIVLGSAIGGSTNAP
FT                   IHLNAIARHLGIHLTNDDWERLGFNIPLLVNMQPAGAYLGEDFYRAGGVPAVVSELLEV
FT                   GRIPHPAAKGANGKTLAENYAGIKATNSDVIRPVDRALMRNAGFLNLKGNLFDSALMKT
FT                   SVIDAAFRERYLSNPEDPEAFEGRAIVFDGPEDFHARIDNPALKLDANCILVMRGAGPK
FT                   GYPGGAEVVNMRPPSYLIKQGVRALPCIGDGRQSGTSGSASILNASPEAADGGGLALLQ
FT                   TGDRIRVDLGKRSVNVLLSDEEMARRRERLDAAGGFPIPQSQSPWQDIFRQSVTQFSEG
FT                   MVLKQATEHQDIARKHTLRNNH"
FT   gene            complement(374238..375503)
FT                   /locus_tag="SPOA0333"
FT   CDS_pept        complement(374238..375503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0333"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="identified by match to protein family HMM PF06808;
FT                   match to protein family HMM TIGR00786"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97465"
FT                   /db_xref="GOA:Q5LKP8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP8"
FT                   /protein_id="AAV97465.1"
FT                   /translation="MFVMLLGLLLTGMPLAFVTLLVALIFALGWFGPMAVPLITSRIFS
FT                   FVNSFVFVSVPMFVLMASILDRSGIAKDLFDAMRVVGGRLRGGVAIQTLLVAVVLAAMS
FT                   GIIGGEVVLLGLLALPQMLRLGYDRRLAIGVCCAGGALGTMIPPSIVLIIYGLTASVSI
FT                   GDLFTASFLPGLMLASFYIAYVLIRAYLNPDIAPIPEPDEIPTKEKLRLLKGLILPILV
FT                   VFMVLGSIYGGIASVTEASAMGVLGVALSAVIRGEFNWELLKGASLQTLSTVGMIVWIG
FT                   IGATALVGVFNLMGGINFVSGLIIGVSDNPTVIVLVMMLILFVLGMFLDWVGIALLTMP
FT                   IFVPIIRELGLDPVWFGVVFAMNMQVSFLSPPFGPAAFYLKSVAPEGISLGEIFRSLLP
FT                   FIAMQVLALAILIAFPGVTGRW"
FT   gene            complement(375570..376130)
FT                   /locus_tag="SPOA0334"
FT   CDS_pept        complement(375570..376130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0334"
FT                   /product="TRAP dicarboxylate family transporter, DctQ
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97466"
FT                   /db_xref="GOA:Q5LKP7"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP7"
FT                   /protein_id="AAV97466.1"
FT                   /translation="MASDSHDFTNERAGPTSAPPEAGTLGKIIDRLGIVFAIAILSSAA
FT                   ILNVEVVLRYAFNSATIWAHETVIFLTASSFVFGGLYVAARNAHIRVVLIYDLLNIKMR
FT                   RLFDVVISVICSFSCAFFAWASWQSVSRAVWTPEGHIRIETTGSAWDPPTAGLIKIFLF
FT                   IVLILLCVQFAVLAFNYFRKRDG"
FT   gene            complement(376203..377222)
FT                   /locus_tag="SPOA0335"
FT   CDS_pept        complement(376203..377222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0335"
FT                   /product="TRAP dicarboxylate family transporter, DctP
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF03480"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97467"
FT                   /db_xref="GOA:Q5LKP6"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP6"
FT                   /protein_id="AAV97467.1"
FT                   /translation="MRRYISQLIATAVFGAALAGSAAAQEYSFRFQSSDPAGNANFILQ
FT                   KSWAEDVRERTGGKVAIELLPVNTIVAHTETQDAVAAGIIDGHFTDTSYFAGKEPAFGL
FT                   IANPVGAWSDPQQMFDFMENGGGKELMNSLVEPYGLHFIGATTPGLEAFVSKVPLDGVD
FT                   DLKGIKMRAPEGMVQRVFAAAGAVPVNLPGSEVFTSLDKGVIDAADYTVFSTNHEQGMH
FT                   DIAKHPVYPGFHSMPLVEVSMNKTTWESLPADIQATLEQSVSDFARRQVSTLAERDAVA
FT                   VAAAAADGVTVHDWSAEERARFRAIAKGEWEAAAGASDASARVYSTLTKYLSDNGLLE"
FT   gene            377348..378382
FT                   /locus_tag="SPOA0336"
FT   CDS_pept        377348..378382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0336"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97468"
FT                   /db_xref="GOA:Q5LKP5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP5"
FT                   /protein_id="AAV97468.1"
FT                   /translation="MRKAEKKSSITLVDVAREAGVSAITVSRVIRTPHVVSERSRRKVE
FT                   AAVEKLGYVPDAAASALASNRTDVIGLLIPSLTNSVFSDVLRGMYDEAENHPFSIQIGN
FT                   FRYRPLTEEMLIGKFLRQKPAGLIVAGLDQTDISKGMLRAADCPVIQIMDYDASAEGDM
FT                   IGFSHYEAGAAAARHLRDRGYRRIGFLGARMDPRTQRRLAGFNDALNGTDDPQQSKRVI
FT                   VTSTASSVSLGAELLRELLVRAPDSDAIFCNNDDLAIGALLEAQRRGIRIPEDFGICGF
FT                   NDLEMSKQMNPGLTSIATPRYEIGRLAISTIVDALSSDKASDPTRIDLGFTVVMRGSSA
FT                   RAVD"
FT   gene            complement(379179..381470)
FT                   /locus_tag="SPOA0337"
FT   CDS_pept        complement(379179..381470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0337"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97469"
FT                   /db_xref="GOA:Q5LKP4"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP4"
FT                   /protein_id="AAV97469.1"
FT                   /translation="MSSNSTHTVSGTVWNQTGNAIKKVWICHFPGKGAAPQYFETQNSL
FT                   NNNQGESFSYDGIQLPSGGNDQWMVYYQDAFNNLIGTDGLFNAEINHNNGGVTITLDGT
FT                   SVDVGQKSSIGVEDTTTYTAMQVPMVAGYLSQGGISVSDMYIAAGLTAPTKSGIGIALS
FT                   GGGSRAMSAGIGQLQALVSMGWTKDVLAMSTVSGGGWVGIPYMFLPKEFSDDDFLGSYL
FT                   PPEQLTNSNINTMGPSQIGGKTNKMSALTLFISMLHMSHAVSDDDRLYSNGTMIWQMLM
FT                   ARYFLHPYGLVTIGHDFNPSDTFAYSDAVIKNNALVNQPVIRSDPFQQADMADPYKIAR
FT                   PMMISNMMLEVQNQSATTFGAPVVSTPFFTGCLGAPDATTTRGIKSSVGGAAVASQGFN
FT                   SMYWYLNGNQPQDQANLVISQRRNWALADCLGTSSSAIAAGVLQFMSRLSLNEIADGVM
FT                   ENGPDVLEADREMLPEDVYLELKNMYDAGDRESLLAQLSAQDIPSFLKTPSYMYWSPAH
FT                   VESSGTSKNPMDYEANFVDGGLMENTGVANLLAFTDINVVFAFINTATAMTKTGGAGIP
FT                   GQNGTDIQVTEDIAALFGYRPYSKSKGWERYSSTDLTKGSIQSRCLARAQIFPDGKFAE
FT                   FLKGLWQATLDENNNPGVYPAVLSQLLELRANPLFGIFKSRLVTISWHYLTPASSWNAA
FT                   LTPSVSSTLSGISDFPNYPTIRTGLDYSEVNFLSSFAGFCALPSNRKPGTSSLMEEVFM
FT                   STPDMPDLED"
FT   gene            381777..382751
FT                   /locus_tag="SPOA0338"
FT   CDS_pept        381777..382751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0338"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97470"
FT                   /db_xref="GOA:Q5LKP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP3"
FT                   /protein_id="AAV97470.1"
FT                   /translation="MDLRKLDLNLLVTFEAIYTAGNISHAAKRLNVSQPTISNALARLR
FT                   DTVGDPLFIRSGRGVAPTPRATGMIGPVRDALQMIQSGFGDDERFDPSTTRRNFRIVVL
FT                   DMLEPILMPPLVRAVQDYRSVTLEMLPVMDFPIAEGLNDGSLDLALTTFDPQHGDIECE
FT                   QVGAAKIVIVARKGHPRIKGEMTPALVSEIGHVALIPKIRALSRVDEVLRYAKIDRHIV
FT                   YMVTRFWSFPHILANSDLIAMMPGDFAAHAALFYPLDIFPVPFEFPEQHIYMIWKKRHG
FT                   LDPGHTWLREKIVEAYRESEARPPGARASVPGAPRPSDFGQTN"
FT   gene            complement(383108..383779)
FT                   /locus_tag="SPOA0339"
FT   CDS_pept        complement(383108..383779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0339"
FT                   /product="HAD-superfamily hydrolase, subfamily IB"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01488; match to protein
FT                   family HMM TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97471"
FT                   /db_xref="GOA:Q5LKP2"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP2"
FT                   /protein_id="AAV97471.1"
FT                   /translation="MKRFAFFDVDDTLITVKSMFDFFRYWTLEWRRESAALEAFEREFS
FT                   QLRAAGESRENLNRAYYRYFAGIRSEDIERAGAAWASAWLAHPERFFIAAPVHLLRELS
FT                   ADGVEPVFVSGSFDAVLRPIADHLSVTNILAAPLELRADGCYTGRIGTPQTIGAGKAVA
FT                   IRNFLSEQKVRADVCLAVGDDISDLPMLQSVGTAVVVGEHPQLTEIADARSWRRLPAMA
FT                   E"
FT   gene            complement(383776..384009)
FT                   /locus_tag="SPOA0340"
FT   CDS_pept        complement(383776..384009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0340"
FT                   /product="tautomerase, putative"
FT                   /note="identified by match to protein family HMM PF01361"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97472"
FT                   /db_xref="GOA:Q5LKP1"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP1"
FT                   /protein_id="AAV97472.1"
FT                   /translation="MPVIQISTFKMADQQKAEALLHEVTAAMHRVTGVPLDKISVFLTE
FT                   VDPARWADAGVVGTHPEFQNLSRRKAYGEVSG"
FT   gene            complement(384039..384818)
FT                   /locus_tag="SPOA0341"
FT   CDS_pept        complement(384039..384818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97473"
FT                   /db_xref="GOA:Q5LKP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKP0"
FT                   /protein_id="AAV97473.1"
FT                   /translation="MDEDGNFVVIGAVTTRADDGVTTRWTGAVVSAQSPVPAFGERAPY
FT                   TIIERFEPDEPLPKHLGDKVLHTLPLPLPCNNYPMVFAPQQYPDANTEDRPSYPLHRAP
FT                   IPDFEPEHGRQLDRPVTLAEWVRASGTLTVTLEHEARKARFSFTFSDLLPRTLYTIMTL
FT                   REHDLDPAGPTRPGPLGVPNVFVTDRSGGAAFEAVLPNPFPDPSQEGGNRVINVVVLCM
FT                   SSQMSHGGAIGRYGLGGDIHAQLKFPQPMFHEFTTRA"
FT   gene            complement(384945..385730)
FT                   /locus_tag="SPOA0342"
FT   CDS_pept        complement(384945..385730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97474"
FT                   /db_xref="GOA:Q5LKN9"
FT                   /db_xref="InterPro:IPR005509"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN9"
FT                   /protein_id="AAV97474.1"
FT                   /translation="MTDNSMKFDTLIVVADKFAEFTVEKPAVTLSQLHAMLKLPKHLVP
FT                   GAVRLLPGQGLSEGDIADLIVQINALDPAGLKWELSLLRTLPERADPCISHKRRSCNTL
FT                   IGSPTKTAHDCYRIDLCIDENCELMGDHQTGQHVQGMLLIEAARQSFIAVTEKYLLTDL
FT                   EEKTYFVINAITTEFTGFVFPLSAHIEYRIVSANVNDRRRKYQVEMDFIQNGELRTRIG
FT                   CAFTVFPHQVIAEKEAALARDAAHCALTQVSLGANAHAA"
FT   gene            complement(385776..386387)
FT                   /locus_tag="SPOA0343"
FT   CDS_pept        complement(385776..386387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0343"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97475"
FT                   /db_xref="GOA:Q5LKN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN8"
FT                   /protein_id="AAV97475.1"
FT                   /translation="MPAELVLISRYPAKPAAAPALAAKLAPVARGRTLVALDDDEVVTL
FT                   VPLEAETALDGLRHSLSEDAAEFAEFLSGDIRREIVSFVEAPKSCNGPLPDTPYIQLRH
FT                   VEVKPEQYAAYRDWRDATIFDVVRNADEVENFLAYHSVVSGQPGVMFVSGFSVAPDTYG
FT                   EVFASERYQDIVRQAGDRYITGGTGGLYTRIYADMSGRVS"
FT   gene            complement(386564..387508)
FT                   /locus_tag="SPOA0344"
FT   CDS_pept        complement(386564..387508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0344"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97476"
FT                   /db_xref="GOA:Q5LKN7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN7"
FT                   /protein_id="AAV97476.1"
FT                   /translation="MEKPENIGNTISIIGKPSGRSLVWDDTRAFLAVARHGTLSAAAGA
FT                   LHIGIATLSRRIDRMEEALGVPLFVRHQSGYQLTEDGSDLIEKAEAMENAAIALSTGAK
FT                   LQAQLTGKVRLATAENFASGLIIPALPEFQARFPGLMVEIVTDITTVNVHRRDADLALR
FT                   MVKPQRGNVTLQRLGTLGYGLYASEAYVQGRNPGTDRGSYETDAFISWGEGQSHLPAAQ
FT                   WAERMLRGRAPALTTTSLSTQVTAAAAGLGLAVLPHFLAADAGLVCLNANIGIDQPIYL
FT                   VIQSDLAQSRRTRALADFLAELVHSNRTRLRGY"
FT   gene            387556..388539
FT                   /locus_tag="SPOA0345"
FT   CDS_pept        387556..388539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0345"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97477"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN6"
FT                   /protein_id="AAV97477.1"
FT                   /translation="MLRRKLGQDLEVSAIGLGCMGMSEFYGPRDDEKSLDVMSRAVVLG
FT                   IDFFDTADMYGPHHNEELIGTFLRQSRARIQVATKFGIVRNPGEYKRSLDNSASYARTA
FT                   CEGSLRRLGVDCIDLYYVHRVNTNQPIEETMEGLAALVKEGKIARIGLCEVSAETLRRA
FT                   HAVHPVTAVQTEYSLWSREVENSVLPTCRALGIGFVPYSPLGRGFLTGRFQSPDEITDG
FT                   DFRASLPRFAEDAITQNRSISNVIAAIAAEKGCSQAQLSLAWLLAKGDNIVPIPGTKRR
FT                   RYLEENAAAASITLTGEEIARLEASIAELPIIGERYTAEGMKGVDA"
FT   gene            388536..388925
FT                   /locus_tag="SPOA0346"
FT   CDS_pept        388536..388925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0346"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02627"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97478"
FT                   /db_xref="GOA:Q5LKN5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN5"
FT                   /protein_id="AAV97478.1"
FT                   /translation="MKPTHGIERDTLALAILDQLESGASERVSNNLDAFDASATELILG
FT                   FSFADVLSREGIDLRTREMLTVAMLGAKGTAPGQLDFHMRAALNCGVTRPEIVEIIYQI
FT                   AVYAGVPAAMNAITSAKKAFEAANI"
FT   gene            388947..390134
FT                   /locus_tag="SPOA0347"
FT   CDS_pept        388947..390134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0347"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97479"
FT                   /db_xref="GOA:Q5LKN4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN4"
FT                   /protein_id="AAV97479.1"
FT                   /translation="MSQYSQRATWRAWLAIAALGTGSFSIVTAELAPIGLLSQIGGDLG
FT                   VSTAKVGLIVTLYAWIAAAAALASAIWLGGLPRRPLLVGLMAVLAASGFATSYSGSFAG
FT                   LMSARIIGAVAHGAFWAMIGTLGAQIVPARQVGVATSIIFGGVSVASVLGVPLANLVGT
FT                   SEGWRSSFLIIGWLSLAVALAVLVTVPAVQGTGRIGTQALFRILSNRRFQRIFLATLFA
FT                   VTAHFMAFTYVEPFLANASAIPVRAIAPLLFTFGAAGIAANMLTAALIDNWLKRIVTLS
FT                   LLLAAAALGVLALFGPQLDLYGAGLALIVWGGSISAILVGLQTWVLKEAGADALQASAI
FT                   YVALFNGAIGLGAAIGAALLGVTSLPGLFLCSALLIGIGIVSVISLAEPQMSPAE"
FT   gene            390671..391216
FT                   /locus_tag="SPOA0348"
FT   CDS_pept        390671..391216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0348"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ60836.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97480"
FT                   /db_xref="GOA:Q5LKN3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN3"
FT                   /protein_id="AAV97480.1"
FT                   /translation="MSPKSPPSGPAKPIATPIVSSDHLAGTDQGWQFSELEYAMTMTYN
FT                   AFSRWMTHCMKAVGYKDFNPLDILVLHNVNHRGKEKRLSDIAFMLNVEDNHTVNYALKK
FT                   LAKADLVVGRKVGKEMFYSTSDQGRQVCEAYRDVRKACLLDAAEATDRDYDEISHVARV
FT                   LRSVSGLYDQASRSAASL"
FT   gene            complement(391276..392235)
FT                   /locus_tag="SPOA0349"
FT   CDS_pept        complement(391276..392235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0349"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97481"
FT                   /db_xref="GOA:Q5LKN2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN2"
FT                   /protein_id="AAV97481.1"
FT                   /translation="MSRPAAPLQGMAYALAGFAVFSLHDALIKALGAGYSVFQIIFFAT
FT                   LFSFVPITVTMLADRRVDTFRPNNPGLVLLRSGLMVGSMVSAFYAFSQLPLTEVYTLLF
FT                   TFPLLVTALSVPLLGEVVRAQRWAAVGIGLIGVLIVLRPGMSALTLGHLAALTAAVCSA
FT                   LATILVRKIGNSERSAVLILYPMLLGALAMGAMQPLVYRPPELVHLGMMALVGVMSFAA
FT                   QHLIIQAYRAAPPAVVSPIQYSQIVWATLLGAVLFGERPDGWVALGAGIIIASGLFVVW
FT                   RESRANVSTRSPVLRAANPRPDAGPSPAPKGPALEPDR"
FT   gene            complement(392232..392450)
FT                   /locus_tag="SPOA0350"
FT   CDS_pept        complement(392232..392450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0350"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97482"
FT                   /db_xref="GOA:Q5LKN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN1"
FT                   /protein_id="AAV97482.1"
FT                   /translation="MSNWFMIWPGSKGGGAALNDRRHISGPGPHDIHRFGIAAMCAAHA
FT                   CPFCVSANGAMQQRRHPGRRPPQDPIS"
FT   gene            complement(392392..392625)
FT                   /locus_tag="SPOA0351"
FT   CDS_pept        complement(392392..392625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97483"
FT                   /db_xref="GOA:Q5LKN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKN0"
FT                   /protein_id="AAV97483.1"
FT                   /translation="MGKGAALPRRLAAGGQAQGGYKAHHGPAQHGDAIAQGLSTQALGL
FT                   AMISVDLRLAQVGNVELVHDLAGVQGRRRRVE"
FT   gene            complement(392691..394046)
FT                   /locus_tag="SPOA0352"
FT   CDS_pept        complement(392691..394046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0352"
FT                   /product="aminotransferase, class III"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97484"
FT                   /db_xref="GOA:Q5LKM9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM9"
FT                   /protein_id="AAV97484.1"
FT                   /translation="MKTANFIKENNARQFWQPMTHPADAQANPPKIITGAAGVRIRDID
FT                   GHETIDAVGGLWNVNLGYSNDAVKQAITGQLDSLPYYSTFRGTTNDAAIELAYDLCDFF
FT                   AEEGIQRVFYTSGGSDSVETALRLARQYHKLRGQPQRTKFLSLKKGYHGTHFGGASVNG
FT                   NNKFRTDYEPLLPGCFHIPAPYTYRNPFNETDPARLAQLCAQALEDEIAFQGAETIAAF
FT                   IMEPILGAGGVIPPHESFMPMVREICDRNGILLIADEVITAFGRTGAWSGSRLWGVQPD
FT                   MMCTAKAITNGYFPFGAVLIGTRMTEVFEGDTSGKGAISHGYTYSGHPVGAAAAVVCLK
FT                   ETVKANVAENAATRGEELFNGLQALAAKHEMIGDVRGGHGLMAALEVVADRASKAPAGA
FT                   AMMNTVYETAYGAGVMLRVSGPNIILSPPLVLSAQDVADILSALDAGFAALG"
FT   gene            394173..395651
FT                   /locus_tag="SPOA0353"
FT   CDS_pept        394173..395651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0353"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97485"
FT                   /db_xref="GOA:Q5LKM8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM8"
FT                   /protein_id="AAV97485.1"
FT                   /translation="MDQAAIDALRTRVIPPRGHVIGGRVEGGGETLDVISPIDGSVLTQ
FT                   IARGGAREVAQATAAARHAFTSRIWAGQPPAARKKVLTRLAELIEGEALDLAVQGVRDN
FT                   GTEISMAFKAESGSAAGTFRYYAEALDKVYGEIAPTAGDILGLVHKEPVGVVGAILPWN
FT                   FPLMIGAWKIAPALAMGNSIVVKPAESASLSILRLAELALEAGLPEGVFNVVTGKGSEV
FT                   GEAMGLSMEIDILVFTGSGAVGRRLLEYSARSNLKRCYLELGGKSPNVVFADVADLDHA
FT                   AKVSAAGIFRNSGQVCVAGSRLIVERSIHDEFVDALCRHASALRVGDPLDLGSTVGAVH
FT                   SVAQLEQNLRFVETALAEGADCALGGKRILEETGGYYMQPTVMTGVTRDATLNQQEVFG
FT                   PVLAVSAFDTEGEAVDLANSTVYGLASGLWTSDLGRAHRMVRAIRAGVVHVNTYGGADG
FT                   TVPLGGVGQSGNGHDKSLHALDKYVDLKTAWMQL"
FT   gene            395648..396946
FT                   /locus_tag="SPOA0354"
FT   CDS_pept        395648..396946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0354"
FT                   /product="aminotransferase, class III"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97486"
FT                   /db_xref="GOA:Q5LKM7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM7"
FT                   /protein_id="AAV97486.1"
FT                   /translation="MTPDTQALLDRRARLLGPNVSLFYDEPVHVVRGQGVWLWDNDGNR
FT                   YLDCYNNVPHVGHCHPRVVEAIATQAATLNTHTRYLHEGILDYVEALTATFDAPLDTAI
FT                   LTCTGSEANDIALRMAQAVTGNTGVIATDHTYHGNTMAVSQLSRTNPPPGGYWDNMAFV
FT                   PAPDSYRPLGGVPGPAHALAFAAAVQGQIEALAARGHKLACLILCPYFANEGFPTLEPG
FT                   WLAPAIEAVRRAGGIVIADEVQPGFGRLGSHFWGHQKAGIQPDVVTLGKPMANGHPVGG
FT                   VVTSPEIMAAFRERFRYFNTFGGNPVSAAAALATLKVVQDEGLMENARAVGDYAREGLR
FT                   DLAGRHECIGDVRGSGLFFGAELVLDRTDKTPATAFAKRVANAMRQRGVLLNFLGIHYN
FT                   TLKIRPPMPFSRDNADQLIETLDAVLSETPFVP"
FT   gene            396943..397887
FT                   /locus_tag="SPOA0355"
FT   CDS_pept        396943..397887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN34322.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97487"
FT                   /db_xref="GOA:Q5LKM6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM6"
FT                   /protein_id="AAV97487.1"
FT                   /translation="MTAAVARALTLWGLDGASYELAAQRENEVWKVSDGTRHYALRFHR
FT                   PAYRSEAELTSELLWVEMLGQAGMQVPQPVRQPDGAVLGRIEGRHVSLLDWLGGRPLGK
FT                   MGQLAPDLDAEAVGRMIGAQMARMHDLSDRWTPPAGFQRPDWRRSGLLGADPLWGRFWE
FT                   HPDLDPAQRQLMIATRERALACFEDFAPGADQGLIHADLVVENVLVDHDRVAFIDFDDG
FT                   AWGYRDFDLATVLVKFIGQPDYDRLRAGLCAGYDARRRVEPGTLDFMLLLRALTYPGWI
FT                   MSRLDEPGGRQRSARMLDTALRLARDFMEERQR"
FT   gene            397884..399119
FT                   /locus_tag="SPOA0356"
FT   CDS_pept        397884..399119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q8YDP7; match to
FT                   protein family HMM PF06792"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97488"
FT                   /db_xref="GOA:Q5LKM5"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM5"
FT                   /protein_id="AAV97488.1"
FT                   /translation="MSDKTILIAGTYDTKDDELTYLAGVIAAQGGGVLSMDVSVLGDPS
FT                   RPTDVSKHAVAEAGGSSIQAAIDSGDENGAMQIMARGAAAKALELYLAGRIHGVIVLGG
FT                   TMGTDLALDLCAALPLGVPKYIVSTVSFSPLLPPERIPADVQMILWAGGLYGLNSICKA
FT                   SLSQAAGAVLGAARAVEAPHRDRPLIGMTSFGKTVLRYMVSLKPALEARGYEVAVFHAT
FT                   GMGGRAFESLAAEGAFAAVFDFAPQEVANHLYGGLSAGADRMTNAGRRGIPQLVAPGCY
FT                   DLVDYIGWQAPPPALADRPSHAHNRLLTSAVLEADERRAVARAICAKLAGASGPVALML
FT                   PTGGCNEWDRPDAPLHDAEGLAAFCDEIRSACPANADLVTLDAHINDAAFSERALAIFD
FT                   DWVARGLVAKGA"
FT   gene            399373..400101
FT                   /locus_tag="SPOA0357"
FT   CDS_pept        399373..400101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0357"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97489"
FT                   /db_xref="GOA:Q5LKM4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM4"
FT                   /protein_id="AAV97489.1"
FT                   /translation="MQNATPHILVVDDHSEIRTAVCRYLEKSGLRTTMAKDAREMDAVL
FT                   ATENIDLVVLDVMMPGEDGLSACKRLSQSGDIPILLLTALSEDMDRIVGLETGADDYLA
FT                   KPFNPRELLARIRAILRRTSRTVSPAGSLAGKRVRFAQWILDSDRRVIVDSEGRETSLT
FT                   SADFKLLVVMLERARMVLSREQLMELTSGRVAAPLDRTIDNQISRLRRKIERDLLRPRL
FT                   ITTYRNGGYCLAADVEVLDP"
FT   gene            400107..401477
FT                   /locus_tag="SPOA0358"
FT   CDS_pept        400107..401477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0358"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97490"
FT                   /db_xref="GOA:Q5LKM3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM3"
FT                   /protein_id="AAV97490.1"
FT                   /translation="MPQSLRLQIVCLVLAALAVAQGVTLVLLEDQRGLAVRAAIGNEAT
FT                   GRAANVVRLIERAPVNLHGQIVSAANSPLVRFEIGTDPVVDHISHDANGATEARIRALL
FT                   DDDFSREIRAELHEIDSSALPLPYLEPGMADQHREMMRGQMLTVELELSIALAGGDWLN
FT                   VSTRFERPPLQWPQFATLSFGLSAAFILLAVFWYLLARVTGPLRLLAAAAEKLGPEQGA
FT                   PVLASAGPREVRELIQAFNRMQDRIVRLVAERTRMLAALGHDLRSPLTAMRVRSEFVED
FT                   DETRDSMIASIEEMQHMVEETLSFARGLADGEPLQSVELGAFLKTLRQDMPDGFTLAQG
FT                   ERIEVPLRPNAMRRALRNLIENAQRYGSEAEVSFARTRGGAVIRVCDRGPGIPEPELER
FT                   VFDPFMRLETSRSRETGGHGLGLSIARSILRAHGGDIVLSNRPEGGLCASLSLPRQG"
FT   gene            401807..402403
FT                   /locus_tag="SPOA0359"
FT   CDS_pept        401807..402403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0359"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97491"
FT                   /db_xref="GOA:Q5LKM2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM2"
FT                   /protein_id="AAV97491.1"
FT                   /translation="MAGQGYISIQNSARDALDPPALEGANWQPTGPPVDNGFHGFGQRG
FT                   ERHMNKLGLAILAVPLAGLGFLVWNMLAPAPQSHSMTPPDTSAQQPGAPLAEVTLPTEL
FT                   SQNARIGQRAFEAKCAVCHGQNAAGQNGVAPPLVHPIYRPGHHADAAFLIAARNGVRAH
FT                   HWKFGNMPPVEGITDGEVQMITRYIRELQQANGIE"
FT   gene            402425..403855
FT                   /locus_tag="SPOA0360"
FT   CDS_pept        402425..403855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0360"
FT                   /product="multicopper oxidase, putative"
FT                   /note="identified by similarity to GB:AAD24211.1; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97492"
FT                   /db_xref="GOA:Q5LKM1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM1"
FT                   /protein_id="AAV97492.1"
FT                   /translation="MAPDISEHQGKNMLSRRSFLWASGGVAAIAALPATAIRAQTAAPE
FT                   LVARVNPVQLLPSGYPETSVWGYGGQAPGAEIRVTQGARIARRFVNQLPQASSVHWHGL
FT                   RAENAMDGVSGLTQDAVPPGESFDYDLVAEDAGTFWYHSHNRSAEQVARGLYGPLIVDE
FT                   PTPPDVDRDVTLMLDDWRIDPETGQIEDDFGATHDLSHGGRLGNYISTNGEAAYQLPVK
FT                   RHERLRLRIVNAANARLFTLGLQGLDGWLMAYDGMPIATPEAIPETFTLGPGQRVDLFV
FT                   DVIADAGQEALLGRVDQRGGFVQAAFPVSGGASVNRRPAPAPLPPNRAPDLAGLDEAAT
FT                   LRLEMSGGAMGGMRDAIWKGSSRKAGDLMAEGQFWAFNGLVGMTDTPLASLSLGQVARM
FT                   TVVNDTVFAHAMHLHGMHFRVLAEDGTPGPLRDTLLTMRGETHEIVFAADNPGRWAFHC
FT                   HMLSHAASGMMTWIEVTA"
FT   gene            403852..404352
FT                   /locus_tag="SPOA0361"
FT   CDS_pept        403852..404352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0361"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97493"
FT                   /db_xref="GOA:Q5LKM0"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKM0"
FT                   /protein_id="AAV97493.1"
FT                   /translation="MKPVYLAGSAVAIIALAAVIYAARATTGPVSAGASTSVSVVSDAT
FT                   LAQGETLYQENCASCHGRSLEGQPNWREPDADGRLPAPPHDESGHTWHHPDSMLFDYTK
FT                   FGGQATLAALGVELESGMPAFGEQLSDDQIRSILDYIKSTWPARVRAAQAERTRADEEA
FT                   RNQ"
FT   gene            404349..405083
FT                   /locus_tag="SPOA0362"
FT   CDS_pept        404349..405083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0362"
FT                   /product="27kDa outer membrane protein"
FT                   /note="identified by similarity to PIR:A49232; match to
FT                   protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97494"
FT                   /db_xref="GOA:Q5LKL9"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:3GYK"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL9"
FT                   /protein_id="AAV97494.1"
FT                   /translation="MTRAKQIILWASLSAMPLIAQASERSDDEIKALVYQAILERPEII
FT                   LQAVEQLQQAEEAAQAASAHAALTENRDSLFNDPNAPVLGNPEGDVTVVEFFDYNCPYC
FT                   RRAMAEVQGLVDADPNVRLVYREWPILGEGSDFAARAALAARQQGKYEAFHWALMGMSG
FT                   KANETGVLRIAREVGLDTEQLQRDMEAPEVTAHIAQSMALAQKLGFNGTPSFVVEDALV
FT                   PGFVEQSQLQDAVDRARKAAAK"
FT   gene            405287..406045
FT                   /locus_tag="SPOA0363"
FT   CDS_pept        405287..406045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0363"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97495"
FT                   /db_xref="GOA:Q5LKL8"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL8"
FT                   /protein_id="AAV97495.1"
FT                   /translation="MPPAQPPITGAKLQSRPAHRPFPSRSVTVALLAALMVAAVLAVGW
FT                   AGLEQQSVAALLERAGPLGPIAIVALMTLAVVISPLPSAPIALAAGAAYGHALGTGLVL
FT                   AGAMAGAMIAFTLARLLGRAFVVRWVGPMSDAGLLGSQNFLTWTVLVSRLLPFVSFDLV
FT                   SYAAGLSALRPWRFVLATLVGIVPASFGLAHLGSALRQPAAGGAVWPVLALGLLTGLPV
FT                   AWAVWRSRRAPGPAGASGSPAQSTKMPRRL"
FT   gene            406161..407222
FT                   /locus_tag="SPOA0364"
FT   CDS_pept        406161..407222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM42746.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97496"
FT                   /db_xref="GOA:Q5LKL7"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL7"
FT                   /protein_id="AAV97496.1"
FT                   /translation="MSASRILTAFGLTGALVTAGVAQAGIVYIPEGSADSVLMVESETG
FT                   QPVGRISGVEAVHGLAGAPGTPYLVAGSYSEIDPESAAQTARPEGVSQADHNAHHAKPA
FT                   KAAMPTDKGLSLVSVIDAGTGEVVRRIEVPGAVHHTAVSPDGRWAMATHPGGDGVSLID
FT                   LSTLEYAGFIATGPMPNYVSFSPDNSRAYVSNAGNGTLSELDLDRRILSRNLLAGEGPE
FT                   HFALSRDGATVFVADAEAGRVLRLDIASGAETASYGFGAELHGLDLSEREDTLFVAVKG
FT                   ADQVAAVDLASGAVRLQELAPAPYHLTVADGGETLFVSSREASMVWAVDQVSLRVTAEI
FT                   GIEGEGHQMVVLP"
FT   gene            407279..409636
FT                   /locus_tag="SPOA0365"
FT   CDS_pept        407279..409636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0365"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by similarity to SP:P37279; match to
FT                   protein family HMM PF00122; match to protein family HMM
FT                   PF00702; match to protein family HMM TIGR01494; match to
FT                   protein family HMM TIGR01511; match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97497"
FT                   /db_xref="GOA:Q5LKL6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL6"
FT                   /protein_id="AAV97497.1"
FT                   /translation="MEHSAHSHPTPDTPDIFTCPMHPEVRQSAPGSCPKCGMTLVSEQA
FT                   AALHAQCHGQGHGPGHGGTDEPGGKYDSVPAGWTGSVYTCPMHPQVRQTDPGSCPLCGM
FT                   GLELDSVASADDGPNPELVDFTRRFRVGAVLTLPLLVLTMGPYLGFPEVRTLFGERMTL
FT                   WIELVLGTPVVWWCGWPFMMRGWTSFRTRHLNMFSLIAMGVLAAWLFSVAAVLWPQVFP
FT                   DGFRDAEGNVGVYFEAAAVIVTLVLLGQVMELRAREGTGKAIRALLDMAAKTARVIRDD
FT                   GREEEIPLDAVQRGDRLRVRPGDKVPVDGVVTEGRSSVDESMITGEPVPVEKVAGDRLT
FT                   GATINGTGSLVMEATRVGADTMLSQIVEMVSNAQRSRAPIQKYADQVAGMFVPAVIVIA
FT                   ALAFVGWAFWGPAPALSYALVAAVAVLIIACPCALGLATPMSIMTATGRGAQAGVLIKN
FT                   AEALERFEKVDTLIVDKTGTLTMGKPRLVAVLPEAGHDEGEVLRLAATLEKGSEHPLAE
FT                   AIVAGAEERGVALGTATDFEAVTGKGVTGTVDGKAVALGNRKLVEDLGLDAGNLAETAN
FT                   TRRDEGETVMFVVVEGALAGLVAVSDPVKETTPAALKALHELGFRIIMATGDNERTAKA
FT                   VAARLGIDEIRADVLPEDKARIVRELQAEGRKVAMAGDGVNDAPALAQADVGIAMGTGA
FT                   DVAIESAGITLVKGNLDGIVRARRLARATMRNIRQNLFFALIYNASGVPVAAGLLYPFF
FT                   GILISPMFAAFAMSASSISVVLNALRLRGTRI"
FT   gene            409666..411012
FT                   /locus_tag="SPOA0366"
FT   CDS_pept        409666..411012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0366"
FT                   /product="amino acid permease"
FT                   /note="identified by similarity to SP:P77400; match to
FT                   protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97498"
FT                   /db_xref="GOA:Q5LKL5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL5"
FT                   /protein_id="AAV97498.1"
FT                   /translation="MTRTPQTHEAAPGGAGSISLTNAVAMGTGVMIGAGIFALTGQIAG
FT                   LAGPLFPLSFVLGAVVTMFSAYSYIVMSNTWPSSGGIAMILTKAYGPGAVAAAASVLMA
FT                   LSMVINESLVARTFATYALRPFGIQDGPLVPAIGVALIVMAYLVNVSGNRAVGLWSLVM
FT                   SAVKIGGIALFGIAALWASGIENWSPAARLSQNGITGFAASVALSILAFKGFTTITNSG
FT                   GEITDPRRNVGRTILLSIAVCVVVYLLVALAVGSALTPVQIQQARDYALAEAAQPVLGQ
FT                   TGFYLTVALAMVATASGLIASVFAVSRMLTMLTEMKMIPHSHFGMPGGIRSHMLIYTVV
FT                   IAGALTVLFDLGRIASLGAFFYLVMDMVVHWGVWKNLRHRIGARGWVILTALTLDAAVL
FT                   AAFTLFKWRADPTIVIVALVTMLAALLAERLYLGGFVSDGGEGKHTGHR"
FT   gene            complement(411009..412142)
FT                   /locus_tag="SPOA0367"
FT   CDS_pept        complement(411009..412142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0367"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97499"
FT                   /db_xref="GOA:Q5LKL4"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL4"
FT                   /protein_id="AAV97499.1"
FT                   /translation="MHLILVLAPSLLLVSLLALVFQGLRQLRRNREQRGPRRRTPPRIG
FT                   GLERNLLRQILRGARRQQAGLLLLSLSLMPPLYLSLEMPKQIVNNVLEPSAGPAEIYGV
FT                   SLNQMQMLGLFSAIYLAAISLNGLGKYMLNTRKGRVAEHLLRRVRLLIYRHWRQRPPHQ
FT                   RQSEIVQVLGAEVEPIGGFAADLIALPVTQGGTLLTILLFMFLQDPILGAAALTVLPVQ
FT                   LVLLPYLQRIVNRLSRERIRAMRVLTRGLTGQLSPEQNGLEHIRQTAASLRELERIRYR
FT                   IHRVKFLAKALNNFLTALTPFLFYSLGGYFVIEERITLGALIAVLAAHKDFSAPLKELF
FT                   RYYQQLEDTRIRYRAVLGFLIERHGAPVDGTPEPDRA"
FT   gene            complement(412340..412849)
FT                   /locus_tag="SPOA0368"
FT   CDS_pept        complement(412340..412849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0368"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAF32271.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97500"
FT                   /db_xref="GOA:Q5LKL3"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL3"
FT                   /protein_id="AAV97500.1"
FT                   /translation="MKNLLIVSLVTAISASVAIAGPSGHSEQSQGQGHDSGGGHAGMME
FT                   TGMPGQASQVNRTIKVTMSETDDGEMIYTPKDFDIKKGETIRFMVTNKGELEHEFILDT
FT                   VERNAMHKEAMSQQMESHQSPNAITLEPGKKGEIIWTFGNPGTFEVACLIPGHYESGMF
FT                   GKVAVN"
FT   gene            complement(412958..413620)
FT                   /locus_tag="SPOA0369"
FT   CDS_pept        complement(412958..413620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0369"
FT                   /product="copper resistance protein B, putative"
FT                   /note="identified by similarity to SP:P12375"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97501"
FT                   /db_xref="GOA:Q5LKL2"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL2"
FT                   /protein_id="AAV97501.1"
FT                   /translation="MAWALPAQAEQLIYGFQAEQLEYRQGDSEDSFVWDFDALIGTDEL
FT                   KLVWRSEGERVQGAGGFETLENQLRLQFPVSTFFDAVVGVQASTPDGLPDRYNAVLGLK
FT                   GLAPQWFEIDADLYLSDNSFFRFEGEYEAMLTNRLTLTPSLELTLPLQDDPIYNQAAGG
FT                   VTLEAGLRLSYDLIDRAVSPYIGVNYERSYGGTADMIRAAGDENGAFSVVFGTRLMF"
FT   gene            complement(413692..415635)
FT                   /gene="copA"
FT                   /locus_tag="SPOA0370"
FT   CDS_pept        complement(413692..415635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="SPOA0370"
FT                   /product="copper resistance protein A"
FT                   /note="identified by similarity to SP:P12374; match to
FT                   protein family HMM PF00394; match to protein family HMM
FT                   TIGR01480"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97502"
FT                   /db_xref="GOA:Q5LKL1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL1"
FT                   /protein_id="AAV97502.1"
FT                   /translation="MPHISAWRAALAGATLLLSAATAAQAGTYDITVDKIRIDAGNFRK
FT                   NGIGYNNSQTPTILRFKEGEKVTLNVTNNLREDTSIHWHGLILPFDQDGVPKISFDGIK
FT                   PGETFTYNFPIVQAGTYWFHSHSGFQEPDGAYGAIVIEPKGGERIRANRDYVVQLTDTH
FT                   PQRGKRIMRNLKMSADYYNRSQRTLQDLIKDSGDIGLKAALEDRKMWGRMRMMPTDVED
FT                   VQGFTPMINGESTEQNWTGLFKPGEKVRLRLINSSAMAYFDVRIPGLKMTVVQADGNDV
FT                   KPVTVDELRISVAETYDVIVQPKENRVYSIVAESMGRTALVRGTLAPREGMAGPVPPLR
FT                   EKPRLTMADMSGMMGSMGMEGHVMQSAAKPLDDMSGMDHSQMNMQPKPQPMEGMDHSQM
FT                   GHAAPAPKAEAAPMDHSAMTGTDQPMAGMDHSQMGHAAPAPQAKAAPMDHSTMTGADKP
FT                   MAGMDHSRMTGSGNSMAGMDHSAMANAKGQGDPFYAPGSGLTPKAANGGKFLSYDDLTA
FT                   RKPLYKDRPATREIELRLTGNMERYIWSINGKKLSEAEPIVLKYGERVRFKFVNETMMS
FT                   HPMHLHGMWSILDTGKGQYDPIKHTVSVAPGTTVYTETEVDVTGQWAFHCHLSYHADAG
FT                   MFRKVVIQGGPA"
FT   gene            complement(415806..416144)
FT                   /locus_tag="SPOA0371"
FT   CDS_pept        complement(415806..416144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0371"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97503"
FT                   /db_xref="GOA:Q5LKL0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKL0"
FT                   /protein_id="AAV97503.1"
FT                   /translation="MRQRAEKMWTSLALALLLTLSAFFAPLTAEIDHRGSPDMAAQHQT
FT                   ADAHNHTGVSSCHKIAACEVPVAMLPRDRVALAGAASNVTFSLNDRAPASMALEAPLPP
FT                   PKVHTTGA"
FT   gene            complement(416293..416856)
FT                   /locus_tag="SPOA0372"
FT   CDS_pept        complement(416293..416856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0372"
FT                   /product="TRAP dicarboxylate transporter, DctQ subunit"
FT                   /note="identified by match to protein family HMM PF04290"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97504"
FT                   /db_xref="GOA:Q5LKK9"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK9"
FT                   /protein_id="AAV97504.1"
FT                   /translation="MLTITRLVDRAIRMILTAFCAVLLLMMVAFTVYTVVMRYVFENPP
FT                   VWGDLLTVLSNIWLVFFALALTVRDKDHIALDLIYTRLPLKWAFLVQQFWTLVIFALGL
FT                   VMIIWGVEAVTTMGGKYWEMWYFAWEDGKLVFKPNYMPKKYAVAIVPISGFLVSLAAIA
FT                   SMLEDSARLRAGTYDPAKGLDSGG"
FT   gene            complement(416936..418225)
FT                   /locus_tag="SPOA0373"
FT   CDS_pept        complement(416936..418225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0373"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="identified by match to protein family HMM PF00597;
FT                   match to protein family HMM PF06808; match to protein
FT                   family HMM TIGR00786"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97505"
FT                   /db_xref="GOA:Q5LKK8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK8"
FT                   /protein_id="AAV97505.1"
FT                   /translation="MESILLLTVLVLLILLGAPIGFTLILIPVVYILITDAAPMILIPS
FT                   QMFSAIDSVPLTAIPFFMLTGELMTSATITDRLVDLSRKMIGRMRGSLAQVNVLVSMFF
FT                   AGMNGSVVADTATVGSLLVPAMKRAGYPPAFAAAITAVSSTIGGIIPPSIMMIVLANAS
FT                   GVSVGALFAGGIVPGIMIGLLLMIINHIIAKRNGFERSAEAFSPKAIAVATYKSSLALL
FT                   IPIVLVGSVVFGIAGVVEAGALTATIALFVGLFVYRTITWNNCKSAFVRAFRNSAMVFI
FT                   IIAASGPFSWLLTSMGAINQLEDWLLSYTYNPLMFALVLVMFICLLGMVMDSAANIIVV
FT                   GPVLVDVMVKAGYSDVQAALVVVVGFLIGSVTPPVGVAFFTAGAIAEVRLEKVALAMLP
FT                   YLVALFALLFVLIVVPEITMYLPRAFGFVN"
FT   gene            complement(418331..419371)
FT                   /locus_tag="SPOA0374"
FT   CDS_pept        complement(418331..419371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0374"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="identified by similarity to SP:P37735; match to
FT                   protein family HMM PF03480"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97506"
FT                   /db_xref="GOA:Q5LKK7"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK7"
FT                   /protein_id="AAV97506.1"
FT                   /translation="MKIESALRTFCLASAAALFAQSATGETVLKLGTVGQLGMPIGDAI
FT                   AEALIPTLEEVSGGQMTIEPHYRGSLCGEQTCGEQANQGLLALWTSSTANFGSFGTSLA
FT                   IFDLPYIFKSIEDADRISAEWLAQKQCEIAAEEAGHVCLTVYSSGGFRQLGNALRPVHV
FT                   PADMEGIKWRVTKSPIEYTLIKNWGAVPVPYDWTQLYQGLQTGVVSGQYVATPWQHIAK
FT                   LHEVAKYYTQIGGSWSGNQLSIDKRQYDALSDQERDWLHQAAAAFGQRVQELDREWVAA
FT                   GETAIKAEITEWYMPTDEELALWRAGAIDAWINAKGTFDPETAIRVLEEQGMTDFIDQL
FT                   KAAGAL"
FT   gene            419547..421010
FT                   /locus_tag="SPOA0375"
FT   CDS_pept        419547..421010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0375"
FT                   /product="transcriptional regulator, gntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97507"
FT                   /db_xref="GOA:Q5LKK6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK6"
FT                   /protein_id="AAV97507.1"
FT                   /translation="MSSTTPRFLKLPEASSLSLRDQICEVVSAAIMSDALAYDRPLPSC
FT                   RELAEQFSVSRNTVFAAYNRLVDLEFLVSRDRSGYFVNPQMALAQKPETDTRSALAEPV
FT                   PCPVAFPASNLMPVVNPLDWNAYPYPFIYNQIDPDLFPVDGWRECTRQALGRRNLLDWA
FT                   SDSVESDSPRLVQQLRQRLLNTRGIYVEDDEILVTLGSQNALFLLGTIFAKFGKPIALE
FT                   DPGFFGARNAFRLAGSELVGVPVDGDGLIPAEIPEGCQLIFTTPSHQFPTMVTMSQTRR
FT                   EELLEAAERRDFLIIEDDYEAEMNYVSKSSPSMRSMDRNGRVIYVGSLSKTLSPGIRLG
FT                   FIVAHRDIIREARVARGVMMRHPPTIVQEIVALFFQLGHYDAHLRNIERRYKKRWHAMN
FT                   NALSRHLGMLERTESEGGTSFWLTGPEGFDASALARRLRGKGVLIDRGQDYYLNCNDKR
FT                   SFRLGFAYVPLSKLEQGIKIIADEVWALL"
FT   gene            421021..422331
FT                   /locus_tag="SPOA0376"
FT   CDS_pept        421021..422331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0376"
FT                   /product="epoxide hydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF06441"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97508"
FT                   /db_xref="GOA:Q5LKK5"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK5"
FT                   /protein_id="AAV97508.1"
FT                   /translation="MQLAASVPSNCTTCLSPIPGFASYLSGTSPWPQGVGSKSTRSGKR
FT                   VLKDHVASNPNVSPFRFHVPDDVLESIRSRVAAYPWHEMPDDGGWDYGTNMDYLKELCA
FT                   YWVDGFDWRAQEARLNAFSNHTAKVDGIDMHFLYEPGSGPDPLPLMISHGWPGSVAEFF
FT                   EIIEPLAHPERFGGDIADAFTVIAPSLPGFAFSTRPPRPWGPRRMAGAINALMTEVLGF
FT                   DGYLAQGGDWGGAICSWLGFEHAPACSAIHINVLTMRHPDGPQTPEEVAWDAQFECDQI
FT                   MQNGYRTQQATRPQTLSYAMMDSPVGVAAWLVEKFHDWSDIPVGDIESAHSKDELLTNI
FT                   MIYVTTRCFNSASWIYYGRREEGGRILSPEGRRVEVPTGCAVFPREMLRWPPRSYAERL
FT                   YNIQHWTEMPRGGHFAAMEQPGMLVDDIRAFARTLRR"
FT   gene            422351..423844
FT                   /locus_tag="SPOA0377"
FT   CDS_pept        422351..423844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0377"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97509"
FT                   /db_xref="GOA:Q5LKK4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK4"
FT                   /protein_id="AAV97509.1"
FT                   /translation="MTLSHAEYRSIAATLEPNGMAFIDGAFCAAADGDSFETINPATGE
FT                   ILARVAHCKAADVDRAVAAARRVFNDGTWSRAEPEARKEVLLKVADLVRKHSDELAVLE
FT                   SLDTGKTITDCLAEIGGEVPKFFQWYAELADKTFGKIAPTSPGALALITREPAGIAGAV
FT                   LPWNFPLVMAAWKIAPALAVGCSAVIKPAEQTPLSTIRLAELMQEAGVPAGVVNIVPGF
FT                   GETAGKAIGLHNDIDTVSFTGSTEVGRMFMRYSGESNLKGVGLEMGGKSPFIVLDDAVI
FT                   DDALIEHAAMSAFWNGGQNCSANMRQLIATPLVEEFTARIIARVKSFRLGDPLDPATDI
FT                   GSMITKDHKDMVLSYIQSGVEEGAQKVIGGNSDLPGFFIEPTVFRNLSPEMKIAREEIF
FT                   GPVLGIMPVASPQEALAIASDTEYGLHATVFTRDIDRALHIARSLPCGTVSINGFSEGD
FT                   IKTPFGGYKQSGSMARDNGTEALEQYLQTKTIWIETQAG"
FT   gene            complement(423926..425029)
FT                   /locus_tag="SPOA0378"
FT   CDS_pept        complement(423926..425029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0378"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97510"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK3"
FT                   /protein_id="AAV97510.1"
FT                   /translation="MKLVKLETFSTEFVCFVRATAEDGAQGWGQVAPYYADITAQVLHR
FT                   QVAPYALGMACEDIDAMLDIVRDREHKFPGSYLRRAMGGVDTALWDMHGRRAGKPVCVL
FT                   IGGTPGPVRAYGSSMKRDITPRDEAARLVRLRDEQGFDAFKFRIGAEVGRDRDEWPGRT
FT                   EEIVPTMRRAMGDDVALLVDANSCYSPARAIEVGRMLEQHGISHYEEPCPYWEFAQTKE
FT                   VTDTLDLDITGGEQDCLMERWQTMIADRVVDVLQPDICYLGGLSRTLRVARMAEAAGMP
FT                   ITPHAANLSMVTLFTMHLLRAIPNAGKYLEFSIEGLDYYPWQQGLFTSDPYRIEEGHAT
FT                   VTDAPGWGVDVNPDWLARSDYRVSELG"
FT   gene            425152..426624
FT                   /locus_tag="SPOA0379"
FT   CDS_pept        425152..426624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0379"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97511"
FT                   /db_xref="GOA:Q5LKK2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK2"
FT                   /protein_id="AAV97511.1"
FT                   /translation="MKHAAGALLSSIRLDRTLRRSVSVQLYMALRDMILSGALRAGERL
FT                   PATRTLAKEVGVSRTTVIDAIDRLVAEGMLVSRIGAGTYVSETLENQHLTTPPSEGAGG
FT                   RQPRLSYVISHAEPAYARRAWLPHKPRAFVTALPALDAFPMAHWARLSARHLRGGRGDV
FT                   MGYGQPKGLAALRRAIATHLSALKGIRCHPEQVFITSGAQHAFSLIGRLLLNPGDRVWM
FT                   ENPGASGARNALLSEGAELVPVDVDGQGMVVSDGLAKAPHFRLAFVTPSHQQPLGHVMS
FT                   LPRRLELLQAAEQAQALIIEDDYDGEFYFGNAPRPALHSIDANGRVLYVGTFSKSLFPS
FT                   LRLGFVLVPERMVAAFDGMFNTWASGPSTATQAIVAEFMDEGHFATHIRLMRQLYKARY
FT                   EALLEAARGLPESIGLQETTSGFHTPAFLAPGVDEAEVVAQAAQQGVTLAPLARYCLSP
FT                   IPQTGLVFGFGCATPEDIARGMGILRDLPVLR"
FT   gene            426750..428057
FT                   /locus_tag="SPOA0380"
FT   CDS_pept        426750..428057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE41123.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97512"
FT                   /db_xref="GOA:Q5LKK1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK1"
FT                   /protein_id="AAV97512.1"
FT                   /translation="MPLSKIRQTPFWHDQLGAMPALQTQPSAKVDVLIVGAGYTGLSAA
FT                   LTTARGGRSTLVMDAEDPGYGCSSRNGGQISTSVKPSLEKLTAKFGPERARGIRAEGAN
FT                   ALRWIGEFVGGEGLDCDFRRVGRFHAAHTPGHYEELVRDAETLRQQEGIESFAVPRAEQ
FT                   RSQLGTDAYFGGVVFSAHCSLHPGKFHRELLRLAIGAGAQVVGQCRVGAITRSGSGFQV
FT                   ETAKGVVEARDVIVATNGYTTALTPWLQRRVIPIGSYIIATEELPEATIDELFPGDRIA
FT                   SDTCKVVYYYRASPDRRRVLFGGRVSASETTALAGAARLRHDMCRIFPQLEGVALSHAW
FT                   SGTVAYSFDELAHTGVQEGIHFAMGYCGSGVSMAPYLGMRAGQKVLGLAEGQTAFDGLP
FT                   FPTRPLYRGKPWFLPAAVAWYRWKDQRQFRKALQMT"
FT   gene            428256..429296
FT                   /locus_tag="SPOA0381"
FT   CDS_pept        428256..429296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0381"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   periplasmic substrate-binding protein"
FT                   /note="Assignment partly based on membership in
FT                   spermidine/putrescine ABC transporter gene cluster;
FT                   identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97513"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKK0"
FT                   /protein_id="AAV97513.1"
FT                   /translation="MKTRTILTITAAVMATGAFAQGKSVTIASWGGSYQEAQSKALFEP
FT                   AAANTGIEVKQETYGGMSDVRLQVSSGQVTLDIVASGSGSAARAAAEGLLEKLDYNVID
FT                   VSTFYPGLYTDYCIGGDVFSTVYAWNTNTYGENGPQSWADFWDVEKFPGSRAYRGKVAG
FT                   ALEGALMADGVAPADVYSVLDSEEGIERAIDKIRELKPHISVFWTSGAQHAQLMKDGEV
FT                   DMTTGWNGRFDNAAKDGAKVAYSFNQALLDYDCFAVPKGAPNRDTAMMFLNEISKPEYQ
FT                   DDLPKYITYGPTNKAAYETGEITADVAAGLPSSPANAAMQLPVSLDWYAKWETIAAEMY
FT                   QEMLTE"
FT   gene            429358..430461
FT                   /locus_tag="SPOA0382"
FT   CDS_pept        429358..430461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0382"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to SP:P31134; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01187"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97514"
FT                   /db_xref="GOA:Q5LKJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ9"
FT                   /protein_id="AAV97514.1"
FT                   /translation="MRGFVLTSTTNEALPISVKNVTKTYGPVHALNDVSLEVRSGEFLT
FT                   LLGPSGSGKTTLLMVLAGFTRPDCGSLKFGDREVIRTPPHLRDVGMTFQSYALFPHMTV
FT                   AGNVGYPLKLRKVPKAEIAQRVEAALETVQLGGFGERRIDQLSGGQRQRVAVARAIVFE
FT                   PRILLMDEPLSALDKKLRDQMQIELRHLHEKLGMTTVYVTHDQREALTMSDRIAVVNHG
FT                   RIMQLATPRDLYERPANRFVADFIGESTFLPVSRQGDTVLFDGTPLLHDSPPPEAASLL
FT                   LMIRPERVVLSREGPREGANNFAATATEVVYQGDSFLLHAALANGEQIVLRGAMRGANV
FT                   TALPAVGEALTLCLAPEDTVLIDGSEA"
FT   gene            430463..431347
FT                   /locus_tag="SPOA0383"
FT   CDS_pept        430463..431347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0383"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /note="Assignment partly based on membership in
FT                   spermidine/putrescine ABC transporter gene cluster;
FT                   identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97515"
FT                   /db_xref="GOA:Q5LKJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ8"
FT                   /protein_id="AAV97515.1"
FT                   /translation="MEAVRTNEAGLRRDEWLERLKLFGLGSPAILLILVILVLPVGWLF
FT                   YVSFIGADGNFSLENYERMLKRKSYARIFQTTFEVSFLTTGLCILIGYPLAYFIAGLPN
FT                   RIANLCLITVLLPFWTSLLVRTYAWLVLLQKRGLVNEWAISLGLWDEPIKIVHNMTGTL
FT                   IGMVHIMLPFLILPVYGAMKAIDRDLMKAASNLGASPRRAFWTVFFPLTLPGLFAGSLM
FT                   VFILCLGFFVTPAVLGGGKVIMVSMKIVSNIELFVNWGAASALGVVLLVSTMVILWIAS
FT                   RFLNLEKMTGGGH"
FT   gene            431347..432174
FT                   /locus_tag="SPOA0384"
FT   CDS_pept        431347..432174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0384"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97516"
FT                   /db_xref="GOA:Q5LKJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ7"
FT                   /protein_id="AAV97516.1"
FT                   /translation="MLRWFRSPATETQITHGQRLWLYVIAVITMILLVTPTLIVVPMSF
FT                   SDSQYLEFPPETWSTRWYDHYFGSPEWMLATRTSFKAAFLTMLVATPIGVLAAYGLHSS
FT                   KIRFVRAAFVLMITPMMVPVVLVAIGAFYAYVQLQILYTITGLVLAHTVLALPLVVIVT
FT                   GSALKSFDMSQEEAARSLGAPRWKAFLTVTLPQIRFAVVTSALLSFLTSFDEVVVAMFV
FT                   SGGDNPTLTRNMFNALRDQIDPTIASISTIMILVTTGMMVLAQLFGQQKTKPK"
FT   gene            432275..433567
FT                   /locus_tag="SPOA0385"
FT   CDS_pept        432275..433567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0385"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE33186.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97517"
FT                   /db_xref="GOA:Q5LKJ6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ6"
FT                   /protein_id="AAV97517.1"
FT                   /translation="MIENERPALADSLWTATANSAPDCPPLVGEAEADVVIVGGGFTGL
FT                   SAALHLAEAGQSVVLLEAETPGWGASGRNGGQVNPALKPDPDDIVARFGDDLGRRMVAR
FT                   WGDGGRLVFDLIARHGIDCDARPVGFLRTATNTRGLAMLSEIARQWRAHGAEYDDLDAA
FT                   ETARLVGAEAYLGAVIDRRGGNIHPLNYALGLAQAAIRAGAVLHGQSRAIGFEDAGTGV
FT                   SVRTELGQVKARRALVCTNAYTGPFGGALGRSVVPVTSVQVATAPLSDNVIRAILPEDH
FT                   APTDTRRLIQYYRKTADGRFVMGGRGARGEAGTRRRQQELRQAAETLFPQLGAADWVHA
FT                   WGGDVAMTVDSLPGLHRLGPNVMAGLGFNGRGVANATVMGTILADWVLGVPERALDFPV
FT                   TPVRPIPFHFLKSAGVALTIGAYRLLDRVNR"
FT   gene            433575..435200
FT                   /locus_tag="SPOA0386"
FT   CDS_pept        433575..435200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0386"
FT                   /product="oxidoreductase, GMC family"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97518"
FT                   /db_xref="GOA:Q5LKJ5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ5"
FT                   /protein_id="AAV97518.1"
FT                   /translation="MSDYDFIIVGAGSAGCVLANRLSESGRFTVLLLEAGGSDLNFWIW
FT                   MPIGYGKTFYKPSVNWMYHTEPDPALNGRVSYWPRGKVLGGSSSINAMVYIRGQAQDFD
FT                   EWQGLGNPGWGWDDVLPYFRRAETNDRGGDAFRGDNGPLHVASMERDLHPLCQDFIAAG
FT                   GELQFPHNPDFNGATQEGVGTYQNTAKGGLRMSAARAYLRPALRRTNLRVETGALAERV
FT                   LFEGKRAVGVSYRQNGQVRTVRARREVILSGGAINSPQLLQLSGIGPAHLLQDKGVEVV
FT                   HALDGVGRNLQDHLCIDHLYRSRVPTLNTQLHPWHGKLWHGLRYVLTRRGPLSLGVNQA
FT                   GGFVRSRPGLDRPNMQLFFSPVSYTKAPPGKRPLMNPDPFPGFLLSAQPTRPTSRGHLE
FT                   IRSGDPTEAPAIHPNYLSTETDVQEMLEGAHLVRRFTETPALARLIEAELLPGADIRSD
FT                   DDLIADIRQRAGTVFHPVSTCRMGPDTQRDVVDARLRVHGIGGLRVVDASIFPTLTSGN
FT                   TNAPAIMVGEKGADMILQDCGAGG"
FT   gene            435270..436184
FT                   /locus_tag="SPOA0387"
FT   CDS_pept        435270..436184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0387"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97519"
FT                   /db_xref="GOA:Q5LKJ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ4"
FT                   /protein_id="AAV97519.1"
FT                   /translation="MHLKLRHLEVFHAVMEEGSVSKAADRLHLTQPAISIALSRLEDML
FT                   GFPLFHRSKGHFAPRPEAYLLHLDAELSILAVEQFANRARLIKQGGAGLLRIGALGASA
FT                   FGLLPQLVARFTADNPKVEIDLRVRSSHQISYLVSNGQCDIGLVEAPVAAPSLEVEPFS
FT                   LPCVCIFPAGSPLEAKDRITPRDLVDHRLIGIQDSNQVDRQLRAVCAEAGFEIAAPVHG
FT                   FFFAVVRRMVAEGAGVAIVDALNGCLPLNDGVSWRPFAPEIRYETALIMKAGAELSLPA
FT                   QAFIQMIRDEMRMCAILPETVRV"
FT   gene            436276..438348
FT                   /locus_tag="SPOA0388"
FT   CDS_pept        436276..438348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0388"
FT                   /product="acetyl-CoA synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97520"
FT                   /db_xref="GOA:Q5LKJ3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ3"
FT                   /protein_id="AAV97520.1"
FT                   /translation="MKDQSSASAALNALLAPKSIALVGVSDRAESYGRALDRMVSEGGF
FT                   AGRVMRVNPRLAAQSQGRIAASLDELPEPPEHVVLSVATARVEAAVDAALAAGARALTV
FT                   FSACPDAAMRERIGDKVRAAGAALCGPNSMGFHNITLGLRVTPFPVPLDLRAGGVGLIA
FT                   QSGSILGALMNNDRRLRFSQAVSTGSETVTTAADYLRWMVDQPETRVVGLFLETVRDPQ
FT                   GFIAAMEAAAARDIAVVILKVGRSALSARMAISHTGALVGDDAVLRALVHRLGGHMAGS
FT                   LDEMAAMLALFAQGRRATAPGIASIHDSGGERELMADMAEDHRLDYAALSPATTAAIQA
FT                   VLEPGIAAENPLDAWGTGQGARETYTRALAAMMADARVGTGLYVLNWRGNYYLHEMHAQ
FT                   ALGDAFGQTEKPLAAVSNFSRSDDAMLAGRFADLGIPLISGMQNAMAAVRALHDHGPVS
FT                   RFRAPEPPHPRAQYWRDVLGGRDWIGEAEGLALFADFGIESPSHALVGTREEAFLAAER
FT                   IGGPVVLKTAQPGLSHKSDSGGVKIGLATPQAVAEAFDDLAARFQGDILVAEMVAPGAE
FT                   WSMGAINDPDFGPAVRIAPGGIFVDLIDEHVLLIAPFSAAEAAAAIDKLRAGKLLAGLR
FT                   GRPTLAASQLAHAAAALSRLAWDLRDTLAEVEINPIIVNTQGAMAVDAVIRAHPS"
FT   gene            438569..439006
FT                   /locus_tag="SPOA0389"
FT   CDS_pept        438569..439006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0389"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97521"
FT                   /db_xref="GOA:Q5LKJ2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ2"
FT                   /protein_id="AAV97521.1"
FT                   /translation="MYTIGTLARRTGTKVQTIRYYEQIGLMPEAGRTSGGQRRYDEAAL
FT                   DRLAFIRHGRQLGFGLDAIRELLALNDQPGQSCSASDSIARRQLAQVQQRLARLRALEA
FT                   ELQRMIDSCDGHRGSDCRVLEVLRDHSECLTDHGSEAPVQS"
FT   gene            complement(438997..440526)
FT                   /locus_tag="SPOA0390"
FT   CDS_pept        complement(438997..440526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0390"
FT                   /product="phosphonate monoester hydrolase, putative"
FT                   /note="identified by similarity to PIR:T44602; match to
FT                   protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97522"
FT                   /db_xref="GOA:Q5LKJ1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="PDB:4UPK"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ1"
FT                   /protein_id="AAV97522.1"
FT                   /translation="MGRQSNVLFIIIDQLRADCLWGALADHVELPHLRALAQDAVSFRR
FT                   HYSVTNPCGPSRASILTGQYAMNHRSVRNGTPLRHDTPNIATEMRKAGYLPLLFGYTDT
FT                   SQDPRAYDANDPALKTYEFPMRGFHEVTEMRLEMSYPWQSHLKNRGYAFDDYAQVYVPR
FT                   PDADGTPRLNGPAMYRAEDSDTAFLTDQFLANMPAWAGQNWFAHLTYIRPHPPLVAPAP
FT                   YNTMYDPAKLPLPARLPGRDDETAEHPFFGPATRYSSPASFVLGFPDLEPTDETIQTLR
FT                   AVYLGLATEVDTHIGRVIAHLKETGQYDDTLIVVTADHGEMLGDRHSWGKMTVYDAAYH
FT                   TPLIIRAPGCKPGHVVEAPTESIDLMPTILDWVGQEIPNAVDGRSLRPFLTGEAPSDWR
FT                   QYSFSELDISEPLDPTLWQQEFGFGPSAGAVAILRDARFTLVEFAADLPPMLFDHQGEG
FT                   EFRNVAGDPAHAADLARLSRQMLRHRMRNMDHTLSLCSITHEGARTQRRYD"
FT   gene            440874..441527
FT                   /locus_tag="SPOA0391"
FT   CDS_pept        440874..441527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0391"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97523"
FT                   /db_xref="GOA:Q5LKJ0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKJ0"
FT                   /protein_id="AAV97523.1"
FT                   /translation="MPLFAGLGAGELAALARQCDLRAYEKAQMVYAEGEAARSAYVIMY
FT                   GQIDSIWYDKTGREVIFETRTRYDLLGLHEVADGRGRPATSVCASRAALVHIPPGASRR
FT                   LLDHPGVQAALARNARDELRNLRDSYRRAVLFDLETRLAHYLLAQADPGRGRPHQLRIE
FT                   ENQLRIAAKVQASRTRVNTTIRKWRESGDIAVKDGAILLERTSRLWDRFGPDQS"
FT   gene            441633..442271
FT                   /locus_tag="SPOA0392"
FT   CDS_pept        441633..442271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0392"
FT                   /product="RNA polymerase sigma-70 factor, putative"
FT                   /note="identified by match to protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97524"
FT                   /db_xref="GOA:Q5LKI9"
FT                   /db_xref="InterPro:IPR011517"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI9"
FT                   /protein_id="AAV97524.1"
FT                   /translation="MNQYSTIAGPFHAIHTPEEFGRAWRQHHPELMRRACRLAQGNPVL
FT                   GEAFLARTTLRILEYLRSSDQPIDNFQAFFAVSLRNTAQDHWRRYRRDMSIMAELGFHQ
FT                   ARAEDPDATLRRVIARQDLDTLCAALSRMSCDQARLVRLRVFESLPYGEIARRLQISEP
FT                   LARKRMQVARNALRQQIEAGKSCLSRHEPGFAASIPAKAHQSLGGTHGQ"
FT   gene            442261..442560
FT                   /locus_tag="SPOA0393"
FT   CDS_pept        442261..442560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0393"
FT                   /product="R body protein RebB-like protein"
FT                   /note="identified by similarity to GB:AAA73405.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97525"
FT                   /db_xref="GOA:Q5LKI8"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI8"
FT                   /protein_id="AAV97525.1"
FT                   /translation="MANDGSGTPVNSQITDAVTQSNVEVVAISPAQSMGMLYQMATHSA
FT                   GLSLQNSVSSQQNLNQIANAVVATAVREILSIGSGGGGGGGGGGASGGGKPKSD"
FT   gene            complement(442435..443445)
FT                   /locus_tag="SPOA0394"
FT   CDS_pept        complement(442435..443445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97526"
FT                   /db_xref="GOA:Q5LKI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI7"
FT                   /protein_id="AAV97526.1"
FT                   /translation="MAWVNLALTCGSFAGLRLAGLDAFVDFRDAETGRGGLHRATRGGH
FT                   GHGTGQQQFGFGDDQTVLGGGGDLAGHQILGHLLEHHRLAGHHQLGHAVEILRRRLRGE
FT                   PRRLPDHLVGRGHDHRGGVILDLLVLEFHRLHHRRIQRRSIDRALGHRPDRRPTSLAPC
FT                   RSGGRRAKGQLAIGLTRRWRQCHFAHGPSLGLCLSLWRGSTGLVIKGRRLGRVDQGLSL
FT                   GDLILDRGDLGLGLGGGRFDGALGLALDTGEDLVTNLGNRLFQLRGRVHGAREFGCLLG
FT                   HDFLQKGPHLPKLSSIALGLAAARGAAASATASTTAADAEDLAHRRGDHRIGDLV"
FT   gene            443439..444830
FT                   /locus_tag="SPOA0395"
FT   CDS_pept        443439..444830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0395"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97527"
FT                   /db_xref="GOA:Q5LKI6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI6"
FT                   /protein_id="AAV97527.2"
FT                   /translation="MPLVPQPQNARWLTGDAVEGAKGLIRETDATYLMKILLRAFGNGG
FT                   PMDAVAATLQTLCDQARSTVDQLNIDAPLTVGDDSIWSGYNPDGHGEFELNIRLLATLH
FT                   VRYNNTLTNPLAIGDVCRACADMISAAPRHPNTAPGLAPIAQLLHQLQNAQAFNKTTNR
FT                   VRVKRRDILDQMPGVGGTQWYLPPEDVLGNIDRLLGYYETGDISGTTTDGLGVLAMLST
FT                   VNVAAIGTLDQIKQQLAAMVNNGLAFTSFAGMVVQMHHSLPECMMAINLMPRDLGVDNS
FT                   AITQIYSPFLTNTGLGDINNVYNEWRQARYTALGGAGQVPDNATQMLIVVQDIFQMPNR
FT                   ATAAHEVALILPVTAQGMTNNAFVFGSNFYNWIVGALNTANPGPAITLEKLSSAVFDQW
FT                   FGPDFNPAIVNPQFGPEVVACVEQGMALPRNQLQNAGQYRQIVAPFVGQAEYGQVEPAQ
FT                   VGNLN"
FT   gene            444910..445212
FT                   /locus_tag="SPOA0396"
FT   CDS_pept        444910..445212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0396"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97528"
FT                   /db_xref="GOA:Q5LKI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI5"
FT                   /protein_id="AAV97528.1"
FT                   /translation="MYEEIEFLRSRTDELLVQVLSQWSASVMSSRDRGLPPYSSLAADL
FT                   AAARDRLAAAAQAAVELDGWDYVVECDEVSGEERVEMDVETREVKSTTVRKGGRK"
FT   gene            445209..445832
FT                   /locus_tag="SPOA0397"
FT   CDS_pept        445209..445832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0397"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ58401.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97529"
FT                   /db_xref="GOA:Q5LKI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI4"
FT                   /protein_id="AAV97529.1"
FT                   /translation="MSGFAEELPRLLAVGRNWVGRELHEDEVIGLVNWLKSETAHNPAA
FT                   AGQIDRGLAAASSVIAQGRQAAEGAIADAFRSVRGAPAPPQAPGQAPPPSLHERVTRTE
FT                   QRVLEQVLKSGVVGEARIDPAMEAQFAQLAEHLANLIETEVVRQVELRMVEFDARTGAR
FT                   IEAQSAQVVELCNQLSAEIRQQLARDLRAETALRPARPAAQKKS"
FT   gene            445902..446225
FT                   /locus_tag="SPOA0398"
FT   CDS_pept        445902..446225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0398"
FT                   /product="R body protein RebB-like protein"
FT                   /note="identified by similarity to GB:AAA73405.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97530"
FT                   /db_xref="GOA:Q5LKI3"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI3"
FT                   /protein_id="AAV97530.1"
FT                   /translation="MPYNTAVNSQITDAVTQSNVQVVAQAPAMAMGSVYQSMAHSTGIL
FT                   LQNSVAAAQQQSALSQAAANQGVMQIYSLDTTAAAGASEKIGQVGTPDQMSSLLAVLNS
FT                   FGG"
FT   gene            446276..446620
FT                   /locus_tag="SPOA0399"
FT   CDS_pept        446276..446620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0399"
FT                   /product="R body protein RebB-like protein"
FT                   /note="identified by similarity to GB:AAA73405.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97531"
FT                   /db_xref="GOA:Q5LKI2"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI2"
FT                   /protein_id="AAV97531.1"
FT                   /translation="MTWPTAVNDQITDAVTQSNVKVVGEAPAMAMGTVYQTMAHSTGIL
FT                   FENAVAAAQQQNALSQAASNQGVMQIYSLDTTATAGASEKIGQTGVADNLTSLLTVLNA
FT                   FKRPQQPGGI"
FT   gene            complement(446685..447080)
FT                   /locus_tag="SPOA0400"
FT   CDS_pept        complement(446685..447080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0400"
FT                   /product="endoribonuclease L-PSP family protein"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97532"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI1"
FT                   /protein_id="AAV97532.1"
FT                   /translation="MTHKTIQPEGWAPAKGYANGMLTRDGHLYVGGQIGWNAQQQFESH
FT                   DFIGQMEQALRNILDVVEAAGGRAEHITRLTWYVIDKKEYMARQSEIGASYRKVMGRHF
FT                   PAMAMVVVSGLVEDDALVEIEATAVID"
FT   gene            complement(447094..448716)
FT                   /gene="badA-2"
FT                   /locus_tag="SPOA0401"
FT   CDS_pept        complement(447094..448716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="badA-2"
FT                   /locus_tag="SPOA0401"
FT                   /product="benzoate-coenzyme A ligase"
FT                   /EC_number="6.2.1.25"
FT                   /note="identified by similarity to GB:AAA92151.1; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97533"
FT                   /db_xref="GOA:Q5LKI0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKI0"
FT                   /protein_id="AAV97533.1"
FT                   /translation="MLGPSAHIDTFTRDNLPPTDQWPDFLLDGFDYPEHLNVGVELTDA
FT                   MVDKGFGDHTALIGNGRRRTYKELSDWTNRLAHVLVEDLGVKPGNRVLIRSANNPAMVA
FT                   CWLAATKAGAVVVNTMPMLRAGELAKIIDKAEITHALCDTRLMEELVSCAKTSKHLRTV
FT                   VGFDGTSNHDAELDRLALQKPVRFQAVETGRDDVALLGFTSGTTGDPKATMHFHRDLLI
FT                   IADGYAREVLGVVPEDVFIGSPPLAFTFGLGGLAVFPLRFGAAATLLEQASPPNMVEII
FT                   QQYRATVCFTAPTAYRFMLKAMEEGADLSSLRAAVSAGETLPAPVYDEWIAKTGKPMLD
FT                   GIGATEMLHIFISNRFDDHRPACTGKPVTGYQVRILDENGNEAPRGEVGRLAVRGPTGC
FT                   RYLADDRQSGYVQNGWNVTGDSFVMDDDGYLHFAARSDDMIVSSGYNIAGPEVEAALLS
FT                   HPAVAECGVIGAPDEARGHIVEAHVVLTPGHTGDALMVKTLQDHVKATIAPYKYPRSVR
FT                   FIEALPKTQTGKIQRFRLRTDIQ"
FT   gene            complement(448720..449172)
FT                   /locus_tag="SPOA0402"
FT   CDS_pept        complement(448720..449172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0402"
FT                   /product="polyketide synthesis domain protein"
FT                   /note="identified by similarity to SP:P16558"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97534"
FT                   /db_xref="GOA:Q5LKH9"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKH9"
FT                   /protein_id="AAV97534.1"
FT                   /translation="MTKDLEKGITENGTGYDGVVWNILGQTYYPKAVCETTFAFETNSE
FT                   PGQFVPVHVHPTQDEFILVQEGELDLKLDGVWSKARAGDLVRMPKGIPHGYFNKSDKPA
FT                   RALFWVSPARKLKELFEALDNLEDVERVVELSAQHEVDFLPPEAND"
FT   gene            complement(449201..450343)
FT                   /locus_tag="SPOA0403"
FT   CDS_pept        complement(449201..450343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0403"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97535"
FT                   /db_xref="GOA:Q5LKH8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKH8"
FT                   /protein_id="AAV97535.1"
FT                   /translation="MADRSFLTWPFFDETHRARAEAMEGWCARLHVDHGDIDAACRKLV
FT                   ADLGAGGWLQATAAVEGERLDVRTLCLSREILARHDGLADFAFAMQGLGTGAISLFGTP
FT                   EQQAEWLPLTRSGQAIAAFALTEPQSGSDVANSTMTATADGDDYVLNGEKTWISNGGIA
FT                   DVYTLIARTGEAPGARGLSAFVLPAGLPGFEVVERLEVMAPHPLARLRFTDVRVPKSAL
FT                   LGAPGEGFKVAMAVLDVFRSTVAAAALGFARRALDESLARVTTRQVQGAPLFDLQMVQG
FT                   HIADMALDVDASALLTYRAAWAKDMGAPRVSREAAMAKLYSTDHAQQVIDKAVQLFGGD
FT                   GVRRGEKVEELYRDIRALRIYEGASDVQRVVIARQVLAQG"
FT   gene            complement(450396..451199)
FT                   /locus_tag="SPOA0404"
FT   CDS_pept        complement(450396..451199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0404"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97536"
FT                   /db_xref="GOA:Q5LKH7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKH7"
FT                   /protein_id="AAV97536.1"
FT                   /translation="MSAADTTHFLCTIEDGIARIALDRPERKNPLTFDSYAELRDWFRD
FT                   LHYNDDIKAVVFASNGGNFSSGGDVHDIIGPLTRMNMKELLQFTRMTGDLVKAMINCGK
FT                   PVIAAIDGICVGAGAIIAMASDLRIATPEAKVAFLFTRVGLAGCDMGACAILPRIIGQG
FT                   RAAELLYTGRAMNADEGAAWGFHNRLVAADALEDEARKLASQIAAGPNFGHMITKTMLA
FT                   QEWSMSIEQAIEAEAQAQAICMQTGDFERAYRAFVAKEKPVFLGD"
FT   gene            complement(451196..451663)
FT                   /locus_tag="SPOA0405"
FT   CDS_pept        complement(451196..451663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0405"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97538"
FT                   /db_xref="GOA:Q5LKH6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKH6"
FT                   /protein_id="AAV97538.1"
FT                   /translation="MSAPNPRPDAGPDSKARLRLWLKLLKTTRAVESGLRENLRTEFAS
FT                   TLPRFDVMSALARNAGGLKMSELSGLLKVSNGNVTGIIERLVEDGHVLREPVPGDRRAN
FT                   RVRLTRKGEEEFARQAARHETWVDGLLGSLDADEARAITATLDRILTEGKS"
FT   gene            complement(451660..452418)
FT                   /locus_tag="SPOA0406"
FT   CDS_pept        complement(451660..452418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0406"
FT                   /product="D-beta-hydroxybutyrate dehydrogenase, putative"
FT                   /note="identified by similarity to SP:O86034; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97537"
FT                   /db_xref="GOA:Q5LKH5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKH5"
FT                   /protein_id="AAV97537.1"
FT                   /translation="MMLEGAHAVVTGGGTGTGAAIAEALAHAGAKVTVLGRREAPLREV
FT                   AKQHKFIGWVTCDVTDPQAVRTAFRQARELNGPVGVVVANAGAADSTPFRKMSAEGFQQ
FT                   MLDVNLKGVFNSFQAGLADMETAGAGRLIAIASTAGLKGYPYVAGYCAAKHGVVGLIRA
FT                   LAVELGRTGVTANAICPGFIETPMLDRSIANIVDKTGLSAEAAAKSLRKGNPQDRFIQV
FT                   DEVAGAVLWLCSQAARSVNGHALALSGGEI"
FT   gene            complement(452415..454709)
FT                   /locus_tag="SPOA0407"
FT   CDS_pept        complement(452415..454709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0407"
FT                   /product="anthraniloyl-CoA monooxygenase"
FT                   /EC_number="1.14.13.40"
FT                   /note="identified by similarity to GB:AAL02071.1; match to
FT                   protein family HMM PF00724; match to protein family HMM
FT                   PF01360"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97579"
FT                   /db_xref="GOA:Q5LKH4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKH4"
FT                   /protein_id="AAV97579.1"
FT                   /translation="MRIACLGGGPAGLYFAISMKLRDPSHQVSVIERNKGDDTFGWGVV
FT                   LSDDALENLAANDPISAETIRSNFAYWDDIAVVHDGVRTVSGGHGFAGIGRKAMLLLLQ
FT                   DRARELGVDLQFQTEARPIAEYQAEYDLVVACDGLNSRVRSDLAAHFKPDIDTRQCKFI
FT                   WLGTHQKFDDAFTFIFEKTEHGWMWVHAYQFDEDTATVIVECSQETWDAWGFEHMSKED
FT                   SVATCERIFAAHLGGHALMSNASHLRGSAVWINFPRVLCEKWHHENVVLMGDAAATAHF
FT                   SIGSGSRLAFDSAISLATYLHSEPTMESAFERYQEERRLEVLRLQSAARNSLEWFEQVE
FT                   RYLDMDPVQFNYSLLTRSQRISHENLRLRDADWLRSAEQWFQTRAGAAAEPVRAPMFAP
FT                   FRLRDMELKNRIVVSPMAQYKAVDGCPTDWHLIHYGERAKGGAGLVYTEMTCVSPKGRI
FT                   TPGCPGLYAPEHEAAWKRLTDFVHGETSAKICCQIGHSGRKGSTQLGWETMDAPLKAEN
FT                   WDLISASPIPWSANNATPREMTRADMDAVRDQFVAAAQMAERAGFDMIELHAAHGYLIS
FT                   SFISPMSNNRSDEYGGSLENRMRYPLEVFTAMRAAWAEERPLSVRISANDWVEEAGVTP
FT                   EEAVKIAAMFHAAGADIIDVSAGQTSIEAKPVYGRMFQTPFSDRIRNETGIATMAVGNI
FT                   YEADHANSILMAGRADLICVGRPHLADPYWTLHEAARIGDRHADWPLPYLAGRDQAWRL
FT                   ADRDAETEIRA"
FT   gene            454843..455619
FT                   /locus_tag="SPOA0408"
FT   CDS_pept        454843..455619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC49422.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97539"
FT                   /db_xref="GOA:Q5LKH3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKH3"
FT                   /protein_id="AAV97539.1"
FT                   /translation="MIDWDDAFDNSSYVPGSGGLAAAWGAAAAAWRKNRGGTLDIAYGR
FT                   GARNRLDLFCPEGAAKGLVVFVHGGYWQKLDKSFWSHFAAGPLSRGWALAVPSYTLAPE
FT                   ARLGQMAEEIRAAIEEAARHVAGPVRLAGHSAGGHLVARMACADGPLPDRLDRVISISG
FT                   IHDLRPLLGTRMNEVLHLDAAEAEAESPALLSRRAGLSVTCWVGANERPELVRQTRLLS
FT                   EAWNVPNVFDPGHDHFSVVAELGRPGSALLTELLKD"
FT   gene            455624..456460
FT                   /locus_tag="SPOA0409"
FT   CDS_pept        455624..456460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0409"
FT                   /product="tryptophan 2,3-dioxygenase, putative"
FT                   /note="identified by match to protein family HMM PF03301"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97540"
FT                   /db_xref="GOA:Q5LKH2"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LKH2"
FT                   /protein_id="AAV97540.1"
FT                   /translation="MSQAYDPSQEGAKMSYAKDMSYGDYLHMDALLATHHPQSDAHDEM
FT                   LFIIQHQTSELWMRLVLHELRAARALLLAGGDFRPAFKMLTRVARIFDQLNSAWDVLRT
FT                   MTPSDYTTFRNALGNSSGFQSHQYRLIEYMLGNRNTAMMKVHEHRPELHAMLAAELEQP
FT                   SLYHVALRALAAKTGASFAPEVYRMDNPHSADAAVQAAWRQVYEDPAKYWDLYELGEKL
FT                   VDLEDYFRRWRFNHVTTVERVIGFKRGTGGTSGVQYLRRMLEVELFPELWHLRGDL"
FT   gene            456748..458676
FT                   /locus_tag="SPOA0410"
FT   CDS_pept        456748..458676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97541"
FT                   /db_xref="GOA:Q5LKH1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKH1"
FT                   /protein_id="AAV97541.1"
FT                   /translation="MPELFNSDIEEAPEARLEDTSVMSSISSGDEGDEGNEDNEGNEND
FT                   EGNEGNEISASTYDDDHNEGNEGNEGNEGVDGQEDDEGNEGDEGNEGNEGNEGNEGDEG
FT                   NEDDEGDENDENDENDEHNEADEGNEHDEGDENFSIISNNTDGQIDLSEADEGNEFDEG
FT                   DEDSTYWDFNFDDEYDEGIDANMHEADEGDEGDEGDENNEGNENNEGDEGNEGDEGNEG
FT                   DEGLINIGLEGDEGNEGNEGDENDEGNEGNENDENDEGDENNEADEGNEFDEGDEDGEF
FT                   FGRGQEADEGDEGDEDDEDDTFGGLLEEADEGNEGDEGDEDDEGDEDDEGDEGDEGDES
FT                   QNGDEGDEGDEGDELNDGDEGNEGDEGNEGNEANEGNEGDEDNEGNEGNEGNEGNEGNE
FT                   ANEGNEGDEDNEGNEEDEGNEDNEGNEGNEGSEGNEGDEGDEGNEGNEGNESNEGNEGG
FT                   LNDEGDEGDENDEGNENDEGDENNEGDEGNEDNEGNEEDEGNEDDEGDEDNEDDEGDED
FT                   DEGDEDDEGDESLEPDHPSRHDEGDEGDEDDEGDEDADALLDDEGDEGDEGDENDDGNE
FT                   GDEDDNLADSGNEDDEGDELNEPDNGDEGDEHDEGNEHDEGDEDDEGDEGDEGDEGDED
FT                   DEGDESV"
FT   gene            459056..459937
FT                   /locus_tag="SPOA0412"
FT   CDS_pept        459056..459937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0412"
FT                   /product="xanthine dehydrogenase family protein, medium
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00941;
FT                   match to protein family HMM PF03450"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97543"
FT                   /db_xref="GOA:Q5LKG9"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG9"
FT                   /protein_id="AAV97543.1"
FT                   /translation="MQYHSPDSFAQAARLAAEAEGITRFLAGGTDVLVQLRADIVTPDT
FT                   LIDIKKIPGTHDITRNGDGSWTLGVAVPGAELGEHAGLVADWPGVVEAMNLVGSTQVQG
FT                   RATLTGNLCNGSPAADSVPAMVAASMTATVTGPDGERVVAVEDIPTGPGRTSLAKGELV
FT                   SALHIPARGANAGDAYLRFIPRSEMDIAVVGCAVNLRLDGDTITEARVSLGAVAPTVLL
FT                   VQDAAAAIIGSTLDDAALDRLAAAASAACKPIDDKRGTIAFRTEVAGVLAKRVARIAYA
FT                   RAKGEIIRGHHG"
FT   gene            459934..460413
FT                   /locus_tag="SPOA0413"
FT   CDS_pept        459934..460413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0413"
FT                   /product="xanthine dehydrogenase family protein, small
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF01799"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97544"
FT                   /db_xref="GOA:Q5LKG8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG8"
FT                   /protein_id="AAV97544.1"
FT                   /translation="MSKIHVSTTVNGDAVEYLCDPRETLLDCLRDKLSLTGAKEGCGTG
FT                   DCGACSVTLDGRLVCSCLVLGVEAEGKEIGTVEGIAEGDVLHPLQQKFIDYAALQCGIC
FT                   TPGILVAAKALLEQNPDPTEEEVRFWLAGNLCRCTGYDKIIRAVMDTARDMREAV"
FT   gene            460413..462674
FT                   /locus_tag="SPOA0414"
FT   CDS_pept        460413..462674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0414"
FT                   /product="xanthine dehydrogenase family protein, large
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF01315;
FT                   match to protein family HMM PF02738"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97545"
FT                   /db_xref="GOA:Q5LKG7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG7"
FT                   /protein_id="AAV97545.1"
FT                   /translation="MALDDRKSDGFTFVGTRPNRPDGLDKVTGRARFGADAHAPGMLHG
FT                   AILRSPHAHARILRIDTSKAEALKDVKAVVTRADFSDKVEFAPGLEGDFWNILENVMAG
FT                   DKALYDGHAVAAVAATSALAARDALKLIEVDYEVLPHVTDVDKAMLMDAPVIRQGAADY
FT                   SVPEGMHPNVVRKHESGHGDVEAGFAEADLVIEDHFTTEATHQGYIEPHACLATLGADG
FT                   KGELWCCTQGHWIVQKTCAALLGIETANLRVTASEIGGGFGGKTTVFIEPVALALSRKA
FT                   NKPVKLVMSRSEVFRATGPTASASMDIRIGMKKDGTLTAAQGTFRLQGGAFPGGPADFT
FT                   AMCAFAPYNLPHVRQVGYDVMTNRPKQAAYRAPGSPMAAFAVESVIDELCNQLGLDPIE
FT                   VRLKNASREGTKASYGPRFQRVGLVETLEAAKAHPHYTAPLKPGQGRGISCGFWFNHGG
FT                   ETSVSLALSEDGSAQVMVGTPDIGGSRASMALMAAEVLGIPYENIRVTIADTATLGYND
FT                   VSHGSRVTYASGLATIKAARHAVEKLCERAAKKWGIPVDAVKWENGCAVPSGPNAGEFD
FT                   PLPLADITADMGRTGGPISGHFEATPEGAGVSFATHIVDAEVDPETGKTKVVRYTVVQD
FT                   AGKAIHPTYVEGQFQGGAAQGIGWALNEEYIYGADGRLQNSVFLDYRIPVASDLPMIDT
FT                   VIVEVPNPGHPFGVRGVGETSICPPLAAIANAVSAAAGARMRQLPMSPPRILAALKADG
FT                   "
FT   gene            462667..462912
FT                   /locus_tag="SPOA0415"
FT   CDS_pept        462667..462912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0415"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:B95401"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97546"
FT                   /db_xref="GOA:Q5LKG6"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG6"
FT                   /protein_id="AAV97546.1"
FT                   /translation="MVEVHLWSGLRSLAGGCEVVSVEARDTGEMLRALVRAHPELQAPI
FT                   DAGVSVAIDGRVIASGLTEPIPEGAEVYLMQRLRGG"
FT   gene            complement(463118..463858)
FT                   /locus_tag="SPOA0416"
FT   CDS_pept        complement(463118..463858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC52076.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97547"
FT                   /db_xref="GOA:Q5LKG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG5"
FT                   /protein_id="AAV97547.1"
FT                   /translation="MSLIPGGKTVYGATVGILMLETRFPRIPGDMGNALTWPFPVQYRV
FT                   VRGASPDRVVRGDPRALLDTFVEAGRDLVATGADGITTNCGFLALVQEELRAALGVPVA
FT                   TSSLMQVPMVQALLPPGKKVVILTISKATLTPAHLAAAGVPLDTPVYGTDAGRVFTRDI
FT                   LGDAPQIDFDACRLDMLDAADEIVAQEPDAGAIVLECTNMVPYAADLRRRTGLPVYSIY
FT                   SMVSWFQAGLMPRRFEQPLDDPRS"
FT   gene            complement(463866..464555)
FT                   /locus_tag="SPOA0417"
FT   CDS_pept        complement(463866..464555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0417"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97548"
FT                   /db_xref="GOA:Q5LKG4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG4"
FT                   /protein_id="AAV97548.1"
FT                   /translation="MTKSESNVDRLYQALRRMAADFAFKPDARINESALATQLDASRTP
FT                   IREALNRLVAEGFLTFRSGRGFFCRSLSPELVMDLYEARVAVEVEAARLAALRGDEREI
FT                   AILMQDLEDIAPDYTARADTEALLSMDEWFHTRLCALSGNGELARMLDNLNDRIRYLRL
FT                   IDLRRLQALGPQGQTMVSAHQRILDAVARHDADGAMAEMRAHIERRREGATQAVRDAYA
FT                   QLYVPEL"
FT   gene            464662..466353
FT                   /locus_tag="SPOA0418"
FT   CDS_pept        464662..466353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0418"
FT                   /product="acetolactate synthase, large subunit, putative"
FT                   /note="identified by similarity to GB:AAL99356.1; match to
FT                   protein family HMM PF00205; match to protein family HMM
FT                   PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97549"
FT                   /db_xref="GOA:Q5LKG3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG3"
FT                   /protein_id="AAV97549.1"
FT                   /translation="MDNRMNGAEAMVRMLEAQGVRHIFGLCGDTTLPFYDAMLRLDHQI
FT                   THVLTRDERCATYMADGYSRVTGRVGVAEGPSGGGATYILPGLIEASESSYAVLGITTD
FT                   ISVASYGKYPLTEVDQKALMAPLTKWNTVISRADHIPRMVRAAFRAMTTGRSGAAHIGL
FT                   PYDVQYDPVDAADIWADPVTASYPAYPQSPAPGAAQAAVEAILSAKNPLIVCGGGVVIA
FT                   QAWEELDRLATRLDIPVATSISGQGSLAETHPNCLGVVGSNGGTDETWEMMEAADLVVF
FT                   MGCRAGSTTTARWEAPKPGTRIVHFDNDPMVMNANYRTEVAVVGDLRLALAEVNAALDA
FT                   RAQGADTFGGAAAVAEKKTRKFEAFEVLARSDQAPIRPERVIRALMNTLPEDATVVSDP
FT                   GTSCPYFSAYYQLPRPGRHFITNRAHGALGYSLSAALGAWYGRPASKTVALMGDGSLGF
FT                   TVGELETVCRSRAPITYVVFSNATFGWIKASQFADKDARYYNVDFNRTDNAAIAAAYGV
FT                   KSWRVEDPAELERVLAEAIAHDGPTLVDVITQPLEESNAPVRRWMG"
FT   gene            complement(466454..467290)
FT                   /locus_tag="SPOA0419"
FT   CDS_pept        complement(466454..467290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0419"
FT                   /product="phenazine biosynthesis protein, PhzF family"
FT                   /note="identified by match to protein family HMM PF02567;
FT                   match to protein family HMM TIGR00654"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97550"
FT                   /db_xref="GOA:Q5LKG2"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG2"
FT                   /protein_id="AAV97550.1"
FT                   /translation="MTPNVDRIAAFSDGTLGGNPAGVVIADQMPAEDEMQRIAAEVGYS
FT                   ETAFAAPQGDGWRVRYFAPVGEVAFCGHATIALGATLAGRFGDGTYALHLNDAGISVEG
FT                   LRHGDQVQAALISPPTRSSAVDAEVLEAAMALFGLDDTDLDPTLPPAVANAGNDHLVLT
FT                   LRNRSRLATMDYDLNRGAAYMRLNGFTTINLLWVETPQRFHSRNAFAIGGVLEDPATGA
FT                   AAAALAGYLRDLGWPHGGNIDIVQGEDMGARSLLRVEIGTTPGDGVRVSGSARQIG"
FT   gene            complement(467341..467541)
FT                   /locus_tag="SPOA0420"
FT   CDS_pept        complement(467341..467541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97551"
FT                   /db_xref="GOA:Q5LKG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG1"
FT                   /protein_id="AAV97551.1"
FT                   /translation="MLRTLLNTAATITAGSLFSAGVMTLGFYILPSSLLAGEPALTRFA
FT                   TETHARFAIAADGEERFAQVN"
FT   gene            complement(467615..468235)
FT                   /locus_tag="SPOA0421"
FT   CDS_pept        complement(467615..468235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0421"
FT                   /product="pyridoxamine 5'-phosphate oxidase family protein"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97552"
FT                   /db_xref="GOA:Q5LKG0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKG0"
FT                   /protein_id="AAV97552.1"
FT                   /translation="MPRAFSQLTFTPAVRAHQERLGSARSYAKFIEGGPQQGHEIGPAE
FT                   QAFIEARDGFYQATVSEIGWPYVQYRGGPAGFLRVLGPRTIGYADLSGNRQYISRGNLD
FT                   GNSRVALILMDYANQRRLKILGRMKFTEGPEAAASLLPDGQTHPAERAAIISVEGLDWN
FT                   CPQHITPRYTEAELAPHLNALGAELAQLRAENERLKQQLSEQD"
FT   gene            complement(468250..468714)
FT                   /locus_tag="SPOA0422"
FT   CDS_pept        complement(468250..468714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0422"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN68558.1; match to
FT                   protein family HMM PF07080"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97553"
FT                   /db_xref="GOA:Q5LKF9"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF9"
FT                   /protein_id="AAV97553.1"
FT                   /translation="MTRPPLPPFTAETAAEKVRLAENGWNNRSADVVTPAYSDDSRWRN
FT                   RAEFVTGHDDIHAFLTRKWDKELDYRLIKELWAWSGNRIAVRYAYEWHDDSGNWFRSYG
FT                   NENWEFDEDGRMSARHTSLNDLPITEDERLFHWPLGPRPDGHPGLTDLGL"
FT   gene            469019..469585
FT                   /locus_tag="SPOA0423"
FT   CDS_pept        469019..469585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0423"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97554"
FT                   /db_xref="GOA:Q5LKF8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF8"
FT                   /protein_id="AAV97554.1"
FT                   /translation="MRPNKKDELVRKALTVFYRDGFHATGMDKLVAETGVSKTSIYKHF
FT                   RTKEELIVAVLKLRDENFRAWFEARVDELADTPADKFLAAFDALGEWFEEDSYRGCMFI
FT                   NAGAEYNCKDDPIRMEAAHHKQVVLDYFTDLARQAGARDPEALGCQILLLKEGAIVISS
FT                   LMGNSKPACDAKDTARILLDNALKG"
FT   gene            complement(469613..471757)
FT                   /gene="fabJ-2"
FT                   /locus_tag="SPOA0424"
FT   CDS_pept        complement(469613..471757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabJ-2"
FT                   /locus_tag="SPOA0424"
FT                   /product="fatty oxidation complex, alpha subunit"
FT                   /note="identified by similarity to SP:P77399; match to
FT                   protein family HMM PF00378; match to protein family HMM
FT                   PF00725; match to protein family HMM PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97555"
FT                   /db_xref="GOA:Q5LKF7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF7"
FT                   /protein_id="AAV97555.1"
FT                   /translation="MGDFHYAKDADGIVTVTMNMDGPVNAMNAEFWPLFAATMDRIEAE
FT                   PELKGVIWTSAKDTFFAGGDLKMLKSIEPDGVEALFRSVEATKAVMRRMEKQPVPHVAA
FT                   INGAALGGGFEICLACNHRIAADNPKTKIGLPEVTLGLLPGGGGTVRLTWLLGLEGAMP
FT                   FLLEGRQVSPDKALKAGLIHQVVPADQLLTRAKEYILSVQGDAAAVTQPWDTKGYKIPG
FT                   GPSTAPHNMTRIAGAAAMLFKKTRGLMPAPTRILDIMTEAAGKVDFDTATRYESRRFVS
FT                   LTPLASTKNMIETLFFGMNKVNGGASRPKGVPTSKVQRLGILGAGMMGQGIAFSAATAG
FT                   LPVVLKDQTLEAAERGKAYTATLLDKRVKQGRMSAEEREAVLALITPTDKADDLKGCDL
FT                   IIEAVFEKIDIKDAVLAEHEALLAENGIWGSNTSTLPITRLATGATRPENFVGLHFFSP
FT                   VDKMPLLEIIAGEKTSDETLARAFDFARQIRKTPIIVGDSTGFYTSRTIGTKIIEAVEL
FT                   VAEGHDPLRVDNLSRLTGMPTGMLSLLDEVQIKLVTDIYNTQVEMGLLDPDKEQNPAAR
FT                   AMLAEMISQHGRHGRATGKGFYDYDGQGKTIWPGLAAWRKEGADIPDADIKDRILFRAV
FT                   LESLRCLEEGVLRTVEDGNIGSILGIGAPVHTGGYLQYVNTYGPARFLARCEELAGKYG
FT                   DRFAPPEILRTHVAEGRALA"
FT   gene            complement(471770..472978)
FT                   /locus_tag="SPOA0425"
FT   CDS_pept        complement(471770..472978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0425"
FT                   /product="acetyl-CoA acyltransferase/thiolase"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97556"
FT                   /db_xref="GOA:Q5LKF6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF6"
FT                   /protein_id="AAV97556.1"
FT                   /translation="MATPAYIYDALRTPRSRGKASGALYEVKPIQLAAGLLREMQARHD
FT                   MDTSRVGDVILGCTAPVGDQGACVAKAAVQAAHWDEAVPGVQLDRFCASGLEAVNMAAA
FT                   KVGSDQEELVVAGGIESMSRIPMLSQGGAMFTDPDFVIDQNSAPQGIGADLIATIDGYS
FT                   REDVDAFAMESQRRAAHARDSGWFDRSVVPVRDENGLTILERDDFIKPDTDMQKLGALN
FT                   PSFAGMGAFGYDDMALAKYPQVARINHVHTPGNSSGIVDGSSAVLIGSEKAGRDLGLEP
FT                   RARIVSATVIATDPVIMLAGPGPAAKKCLDKAGLKVSDIDIWEINEAFASVALRYMKDL
FT                   DIDHEITNVNGGAIAMGHPLGATGGMLVSTVLDELERRGAKRAMISLCVGGGMGISTLI
FT                   ERL"
FT   gene            473076..474071
FT                   /locus_tag="SPOA0426"
FT   CDS_pept        473076..474071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0426"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97557"
FT                   /db_xref="GOA:Q5LKF5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF5"
FT                   /protein_id="AAV97557.1"
FT                   /translation="MAVTIPATIVANILEGAVARGADPAAILARASLPGVVGPLEAPDF
FT                   VRLVRAVTLTLDDELAGLQDRPQRIGTHAIMAAHVSHAETLGAAYARAAGFMDLMDNSF
FT                   RYSLRESGANLIFEMTRIPGREVLNNAAVEMVLVLVSRMLAWLVGNRGALNGAWFDYVA
FT                   PGHVAAYRAMFQRAPMQFGQCSSGLAIPLALTRLPVLRSEDQATAYARRTPLDAFLPQD
FT                   ATTGLPLEVAVAVEACLSEQGRLPDMAQVARDLNLAPHTLRRRLKGDGVDYSNIRKQVR
FT                   RDMAVRLLATTGDSVESIAAQTGFSEASAFIRAFRSWTGLTPRAYRKSEL"
FT   gene            complement(474087..474419)
FT                   /locus_tag="SPOA0427"
FT   CDS_pept        complement(474087..474419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0427"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97558"
FT                   /db_xref="GOA:Q5LKF4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF4"
FT                   /protein_id="AAV97558.1"
FT                   /translation="MTVQDAPSLPPETPDDMASNAARAAGYLKTLAHEGRLMILCHLGA
FT                   GEKSVGQLENLLDIRQAAVSQMLARLREEGLVSTRREGKTVFYSLSDSNTEQVIGLLYS
FT                   LFCSND"
FT   gene            complement(474485..475711)
FT                   /locus_tag="SPOA0428"
FT   CDS_pept        complement(474485..475711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0428"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97559"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF3"
FT                   /protein_id="AAV97559.1"
FT                   /translation="MRLQDLDIIVTAPPAPGWGGRYWILVKVTTDTGITGWGECYASSV
FT                   GPDAMTHVIRDVFDRHMAGENPENIELMFRRAYSSGFTQRPDLTVMGAFSGLEIACWDI
FT                   LGKDRNRPVHALIGGRMNQRIRAYTYLYPLPHHDIAGFWTSPDQAAECAAEMVRRGYTA
FT                   VKFDPAGPYTIRGGHMPAMSDISLSVAFCKAIREAVGDKADLLFGTHGQFNTAGAIRLG
FT                   QALEPYAPLWFEEPTPPDNLEDMARVARNVRIPVATGERMTTKTEFGAVLRAGAAEILQ
FT                   PALGRAGGIWEMKKVAAIAELFNAQMAPHLYAGPIEWAANIQLAAAIPNILLLESIETP
FT                   FHDALIKGSIRVDNGFVIPPDAPGLGIEVDEELARAHPFTGNDLHLNMQEAPCDYASGN
FT                   AFQGGAPTI"
FT   gene            475904..477349
FT                   /locus_tag="SPOA0429"
FT   CDS_pept        475904..477349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0429"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97560"
FT                   /db_xref="GOA:Q5LKF2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF2"
FT                   /protein_id="AAV97560.1"
FT                   /translation="MIKRILAGLGLVILALVAVIAFRTVQYRPGPVEASQPFSVGADID
FT                   RAAQVLAEAVRFRTVSTDMSHPDFPAFLAFLEQSFPAVHRTMERTLLEPVTPLYKWQGS
FT                   NPDLPPVMLAAHYDVVPVTEDTLGEWDHPPFAGVVADGFVWGRGTLDNKGALIAALTAA
FT                   EKLINDGFTPERTIYFSFGGDEETGGLGAIAVAEHLRAQGVQLAWVLDEGSFVLDKIIP
FT                   GLDVPVASINLAEKGYLTIQLVAHAEGGHSSMPPRHTAVGQLARAVARLQEAPMPGGLT
FT                   GVSAEFFDALGRHFSIDKRAIFANRWLFDPVLEGILSGSPSTDAMLRTTTAPTMLEGSP
FT                   KENVLPTRAVATVNFRLHPRDSIDDVLVHVKAAIDDEGIEIVADRDLASPASPVSDSQG
FT                   AGFKDVEASIREVFGPIASVPGLTIAATDARHYAKAADAAYRINPFQIEGDDLARFHGI
FT                   DERLSIANIERGINFYAALIGKQ"
FT   gene            complement(477356..478450)
FT                   /locus_tag="SPOA0430"
FT   CDS_pept        complement(477356..478450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0430"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97561"
FT                   /db_xref="GOA:Q5LKF1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF1"
FT                   /protein_id="AAV97561.1"
FT                   /translation="MQKIRAAVCHEFNAPLVIEEVLLAPPGTGEVEVTLDAVAICHSDI
FT                   SYADGAWGGHLPAVYGHEAAGTVSAVGPGVEGFAPGDPVVVTLIRACGTCANCAGGQPT
FT                   ICDTPYDGVKQGPLRTADEGPLLQAMACGAFAEKVVVSQRQIVRIPADMGRDVACLLSC
FT                   GVITGVGAAVNAARLRAGQDVVVIGAGGVGLNAIQGARIAGARRIVAVDMTEEKLDIAR
FT                   EFGATHGVLATSPKPWRAAYKALGGRGADAVLVTVGAVRAYDEAPKYLGWGGRAVMIGM
FT                   PHAGAMAQYEPMSASFQGHGLIGSKMGDVVIQRDIPWMIDLYQQGRLKLDELISGRWSL
FT                   DQINEAIADTRTGSAKRNVILFNH"
FT   gene            complement(478537..479736)
FT                   /locus_tag="SPOA0431"
FT   CDS_pept        complement(478537..479736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0431"
FT                   /product="tetracycline resistance protein"
FT                   /note="identified by similarity to SP:P02982"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97562"
FT                   /db_xref="GOA:Q5LKF0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKF0"
FT                   /protein_id="AAV97562.1"
FT                   /translation="MRLPFLFILATVMIDAMGIGLIMPIMPDLIVEVKGGTLADAALWG
FT                   GVLSTAFAAMQFLFGPVIGSLSDALGRRPVLLVSLFVMALDYVVMALAGSIWLLLAGRI
FT                   VGGITAATHATASAYMADVSRPEQKAARFGMLGAAFGVGFVLGPLMGGVLGEFGTRAPF
FT                   WAAAVLAGLNFVLGLFVMNETVTAATRRAFSWASANPLGAFRMLGQVPGLKGLLWAYFL
FT                   YSVAIYVYPAIWAYFSQERFGWSSRMIGLSLGIFGFLMAVVQGGLLPHITRRIGERRTV
FT                   IWGQLFDFVGFGLLAFIASGTLALILIPITAMGAVVPPALQAIMSRSVADDQQGALQGV
FT                   MSAVHALSMIVSPLLMASVFARFTGPQAPIYLPGAPFLVALALMAAGLVIFLRTRTAVT
FT                   "
FT   gene            complement(479797..481134)
FT                   /gene="pcaB"
FT                   /locus_tag="SPOA0432"
FT   CDS_pept        complement(479797..481134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="SPOA0432"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /note="identified by similarity to SP:P32427; match to
FT                   protein family HMM PF00206"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97563"
FT                   /db_xref="GOA:Q5LKE9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE9"
FT                   /protein_id="AAV97563.1"
FT                   /translation="MAASVFDSAHLARLFPAGDAGRLFTDGAELRAMLLVEGMLAKAQG
FT                   ALGLIPVESAGAIHRAAMEIHLDPGALAEATGANGVSVPALVAAFRSEMQAPEHAQYVH
FT                   WGATSQDIIDTGLMLRLRQAVSVLERDLAAVLETLAALAESHADLPMAGRSYAQHATPT
FT                   SFGAVVASWGAPLLDLLRELPGLRRDCLLVSLSGAAGTGAALGPEVAQLRADLAQLLNL
FT                   ADPGRSWHTDRTPVLRLAEWCTRIALALGKLGEDAIELSQTGIAEITLGGGGASSTMPQ
FT                   KQNPVGASALVALSRQVPGLLAVLHGAGVHRHQRDGAAWFTEWMCLPQIVLGAAASVQI
FT                   TQRLLPGLAPCPEAMAAALDTNYGTIHAEAVNFALAAHLPRPEAQAAVKTLCAEAMESR
FT                   TPLRELIARDWPQLDAAALTDPSRQLGAAPDEARAFAARVRSQGAT"
FT   gene            complement(481134..481847)
FT                   /locus_tag="SPOA0433"
FT   CDS_pept        complement(481134..481847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0433"
FT                   /product="esterase EstC, putative"
FT                   /note="identified by similarity to GB:AAF66687.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97564"
FT                   /db_xref="GOA:Q5LKE8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE8"
FT                   /protein_id="AAV97564.1"
FT                   /translation="MADFLLIHGSCHGAWCWRDLIPALEERGHTARAVNMPSHGSDVTP
FT                   IGEVTLNSCRDAVLGASTPDTLIVGHSWGGYPISAAAEQAPDAMRGLIYLCAYVPLSGH
FT                   SMIDMRKRAPRQTLLDAVIKSEDGLSYTVDPERVADLFYHDCRAERVHYAQPRLCPQAI
FT                   APQETPLTLSDRFASVPKVYIRCAEDRTIPPEYQEEMTADWPSDRVHVMNSSHSPFFAD
FT                   PQGLARLLTRIEGQF"
FT   gene            complement(481860..482648)
FT                   /gene="catD"
FT                   /locus_tag="SPOA0434"
FT   CDS_pept        complement(481860..482648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catD"
FT                   /locus_tag="SPOA0434"
FT                   /product="3-oxoadipate enol-lactone hydrolase"
FT                   /EC_number="3.1.1.24"
FT                   /note="identified by similarity to GB:AAL02408.1; match to
FT                   protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97565"
FT                   /db_xref="GOA:Q5LKE7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE7"
FT                   /protein_id="AAV97565.1"
FT                   /translation="MQIADLGDIKLHFRVDGDPDGAPVVFINSLGTDLRLWDPILPHLP
FT                   AGLRLIRYDKRGHGLSDAPEGPYAMGTLVRDAERLLDLLDIRDAAVVGLSIGGMIAQGL
FT                   AVKRLDQVRALVLSNTAAKIGTKEMWQQRIAAVTAGGIEALADTVMERWFSRGFRATPE
FT                   LALWRNMLVRQPVQGYAGCSAAIAGTDFYTPTSGLRLPTLGIAGDEDGSTPPDLVRETV
FT                   DLIPGSQFHLFRKAGHLPCVEHPAAYAERLAQFLRDVGHF"
FT   gene            complement(482759..483733)
FT                   /locus_tag="SPOA0435"
FT   CDS_pept        complement(482759..483733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0435"
FT                   /product="pyridoxal-phosphate dependent enzyme"
FT                   /note="identified by match to protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97566"
FT                   /db_xref="GOA:Q5LKE6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE6"
FT                   /protein_id="AAV97566.1"
FT                   /translation="MSTLELIEAAAERLSGHVRRTPLLSSPFLDEIAGRRVLVKPECLQ
FT                   HTGSFKFRGAWSAISALDPEARARGVIAFSSGNHAQGVAHAATLHGIASVIVMPSDAPR
FT                   LKIDNTRALGAEVVLYDRGRESREEIGTALAGERGLTLIRPYDEPQVIAGQASVGLELA
FT                   EQAGELGVESGDVLVCCGGGGLTSGVALALEARAPGLRARPVEPEGFDDVKRSLAGGTI
FT                   SRNNSETGNICDAILTPEPGRITFPILSRLCGPGLAVTEDEALRAMALAFLRLKIVLEP
FT                   GGAVSLAAALFHPDQVEGDTVLAVASGGNVDAALFRTALELHA"
FT   gene            complement(483730..484557)
FT                   /locus_tag="SPOA0436"
FT   CDS_pept        complement(483730..484557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0436"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97567"
FT                   /db_xref="GOA:Q5LKE5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE5"
FT                   /protein_id="AAV97567.1"
FT                   /translation="MAAFTTTDGLRLFYEDEGTGQPLLCLAGLTRCSRDFEFLRPHVTD
FT                   LRLIRLDYRGRGQSDYDPDYRNYNVLREAHDVIELLDHLGLDRVTVLGTSRGGMIAMAL
FT                   AASHPDRLAGVILNDVGPVIEPAGIARIMDYVGKKPVSKTHDQAALALKQAMEPQFPGV
FT                   PLSVWRKQAEIQYAASDQGLALRYDDGLHKALLDQAATGAIPDLWLFFEALRDIPTAVL
FT                   RGANSDILGAGTVAEMHRRHPGLISAEVPDRGHVPFLDEPQSLDLIRRILETA"
FT   gene            complement(484558..485244)
FT                   /gene="dehII"
FT                   /locus_tag="SPOA0437"
FT   CDS_pept        complement(484558..485244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehII"
FT                   /locus_tag="SPOA0437"
FT                   /product="haloacid dehalogenase, type II"
FT                   /EC_number="3.8.1.2"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01428; match to protein
FT                   family HMM TIGR01493"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97568"
FT                   /db_xref="GOA:Q5LKE4"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE4"
FT                   /protein_id="AAV97568.1"
FT                   /translation="MPITTCIFDAYGTLFDVAAAARQAADEPENAALRPHWQALASHWR
FT                   LKQLQYSWLRAITGAHTDFWQVTGEGLDWALEAVGLAGDAVLRQRLLDLYWQLQAYPEV
FT                   PAMLRALKGAGLETAILSNGSPDMLDGAVRSAGLGDVLDDVLSVESVGIFKPDRRVYDL
FT                   VGQRFGCPPEAVLFVSSNGWDAAAAAGYGFRTAWVNRAGEPVDRLPWTPDHILSDLTGI
FT                   PELAGV"
FT   gene            485378..485806
FT                   /locus_tag="SPOA0438"
FT   CDS_pept        485378..485806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0438"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97569"
FT                   /db_xref="GOA:Q5LKE3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE3"
FT                   /protein_id="AAV97569.1"
FT                   /translation="MTQIKQGDTVRIHYTGTLLDGKTFDSSEGRDPLEFTVGSGQIIPG
FT                   LDKAMPGMETGEKKRVEVPCAEAYGPLNPEARQAIPREGIPDDIPLELGTQLQMQSPDG
FT                   RVIPVTVVELEEATVTLDANHPLAGQDLIFDIEVVSIN"
FT   gene            complement(485896..486687)
FT                   /gene="fabI-3"
FT                   /locus_tag="SPOA0439"
FT   CDS_pept        complement(485896..486687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI-3"
FT                   /locus_tag="SPOA0439"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="identified by similarity to SP:P29132; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97570"
FT                   /db_xref="GOA:Q5LKE2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE2"
FT                   /protein_id="AAV97570.1"
FT                   /translation="MSGLLQGKRGLIMGVANDRSIAWGIAKAMHEAGAELAFTYQGEAF
FT                   GKRLEPLAASVGSDFMVDADVTDDASLDTAFEQLAARWPTLDFLVHAIAYSDKSELTGR
FT                   FLNTTRANFKHSMDISAYSLIEVARRAYPMMKENGGTVLTLTYQGSNRVVPNYNVMGVA
FT                   KAALESATRYLANDLGPDGIRVNAISPGPMKTLAGAAIGGARKTFKFCDQNAPLRSNAT
FT                   LEAVGGTAVYLASDAGACTTGEIIRVDGGFHVLGMPQSEFM"
FT   gene            complement(486694..487923)
FT                   /gene="fabB"
FT                   /locus_tag="SPOA0440"
FT   CDS_pept        complement(486694..487923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="SPOA0440"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by similarity to SP:P14926; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97571"
FT                   /db_xref="GOA:Q5LKE1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE1"
FT                   /protein_id="AAV97571.1"
FT                   /translation="MRRVVVTGLGIVSSIGVNAEEVTASLRAGRSGIVACEEMAEHGFR
FT                   SRIAGTLKIDVAEHVDKRALRFMGPGAAYAHIAMQQAIADAGLSEEQVVNPRTGLVAGS
FT                   GGPSTSAMLSAHQTVLKTGATKRIGPFAVPKCMCSTISANLATAFKIKGLNYSITSACS
FT                   TSLHCIGNAAEQIMMGKQDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFD
FT                   QDRDGFVISGGGGIVVLEELEHALARGAKIYAEVTGYAATSDGHDMVAPSGEGGERAMR
FT                   LAVSTLPEDRKISYINAHGTSTPVGDVGEVEAVRRVFGEGRVPPISSTKSMTGHAQGAA
FT                   GALEAIFCLLMLEHDFITPSINVETLAEGIQPGEVATQYVENAGLDSVMTNSFGFGGTN
FT                   GSMVLSKFRG"
FT   gene            488138..489025
FT                   /locus_tag="SPOA0441"
FT   CDS_pept        488138..489025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE06700.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97572"
FT                   /db_xref="GOA:Q5LKE0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKE0"
FT                   /protein_id="AAV97572.1"
FT                   /translation="MTVAIPDLRVCANLTGKTLLICVGAAKCATSWLHDYLGSRPEVTV
FT                   SPLKELHFFDSKFPEHALGDADGLALARLSFQLGQAGDAVANLRHRAIFQASLDRAQMI
FT                   YDDNAYFGHFARLCGPQTRCFCDLTPSYSAIGAEGFAYMKRFCASQDIEVKILFLMRDP
FT                   VRRFWSQLRHLQQMNPVNDVASKWRHALTAPALLARADYRGIVLALEQVFPSANLLCLF
FT                   YESLFEGDDAIRRLCRFIGIPFAPAATGQRHNETTVRLPLSDDARDAFRHLLAPQYDFC
FT                   RERFGRSIPGSWLA"
FT   gene            489041..489136
FT                   /locus_tag="SPOA0442"
FT   CDS_pept        489041..489136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0442"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97573"
FT                   /db_xref="GOA:Q5LKD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKD9"
FT                   /protein_id="AAV97573.1"
FT                   /translation="MLDSVGRFCYHAATFLNFVTCFGAIEDSRVF"
FT   gene            489176..489439
FT                   /locus_tag="SPOA0443"
FT   CDS_pept        489176..489439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97574"
FT                   /db_xref="GOA:Q5LKD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKD8"
FT                   /protein_id="AAV97574.1"
FT                   /translation="MPEDGIGFEFFRDDQNPRLTIVNEAALQNASNQLFNEIAHLRAFD
FT                   HLGNAVEAVQKAAQHKARQDPPDWDDNVPPDATDGGDFFLLG"
FT   gene            complement(489506..490015)
FT                   /gene="fabA"
FT                   /locus_tag="SPOA0444"
FT   CDS_pept        complement(489506..490015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="SPOA0444"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by similarity to SP:P18391; match to
FT                   protein family HMM TIGR01749"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97575"
FT                   /db_xref="GOA:Q5LKD7"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKD7"
FT                   /protein_id="AAV97575.1"
FT                   /translation="MAQYPSSFDKEDLLKCARGELFGPGNAQLPAPPMLMMDRITEVSA
FT                   DGGAHGKGHIRAEFDITPDLWFFDCHFPGNPIMPGCLGLDGLWQLTGFNLGWRGWLGRG
FT                   YALGVGEVKLTGMVRPDRKMLTYKVDFTKAIQTRRLTMGVADGIVEADGEVIYQVKDMK
FT                   VALSES"
FT   gene            490204..490623
FT                   /locus_tag="SPOA0445"
FT   CDS_pept        490204..490623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0445"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97576"
FT                   /db_xref="GOA:Q5LKD6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKD6"
FT                   /protein_id="AAV97576.1"
FT                   /translation="MTPNSQEIATDWLVDAGLRPTRQRVALAELLVGDGRHRHVTAESL
FT                   FDAARSKGAAVSLATVYNTLRAFCDAGVLQEITVDGSKSYFDTNTHDHPHFFWEDEGRL
FT                   SDAPSDQLVIQRLPEAPEGVEIASVDVVIRLRRKG"
FT   gene            complement(490624..491520)
FT                   /locus_tag="SPOA0446"
FT   CDS_pept        complement(490624..491520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPOA0446"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPOA0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97577"
FT                   /db_xref="GOA:Q5LKD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LKD5"
FT                   /protein_id="AAV97577.1"
FT                   /translation="MLYLTLRQYEYVCAVGRHGSLSAAAAALNVSQPALSAALTKIESH
FT                   LSQPLFMRRRGSAMAVTPAGRRFITAAEALLSDAARIEDPAHPRPARRQLHLGCFTDLA
FT                   PFLLAPALHALRRALPDVTISTRADGFEALISALLKGQIDLALTYDLGLDAGFDRQPLY
FT                   QSHPQAVMAPDHPLAQGTDPDLEALTAHPLILSDEGLSAQHMLGLFRRRGLAPVVAHRA
FT                   ATLELLRSLAAHGEGVGISYAAPAHPASYDGRPLLSRPIAGADLAESVILARHGTGPAD
FT                   RTTARAAQVLTDLFVAR"
XX
SQ   Sequence 491611 BP; 92343 A; 154238 C; 154436 G; 90594 T; 0 other;
     atgccccacc cgcttgttac gcccgagatg atcgagacct ttcagcgcga tggcgttgtg        60
     ctgatccggg gtctgttcgc cgatcatgtg gaaacgctgc gggccggggt agccgccaat       120
     atggcggcac ccggccccta tgcctcggac aaccgcaagg aggggcacac gggcctgttc       180
     tttgacgact attgcaactg ggagcgtatc cccgagtttc gcgaggtgat cgagacctcg       240
     cccgccgccg aggtggccgc cgagctgatg cagtccaaaa ccgtgcagat gttccacgac       300
     cacgtgctgg tcaaggaacc gggtacctcg atggcgacgc cctggcacca ggacgggccc       360
     tattactttg tcgaggggcg ccagaccgtc agcttctggt cgccgctcga cgcggtgagc       420
     gaggcgacgc tgcgctgtgt ggccgggtcg catcgctggg agaaggaggt tctgccgaca       480
     cgctgggtgt cagaggaggg gttctttgcc gatgagggcc aatacatgcc ggtgcccgac       540
     cccgaggccg aggggatgcg gatcgtcgag ttcgagatgg cgccgggcga tgcggtggcc       600
     tttgattacc gcaccctgca cggcgcgcgc ggcaaccgct ccacggcccg cagacgggcc       660
     ttctcgctga ggctgctggg cgacgatgcg cgctatgtag agcgtcccgg tcgcacctcg       720
     ccaccctatc cggggcatga catggtgccg ggtcagcgcc tgcgcgagga ttggttcccc       780
     gtcctgctga agcgctagcg gggggcgctg ccctcggcgc tggcgcgcct cgcccggggc       840
     atttgtggcg aaatgaaggg tcagggccgg gtcagaacca ctgtcccggt tccatcaggc       900
     ccagatcgag cagctggcgc gaatgccact cgaagggcgt cgaattgtgc cagcggaagc       960
     tctggatctc gaaggtcgat ccggggttct ttttcagcgc cttggccgtg cggaaggagc      1020
     agattgccgc tgtcaggtta tggtgccagg ggcaggcata ggtgttgtat tcctgatcgt      1080
     cgaacgtgtg gtcgggctgc agatgcaggc cgggcgccga tctgaacagc gcgatccggt      1140
     cgatcttgcg gctgtccttg gggatatgtt cctcgtagcg ccagcgcacg ccgccgaaga      1200
     aatcgagctg gcgttcgcgc ggatggccgg tctcgggttc tttgcgggcc tgggcgtaat      1260
     agccggactt gtccagaaag gcgcggtcga gcgagacgcc gatgggaaag gcccccagat      1320
     cgtcggcata aaggtcgatc acataggtca gcatggcatc gcgccgctct tcgccgtgaa      1380
     aggccagcat ctcgccgatg ctgcgcgtct cgcagaacgg gtagaacagg tattcggcgt      1440
     taaagcagta atacatccag atgcccggtg ccgccgcgat gatgcggttg atggcattgg      1500
     tcaccgccag gcgcggtccg caatcaaacg ggatgcgatg tacccggctt tcgacatcgg      1560
     ggggcagggt aaaggcatcg ggcatcaggg ccagcaccga tttgaacccg cattggatgt      1620
     ggtggcgcat ggtggtggcc agctctacat catcctcgac aaagatcatc gccaccggac      1680
     ccttggccag agcggcgccg ccggtcttga ggaaatgatc gaatgaggcg tattccatgc      1740
     ctgtccagcc tgccttgctt atctgcctgt ctggcattct ggggcaattt cggttaattg      1800
     cgcgtgcatt gcaagcggcg cccgaaccct gtagaggccg ccgctgatcc cgcgaaagca      1860
     aaggcccgtc cgatgtccga ccccaagaag ctgtttatca agacctatgg ctgtcagatg      1920
     aacgtctatg acagcgagcg catggccgaa gcgcttggcg ggcagggcta tgtcgagacg      1980
     cagagcgccg aagacgccga catgatcctg cttaacacct gccatatccg ggaaaaggcg      2040
     gcggaaaagg tctattccga actgggccgg ttcaaggggc tgaaggccgc caaacccgat      2100
     ctgaagatcg gcgtggcagg ctgtgtcgcc caagctgagg gcgaagagat catgcgccgc      2160
     cagccgctgg tcgatctggt ggtcggcccg caaagctatc accgcctgcc cgagctggag      2220
     gccaagacgc gcgccgggga gaaggcgctg gacaccgatt ttcccgagga agacaagttc      2280
     gagaagctga aaggccgccc caaggcgaaa cgcggtccga ccgccttcct gaccgtgcag      2340
     gaagggtgtg acaagttctg cgccttttgc gtggtgccct atacccgggg cgccgaggtg      2400
     agccgccccg ccgaccggat cctgcgcgag gcgaacgagc tggtcgaacg cggcgtgcgc      2460
     gagatcactc tgctgggtca gaacgtcaac gcctatcacg gcgcaggtcc caacggcgac      2520
     atgacgctgg ccgggctgat ctgggagctg gacaagatcg acgggctgga gcgcatccgc      2580
     tttaccacca gccaccccaa tgacatggcc gatgacctga tcgaggcgca tggcacctgt      2640
     gccaagctga tgccgtacct gcacctgccg gtgcaggcgg ggtcggacaa gatcctgaaa      2700
     cggatgaacc gcagccatac cgccgaaagc tatctgcggt tgatcgagcg catccgcgcc      2760
     gcccgccccg atatcgtgat gtcgggcgat ttcatcgtcg gcttccccga agagaccgag      2820
     gccgatttcc aggacacgct cgatctggtc gagcaggtcc gctatggcta tgcctattcg      2880
     ttcaaatact cgacccgccc gggcaccccg gcggccgagc gcgcgcaggt cgaccctgcc      2940
     gaggccgacg atcgcctgca acggttgcag gcggtgatca cccgccacca gcgcgagatc      3000
     caggacggca tggttggccg cgaggtcagc gtgctgtttg aaaagccggg ccgccagccc      3060
     ggccagatgg tcggcaaaag cgaatacctg cacgcggtgc acgtgcagga tcccgggctt      3120
     gaggccgggc agatcgcccg ggtgcggatt gtcgcctcgg gggccaactc gctggctggc      3180
     gagctggcct gagccgatat cggatcagtg cgacggcggc gtcttggcga cgatctggag      3240
     cagagacgag cgcatgtaat cgtgctgacc cacgccccat tcgtcacggc agatgcgctc      3300
     gccgatggca tgcgcctcgg gataggtata ccccatccgc accagatcct cgacaaacac      3360
     ggcgttgggc cgatcccaga tcacactgct ggtcggtccg cgaaagcagc tgatggtgat      3420
     gttatggaca tccgaccccg gtttggtcgg gcgctgttgc gcctcgggtg acgtcgccac      3480
     gacagcggtt agcgccagga cagccccggc gcgcagatag gctttcatgt caataccccc      3540
     acgtctgaca agaaatatgt accaccgcca cacagccgat gacggtgcac cggtcccgga      3600
     gaggggccga cgggatgatg ctagccgatc cgggagagtc gcggaagccg cctccgaagg      3660
     ggggtgatcg ccttcgattg tcaaccaaaa cgggtgtaat tccgatccct gggcgcatct      3720
     gtttccaatg gttctgcaat ccctttgtcg ggaggcaggg tggggcaagc gcaagcgcga      3780
     gaatcggtgc gggcagcgtc ggcaaattcc gggtgagggc caccgattcg tgacaattcc      3840
     cggtaatcac tggtgagtgt cgacaaattc accacaatat atggtggatt tcgcttcaca      3900
     aaaatgtcga attttcctaa gcttgcagta gtttcgcgtc tggtggccgg cgctgatccg      3960
     ccgatcgccg acagtggggg aactcaggtg agggattttc ggtgactgat ttgaaattca      4020
     agagcgtggc tgccgcgctt gcaaccgtcc ttgcgctgac cgggctcacg acagctccgg      4080
     ccaccgctca atccacccgg accgtgatcg gggaacgcta tgttccgacc atctgggtcg      4140
     atccggatgg atgtgaacat tgggttatgg atgacggcgc cgagggtttc atgacccccc      4200
     atgtccgccg cgacggaacc ccggtctgcc gccggggtgc gctgtgcggc acgatgcccg      4260
     cggaccagtt ctttgcaacc gacagctacc gtatctcgtc cgaggggcag gcgcggctgc      4320
     gccagttctt ccaggagacc ggcgccaacg gctatatcat caccggacat accgacagcc      4380
     gggcctcgga cgcctataac ctgcgtcttt cggtcaaccg ggccaattcg gtggcgcggg      4440
     tgggccgtgc tacgggagcc cgcatcgtcg atgtgcgcgg ctatggcgag cgtgatccgc      4500
     gcgttcccaa taccagcgcc gccaacatgg cgcagaaccg ccgcgtcgaa atcatctgcg      4560
     tgaattgagg agagcgacat gaaactgatc aagggaatcg cccttctcgc ggctctgggc      4620
     gggcttgccg cctgcgaggc caccgacaag acccgtgacc gtggcatcga cgccaaggac      4680
     ctgtcgcagc tcaaggcggg tatctgggtc gatccgaccg gctgccagca ctggatcatc      4740
     gacgacggtc tcgaaggcta tctgtcgcag cggatggacc gcaacggcaa gccggtctgc      4800
     gacgactcgc tgcccaaggg cgtggccacc ggcccgttca agaaaggttc gaacatcgtc      4860
     gacgcaatct aagcgcccga catggcatca gggccgcccc ttggggcggc cttttttgtt      4920
     tcaaacaggt gaaaattttg cggtcccgct tgcaccgacc gcaatatctt ggctacgctt      4980
     gtctcaggac tgcgataaca ggagagcgga tggccatcag cgccctcaca ccaccgcaag      5040
     acagcagcac ccccgcggag ctgcaactgg aattccccga caaccggctg ttgatagatt      5100
     tatgcggcga gcatgaccgc cacctggtgc tgatcgaaca ggtgctgggg gtgcagatcg      5160
     tgcggcgcgg caatctgctg tcggtgctgg gcgaggacgg cgcgcgtgac cgcgccgccg      5220
     aggtgctgga ggcgctgtac gagcggctgc aatcgggccg cccggtcgaa ggcgccgatg      5280
     tggaccgcga attgcgcatg ggtcggggcg aagaggccaa ggacacgccg gcggaggacc      5340
     agctggagat gttcctgggc ggccggatcg agatcaagac ccgcaagaag ccggtcgagc      5400
     cgcgcactga cgcgcaaaag gcctatgtca aatcgctgtt cgagaacgaa ctggcctttg      5460
     gcatcggtcc ggcgggcacc ggcaagacct atctggcggt ggcggtgggc gtgtccatgt      5520
     tcatcaacgg gctggtcgac cgcattgtcc tcagccggcc cgcggtcgag gcgggggaaa      5580
     agctgggcta tctgccgggc gacatgaagg acaaggtcga cccctatatg cagccgctct      5640
     atgacgcgct gaacgatttc ctgccgggca agcaggtcgc caagctgatc gaggaaaaga      5700
     agatcgagat cgcgccgctg gccttcatgc gcgggcgcac gctggccaat gcctttgtgg      5760
     tgctggacga ggcgcagaac gccaccacca tgcagatgaa gatgttcctg acccgtctgg      5820
     gcgagggcag ccgcatggtg atcaccggcg accgcagcca ggtcgacttg ccgcgcgggg      5880
     tgacctcggg cttgtccgat gccgaacggc tgttgaaacc ggtgccgggc atcagcttca      5940
     actacttcac ctccaaggat gtggtgcgtc atccgcttgt ggccgcgatc atcgaggctt      6000
     atgaggccga cacgggctga acggagcggg cgagtgatca gaattgcggg gtttgtagcg      6060
     gcggtgctga cgctggtctg ggcattggtg catgcatttg tcggcggcgc cgaaacagca      6120
     accccgctgc tgcactctgc cctgccagag gttgcccgcg ggaccggctg gctggtctgg      6180
     cagttcatga ccgggctgtt gctggtgatg tcggcgatgc tggcctgggg gactcgcgcg      6240
     cgcaacgcgg cgctgctttg ggccgcatcg gcacaggcgg cgatgcttgc gttgctgggc      6300
     atcgtcctgg ttcccgcgat cggcatgagc tatggcctgt tgccgcaggg ttggctgttt      6360
     ctgcccgtcg cgctgctggg cgtggtggcg gcacggggcg cggcacgatg acgctggatc      6420
     tgacactcga ggacccgcgc tggaccatcc tgccgccgct ggcggacagg gcgatctcgg      6480
     caacgctggc gcagatgggg ctggacccgg agctttgcga aatcagcctg ctgggatgcg      6540
     acgatgcccg cattaccgcg ctgaacgccg agttccgtga aaaaccctct ccgaccaatg      6600
     tgttgagctg gccggccgag gatctggccg ccgaaacgcc gggtggcacg ccgcttgcgc      6660
     ccgaacccga tttcaccggc gccgtcccgc tgggcgacat tgccattgcc tttgacacct      6720
     gccagcgcga ggccgatgcc gccggcaaac ccatcgccga ccacgtgacg catctgatcg      6780
     ttcatggtct gttacatctg ctgggctacg atcacatccg tgacgaagac gccacgctga      6840
     tggagggttt ggaaacccgc atacttggca atctcggtat tgatgaccca tatactatgg      6900
     agtgaggggc cgcagggcct cgttttggaa caggattgat gggcgacata gaaggcagtt      6960
     ctagcgcagc gcagagcgcg cagccggagg aaaccggcga aacgaacgca gacaagacag      7020
     ggtttttcac ccgtatcatg gatgcatttt catccggtga aagccagcag gaaccaaccc      7080
     ttggcggggc ctcggccgca cctgttccgg tgccgggcat cctcaacctg cgccggatgc      7140
     gggtcgagga tgtggcgatc ccgaccgccg agatcgtgtc ggtgccgctg accgtctcca      7200
     aggaagagct ggtacatgtg tttcgagaca gcggcatgac ccggattcct gtctatgaaa      7260
     acacgctcga tacgccgctg ggcttcgtgc atctcaagga tttcgcgctg acccacgggt      7320
     tcaacggcaa ctcgacacag ttcgacctgc gctcgatgct gcgcccgctg ctgtttgtgc      7380
     cgccgtcgat gccgatcggc gttcttctgg ccaagatgca gaccgagcgc cgccatatgg      7440
     cgctggtgat cgacgaatat ggcggcgtcg acgggctgct cactatcgag gacctgatcg      7500
     aacaggtggt cggcgagatc gaggacgagc acgataccga cgaggcgcag acctgggtca      7560
     aggaacggcc cggctgctat atcgcgcagg cgcgcacgcc gcttgacgag ttcgagaccg      7620
     agatcgggcg ctcgctgacc aatcacgagg atgtcgacga ggaagagatc gacacgctgg      7680
     gtgggctggt cttcatgctg tcgggccggg tgccggcgcg gggcgaggtg gtgccgcatc      7740
     ccgacggggt cgaattcgaa gtgattgatg ccgatccgcg caggatcaag cgcttgcggg      7800
     tgatgatccc cgacgccgcc gaatgagttt acttgccggt tggtatctgt ggcagcgcat      7860
     gatgctggcg ctgggtctgg gggccgtggc ggcgctgggg ctcgcaccga tgtcgctgtg      7920
     gctggccacg atcggcgcct tgctggcgct gcccgcgctg tttctggcgt cgccgggatg      7980
     gcgtcaggcg gcctggacgg gatgggcctt tgccaccggc tatttcggac acgcactggc      8040
     ctggattgtt gaaccgtttc tggtggatgt ggcgcgtcat ggctggatgg cgccgtttgc      8100
     gctggtgctg atggcgggcg ggctggccct gttctgggct gccgcatttg cgctggcggc      8160
     ggcgcccgcg cgggggccgg aacgccgggt gatgctgctg gtgctgacgt tgagcctcgc      8220
     cgagatggcg cgcggctatg tctttaccgg atttccctgg gccggtctgg cgcagatctg      8280
     ggtcgagacc gatgccgcgc tgctgctggc ctggaccggc ccgcatgggc tggcgctggc      8340
     gacactggcg gcggtgttgc cgcccggtgt tgcgctggcg cgcggtctgg gcgggcgggc      8400
     gttgctgttg cgctgcgttc ccgcgctggc gttggggctg gcgatactgg ccgtggatgg      8460
     cgcgcgcgtt ccgctcgaag gctctggcaa ggtggtgcgt ctggtgcagc ccaacgcgcc      8520
     gcagcaccag aaatgggatc ccgattggta cccgctcttt ctggagcgcc agatccgctt      8580
     taccgccgcg ggcacagcgc ccgatctggt ggtctggccg gaatcggcac tgccctactg      8640
     gctggatgac gccggcccgg tgctggaacg gatcgccgcc gctgcgcgcg gcaccccggt      8700
     actgctcggg gccaaccggg ccgaaggccc gcgtatctat aacgcacttg cgctgatcgg      8760
     ggcgggcggg cggatcgagg ccacttacga caagcaccac cttgtccctt tcggggaata      8820
     tgtcccgctt ggcgatctgc tggaacaatt cggcatctcg gggtttgcca cccgcagcgg      8880
     gcgtggcttc agcgcggggc cgggcccggt tacgctggcg atcccgggga tcggtgcggc      8940
     gctgccgttg atctgttacg aggcggtgtt cccccgcgac gcgcgcggta ccgccgaacg      9000
     tccccgactg ctggtgcagg cgaccaatga cgcgtggttc ggtacctggg ccggccccta      9060
     tcagcatctt gctcaggcgc ggatgcgggc gatcgagcag gggctgccga tggtgcgggt      9120
     ggccaatacc ggtgtctcgg cgatgatcga cccccagggt cgcatcacgg ccgccttggc      9180
     cttggggcgc gagggctatc tggatgtgga cctgccgcct gcgctggcgc caaccgttta      9240
     tggccgcact ggggatctgc cgctgctggt gaccctgctg gttctattgg ctgcggcagc      9300
     gcggatacag ggtcgcaacc tgttgccaaa tagcgattga ccttgccaat ggccccgcgt      9360
     atcccggctt ggacctgcca caacggcttc ctggcgtggc gagggaaacc ttcaatggag      9420
     cacttttcat gtcccgacag aactatatct tcacttcgga atccgtttcc gaagggcacc      9480
     cggacaaggt gtgcgaccgc atttccgatg ctgttctcga cgcctttctg accgaggagc      9540
     ccgaggcgcg tgttgcctgc gaaacctttg ccaccaccaa tcgcgtcgtg atcggcggcg      9600
     aggtgggcct gtccgatcag gccaagctgc gcgaatacat gggccggatc gaccagatcg      9660
     cccgggactg tatcaaggat atcggctacg agcaggacaa gttccaccac gagacggtgg      9720
     agataaccaa cctgctgcac gaacaatcgg cccatatcgc ccagggcgtc aatgccgccg      9780
     agggcaagga cgagggggcc ggcgatcagg gcatcatgtt cggctatgcc accaccgaaa      9840
     caccggcatt gatgccggcg ccgatccagt acagccatgc catcctgcgc cgcctggccg      9900
     aagtgcgcaa gaacggcacc gaaccggcgc tggggccgga cgcgaaatcg cagctgtcgg      9960
     tgatctatcg tgacggcatg ccggtcggcg tctcgtcgct ggtgctgtcg acccagcatc     10020
     tggaccccga tctgaccagc gccgatatcc gcgccatcgt cgaaccctat atccgcgagg     10080
     tccttcccga gggctggctg agtgccgaca ctgtctggca tgtcaatccg accggcaagt     10140
     tcgtgatcgg cggccccgat ggcgacgccg gtctgaccgg gcgcaagatc atcgtcgaca     10200
     cctatggcgg tgccgcgccc catggcggtg gtgccttctc gggcaaggat ccgaccaagg     10260
     tggaccgctc ggccgcctat gccgcgcgct acctggccaa gaacgtggtc gctgccggtc     10320
     tggccgacaa atgcaccatc cagctgagct atgccatcgg cgtgtccaaa ccgctgtcga     10380
     tctatgccga tacccatggc accggcgaca tcgccccggc ggcgatcgag aaggccatcg     10440
     acacggtgat ggatctgacc ccgcgcggca tccgcaccca tctgggcctg aacaagccga     10500
     tttacgagcg caccgccgct tatggccatt tcggccgcga gcccgaggcc gatggcggct     10560
     tcagctggga gcgcaccgat ctggccgagg cgctgaaaaa ggcggtctga accggtttca     10620
     ttgattaagc tgaacgggcg gcttaaaggc cgcccgttcc gcattggtga gggcgagtga     10680
     tgcagaggat catggtgatc ggcgggccgg gatcgggcaa gtccacgctt ggccgcaagc     10740
     ttggcgcgcg gctgggactt ccggtggtgc atatggatcc gatctattgg ctgggcgatt     10800
     gggtcgagcg cgacaaggcc gaagcaatgc gaatggccaa ggaggtcgcc gacggttcgc     10860
     aatgggtgtt tgagggcaac catttcgcgt cgatggcgta ccgggcggag cgtgccgatc     10920
     tgatcgtgtt cctcgatatg ccccgcgttc tgcgcatgtg gcggattctg tggcggtcgc     10980
     tgcgctacta cgggcgcacc cggccggata tggggccgaa ctgtcccgag cggtttaacc     11040
     gtgcctttct taagttctgc tggacctatg accgcgaggg acgtttgcgc gcacttggct     11100
     tcgtcgacga ctggcgcgac cgacgtcgcg ttcgcattct gacatcgcgg cggcaggtcg     11160
     cggcatttct ggtcgaaatt gaccggcagt gaaacgcccg gatgcggcat cgtcttgtgc     11220
     ccggcgcaac gtgatcgacg acagggcggc caggtggtcg ccctttttcg ttgacccggg     11280
     gtgtttgcgc ttgacccgca cggcgtggtt tttcaccttt ggcaaggaag acggagaccg     11340
     catatgcgcc agtttgcacg ctatacgctt atcgccgcgc tgacgcttgg ctctgcgctg     11400
     atggcgcatg cggaagagga cgacctggtg tttcgggtcg atggcgagac cctggtctat     11460
     gacaccacac gcggtgacga ggcgggtggc accgacgata tcgaggtggc ccatgtcgac     11520
     cgcctgctgg cgcttctgcg tcagaacccc gagatccggg tacttgatct caatagcacc     11580
     ggcggcagtc tttatgccgg gcgcgagatg gcgcggatcg tgctggattt cgacctcgac     11640
     accctggtgt cgggcgaatg tttcagctct tgcgtgcgca tctttctggc cggggccggg     11700
     cggcggatgc tgctgggcgc caagatcggc tttcaccaga ccacctggtc gcccgggtcg     11760
     gtcgaggagt attacaacgc caaccgcgac tcggacggct ggggcacccc gttcgatttt     11820
     gcgtcatggg tctatgagga tacccagacc gaggtgcatg acgacctgat ctatatgatc     11880
     gaccggggcg tggatgcgga attcgccgtg cgcaccaagg gcgtgcgcgc ggacgacagc     11940
     tggtacccct cgcggctgga gctgacgcgc gccggggtgc tgcgcgagcg gctgcgtgac     12000
     gctgaatgag cggccaggcc cccaggcaga cccttgcacc gggcgcgcgg gcgcagtaac     12060
     cccgcggcca tgagcaagac gacacctgac cgcccgcgcc gcaacttcta tggccgcatc     12120
     aagggcaaga ccctgaaacc gaaccagcgg acctatctgg acgaggacct gacgccgctg     12180
     gcgcccggcc cggtgagctg gcaggacaat cccacccgcc agccgctgga tctgaacgcg     12240
     ctgtttggcg gtcgcgagac ctggctggag atcggctttg gcggcggcga gcacctggtg     12300
     catcaggcgg cctcgaaccc cggtatcggc attatcggcg cggaacccta tatcaacggg     12360
     gtggcgatgc tgttgggcaa gatccgggcg gcgggcggag acaatgtgcg ggtgcatccc     12420
     ggcgatgtgc gcgacctgtt cgatgtgctg ccggcacaga gcatttcgcg cgctttcctg     12480
     ctctatcccg atccctggcc caagaaacgg catcaccgcc gccggttcgt gacgcccgaa     12540
     catctggagc cgctggcgcg cgtgctgaaa cccggcgcca tctttcgggt ggcgaccgat     12600
     attcccgact atgtccgcca gacgctggag gaagtgccgc gcgccggttt cgaatggctg     12660
     gccgagcgtc ccgccgactg gcggcagccc tggggtgact ggatctcgac ccggtatgag     12720
     cagaaggcgc tgcgcgaggg gcgggtgcca cattatctga ccttccgccg gctggagggg     12780
     tgagccaggg ggcgctgccc cccacgcctg cggcgcgtcc cccggagtat ttcgaaccag     12840
     aaagaagcgg atggtctgcg tgcctgttcc cgctggaccc tgactgggca attgggtaat     12900
     cgcaggggga gttttccaaa ggagcgcgca tgtccggaca cggcaccccc atcccgatga     12960
     cctcgcatcc ctgtggcccg ctgagcggtg tggccgaggt gccgggcgac aagtcgatct     13020
     cgcaccgggc cctgatcctg ggcgcgatgg cggtgggcga gacgcgcatc accggcctct     13080
     tggagggcga ggatgtgctg gacaccgcca aggcgatgcg cgcctttggc gccgaagtga     13140
     cccggcatgc cgatggatca tggtcggtgc acggtgtcgg cgtgggcggc tttgccgagc     13200
     ctgagcaggt gatcgactgc ggtaactcgg gcaccggtgt gcggctgatc atgggggcga     13260
     tggccacatc gcccatcagc gcgaccttta ccggcgatgc cagcctgaac aagcgcccga     13320
     tggcgcgggt caccgatccg ctggcgctgt ttggcgcgca ggcggtgggt cgcgaaggcg     13380
     gccggctgcc gatgacaatc gtgggcgccg ccgatccggt gccggtgcgt tacgaggtgc     13440
     cggtgccctc ggcccaggtg aaatcggcgg tgttgcttgc gggcctgaac gcacccggcc     13500
     agaccgtggt gatcgaaaaa gaggccaccc gcgaccattc cgagcggatg ttggcgggtt     13560
     ttggcgccga ggtcacggtc gaggataccg atgaaggccg cgtcatcacc ctgaccgggc     13620
     ggcccgagct gaaaccgcag gtcatcgccg tgccgcgcga cccgtcgagc gccgccttcc     13680
     cggtctgcgc cgcgctgatc acccccggct cggatgtgct ggttcccggc atcgggctga     13740
     acccgacgcg ggcgggcctc ttcaccacgc tgcgcgagat gggtgccgac ctgacctatg     13800
     agaacgagcg caccgagggg ggcgagccgg tggccgacct gcgcgcgcgt tattcgcccg     13860
     acatgaaggg gatcaccgtg ccgcccgagc gcgcggccag catgatcgac gaatacccgg     13920
     tgctgtcggt ggttgccgcc aacgcgcaag gcgtgaccat gatgggtggc gtcaaggagc     13980
     tgcgcgtcaa ggaaagcgac cggatcgacg cgatggcgcg cgggttgcgc gccaatggcg     14040
     tgaccgtcga agagggcgat gactggtggg cggtacatgg tctgggtatc ggcaaggtgc     14100
     cgggcggcgg cacctgcgag agctttctgg atcaccgcat tgccatgtcc ttcatggtga     14160
     tgggcatggg ggctcaggcg ccggtttcgg tcaacgatgg cagcccgatc gccacctctt     14220
     tcccgatctt cgaaccgctg atgggcggtc tgggcgccaa gctggagcgg gcatgacgtt     14280
     tacggttgca atcgacgggc ccgccgccgc tggcaagggg acgatttcca aagctgttgc     14340
     ggcgcatttc ggtttcgccc atctggatac cgggctgctc tatcgcgcgg tgggacgccg     14400
     cactctggag ggcgaggcgg ccgaaacggc tgcccgagac ttgcgcaccg aggatctgga     14460
     gcgtgatgac ctgcgcacgg cccaggtagc gcaggccgcc agcaaggtgg cggtgatcgc     14520
     tgaggtgcgc gcggcgctgg tcgatttcca gcgcgccttt gcccgccggg ccgggggtgc     14580
     tgtgctggac gggcgcgata tcggcaccgt gatctgcccc gaggccgagg tgaagctctt     14640
     cgtcaccgcc agcgccgagg tgcgcgccga acgccgctat ctggaactga cggccaaggg     14700
     ccaggacacc acgcgcgcgg cggttctggc cgatgtgcgc gaacgggatg cgcgcgatgc     14760
     cgaccgtgcc accgcgccga tgaaaccggc cgaggatgct gtgctgctgg ataccagcac     14820
     gatggacatt ccaactgcgc tggccgccgc gattgccgag atcgaacgga agatgcccgc     14880
     gaagggctaa ttccttcgcg ggcgtgtcgg ggcgccggga agcgcgcccc tggggccggg     14940
     atcagaggtc gcccaccgcg acatgcttga tcttggccca gttgccatcg gcggtggcgg     15000
     tggtgcctgc cacgtcctca aggaacttgt cgcgggtggc ggcgttcagg aacaggaaca     15060
     gtttgccatc cgccaggacg tatttgtccg ggtcgccgtc gaacttcttg cccacggcca     15120
     cgccataaga gcagaagccg ccgtgctggg gcagataacg cgccggctcg gcctggaatt     15180
     ccttgaggtt ctcttcggag gtgaaatagt aggacgcccc gtcgatggtt gccgagtaat     15240
     tggcaaagcc ctcgaccggg ttgccgtcgc gcaccagggt caccagatcg acgccatgtg     15300
     cggccagcgg cgcgccgcct gccgaaatgc cattcgagac gttgacctcg tccgcggcaa     15360
     aggcgggggc ggccagcatc ggcagcgcag caatcagggc agtgagtgcg aaagtcttca     15420
     tgttgagatc cttccagtgt ggtttcaacc gggcggatcg gcccggtgac caacagatag     15480
     aggccgcaac gtgaacctgt tatggcagat gatcccgaaa gaattgcaga tcgttcagat     15540
     gttcgaatga ttggcaattt taggcgttgg ccttacatcc ctgccgccag gcttgccaca     15600
     acaacgccca gatagttgcc caccgcatag cccaggatcg caatcgcgat gccgggcacc     15660
     agcagcgccc ggttgcgcag cgcaccgcag atcaccggga tgaagggcac cgacatgatc     15720
     gccgcgcccg aggccaccag ataggtgtcg cggtcgatcc cgaacaggcg gcaaagcaac     15780
     gcgtgcagcg ccatggcccc cagcaggata aaggcgaaat agccgccaag ggcccagttc     15840
     atcccgctca gcaccgacag atccagcagg gtggccgagc tgaggcagaa gatcaggatc     15900
     agatacatgc caaggtggaa gctggtcgta ctggcatgca accggggaac aaaggcgccc     15960
     agcaggccga atgtggtgat cagaaggatg gttgcggtgc ccgaccacgt ctcgggcagc     16020
     aggccggaga gtgctaccgc cacaccgaca cacagacccg ccgcgccaaa ggcaagcgca     16080
     gaccctgcca gcccggaacg ctggatcagg cgcgcatatc cgcgcgcgct gtcatcggcg     16140
     atatgagatg tgttggcctc atgatcgcct tgggaatggg gcacgaaggg cggcaggatc     16200
     aagcccgcca gccgctggcc caccagcacg atgaccagca tgtaaccgat ggaaaacacg     16260
     atgtcatagg tcaccatggt cagaaacagc gcgtcgctgg ccccggttgc ggatttgatc     16320
     gcacccatgt tgacgccgct gccggtatag gcgcccaccg ccatgcccgc gacctgcggc     16380
     aggttctcga cccggccctg gaacagcagc acccccagca ggctggccac acagaccgag     16440
     accagcgaca gcgccatggc cagcccggcg ccgcgcgcct cggtcagggc gcggcgcagg     16500
     ttggcggcaa acaggatcag cggcagcgcc agcgccacgc ttacctcttg cagagtggtc     16560
     tgtatctggg tgaaggcgct caggtcgagg ctcagcgcca gcgcaaatcc ggtggcaaag     16620
     gtcagcggca caacgccgat ccggtccagc gcgggtattc gcgccgccag ccagatgatc     16680
     agcgcgggca gggtcagcag gatcagggca aacagcatcg cggcctccta atgtgtttcg     16740
     tgccagaccg gccaccaatc ggtgatcgcg gtgccgtcga acacggcgat atcgccgaat     16800
     tgcaggaaca gcgcctcgct ttggcgcggg cggaaaaaca ggaaatcacc gggtttcagg     16860
     gtgctgtttg caggcagatc atacatttcc tgattgctgg aatgcccgaa caaggcggag     16920
     cgccgcgcgc ccgccgggtg gcagggatcg gccagccagt tgccgccata gatgaaacag     16980
     gcgcgctcag gcgagcggcc catgaggcgc agcacccggc tcagccccgg cgccattggt     17040
     atttcgggcc gttccacggt tttcagaacc ggtgccgcga taaaggccgc cggttgcagt     17100
     gcctccagcg cgggcaggtc gaaatcggtc ggcttgacca gggccgaggc cagcgccagc     17160
     tctgtttccg gcccgcttcc atcataaagc atgaaggtgg tgctgccgcc ggtgttatag     17220
     atcagtttgg ccgcggtccc ggccccgagc gtctgaaccg tcagcgcatg gaaccgggca     17280
     taggccgccc gcgccgcgtc caacgcgcgc gcccggctgg cgatcaggcg gggcaggcgg     17340
     gcgatatgcg gctcgtagcc catcagccca gtcaggtgca ggttcggatc gtcgcgcagt     17400
     cgggtcaggg cggcagcaaa ctccccggcc cgcgccagcg agaaaccgcc ccgatgcagc     17460
     ccgatatcga cctccagaca gatgcgcaag gcgcggtccg actgggcggc aagcgcggca     17520
     tattccgcca gtcgttccgg gctgtcgatc agccagtgca cctgtgcgtc cagcgtggga     17580
     gacgtgcctg ccaccgcacc caccggcatc ggcttgccca gcaggatatc ggcctctgga     17640
     aacgccgctg cggcctgctg gacaaagggc aggtgaaagc tcatcagcct gttggtctcc     17700
     agccctgcaa tcaccacccg caacaggtct ggtgcgggca gcgatttttc gaccacccgc     17760
     agcgccagac tgggcgccgt catccggcgc accgccgcca tgttggcggc caacctttcg     17820
     gtatccacca ccaacgtcgg cagctgtcgc cccgccgcga tcaacgcggc ctgcaacttc     17880
     tggaaatacg cctcagacat ctccagcccc gaacagcgcg gcggtatggg ggttgaggaa     17940
     cttgcccgcc ggatcaagcc gcgcccgcag tgcggcgaac cggtcgaaat cgggataaag     18000
     cgccaccaga tcgggagcat tgagcgaatg cagcttgccc caatgcggcc gcccgccata     18060
     tgcgcgcatg atcggctcga ccgtgccaaa cagcatgtcc agcggctctg acgcgagctt     18120
     gtgcaccgcg accgacaccc gcgtgccgtc gttgaagggc gacagccatg catcgtcctg     18180
     tccggtgaac cgcacctcca tggggaagaa gctctccttg cgcgattcca gcgccgccac     18240
     caccgcgcgc accgcctctt gtgcgcggtc ctcgggcagg tggtattcca tctcgttcat     18300
     ccgggtggcg cgagcggtcg agaggagttt ccaatattcg tcggtcgtat cctccagcac     18360
     cccgtctgcg gggacctcca gcgccacata ggcaccgaac gcgcgccgcc gcaaccaggg     18420
     ccaccagccc aggatatcgc gcaggtcctt gagcgtcgcg atccagtcct cgtcctcgct     18480
     gggcacccgt ccggcgatct ctccctcgta caggtcatgg gtgatcaccg ccgcatagcc     18540
     cagattgggc agcacgtaga attcgaaatt gcgatgggcg gcggccagat cgtgcatgcg     18600
     cgtgatcgcc tcatcggtgg gcaggatgaa cagccggcgg ttcagcgcat agctgggctc     18660
     cagtttcagc gtatatcgcg tgatcacccc cagcgtgccc agcgacaccc ggcctgcgtc     18720
     gaacagatcg ggattgctgt cgcgggtcac gtcgcgggcg gtgccatcgg cggtgatcag     18780
     acggaaccct gtgatacagc catgcatggc ctgcaagccg cgcccggtgc catgggtggc     18840
     ggtgctgaat gacccggcca gcgtctgcac gtcgatatcg ggcaggttgg caaagcccag     18900
     accgtggtct gccgccagca tcgccgcctg acgcagccgg gtcccggccc cgaatgtcgc     18960
     catccccgcc gccgcatcga ccgagatcag gcccgacagc cgtccggtat ccagaatcat     19020
     gtcctggctt ggcaccagcg cggaaaagga atggcccgag ccaacagggc gaatccgccc     19080
     cggccatgcg gcgatgcggg tggccagctc ctcctccgag gcggccgcgt agatctgctg     19140
     cggcgtggcc acctgatagc ccgaccagtt gcgccagacc tggcggcccg gcggggcagg     19200
     ggggatgtcg gggctgtaat cgggccgggt gaaatcgcgg ctcaaccaat gggcctgcat     19260
     cgctgcgggc accgccaacc cggccagcgc gccatagccc agcagtttgc gccgtgtcag     19320
     tgtcattgct gcccctcccc ggacatgaac gcgatcagcg ccgccagttg ctcgtccgaa     19380
     caatccagac acaggcccat tgcgggcatg ttcccgaacc cgttccgcgc cgataacaac     19440
     aggccatgcg ctccacgttc cttttcccgc gcagcccacg ccgggacaaa gccggtcaaa     19500
     ggcgcctgcg cctcgaccaa tgcgtgacag gccatgcagg accgttcgta gattgccgcc     19560
     agctccgggt cggtcgggcg ctgggtctcg gcccgggcga tgtcggttgc ctccggttcc     19620
     gcaggcgcgt ccgcgccgga gagccaccac cagagcgccg ccagaaccag cgctgagatg     19680
     agcaggataa gggcgcgcat cagctctcct cctcagtgtc gcgacgcaag tagagcgaaa     19740
     gataggcatc cagcgcgcgc accatctctt cgtgatactg cgcctccagc gcgggtgagg     19800
     tctgccgcgc catccggtct tccagcgtca gggcgatctg cacggcggtg gtcgccacca     19860
     cctgcggatc gccgccggtg aacccgtcca gcccccgcgc ccagcggtcg gcgaggaagc     19920
     ccaccagttc ggcattgtcg tcgtcctcga cgctctgcac cccgcgcagc gaggccagca     19980
     gcagcaagag gcccctgtaa taaggatgct cggccataaa cacgcggatg ccctccagcg     20040
     tgcgccggat gcgcagcacc agatcgggct cgccttcggt ggcggcaatc gtctcgatga     20100
     aatgttggcg caggtcgccc gcggcgcggg ccgacagctc gtccagcaga tcgcgaaggg     20160
     tgggaaagta gcgatagatt gagctgacgg gcacacccgc ccgctcggct atcagcgagg     20220
     tgttcagatc gcccggcggc cgctcggcca agagcgcgga tgccgcatcc aggatatctg     20280
     caacccgctg gcgcgcgcgg gcctgtttcg gcgtcgcgcg ggtatgcatc ggggtgtcgg     20340
     tttcagttgg aaccatggct ccgctctcct ctcatcagaa agcggaaact ttttccgaaa     20400
     aattttcaac ttctttcgca cctgacgttg cggcagccgc gcgtcaggcg aaatggaccg     20460
     agaccgcgcc aaaggggccg aaatccgcct cgatccgggt gccgggcggg cattcgaccg     20520
     ggcggatgaa actgcccgac agcacgatat gccccggttc gatgacttgc ccgtattgcg     20580
     ccatgcggcg ggcgagccag accacgcttt cgaccggatc gttcagcacg cccgcaccca     20640
     gcccggtttc ctcgatctcg ccattgcgaa aggtcagcgc cccgacccag cgcagatcga     20700
     acgcgtccgg cgcatggcgc tgcttgccca gcaccacgcc cgcattggcg gcattgtcgc     20760
     tgatcgtgtc gcagacattg cgcgcgtgcc ccgtctcggg atcgacccgc aggatgcggg     20820
     tgtcgaggat ttccagcgac ggcgcgacat agtcggtggc cgccagcaca tcggcgcgcg     20880
     tcacatatgc cccgcccagc ggttccttca tcacaaaggc gatctcggcc tcaacccggg     20940
     gctggatgaa ccgccccttg ggcaccgtgg ccccatcgtc aaaggccatg tcgtcgaaca     21000
     ggatgccgct gtcgggaatg tcgatgttca gcgcatattg catcgccttc gaggtcagcc     21060
     cgatcttcca cccgatcaca tggcgccctg cggtctgctt gtgtgccgcc agcgcctgct     21120
     ggatggcata ggcgtcgtcc atgtccatgc ccggataggc cagcgacaac agcccgatct     21180
     ggcggccggt ttcctcggcc ttgatcaggc gggcggcggc atcggcgtgc tgttcgggtg     21240
     tcatacctcg tcctccaccc cgttgaccag cgtgccgacc cccgtcacct cgacctcgac     21300
     cacatcgccg ggtttcaggt aacgcggcgg atcgaaccgt gcgcccgcgc cggtaggcgt     21360
     gccggtcacg atgatgtcgc cggggttcag ggtggtgaag gtcgagatat aggcgatttc     21420
     ctcgcgcacg gaaaagatca tgttggccag cgcatcgtcc tgccgcagct cgccattgac     21480
     ccgggtggtg atccgcgccg cgtcgatctg ggcgggatgg gtgaagggca ccatccacgg     21540
     tccgatggca cccgaccggt cccagttctt gccttgcgtc acgttgaact tggcatgccg     21600
     cacccagtcg cgaatggtgc cctcgttgca aacgctcagc cccgcgatat ggtcataggc     21660
     atcctcggcc cggatgcgcc ggcccccctt gccgatcacc acggccatct caccctcgta     21720
     atccagggtg tggttctcgg gcgggcggat caggggctgg ccatggccga caaagctcga     21780
     cgcaaagcgg ggaaacagcg acatgtattt cggcgccgcg ctgccatcct tgtattcggc     21840
     gttgcggtcg ggaaagttga cgccgacgca gatgatcttg ccggggttcg gcaccggcgg     21900
     cagataggtg aaatcgctat gcgtcaccgc ccggcccatc gccgccttgg ccagatcatg     21960
     cagaccgccc gccgcgatca ccgcgcgcag gtcgggccac cgcgggaagt cgggcgacaa     22020
     cgccacgaac ccctcgtcac ggatgatgcc gtaaagctcc tgccgctcgg cggcaatggt     22080
     ggcgaacttc atgctgttcc tctcgtctgg cccggagttc aaaccgggaa aatcacgttg     22140
     gtctgaccgg ttcccgagga tggaaaatac tcggtcacca cctcacacgg cttgtcataa     22200
     ctgtcccagc caagcgcacc atagagcatc gcggtatcgt gcatcgaccc ctcgccgcag     22260
     caaaagcggg cgtaatcgcc cagcatcttc agaaacgtcg catgatcgcc gcgcttccac     22320
     atctccagca catgcaggtc catctgccgg ttgaactcgg aactgatggt aaaggtgccg     22380
     ttgttggcgg catagtcctt gttgggccag atcttgtgcg acaaagagcc agaggcgacc     22440
     agcaacacct tgctgttgct ggcctcgacc gcggcgcgga tcgcctcgcc cacgatgcgg     22500
     ctttcgtcat ggtcgtgcac cgtgcaccat gcggcgaccg agaccacctt catcttgtgt     22560
     tcccggctca tgaaccgcat cggcaccagc gtgccgtatt ccagttccag actgtcaagg     22620
     tgatgggcca gcgtataggc gccgcgcgcg ctggcctctt tggcgatggc atcgcccagc     22680
     cccggattgc cctcatagtc atagggcatg ttctggatga attgcggaaa ctcgttcgag     22740
     gtgaacagcc cctgaaaccg gctgtttgcg ttgatgtgga accctgcgtt gatcacccaa     22800
     tgggtgtcgc agatcaccac ggtatcggcg ccaagcgcgc gggcgcggcg ggcgatctcc     22860
     agatgcccgt cgatggccgc ctgccgcttg cccttcacgg gcccctcctg ctccgacatc     22920
     agcatggtcg gtacatgggt gcatttggcg gcgaggacta tttctcccat ttctttcctc     22980
     cgtcacggga tggtcgcgcg tttcccggtg ggtggttcag gcgcccaggc gctggatctt     23040
     gtgctggccg gtggcaaagc cgatgtgctt ctgctccatg tagaattcaa acgaccagtc     23100
     gccgccgtcg cggccgatgc cgctggcctt gaccccgcca aagggggtgg gcaggtggcg     23160
     cacattctcg gagttcaccc agatcatccc ggcctcgagc ttgtcggtga accgcagcgc     23220
     gcgcgtcagg tcgttagtcc agagatagcc ggtcagccca tagggcgtgt cattggcgat     23280
     ttgcagcgcc tcttcttccg tcgaaaacgg gatcgcggtc agcaccgggc cgaaaatctc     23340
     ttcgcgcgcg atacgcatcc ggttgttggc gccggtaaac agggtggggc gcacgaaata     23400
     gccttggtcg cccaccacct caccgcccgc tgcgacggtg gcgccgtcct ggcgcgcgat     23460
     gtcgaagtag ctggtaacct tggcaaaatg ctcctcgccg atcagcggcc cgatctcggt     23520
     tgtcggatcc agcgggtggc ccaccttgat gttgttcacg cgttcgacca gccgcgcctc     23580
     gaactcttcg cggatcgtgt cctgcacaag caagcgcgag gaggacgtgc agcgttcgcc     23640
     gttgattgag tagatcatga agatcaccgc atccagcgcg cgctcggtat cggcatcgtc     23700
     gaacacgatc accgggttct tgccgcccag ttccagatgc acccgcttca gcgtgtcggc     23760
     cccctgtttc acgatcaggc tgccggtgcg gctttcgccg acaaaggcca cggccttgat     23820
     cagcggatgt tcggtcagcg ccttgcccgc atcctcgcca aatccgttga ccaggttcag     23880
     caccccgggg ggcaggcccg cctcttcggc gatctcgatc aacagccgcg cgctcagcgg     23940
     gctgagctcg gcgggtttat gcaccacggt gcaaccggcg gccagcgccg gcgcaatctt     24000
     ccaggtggac agcatgaacg gcgtgttcca cggcgtgatc acccccaccg ggccgatcgg     24060
     aacgcgggtg gtgatattca tcaaagtggg cgatttcaga tgctgcccat cgcgcgcctg     24120
     caccacctga tccgcgaaat agcggaaatt ctcggccccg cgcagcgccg ccttggacat     24180
     gaagcgccag gcctgcccgg tgtcccagca ttcacacagc gcgatttcct cggctcgcgc     24240
     ctcgattcct tcggcgatgc ggatcaggat ggcgcgccgc tcggtcgcgg gcatgtcgcg     24300
     ccaggcggga aaggccgcat gtgcggccct tgccgccgcg tccatatcgg ccgcgtcgcc     24360
     gcgcgccaca gaacagatca ccgatctgtc gaccggagag atgctgtcga accgccccgc     24420
     gccgcccggt acgtcctgcc cgccaatccg gttcatcacc ccgtcgcggc gaaaccgctg     24480
     gagatgtcgg tcaagatcgg ccagcctggt gctgaggtcg ggcatcggga atgtctcctg     24540
     ggggttatta tcattcacat gttaaataaa atgatgccac gagtcaaccc cttccccagc     24600
     ggcctgcttc tgcgctgcgg catatccgcc cgccacagcg cagcaaatct gcaaactcgg     24660
     attggaaaat cgcctgttag cgaccaaata gatcggaaaa tccgacacaa acctgccaag     24720
     tgtgtttgat ttcgccgccc ccctcccgta aagctgcgcg ccaagcggga cattatgcaa     24780
     atcagatgcc tcggcatcag gcgaagctct cagggtttcc gggtatttgc ccggaccgtc     24840
     ccatgaatta ggtagggccc gcgacgggat tcggacacga gaagacgtag cgatcacatg     24900
     cagaatttca gattgaaaaa gggattggac ctgccggtga aaggcgcacc ggttcagacc     24960
     attcatcccg gcccggcgat cggctcggtg gccgttctgg gcgccgatta tctggggctg     25020
     aaaccccgga tgctggtgca ggaaggcgac gaggtgcgcc gtggcacgcc gctcctttgt     25080
     cacaaggacg cgcccgaggc gatgatggtc gcaccggtga cgggccgtgt cgccgcgatc     25140
     aatcgcggcg cgcgccgggt gttgcaaagc gtggtgatcg aggtgaccga tgccgccgat     25200
     cccgggcttg actttgccac caccggcaat ggcaagacgc gtgagggcct gaccgagaag     25260
     ctctgtgccg ccggtctgtg gaccgcgttt cgtacccgtc cctattccaa aatgccggtg     25320
     ccgggcgaca cgcccaacgc gatttttgtc accgcgatgg acagcgagcc gctggccgcc     25380
     gatgccgcca ccatcatcgc cgacgcgggc agcgcctttg ccagcggtct ggcggcggtg     25440
     gcgctgctga gcgacgggcc gacctggctg tgtcacaagc cgggcgatgc gatcccgggc     25500
     ggcgatgtgg cgggcgtgtc ggtcgccacc ttcgatgggc cgcacccggc gggcctggct     25560
     ggcacccata tccatttcct ggcgccgctg acgtcggaca aatcggtctg gaccatcggc     25620
     tatcaggacg tgatcgccat cgggcggctg ctggaaaccg gccatctcga cccgtcgatg     25680
     gtgatcgctc tttccggccc cgccgcgcgc gagccgcgcc tgatccgtac catcatgggc     25740
     gcctcgaccg gcgatctgac caccgccgag atcagtgtcg acgcaccggt gcgtgtcatc     25800
     tcgggatcga tcctgagcgg gcggcaggcc gagggaccgt ttgcctatct tggccgcttc     25860
     gcccggcagg tgaccctgat cgaggaagac cgcaagcagc acacgttggg gtggatcctg     25920
     ccgatgccgt cgaaattcgc ggtgcagccg gtgctgggct cggccttttc gcgcaagctt     25980
     tatgcgctga cctcgaacct gaacggtggc cgccgcgcca tggtgcccac cggcacgttc     26040
     gaagagctga tgccgcagga ttacctgccg acgcagctct tgcgcgcgct tctggtgatg     26100
     gataccgaca ccgcgcaggc actgggcgcg ctggagctgg acgaagagga tctgggcctt     26160
     gtcggctttg cctgtccggc gaaatacgaa tacgggctgg cgctgcgcga cagcctctcc     26220
     aagatcgaaa aggagggctg agcccatggg gttgcgcaac ttctttgacc ggatcgagcc     26280
     gaatttcacc aagggcggca aatacgaaaa gctgttcccc atctacgaga tggtcgaaag     26340
     ctttatctat acgcccaaga ctgtgacgac ggcggcgccg catgcccggt cttatgtcga     26400
     tatgaagcgg atcatgacct atgtcgtgat cgccaccatt cccgccatcc tgtgggggat     26460
     gtggaatacc ggctatcagg ccaattctgc catcgccatg ctgggcgccg acgcggccac     26520
     cggctggcgc atcgccatcc ttcaggcgct cggcatttcg ctggatgcgg ccaatccgct     26580
     ggccaatgtg gcgcacgggt tcctgtattt cctgccgatc tacctgacca cgctgattgt     26640
     cggcggtatc tgggaggtgg tctttgccac tgtgcgcggg catgaggtga acgagggctt     26700
     tctggtcact tcgatgctct acaccctgat catgccggcc agcgcgccgc tgtggcaggt     26760
     ggcgcttggc atctcgtttg gggtggtgat cgggaaggaa gtgtttggcg gcaccggcaa     26820
     gaacttcctc aaccccgcgc tggtcgggcg tgcgttcctg tatttcgcct atcccgccaa     26880
     tatgtcgggc gacagcgtct ggaccccggt cgacgggttt tccggcgcca ccgcgctggc     26940
     ggtgtcggcg gcggatggct atcagcagct ggcgaccaac ggcatcacct ggatggacgc     27000
     cttctatggc accattcagg gcagtttcgg cgaaacctcg acactggcct gcctgatcgg     27060
     ccttgctttc ctgttgatga cgaaaatcgc caactggcgc ctgatcgtgg gcagcatggc     27120
     gggcatgatc ggcttttcgc tgctgctcaa tgtcatcggg tcggacagca acccgatgtt     27180
     cgccatgccg tggtactggc acctggtgct gggcggctat gcctttggcc tggccttcat     27240
     ggtgacagag ccggtttcgg ccagccacac caacaccggc cgctatatct atggcgcgct     27300
     gatcggggtg atggtggtgc tgatccgggt gatcaacccg gccttccccg aggggatgat     27360
     gctggccatc ctgttcggca acgtgtttgc gccgctgatc gactatttcg tcgtgcaggc     27420
     caacatcaaa cggagggcgc gccgccatgt ctgagacgca gagcaagggc ctgatcgccc     27480
     gtttcctcgc cgcgccgccg gattcggtgg gcaagaccat ctttgttgcc gtggccgtct     27540
     gtctggtcgc ctcgatgatc gtgtcctctg ccgccgtcgc cctgcgcccg gtgcaagagg     27600
     tcaacaagct caaggacaag cagatgaaca ttctgcaggt cgcggggctg ttcgaaccgg     27660
     gccagaacgt ggccgaggca ttcaaggcgt ttgaaccgca ggtgctggaa ctgaccacgg     27720
     gccggttcac cgaccagttc gacgctgcca cattcgatga caaggccgcc gccaacgatg     27780
     ccgatctgag ccgcgcgctg gatgacgacc ccgccgggat cggccgtcag gcgctttacc     27840
     gcaccgtcta tctgctgcgg gacgaagccg gtggcatcga caaggtgatc ctgccgatcc     27900
     atggctatgg cctgtggtcg acgctctatg gctttatcgc ggtcgaagag aacggcaacg     27960
     acatctttgg cctgcaattc tatcagcacg gcgagacgcc gggcctgggc gccgaggtgg     28020
     acaacccgcg ctggaaggcg atgtggaacg gcaagaagct gcgcgacgat gcgggcgatc     28080
     tgcagatcac cgttgccaag tcgcaacccg ccgccggtgc cgatttctat gtcgacgcgc     28140
     tggccggcgc cacgctgacc tcggtcgggg tggataacct ggtgcggttc tggatgggcg     28200
     agcaaggcta tgcgcccttc ctcgaggccc tgaaagcggg agagatctga tgtcccagac     28260
     caagaaagaa ctgctgatcg atccgctggt cgacaacaac ccgatcacgc ttcaggtgct     28320
     gggcatctgc tcggcgctgg cggtcacctc gtcgctgcag gttgcctttg tcatggcgct     28380
     ggcggtgacc ttcgtgacgg cgttctcgtc cttcttcatc tcgatcctgc gcaaccagat     28440
     ccccagctcg atccggatca tcgtgcaaat ggtgatcatt gccagcctcg tgatcctggt     28500
     cgaccagatc ctcaaggcct atgcctttga aatctcgaag accctgtcgg tctttgttgg     28560
     cctgatcatc accaactgca tcgtgatggg ccgggccgag gcatttgcga tgaagaaccc     28620
     gccggttgcc tcgttcatcg acggcttcgg caacggtctg ggttacgggc tgatcctgat     28680
     gctggtgggc gtgatccgcg agctgttcgg ctcgggcagc ctgtttggcg tgaccatcct     28740
     gcaaaccgtt aacaacggcg gctggtacgt gcccaacggt ctgttgctgc tgccgccttc     28800
     ggcgtttttc gtgatcggcc tgttgatctg ggccttccgc acctggaagc ccaagcagat     28860
     cgaggaacgt gaattcaaga tccagtcggt ggaggcgcat tgatggaagg gctgatttcc     28920
     ctcgcggtca aggccgtatt cgtcgagaac ctggcgctca gcttctttct cggcatgtgt     28980
     accttcatcg cggtgtccaa gaagatctcg accgcattgg gcctgggtat ctcggtcatg     29040
     gtggtgcagg cgatcaccgt gccggccaac aacctgctgc tgaatacgct cttgaaaccg     29100
     ggagcgctgg cctgggcggg tttcccggat gtggacctga ccttccttgg tctgatctcg     29160
     tatatcgggg tgatcgcggc gatggtgcag atcctcgaga tgatcctcga taagtatttc     29220
     ccgccgctct ataacgcact tggcatcttc ctgccgctga tcacggtgaa ctgcgccatt     29280
     ctgggcggtt ctctgttcat ggtggagcgt gactacaact ttgccgaggc gacgacctat     29340
     ggcctgtcct cgggctttgg ctgggcgctg gccatcaccg ccatggcggg cgtgcgcgag     29400
     aagctgaaat attccgacgt gccggacggg cttcagggtc tgggcatcac cttcattacc     29460
     gcggggctga tggcgatggc cttcatgtcc ttctcgggcg tcaaactgta agggggcgga     29520
     cagatggaaa ccttttcgct gggcgtcgtc ctctttaccc tgatcgtgat cgcgctggtt     29580
     ggcgtgatcc tgatggcccg ctcgcggctg gtctcgaccg gcaatgtgaa catcaccatc     29640
     aacggcgaga agacgatctc ggtccccgcc ggtggcaagc tgttgcagac gctggcggcc     29700
     gagaaactgt tcgtgccctc ggcctgtggc ggcggcggta cctgcgcgca atgccgggtc     29760
     aagatccatt cggggggcgg ctcgatcctg ccgaccgagg aaagccacat caccaagcgc     29820
     gaggccgcct gtggtgaccg cctgtcctgt caggtcgcgg tcaagcagga catggatatc     29880
     gaggtgccgg aagaggtgtt cggcgtcaag aaatggcgct gcaaggtgcg ctcgaacgac     29940
     aacgtggcca ccttcatcaa ggcgctggtg ctggagctgc ccgagggcga gaacgtcaat     30000
     ttccgcgccg gtggctatat ccagatcgag gcccccgcgc accagctggc ctataccgat     30060
     ttcgatgttc aggacgagta tcgcgaggat tgggaccgct tcaatctgtg gcagtacaaa     30120
     tccgtcgtga acgaaccggt cgaacgcgcc tattcgatgg ccaactatcc cgaggagaag     30180
     ggcatcatca tgctcaacgt ccgggtcgcc tcgcccccgc cgggcagcag cgacattccg     30240
     gccggcaaaa tgtcgtctta tatcttcaac ctgaagccgg gcgatgaggt caccatctcg     30300
     ggtcccttcg gcgagttctt tgcccgcgat accgacaagg aaatggtgtt catcggcggt     30360
     ggcgccggta tggcaccgat gcgcagccat atcttcgacc agctcaagcg gttgaagagc     30420
     aagcgcaaga tctcgttctg gtacggcgcg cgctcgaaga aagagatgtt ctttgtcgag     30480
     gatttcgaca tgctggctgc cgagaacccc aatttcgaat ggcatgtggc cctgtcggac     30540
     gcgcagcccg aggatgactg gaaaggctat accggcttca tccacaacgt gctgttcgaa     30600
     gagtatctca agaaccatcc cgcacccgag gattgcgagt tctacatgtg tggaccgccg     30660
     atcatgaacc agtcggtgat caacatgctg ctggaactgg gtgtggatcg cgaagacatc     30720
     atgctcgacg atttcggggg atgaacaaga aacaccggtg ctgacaggca ccggtgtctt     30780
     cgtatccgcg cccaagatta ttctgcgaat aatctcagga gaaaattcgc agaattttct     30840
     cggggcttca ctgatgggtc agccgacgat catctgcttc atcttcaatg cttcgtattc     30900
     cagttccctc aggcggaagt tcaccacgtc gccgatggtg atcatgccgc agagcttgcc     30960
     gtcgcgcatc accggcaggt ggcggaaccg gccttcggtc atccgtttga gcaccacgtt     31020
     cagcgtttcg tcgggcgcgc aggtctgcac cgcgcgcgtc atcagcccct cggcctgctg     31080
     gggcagggtc tggcccggcg tatcggccat gcggcgcacg atgtcgcgct cggagaggat     31140
     gcccagcagg gcaccgttct gatctgtgac cagaaccgcg ccgatccgct tgtccttcaa     31200
     cacgccgacg acctggccga tcgtgtcgcc cggtctgacc gaaaacaccg cctcgccctt     31260
     gccgccaagc agatcggcaa cggtcgactg tgactgggcc aggttcgaac tggccgactg     31320
     gctataggtc gtcttctcgg ccttgtcgcc acgtgtcggg gcctgatatg aggatggggc     31380
     catgggctgg gtctcctgct tgcttgttgc ggcttacccc catcttaccc gggcatcccg     31440
     atccgcaaag ggccaatcgg ccgcagccag gacaaaaccg cagcccgccc atgttcgaca     31500
     ccctgtacct gaccccggcc agcgcggcgc tgatcttttt catggtcgtc gtctgtggcc     31560
     atggctaccg caaaagctgg aaggccgagc cacccgcgcc gcgctggcat ctctgggcct     31620
     atgggctgcc ggcggcaatc ggccttctga cgctggcctt cctgccgctc aagggctgag     31680
     ccggtttgac tccgccgcgc cgctggccta tgccgcagca gcgaaatatc cgaggttggc     31740
     ccatggtccg ttggcttgca ctgcccgttg ccctcatgct gtccggctgt cttttcgagg     31800
     ccgaaccgga ggtggtgaaa ctctctggcg acacgatggg aacgacctat cacatcacgg     31860
     ccatcggcgc ggatctggac gccgaggcgc tgggggccgc ggtcgaagtg acgctggccg     31920
     ccgtgaacgc caagatgtcg aactgggacc cgaagtccga ggtttcgacc ttctcggccc     31980
     gaactgacac agcgccgatg ccggtctcac ccgagtttgt cactgtgatc ggggccgcca     32040
     accaggttca tgcacaatcg gggggcaagt tcgacatcac gctgggcccg ctgatcgagc     32100
     tgtggggctt tggcccacgc aagcccgagg atccgatccc ctcggatgcc gagattgcca     32160
     gcgcgcttca gggcgttggg caggcgcggc tgctgacgct ggatacggct ggtgggactc     32220
     tggccaaggc gcggcccgag acgggtatca acctgagcgc cattgccaag ggatacggtg     32280
     ttgacgcggt ggccgagacc ctgcgcgggt tcgagatcga cgattacatg gtcgagatcg     32340
     gcggcgatct ggtgacgcgc ggcaagaacg acaagggcga ggcctggcgc atcggcatcg     32400
     agcggcccga ccggggcgcg caaaccgtgc aactggtggt gccaatcagc gattacggca     32460
     tggcgacctc gggcgattat cgcaactatt tcgagcatca gggccagcgc tattcccata     32520
     tcctcgatcc ggtcaccggg cgtcccgtca cccatcgcac cacctcggtc accgtgattg     32580
     ccgacagtgc catgatggcc gatgcctggg ccaccgcgat gctggttctg gggctggacc     32640
     aggggctgaa ggttgcagag gcgcataaac ttgccgtgtt cttcatcgaa agggatgcgc     32700
     aagacggcgc cgaggcttat atgacggccc agagcagtgc cttcgccgat ctgctcaacg     32760
     ccgccgactg acaccgcgaa agggtatcgc catgaccacc ttcctgctgg ccttcttcct     32820
     gttgatgatc gtcatgttgg gaatgtcgct gggcgtgatg ctgatgggca agcggatcaa     32880
     gggcagttgc ggtgggctca acgcgatctc gggggcggac cgctgcgtcg tctgctccaa     32940
     ggagatcgac cccgacagcc cgctgcgtga ccggctgcaa tgcccccgcg cgcgcaagat     33000
     ggccgagcgg ctgcaggacg cggactgagc ctgcgaggcc tcagtcgcgc accaggaaac     33060
     ccgacgagat attggtggcc atgcgaatgg cctgtgtgcg gttgtcgcaa ttggatttcg     33120
     acaggatcga cttgacctgt gaattgatcg tgtcgagcga acggccacgc tcttcggcga     33180
     tctgtttgtt ggtcttgcct tcggccatca actcgaacac tgcgcattcg gcctcgctca     33240
     ggtcgaacag tgccgcgatc gtgggcattt ccagccgata ggtgcggctg gtatcggtac     33300
     tcatcagcag aaagccgtcc agcgcctgct cgccgatttc acgggccttg tgcaggggag     33360
     agatgtcgat gcacagcgcg tcgccgatac gggcgtcgct ttgatgatcg gcctccaacg     33420
     cttccttgcg ggggcgggcg ccgaatctgc catgttgctg cggatcaccc agcagggtgc     33480
     gggcgcggct cagatcgtca tcgctgcgaa agctcagctt gccctgcggg tcgcggcgga     33540
     acacgccgct ttcttcggac tggcggcgga actcctcgtt gccggcgatc acgttcatgc     33600
     gctcgtccag aacgcagaac cccacatcca atttgtccag cgcgttcaga accgtctgat     33660
     gccgtttctg taccgcctga atcgggcgcc cgatgctgag cgccttggca atatgcggca     33720
     acaatcgcga tgcgcgcgcc aaccgctgcg gcaggtcgtc agaggcgtcc gagccgaact     33780
     gcatggaaaa ccggtcgtga aacaactgat ccttgttcaa cagcgcgcca cagcgatagc     33840
     ggatgccata ttgcatcatc gttttctgat tgggacgcgc cagcagttcg gcctcggatg     33900
     cggccagcac cgaatcggga atcagctgga tatcgtcggt cgcacgggaa tgacgggcaa     33960
     aaacggcctg atcggcgatt tccagatcgt tgtgctggtt cagataccct tcgaccagat     34020
     cgatctgata ggtgtcgctg aaatgcgagg ccagcagatg cggctgatcg cccggcgttt     34080
     cgacctcgaa aatcattgca ccgatcccgc cggcatagcg cgcgattcga gtcagaagct     34140
     ccggccactt tccagggtcc agcgcggcgt cgtaaattga gagaacgagt tgatcgtgct     34200
     ggtcagtcgg ggccatgggt cttgatgatt cgatgggtct tttcacgaat atagcgtgtt     34260
     tcaccatttc gggtgattat tgtcacgtat ccaagcctta ccctacgtct cattgataac     34320
     tgagagtgag tggctcggta caatttatag tcttgctgag ttggtgtccg cggaagaccg     34380
     ttcaccgaac cgtgcagggt cccgccgggg aaattacgac ccggtcctga gccaagggcg     34440
     gttgaacgcg gatcaccact cagcatccta gatggattgc gcgttagaaa taggcgacct     34500
     gaaaaattgc agaagacatt tgaaaaacac gcaagggtgg cggcagaatg gtgttgccgc     34560
     cctttcgttt tcccgcccga cggcgcggga ggccccaggg acaacagacc ggaggtagat     34620
     tgatgatttc gaaacatgtg attggtatgg ccctggcctg tgggctggtt gctctggccg     34680
     cgcccgaagc acaggcgcaa tcggggtgga gcgtctgccg cgacgtcgaa tgcctggacc     34740
     aggggtggaa cgatgcgcag cgccgctggt ggtacaccac cacccagggt tcgcgcctgt     34800
     tgccgctgtc ctggatgcgc gcgctggaac agcccggcga tggagacggg gcgatccgcg     34860
     ccttcctgga ccgcgcctat atggacgagc tgggctatat cgccaatccc gatccggtgc     34920
     acaatcccga ggggctgccg ctgggctggg tggtggatca ggacaagacg ctgagcgccg     34980
     acctgatgtg cgacaccttc ccggaaacct gcgatgcgct gaccatgcgc gagccttggg     35040
     tcgggctgac ctgttcggcc tgccacacca acgagatcac ccatcagggc cgccgcctgc     35100
     gggtcgaagg ggcaccgacg ctggccgatt tccagcggat ggaagaggat ctgctgcagg     35160
     cactcaagga cacggtggcc gatcgcgacc ggttcgatcg gttcgcgcgc ggggtgctgg     35220
     gggccgatca atcgatcgac gggcgcgagt cgctggaact gcagcttaac gaacagatcg     35280
     tctggcagca ggcgctggcc gacaagaatg ccgcgcccaa ggtgcgctac ggccatgccc     35340
     ggctggacgc gcagggccat atcctgaaca aggtggcgct gaccatccgc cacccgaacc     35400
     agatcaccaa tgtgctggcc gatgcgccgg ccagctatcc gcatatctgg aacacctcgc     35460
     aacaggatca gctgcaatgg aacggcatcg cgccgcgcat ggccaggatc cggctcctgg     35520
     gcgaaaacac cgagctgggc gcgcttgtgc gcaacacctc cgaggtgatc ggtgtctttg     35580
     cccatctcga gacggacaag tccaaggtgc tgcgcggcta tccttccagc gcgcgtgtcc     35640
     gcgaactggt gtcgctggag cgtcagctgg aaagcctgca atcgccgcgc tggcccgagg     35700
     acatgctggg cgcgatcgac tgggatctgg cggcgcaggg gcgcgaggtc tttacccgca     35760
     agatcgacgg cgaaagctgc gcggattgcc acagccacat ggcgcccggc gacaccagca     35820
     gcaagatgga aatcagcatg accccgctga ccgagctggg gacggatgtg ttcaccacct     35880
     gcaacacatt cctgcaccgc tcgaaatcgg gcaatttcgg cggtcagctg gtggatacca     35940
     aattcacccg gatcgaccgg gacgaggact atacccgcct gatgctggtc aacgcgaccg     36000
     tgggcaccat tcgcggcaag ctgttcgagg ttctggctgc cattctgggc aaggacgacc     36060
     ggcccagtgg aatccgcacc gaaagcagcc ttgtcaccga atatctcccc ggtgtcagtg     36120
     acgcaaagaa gaaggccgat gccgaggaat gtctgaccca ggaacatccg ctgctggcct     36180
     acaaggcccg ctcgttgaac ggtatctggg ccactgcgcc ttatctgcat aacgggtcgg     36240
     tcccgacgct ctacgacctg ctgctgcccg cgcgtatgcg caacgtggca acggcgcttg     36300
     atgcggagct gcccgaggat gccgccaccc ggcccgaggt ctttggtgtg ggcagccgcg     36360
     agtttgaccc ggtcaaggtc ggtttcgtct cggagctgga ccagaacccg ttcaccttcc     36420
     gcgcgcgggg cgaggatgga gagccgatcc ccggcaattt caacgcgggc cacgattacg     36480
     gcaccgccgg gctgagcgag gaggatcgcc gcgcgctggt cgagtatctg aagaccctgt     36540
     aatcaggcgg tgcgccttcg gcgcgcttga tgtctcgtcg tcgttcctcc tcctcggcgc     36600
     gggacgcgag gtgacgcatc cttggatcgg cggtgctctt cgcaaggcgg gacgcctccg     36660
     gcgggagtat tttgaaccag aaagaagcag ggaatattat gtttctttct ggtcggaaat     36720
     actccagggg gtccggggga ctggtccccc ggcgctgtcg tctggttcag ccgctcagat     36780
     aggtgcccat caggaaggca agcgcacaga gcgtcacgct ggcgaggata ttgccggcgg     36840
     cggtggcgat cgagcgggtg cgatgcaagt cgagcgtctg ataggcgaag ctcgagaaag     36900
     tggtaaagcc gccgcagaag ccgaggatca ggcgacggcc atgttcaatg tccggtccgc     36960
     cggtttctgg ctgaccgagc cagaaaccca gaagtagcgt ccccaacacg ttgaccacca     37020
     gggttgcgag cggcaggtca tgggtgatgc ggcttgacat ccagtggcgc agaaccgccc     37080
     ccagaccgcc gccaagcgca aagaatgcat gcagtgtaag tgcggtcatc gccgggcctc     37140
     gcggccgcgc cccagcgcct cgcccagtat tgcggcggcc aagcccgcgg cgatctccag     37200
     ggtcatggcg gtgaggccga tggaccatcc gtccatgcgc gtgagctggt cgagctcaag     37260
     gacgaaggag gaaaaggtcg aaagaccgcc acagaacccc accgctccca gatgcagcag     37320
     atggggatgc agccggtgcc ggatggcata gagccagccg agcaggaaac aggcggcgat     37380
     gttgatgccg aatgtggcgg tgaggaagga caggcccggc agttgaaatc ccagcaactc     37440
     gcgcaggaca gagccgatcg ctccgcctgc gaataccgcc agataactgc ccgccttttg     37500
     tctcatcggc ttcgcatagc gggcggcgcg gcgggtttca attccgcgcc gcggctggca     37560
     gcccgaggat ctcacgcgcc tgttgccagc tggcgactgg gcgctggtat ttgtcacaga     37620
     gttcgacgct gcgtcggacg agtgcagcgt ttgagggggc cagcgtttgc cggtcgaggc     37680
     ggatgttgtc ctcgagcccc gtgcgtgtgt gtccgcccgc agcgatggcc cattcgttga     37740
     cggtcagttg attggcgccg atgccggcgg cgcaccattc ggcctggggg gcccgggtcc     37800
     gcatcatccg gacatagaaa tcgaacacct cgcggtcggc gggcatcgcg ttcttcaccc     37860
     ccatcacgaa ttgcacatag agcttgccgt agagcagccc gcgcccgtgc atgtcaatgg     37920
     cgcgcaggat atggctgagg tcgaaggcct cgatttccgg ggtgacgcga tagctgcgca     37980
     tctgggcggc cagccagtcg accaggtcgg gcgggttctc atagacccgg gagggaaagt     38040
     tgttggagcc caccgagagc gaggccatgt caggtttcag tggcagcatg ccgccgcgcg     38100
     cctgcccggc gcccgagcgc ccgccggtcg agaattgtac gatcatgccc gggcaatgtg     38160
     tgtgcagccc ctccgtcagc cgcgcaaagc ggtcggggtc gctggatggg gtgccgtcgt     38220
     cgttgcgcac atggcaatgg gcgatggcgg cgccggcctc gaacgcctct tgcgtgcttt     38280
     cgacctgttc gctgaccgtg atgggcaccg ccggattgtc ggccttggtg ggaaccgacc     38340
     cggtgatcgc gacgcagatg atgcagggct tgttggcggg cgtgtccatg ggcggtctcc     38400
     ggttcagata tcgaagaaga cggtttcctg cgggccttgc aggtggatgt cgaagcggta     38460
     gagcggtttg ccgtcgcgtt cgtcacggtt tgcgatcagg gtggcgcggc ggttttccca     38520
     ttcgatcagg ttcagcaccg ggtcggcggc attggcctcg gcctcgtcgc tgaaatagag     38580
     ccgggtgttg aggccgatat tgatgccgcg cgccacgatc caaagggtca gatgcggcgc     38640
     ctgcatcgcg ccgttgcggc ccggcaccgg gccgggcttg acggtgtcga acccccagtc     38700
     gccggtctcg aaatcggtga tcacccggcc ccagccgcga aacccctcct cgacctggcc     38760
     ggggtcttcg ggatgggcat ggatgccggc ggcattggcc tgccagacct cgatcagcac     38820
     atccttgacc gggctgccgg tcccgtcgat cacccggccc tcgacccgga tacgcgcgcc     38880
     ggcggcattg ggtccggcga tatcccagcc cagttcccgc tcgtagatgt cgaaccccgc     38940
     ggcacccggg gccaggccga tatgcacata ggggccggcg gtctgggacg gcgtttcctt     39000
     cagatagtcg agcttctgca ccatgatcct cttctccttg tcgcgtttcc caaccggaaa     39060
     accggggtca ccctgtctgg aaacgcttca attcccctca agccggtttt cgaacagggt     39120
     cgagcggcgc ccgcgcagca ccacgtcgaa ccggtaggcc agacaatcga aggggatcgc     39180
     ggcattcatg tccagcggcg cgatcagccg gtcgatggcg gcggggtcgg ggatggtgtt     39240
     gacgatcggg catgcgtgga tcagcggatc gccctcgaaa tagagctggg tgatcagccg     39300
     ctgggcaaag gcggtgccaa agatcgacat gtggatatgg gcgggccgcc agctgttgac     39360
     ccagttgcgc cagggatagg cgccgggttt gacggtgcgg aagtagtaat agccgttctc     39420
     gtcggtcagg gtgcgcccgc agccaccaaa attgggatcg atgggggcaa gataggtatc     39480
     ctttttatgg cggtaccgcc cgcccgcatt ggcctgccag atctccacca gcgtatgggg     39540
     caggggccga gaattttcgt cgaaaattct cccatgcaac aggatccgtt cgccaagcgc     39600
     gctgtggccc gcctgggcat agttatggat caggtcattg tcgccggcgc cgatatcgcc     39660
     atggccgaac acggggccgg tgatctcgct caccgtgttc tcaaggctga tcagcgcctg     39720
     ccggggggaa cgcgccaccg aggtcttgta gtcgtgtaca tgcgcgggcg ggtgccaggc     39780
     gcggtcgcgc tggtagaatt cgccgggttt gggcatctgc gccttctcct tgtcactggg     39840
     ccgttcgcgc gccggtccga tcaatccgct tccatttcgt cataggtctg ccgcgccagt     39900
     ttcagcgcct ggttggcgcg cggcacaccg gcatagatcg ccacgtgctg gaacgcctcg     39960
     agcacgtcct gcttgctggc gccggtccgt gcggtggcgc ggatatgcat cggaatttcg     40020
     tcgaaattcc ccagcgccgc caacagcgcc agcgtcagca tcgaccgctc tcggtcgctg     40080
     atcccgtcgc tggcccagac cgtgccccag gcgccttcgg tgatcagggt ctgaaacggt     40140
     gcctcaaacg cggtcttgcc cgcctcggcc cggtcgacat aggcatcccc cagcacccgg     40200
     cggcgcacct tcattccgtt gtcatagcgt tcagacatcc gtcttccttt ccgccatgcc     40260
     ctaatagggc agaccgacgt agttttgtgc aagcactgtc tgcgcatccc gactgtcgcg     40320
     caggaactcc agctcggccc gctggatgcg caggtcgaac tcgctctgtt cgggaaaacg     40380
     gtgcagcaat ttggtcatcc accagctgaa gcgttgcgtt ttccagatcc gggccagggc     40440
     ctgttcggaa tagcgctcga tcccctcggt ctcaccgctc tcgaacacct gcaccagcgc     40500
     gtgatagagg taatggatat cgctggccgc cgtgttcagc cccttggcgc cggttggcgg     40560
     cacgatatgg gccgcatcgc cacacaggaa cagccgcccc cagcgcatcg gctcgcagac     40620
     aaacgaccgg agtggcgcga tagatttctc gatcgaagga ccggtcacta gacgttctgc     40680
     aacagcgcgc ggcagccgct gccgaaactc ggcccagaag gcatcgtcgc tccaatccgc     40740
     gaccttgtcg gacagcgcgc actggatgta atagcggctg agcgtggcgt tgcgcatgga     40800
     acagagggca aagccgcggt ccgagaggct gtaaagcacc tcgtcgctca cgggtggcgt     40860
     ttccgacagc agccccagcc agccgaacgg atagacctgc tcgaactcct tgcgaatgcc     40920
     ggtcgggatg gtctggcggc tgacgccgtg gaacccgtcg cagcccgcaa catagtcaca     40980
     gtcgatccgg tgttcggtgc cgttggcggt ataggtcacg taaggcgcat cgctgtcggc     41040
     atcgtggatc gtcacgccct cggcgttgaa cacgctcttg ccgccgaccc ggtcgcgcgc     41100
     ctcatagaga tcatgcgtca cctcggtctg gccatagacc accacatgcc gcccgatcag     41160
     ctcttcgaag ctgatgcgga tctgctcctc accatgggcc aggatggtgc cgtgatggac     41220
     aaagccttcg cgatccatcc gctcggccac gcccgcctcg cgcatcaggt tgacaaaacc     41280
     cacctccagc acaccggccc ggatgcgccc cagcacatgc gcccgcgact gacgttccag     41340
     caccacggtg tcgatgccct tgcggtgcaa cagctgcccc agcagcaggc ccgaggggcc     41400
     gcctccgaca atcacaacct gcgtgcgcat cgtctctcct cccattggtc acaggatgaa     41460
     tgattgaatg cgtgatgtaa aatgagtaaa cctgtcactt gatttccgaa ataggcaagt     41520
     aaatgatcga ccgccgcatc aagttccgcc acatccagtg ttttgtggaa atcgcgcgcg     41580
     agggcagtct gaaaactgcg gcggcaaagc tgttcctgac ccagcccgcc atgtccaaga     41640
     ccctgaagga gttggaagag atcaccggca ccaccctgat gcgccgcagc cgggcggggg     41700
     ttgagctgac caagccaggc gaggtgttcc tgcatttcgc ccggatgtcg ttggccagcc     41760
     tgcaacaggg gctcgacggg atcgagaccg aggggcgccg ccagcgggaa accctgtcgg     41820
     taggcgcgct gcccagtgtg gcggcctatc tgatgcccgg tgccgtgagt gaattctcgc     41880
     ggttggcgcc acatgcgttg ttgcgaattc aggacgggcc gcacggatat ctgatcgagc     41940
     ggctcaggct gggggcgctg gacctggtga tcgggcggat gggtccgccg gaaaccatgc     42000
     agggcctgtc ctttacccag ctctatcagg aacaggtggt ctttgtggta cgcccgggcc     42060
     atccgttgct ggccgcgccc gatctggcgc gggtggccga ctggccggtg atctatcccc     42120
     cgcccggcgc cgcgatccgg cccctggtcg agcagatgct gatcgccaac gggatcggcg     42180
     agtttcccaa ccggctggaa accgtctcgg gcgcctttgg ccgggtgcat gcccgccgct     42240
     cggacgcggt ctggatcatc tcgcgcgggg ttgtggccaa tgagatcgca gaggggcggc     42300
     ttgtcgcgct gccctttggt accgagctga cccggggacc ggttgggctg atgacccggc     42360
     cagaccggcc cgagagcgcg gtggcccagc tctttgcgct ggcattgcgc aatgtgatcg     42420
     gcgccggggc aggggcctga ccaaagtcaa gtaatcggcg cggcggggcg cctaggactg     42480
     tggccagacg caatcctgtg cccgaggtgc ccatgccccg ccaacccaac agaccggaac     42540
     cgatccgttg cgccctgcgc cgtgtcgccg gtgtgctggg cgctttgctg ctggtgctgc     42600
     aactgctggt gccgcacctg gcccaggctg atgaaggcgc atggatcgag atttgtgccg     42660
     aaggtggcgc cacctggatc cagatgcccg ccgaggagac gggtgacccc tgtcccgact     42720
     gcggcgattg cctgctgtgt tcaactgcga tggatgtcct gacgcccgcc tatggcgcgg     42780
     ctgtcgaacc ggtcatcctc atcgcccggc aactgaccgg aaccgatgtg tcggttgcgg     42840
     cagcgcgaca ccgtctttgg cctgaaaccc gtggcccccc attccaagac aagagaggtg     42900
     cgatgtgctg atcacgcgcg tcatccgggt tctgctgacc cttctgttcc tggcccccct     42960
     cccggcgctg gccagcgacc tgccccggtt tctggccgcg cttgcgcccg ccgacctggc     43020
     ccctggcgcc gatggctttg gcccgctgcg cgaggatgtg ccggtggcac cggtgctcaa     43080
     gggtggcgag accgttgcct gggcctttct gacttcggat ttcgtgggca ccaccggtta     43140
     ttccggcaag cccatccatg tgatcgccgc catcgatgcc gacgcggtgc tgaccggcgt     43200
     caagctggtg gaacattccg aaccgatcgt gctgatcggg attcccaatt ccaagatggt     43260
     ggccctgacc gaaggctaca aaggcctcga cctgaagcgc gaggccgaga ccggcggcga     43320
     ggggcatgat ctcgatatca tctcgggtgc caccgtcacc atcatggtga tcgacgacag     43380
     tctggtgcgc gcaggactca aggtggcccg cgcgctgggg ctgggcggcc tgtcgcccgc     43440
     cacccccgaa ggcccgcgtc gcgagatcga catgggccag accgggacca gcgactggtt     43500
     caccctgtcg ggcgacggct cggtccggcg gatgaccttg gacatcggtc agatcaatgc     43560
     cgcgtttgac gccacgggcg acgaacgcgc caaacggcgg cgcgaacgtg gcgcgcccga     43620
     ggataccttc atcgacatgc atctggccct ggtctcggtg cccgagatcg gccgcaccct     43680
     gctgggcgag gcggaatatg caaatcttgt caactggttg gagcccggcg aacaggccat     43740
     tctggtgttg gggcgcggcg cctacagctt caagggttcg ggctatgtgc gcggcggtat     43800
     cttcgaccgg atccagctga tccagggcga cagcgcggtg cggttcttcg accgtcagca     43860
     acgccgcctg ggcacggttg cggcgacgga tgcgcccggc tttaccgagc ttgacctgtt     43920
     caagatcccc gccgatgccg agttcgaccc ggccgccccc ttccgcctgc aactgctggt     43980
     gcagcgcgcc gtgggcgcgg tggagaaaag cttcctcacc ttcgatctgg gctaccgcct     44040
     gccggaacgc ttcctgctgc ccgcagccgc cccggcggtg gtcgaggacg caagcgacga     44100
     ggccgccgcc aaggccgcgc tgtggcagcg gatctggaag gaccgcaccg tcgagattgg     44160
     cgtgctgagc gcgatgctgc tgttgctgac agcgaccttc ttctttcagt tccaggccac     44220
     gatgaacgcg cgcgtcttct attggttccg ctttgcctat ctgagtgcga cgctgttctt     44280
     catcggctgg tatgccaatg cgcagctgag cgtcgtcaac ctgatggcgc tggcgggcag     44340
     cctgcgcacg ggcttcagct gggatgcctt cctgcttgac ccgctggtgt tcatccagtg     44400
     gttcgcggtg gccgccgcgc tgatcttctg ggggcggggc gcctattgcg gctggctctg     44460
     cccgttcggc gccctgcaag agctgaccaa caagctggcc cgcgccctgc gcctgccgca     44520
     atggaccctt ccgtgggggc tgaacgagcg gctttggccg gtgaagtaca tgatcttcct     44580
     gggtctgttc ggtctcagct ttgtctcgat cccgctggcc gaaacctatg ccgaggtcga     44640
     accgttcaag accgcgatca tcctcaagtt catgcgcgac tggcctttcg tggtgtttgc     44700
     gctgctgctg ttgctgatcg gcctcttcat cgaacggttc tattgccgct atctctgccc     44760
     gctgggcgcc gcactagcga tccccgcccg catccgcatg ttcgactggc tgcgccgtta     44820
     caaggattgc ggcaacccct gccagacctg cgccaacgaa tgccccgttc aggcgatcca     44880
     ccccacgggc gagatcaacc cgaacgaatg catcacctgc ctgcattgtc aggtgctcta     44940
     tcagtccgag gccaaatgcc ccgtcgtcat ccgccagatc aagcggcggg cgcgcacagg     45000
     gacggtcgat ccgaaactga ccctcggaca cccaccggcg aaccatccaa acgccaaacc     45060
     gcaagaagct tcctgaaagg aggaacgatc atgtcggacc acgataacaa cctgagcgtc     45120
     acccgccgcg gcctgctggg cgcgacagcc accggcgccg ttctcgccag caccgggctg     45180
     ggtgccaccc tgatgaccgc gcgcgaggca tccgccgccg ccaaggtcaa tctcgaaccc     45240
     ggcgagctgg acgagtatta cggcttctgg tcctcgggtc agaccggcga gctgcgtatc     45300
     ctcggcatcc cctcgatgcg cgagctgatg cgggtgccgg tgttcaaccg ctgctcggcg     45360
     accggctggg gccagaccaa cgagtcgctc aaggtgctga ccgagggcct cttgcccgag     45420
     accaagcagt tcctggcgtc caacggcaag aaaacctatg acaacggcga cctgcaccac     45480
     ccgcatatgt cgttcaccga tggcacctat gacggccgtt acctgttcat gaacgacaag     45540
     gccaacaccc gggtggcccg cgtgcgctgc gacgtgatga aatgcgacaa gatcatcgag     45600
     atccccaatg cgcatgacat ccacggcctg cggccgcaga aatacccgcg caccggctat     45660
     gtctttgcca atggcgagca cgaggcgccg ctggtcaatg acggccagat cctcgatgat     45720
     ccctcgcaat atgtgaacat cttcaccgcg attgacggcg acagcatgga gatcgcctgg     45780
     caggtgatcg tgtcgggcaa cctcgacaac accgattgcg actatcaggg caaatacgcc     45840
     ttttcgacct cgtacaactc ggaaatgggc atgaacctgg ccgagatgac cgagaacgag     45900
     ctggaccatg tggttgtctt caacctcaag gaaatcgagg ctggcatcgc ggcgggcgat     45960
     tatcaggagc tgaacggcgt caaggtcgtc gacgggcgca agggcgcggg caacaactat     46020
     acccgctata tcccgatccc caacagcccg cacggcgtga acgccgcccc cgacaagcgc     46080
     cacatcatga tcaacggcaa gctgtcgccc accgtctcgg tgatcgacgt cgagaaggtc     46140
     gatgcgctgt ttgccgacaa tgccgatccg cgctcggcca tcgtggccga accgcagctg     46200
     ggccttgggc cgcttcacac cgcattcgac aacaagggca acgcttatac caccctgttc     46260
     ctggacagcc aggtggtgaa gtggaacatc gcaaaggcga tcgaggccta tgccggcgcc     46320
     gatgttgacc cgatcctcga caaggtcgat gtgcagtatc agccgggcca caactcgacc     46380
     tcgatgggtg aaaccgccga ggccgatggc aaatggctga tctcgatgaa caagttctcg     46440
     aaggaccggt tcctgaacgt cggccccctg aagcccgaga acgagcagct gatcgacatt     46500
     tccggcgaca agatgaaggt ggtgcatgac ggcccgacct ttgccgagcc gcatgacagc     46560
     atcatcgtgc accggtccaa ggtgaacccg gtcaacgtct gggaccgcaa cgacccgatg     46620
     tgggaagacg cccgccagca ggccgccgcc gatggtgtcg acctggagga aggtgccgaa     46680
     gagccgatcc gcgatggcaa caaggtacgg gtctacatga cgtccgtggc gccgaccttc     46740
     agcctcgaga agttcacggt gaagcagggc gacgaggtga cgatctatgt caccaacctc     46800
     gacgatgtgg atgatgtgac ccacgggctg tgcatggcca actttggcat cgcgatggaa     46860
     gtggcgccgc aggcgaccgc ttcggtcacg ttcattgccg accgtccggg cgtgcactgg     46920
     ttctattgcc agtggttctg ccacgcgctg cacatggaaa tgcgtggccg tatgtttgtc     46980
     gaaccgcggg gagcataagt catgcgctgg cccctgctga ttgcgaccct tattgcctcg     47040
     cccctttggg cggcggattg ggacgtgccc aaccgggcgg gggccatttc cgaaacactg     47100
     gcccaggcgg cggatggtga caccctccgc ctggcgcccg gtatctatgc cgaaaccctg     47160
     gtcctgtccc ggcccgtcac ccttgacggg atggggcggg ccaccatcga cgggcaaggc     47220
     accggcagcg tgatcaccgt gaccggcccc ggcgtgaccc tgcgcgggct caccgtgatc     47280
     ggctccggct cggaccatga cgggatcgac agcggtatcc agctgaccaa gaccgcccgc     47340
     gccccggtgg tggaaaacaa cgtgctgatc ggcaatctct acggcgtcga tatccacggc     47400
     gccaaggatg cgctggtcaa gggcaaccgg atcgaaggcc gtcaggaccg ccgcatgaac     47460
     gcgcgcggca atggcgtcta tgtctggaac gcccccggcg cggttgttga gggcaatgat     47520
     atccaatacg gccgcgatgg catcttcgtg aactcctcgc gccgcaatct gttccgcgac     47580
     aacctgttcc gcgatctgcg ttttgccgtg cattacatgt atgccgacaa ttccgaggtc     47640
     tcgggcaatg tctcgatcgg caacgatctg ggttatgcgg tgatgttcac cagccgggtc     47700
     aaggtggtcg acaatgtctc gatcggcgac cgcgaacacg gggtcatgct gaactatgcc     47760
     aatgacagcg tgatctcggg caatgtggtg aagggggcga aagagaaatg caccttcctc     47820
     tacaatgcca acaagaacga gtttaccaac aactggttcg aaggctgcgg catcggcatc     47880
     catttcaccg ccgggtccga gcggaaccgg atcgtcggca acgcctttgt cggtaaccgg     47940
     acccaggtga aatatgtctc gacccgctgg gtcgagtggt ccgaggatgg gcgcggcaat     48000
     tactggtccg attttgcggc ctatgacgtg aacggcgacg gcatcgccga cgccccctat     48060
     cgccccaacg acagcatgga ccatgtgctg tggacccagc cggcggccaa gttgctgctc     48120
     ggctcccccg ccgtgcagct gctgcgctgg tcgcaatccg cctttccggc ccttttgccc     48180
     ggcggcgtga tcgacagcaa cgccctgatc aaagcccctg aaccctcagc cctgaaaaag     48240
     gtgcctcatg acggataagg ccctgaccat cgaaaccctg tgcaaggatc gcggaccgac     48300
     ccgcgttctg agcgatgtgt ctctgcatgt cgcccccggc gagcgcgtgg cgctgctggg     48360
     ccataacggc gccggtaaat cgacgctgat caaatccatc ctgggcctga cccggatcga     48420
     cggtggcagc attcgcatcg gcactgccgc gcccggcagc gctcaggccc ggcgcgagac     48480
     cgcctatctg cccgaggcgg tctcgttcca cccggccctg accgggcgcg agcagctgag     48540
     gctgttcgcc cgcctgtccg gcgagcgggc cgatgtgtcc ggattgctgg agcgggtcgg     48600
     gctggccgac gcgatggacc gccgcatcgg cgcctattcc aaggggatgc ggcagcgact     48660
     gggcctcgcc caggtgctgc tcggcaaacc ccgtgtggcg ctgctggacg agccgacgag     48720
     cggtttggac ccgatctcgc ggcaggatct ctatgccatc atcgacgaac tggcggggca     48780
     gggggcggcg gtcctgatcg ccagccatgc cctgaccgag gtcgaggccc gcaccgaccg     48840
     catcgccatc ctgcgcaagg gggtcaaggt ggctgacgac acactggcca acctgtctgc     48900
     gctggcgggt ctgccaatcc gcttgcgggt cagggcgcgc gagaacgccg atgcgctggc     48960
     cgcccggctg ggcggcagcc gcgtcaacgg tgcctcggtc gagctgctgt gcgatcccgc     49020
     cgacaagatg acggcgctgc gcagcatcgc cgccatgggc gaggcggttg tcgatgtcga     49080
     catgaccccg ccccggctgg aggacctcta tcgccattat gcaaaggaga cgctgcaatg     49140
     acccgttttc ttgcggttgc ccaaaccgaa atgctgatcc tgcgccgcaa ccgctggctg     49200
     ctggtcgcga ccctgatcat ggtcctgttc gcgctggcgc tgacatttgc gggcagcgcg     49260
     cccaccggca cgctgggggt cgatatgctg acggtctcgg tcgcctcgat gaccacgctc     49320
     agcgtctatc tggcgccgct cctggcgttg atgatctcgt ttgacgcggt ggcgggcgac     49380
     atggaccggg gcagcctgcc cctgctgctg tcctatccgg cggggcgggg cgagattctg     49440
     ctgggcaagt tcgccgcgca tctggccgcc ctggcattcg ccatgaccgt cgggtttggc     49500
     actgccggtg ccgtcgcggc ctggttcggt ggcgcgggtc ctgaaagcct gatggcgctc     49560
     ttgcgcctca tcctcacctc gatcctgctg ggcgccgcct ttctggcgct gggatacctg     49620
     ctgtccgcga ccgcccgagg ctcggccgcg gcggcgggtc tgtcggccgg gctctggctg     49680
     gtttttgtcg tcctctacga tcttggcctg ttgggggccg tggtcatgga caagggcggc     49740
     accttcaccc aatctgtctt cccctgggtg atggtggcca acccggccga cgccttccgg     49800
     ctgtggaaca tcgccgcgac cgagggggtc gccatggcct cgggcatgac cggcgccgca     49860
     caggcgctgc cggtctgggc cgcgcccgcc tcgctgctca tctggccggt gctggggctg     49920
     ttgttggccc gcgccgcctt ccggagggtc gagccatgag aacccttgcc ctgatcgcgc     49980
     tgattgcgct ggccgcctgc aaggaggaag aggccgccgc gccgcctgtg ccggtcgatc     50040
     tgaccgaaag cgcgctcagc tatttctgtc agatgaacgt ggccgaacat ggcgggccaa     50100
     agggccagat ccacctcaag gggcatccgg caccgctgtt ctttgcccag gtgcgcgaca     50160
     tggtcgctta tctcaaaagc cccgagcgcg aggccgagat caccgccgtt tacgtcagcg     50220
     acatgggcgc tgcgcgcagc tgggccgagc ccgggccggg caactggatc gccgccgata     50280
     gcgcgctttt tgtcaccggc gccgatgtgg cgggcggcat gggcgcgccc gaactggtgc     50340
     cctttgccac gcccgaggcc gccgcgcggt tcatcgcgcg tcatggcggt caggcgctgc     50400
     cgctcaacga cattcccgat gccgcggtcc tgggtccggt cgacctgacc cagccgctgg     50460
     cgacaccggt gctgtaattc cgcacccgca acccaaagag aaggagaacc ccatgttcaa     50520
     aaaccgactg atcctgacca ttctggccgc agggctggcg ctgcccgccc tggccgatgg     50580
     cgatgccgac aagggcaaga aagtgttcaa caagtgcaag gcctgccatg cggtcggcga     50640
     gggcgcggcc aacaaggtcg ggccacagct gaacggcatc atcggtgccg ccgccggtca     50700
     ggtcgaaggg ttcaagtatt ccgacgccct gatcgaggcc gccgcagggg gtctggtctg     50760
     ggacgacgag agcctggccg cgtttctggc caagcccaag gatttcatga agggcaccaa     50820
     gatgtccttt gccgggctca agaaggaaga cgagatcgaa aacgtcatcg cctatttgca     50880
     aggattctga ccttgccggg cgggtcgccc ggcggcccgc cctaaccttc gagcgagacc     50940
     cagagcacgc gcgcgtcttc gtcactggtc gagacgcagc catgacccat gccgctgtcg     51000
     taatagacgc tgtcgcccgc cttcatcggc aggggccggt agtgttcggt ataaagggtc     51060
     agctcgccgc tcagcacgaa catgaactct tcgccccggt ggcgcaccca ggtgtcgaac     51120
     tcgctgacgt cgcgggcctt gatcgtgctg atatagggca gcatccgctt gctggtcagt     51180
     tcggtacaca gcaattcgtg gtcataggtg ccggtgacct gatgttcgcc ctggtccttg     51240
     cgggtgaaat cgcgccggcc cgagatgtcg ctcttgcccg attgcacgaa cagttgcggc     51300
     gtctccagat ccagcgcctg catcaggcgg cggatgatgt cgaaactggg ccgggtctgg     51360
     ttgttctcga tcttggacag ggtcgagcgg ccgatcgcgg ccgaccgtgc ggcctcttcc     51420
     agcgtcaggc ccttgtcctt gcgggcgtcg cgaatcattt tgcccagcgt ttcgccatcg     51480
     ggcgcttcca gcgcttcggg gctcaacccc tcgtcctcgg cctgtaccgg ttccatatca     51540
     tccctccgca tgtccccaat tccttgcagg atcagcctaa cccaatcaaa atttctcacg     51600
     caaatctttt gttgcgaata agggaaaagt ttcctatagg agacgcacct tgtgtgcgac     51660
     gggatacaat ccgcgcgcca acagggcatt caggggggtt ctcgtgagcg agcgcgtttc     51720
     gtcactgatc ggcagagggg agggccaacc aggccccgcc cctgccgcgg gccgcaggtc     51780
     cacctccgaa aaactaccgt tccggtccgc gcctgtcgct ggcctctctc tcctcctccc     51840
     ggcctcaccg ggcgtggacc ggaacggttt cttctccgcc gcatcctgtc tttcagccca     51900
     agggattccc cagtcatgac cgatacgccc aaacgcaccc cgctctatga tctgcatgtc     51960
     gagcttggcg gcaagatggt ggatttcgcc ggatgggaaa tgccggtgca atacccgatg     52020
     gggatcatgg gcgagcacaa gcagtgccgc gaaaaggcgg cgctgttcga tgtcagccac     52080
     atggggcagg tgatcctgcg cggggacgat atcggcgcca agctggaaaa gctttgccca     52140
     caggtgttct tgaccctgcc cgagggcaag gcgcgttacg gcttctttac caatgccgag     52200
     ggcggcatca tggatgacct gatcgtgtcg aatgccggcg agtatttctt tgtcgtggtg     52260
     aacgcggcgc tgcgccatca ggatatcccg catttggcgg cgcatctgga tggggtcgag     52320
     gtgaccgaga tcttcgaccg cgcgctggtc gcggtacagg gccccagcgc cgaggatgtg     52380
     gtgggccgcc tctgccccgc cgcgcgcgat ctgaaattca tggagacgat gctgggagag     52440
     atcgacggcg tagactgccg tatctcgcgg ctgggctata ccggcgagga cggttacgag     52500
     atttcgatcc ccgagggcga ggcgatccgc atctcgcgcc tgttcctggc gcatgaggat     52560
     tgcgaaccgg cgggcctggg cgcccgcgac agcctgcggc tggaggcggg gctgtgcctc     52620
     tatggcaatg acatcgacaa cggtacctcg ccgatcgagg ccagcctgct ctgggcaatc     52680
     cagaaacggc gccgcgaaga gggcgggttt ccgggcgccg ggcgcatcct gaaagagatc     52740
     gctgaaggtg ccccgcgcaa gctggtcggt atcaagcccg aaggtagggc gcctgcccgc     52800
     cagcatgtgg agatccagag ccttggcggc gagaccatcg gcgagatcac ctcgggcggg     52860
     ttcggcccga cggtcggcgc tccggtggcg atgggctatg tcgccagcgc tcatgctgca     52920
     cccggcgaaa aggtgaacct gattatccgg gggaaggccc agcctgccga gatcgttgcg     52980
     ctgccctttg ttgcgcagaa ttacaaacgt taacccagcc ctgccgcgcg gcagggggca     53040
     caaagccttg taaaggcttt gtccacaagg tttttacaaa accttgcccc cgcctgtggt     53100
     aaccgaaaca tactatctga aggatcgaca aacatgacca tctattactc cgaagatcac     53160
     gaatggctca gcgtcgaggg cgagatcgcc acgctgggta tcaccaaaca cgctgccgac     53220
     cagctgggcg aggtggtgtt catcgaacag aaagaggccg gtgatgcctt tgcccagggc     53280
     gacgagatcg gcgtgatcga atcggtcaag gcggcttcgg agatctatgc ccctgttgat     53340
     ggcgaagtgg tcgaggtgaa cgaggaactg gccgacaatc ccggcgctct gaacgacagc     53400
     cccgagggcg atgcctggat ctacaagatc aagctcagcg atcccgccca gcttgacggc     53460
     ttgatggatc tcgccgccta taccgacatg atcggctaag ccgccggccg ccggccctgc     53520
     cggcggcacc caccgcctga cgaggacgca gagccatggc cttcaaactc accgattacg     53580
     aagcttacga tttcgccaac cgccgccata tcggacccag cccgcgcgag atggccgata     53640
     tgttgcaggt gatcggcttc aagacgctcg accagctgat cgacgccacc gtgccgccgt     53700
     cgatccggca gaaagaggcg ctggactggg gtccggccat gaccgagcgc gacgcgctct     53760
     atcacatgaa acaggtcgcc tcgaagaaca aggttctgac ttcgctgatc ggccagggct     53820
     attacggcac caccaccccg gcgccgatcc tgcgcaatat cctggaaaac ccggcctggt     53880
     acaccgccta taccccctat cagcccgaga tcagccaggg ccggcttgag gcgctgttga     53940
     acttccagac catggtcagc gatctgaccg ggctcgacgt ggccaacgcc tcgctgttgg     54000
     acgaggccac cgcggcggcc gaggcgatgg ccatggcgaa acgctccagc cggtccaagg     54060
     ccaacaacgc ggccttcttc gtcgacaaga actgtcaccc ccaaaccgtc gcggtgatcc     54120
     gcacccgggc cgagcccttg ggcgtggatg tgcaggtggg cgacccctcc gagctggagg     54180
     ccggcgcggt gtttggcgcc atcttccagt atcccggcac ctatggccat gtgcgcgatt     54240
     acaccgccga gatcgcggcg ctgcacgagc acaacgccat cgccatcgtc gcggccgaca     54300
     tcctgtcgct ggcgctgctg aaatcgcccg gcgagatggg cgccgatatc gccatcggct     54360
     cgacccagcg ctttggcgtg ccgatgggct atggcggccc gcacgcggcc tatatggcca     54420
     ccaccgacaa gcttaagcgt gccatgccgg gccggatcat cggcgtcagc atcgacgcgc     54480
     gcggcaacaa ggcctatcgc ctggcgctgc agacccgcga acagcatatc cgccgcgaaa     54540
     aggccaactc gaacgtctgc accgcccagg cgctgctggc ggtgatggcc tcgatgtatg     54600
     cggtctatca cggtccggac gggatcaagg cgatcgcgca atccgtgcac cgcaagacct     54660
     cgcgcctggc cgccgggctt gaggagcacg ggttcaaagt agcgccagaa gtattctttg     54720
     acaccatcac agtcgatgtc ggccccctgc aaaagacggt gatcgaggcc gccgtggcgc     54780
     gtggtgtcaa cctgcgcaag gtgggcagtg accggatcgg catttctctg gacgaacaga     54840
     cccgctcgga aaccatcgag gcggtctggg gtgccttcgg catcgacaag aaggatgaca     54900
     gcgtcaagaa ccgtgcctat cgcctgcccg attacgcgct gcgcgagacg ccctatctga     54960
     cccatcccat cttccacaag aaccgggccg aggccgagat gacccgctat atgcggcgtc     55020
     tggccgaccg cgacctggcg ctggaccggg cgatgatccc gctgggcagc tgcaccatga     55080
     agctgaatgc caccatcgag atgatcccgg tgacctggcc ggaattcgca aacctgcacc     55140
     ccttcgtgcc cgaggatcag gcgcagggct atctcgagat gatcgacgac ctgtccgaga     55200
     aactgtgcca gatcaccggc tatgacgcga tctcgatgca gcccaattcg ggcgcgcagg     55260
     gtgaatatgc gggcctgatg accatccgca actatcacgc ggctcagggg cagggacacc     55320
     gcaacatctg cctgatcccc acttcggcgc atggcaccaa cccggccacc gcgcagatgg     55380
     tgggctatca ggtggtgccg gtccgctcgg acgatcacgg caatatcgac ctggccgatt     55440
     tccgcgccaa ggccgagcag cacagcgcca atctggcggc ctgcatgatc acctatccct     55500
     cgacccatgg cgtgttcgag gagaccgtgc gtgaggtttg cgacatcacc catgaacatg     55560
     gcggtcaggt ctatatcgac ggggccaata tgaacgcgat ggtgggtctg gcgcagccag     55620
     gcgagatcgg cggcgatgtg agccacctga acctgcacaa gaccttctgc attccgcatg     55680
     gcggcggcgg ccccggcatg ggtccgatcg gggtcaaggc gcatctggcc gaacatctgc     55740
     cgggccatcc tgaatatggc acggcggtgg gcccggtgtc ggcggcgcct ttcggctcgc     55800
     cctcgatcct gccggtcagc tgggcctatg ttctgctgat gggcggcgca ggcctgaccc     55860
     aggcgaccaa ggtggcgatc ctgaacgcca actacatcgc cgcacggctc aaggatgcct     55920
     atccgatcct ctacacctcg gcgacggggc gggtggcgca tgaatgcatc ctcgacaccc     55980
     ggccgctgaa cgacgagggc ggcgtgagcg tggatgacgt ggccaagcgg ttgatcgaca     56040
     gcgggttcca cgcgccgacg atgagctggc cggtggcggg cacgctgatg gtcgaaccca     56100
     cggaatccga acccaaggac gagctggacc ggttctgcga ggccatgctg tcgatccgcg     56160
     ccgaggcgca acagatcatc gacggcaaga tcgaccccga aaacaacccg ctcaaacacg     56220
     ccccccatac ggtgcgtgac ctggtggggg actgggaccg gccctacagc cgtgaacagg     56280
     cctgcttccc gccgggcaac ctgggtgtcg acaagtactg gccggtggtg aaccgggtcg     56340
     acaacgccta tggcgaccgt caccttgtct gcacctgccc gccgatggat gcctatgaag     56400
     aggccgccga atagcgtgcc gaccggggcg ggcgcccgcg cccgtcctgt cccgagcaaa     56460
     cgggaaggat aacatgatct gccctgacca gacccgcgcc gcgcgcccgg cgcgggagat     56520
     cgacatcatt ctgcccgatg gcagcccgcc ctcggcggca cggatgctgg ccgatctgtt     56580
     tcgcaccgca aacgagatcc tgggcgccca tgcctatcgg gtctcggtac atcggctggc     56640
     ggcgcagccc tgcgccgatc cacgccgctg gacccggcgg accgtcatcc tgctgggcga     56700
     tatccgcaca cgctggagcg tggcggaccc gttattgccg gtgttgcggg tcctgttggc     56760
     gcaggcgccg cgccgggtgc tggtgggggg cgcggtgttc ctgttgcgcg atgccgggct     56820
     ggcgcggaac tgcgcgctgg cgatccactc aaacttttgc gccgccgccg ccgaagaggg     56880
     gttggagggg ctgcccgatg caccgctctt tcactctgac gggccggttt ccagcgcggt     56940
     cagcggtttt gccgcagtgc cgctgatgct ggacctgatc gccgaggatc atggccaggt     57000
     cagcgcggat gccctgcgcg cctatctggg cctgcccgcg ccccagtcgc agccccgcag     57060
     ccgcctgagc ctgggcctgt tgcaaagggc ccgcggcgac cggctgatcg agcgcacgct     57120
     gaccctgatg caggagcata tcgaggagcc gctgaggatc ggcgatctcg cgggcatgct     57180
     gggggtctcg acgcgcaagc tgcaacggca attcctggac ctgaccggcg aggggccgct     57240
     ggccgcctat cgcgccttgc ggatcgaacg ggcgcagcaa ttgctggagc agaccaatct     57300
     gccgctgacc gagatcattg cggcgaccgg gttcggcacc cattccaatc tggcccgatg     57360
     gatgcgcaag gaaaccgggg ccagcccgca tatcctgcgc cagcgcgccc tgtcgggacg     57420
     cgcggcctag gtcacgaaac gaaaacgggg cggcaagggc cgccccatct tcctggtccg     57480
     tggtcccgat caggtcaggt cgaagcggtc ggcattcatc accttgaccc aggcggcgac     57540
     gaaatcggcc acaaagctgg cctcggcatc gtcctgggca tagcgctcgg ccaatgcgcg     57600
     gagttgcgag tttgagccga acaccagatc gacccgcgtc gcggtccagc gggctgcgcc     57660
     gctggcgcgg tcgcggcctt catagacacc cttgcccgac ggtttccact cggtgcccat     57720
     atccagcagg ttggtcagga aatcgctgct cagcacgccg gggcggttgg tcaggacacc     57780
     gtgggccgaa ccgccgtgat tggcgcccag cacccgcaga ccggcaacca gcaccgtcat     57840
     ttccggtgcg ctcagaccca gaagctgggc acgatcgacc agcatctcct cgggcgaggt     57900
     ggacaactcg cgcgcctgat agttgcggaa accgtccatc acgggttcca tcaccgcaaa     57960
     gctttcggcg tcggtctgct ctgcgctggc atcaccccgt cccgaggtga agggcacctc     58020
     gatctggtga ccgccggcct ttgccgcctg ttcgacgccg gcacagcccg ccagcacgat     58080
     caggtcggcc atcgacaccg acttgccgcc gctgctgaac ccggcctgga tcccttcgag     58140
     cacgcccagc acacgggcca gtttcgcggg ctcgttgacc tcccagtcct tttgcggggc     58200
     caggcggatg cgggcgccat tggcgccgcc gcgcatgtcc gagccacgga aggtcgaggc     58260
     cgaggcccat gcggtcgaca ccatgtccga cacgctgagg cccgaggcca ggatctgcgc     58320
     cttgagcgcc gcggcatcat ccgcgtcgat ctgcgtgcct gccgggatcg gatcctgcca     58380
     gatcagctct tcagccggca cttccttgcc cagatagcgc gcgcgtgggc ccatgtcgcg     58440
     atgggtcagc ttgaaccagg cgcgggcaaa ggcgtcggca aaggccgccg gatcctcggc     58500
     aaagcgcttg gcatgcggca acagtttggg atgatagcgc agcgacaggt cggcggtggt     58560
     catcatcggg cgatgcttct tggacgggtc aaaggcatct tcgaccatgt cctcgtcctc     58620
     gacattggtg gccagccaga tattggcccc tgcggggctt ttggtcagct cccagtcgta     58680
     tttgaacaga accttgaaat agcccatgtc ccaggtggtc gggtgcggtt tccacgcgcc     58740
     ttcgatgccc gaggtgatgg cgtctgcgcc cttgcccgaa ccatgcgtcg acagccaacc     58800
     caggcccatc gcctcgatcg gggcggcttc gggctcgggg ccgacagcgg atgcggggcc     58860
     gttgccgtgc gccttgccga aggtgtggcc gcccgcgacc agcgccacgg tctcggcctc     58920
     gtccatcgcc atccgcccga aggtctcgat cacgtcgtga cccgaggcga cgatgtcagg     58980
     gttgccgtcc ggcccctcgg gattcacata gatcaggccc atctgcacgg cggccagcgg     59040
     gttttccaga tcgcgcgcac ccgagtagcg gctgttggcg gtgtccgaag gggcgagcca     59100
     ttcgccttcg gacccccaat agatatcctc ttcgggttcc cagatgtcgg gccggccacc     59160
     ggcaaagccg aaggtcttga agcccatcga ttccagcgcc acgttgccgg tcaggatcag     59220
     cagatcggcc cacgagatct tgtcgccgta tttcttcttg attggccaga gcaggcgacg     59280
     cgccttgtcc aggttgccgt tatcgggcca gctgttgagc ggggcgaacc gctggttgcc     59340
     ggtgctgcca ccgccgcgcc cgtcggcggt gcgataggtg cccgccgcgt gccaggtcat     59400
     gcggatgaaa agagggccgt aatggccgta atcggcgggc caccagtcct ggctgtcggt     59460
     catcagcgcg gtcagatcgg ccttgagcgc gtcgaggtcc agcgacttga acgcctcggc     59520
     atagttgaac tgagcgccca tcgggtccga tttggacgaa tgctggtgca gcaccttcag     59580
     attgatctgg ttgggccacc aatggtggtt gcgcatgccg gtaccggcgg catgtccgtg     59640
     catcaccggg cactggcctg cgttgggggc gtcgtttccg tccatgtctg tctccgatca     59700
     tgagttgata gaatgggttg cagcaccaga aagaaccggt cgcggccgtg gcactcaccg     59760
     gggtatcctg atgtcatgag gcgagactag caaaggaaca tgatcggaat aagttacatt     59820
     ttccgatcta ttcgataatc aaagcttatg gctttgccag ggtgtgatcg cggatcgctt     59880
     cggccagcac atcgaccgtg tcgatcaccg gcggggagga gggcaggctg tcggcgatca     59940
     gcgagaattc ggaacaggca acaaagatca gcgcggctcc cttgtcggcc agttcctctg     60000
     ccgcggcggt cagaatcgcg cgggcggcgg gcaccggtcc ttcggccttg atggtgcgaa     60060
     tcgcagtcag catgcggtcg gcgtcctcgg gccagagcgg agtgagctgc gcctcggcca     60120
     gcgccgcatc gaagacgccc gccatccgca cggcgggcga ggcaagcagg cccacccgtg     60180
     cgcccggtgc cactagcgcg cgcgcgcgtg ccaccgacag cgataccatg ttcaacagcg     60240
     gaatcgacac cgccgcctcg atagcggggg catagtgatg ggcagtgttg cagggcatgc     60300
     caagcgcggt agcgccggcc tgttccagcc cccgcgccat ctgggccagg gtgggaccgg     60360
     gatcggtgcc ggtgccctgg atcagatgtg cgatccgcga gggcacctgc gggttcatgt     60420
     cgatcaacag cggcaggtga tcggcatcat ccgccgcgcg aaccgttgcc agcagccgct     60480
     gttgcagcag gatcgtcgcc tcggggccca tgccgcccag aatgccaacc acgcgccggg     60540
     tcatgtcggg caccggccgg ggcaggggag aaggctgggc atgttggtgt cctttcgggt     60600
     ctatgcatca aggaggctgc gcttacgaaa gccgcaaccg ggcggatagg caagggtcag     60660
     ccgcgcatgc gggcatggtc ggggtcatag ggcgagggtg cgatcacccg cgcggccacc     60720
     atgtcaccac agaggtccag catcatctca ctgcccggct ccgccagttc gggatcgaca     60780
     aaggcatagg ccaggttcat gccgacccga tggccccagt cgcccgaggt caccgtgccg     60840
     accacccgct gccccaccat cagcgaagcg ccgccgcggg ccggggcgcg gtcggtggcg     60900
     atctgaaggg tgaccagcat cttgcgcggg ccgtcagact ggcggtcgag cagcgctggt     60960
     ttgccgatga atgcgccctt gtccagcttg acgaaccggc tgagcccggt ttcaaacggg     61020
     tcgaactcag tgatcagatc ggccttccag tgcaggaagc ctttttccat ccgcatcgat     61080
     tccaccgccc gggcgccgaa cagggtcagg ccatgcgcct cacccgcctt cctgagcgcc     61140
     agataggccg catagagcga ggcgttggga atgtggatct cataggccag ctcacccgag     61200
     aaactgaccc ccatgaccgt tgccggggca aagccgatga aacactcgcg caccgagagc     61260
     caggggaagg cctcgcgcga ccagtcgccc cgggcgcagg ctgagagcac cgcgcgcgcc     61320
     cgggggccgg ccaggaccag gatggtctgg tcattggtga gggagcgcag ctgcacgtcc     61380
     tcgcctggct ggatatgctg gctgagccag tccatgtcgt gaaattcgct ggcggcggcg     61440
     gagccgtacc agacccgcgc gggcccgcgg tccgaggcgg gaagattggc gatagtcgcc     61500
     tctgccttga tcatgccgtg atggttcagc aggtaaccga ggccaacgcg gcccgcacgc     61560
     ttggtgacgc tgccgcagaa catgcggtcg aggaaggcat ggcggccgct gccggtgatt     61620
     tcgatcctgt tgaagccgtt cacctcggcc agtcccacgc tgttctggac agctttcacc     61680
     tcggcggcga cgacgtcgaa ggcttcgtcg aaatcgaagg tgagcgaggg gtggaactcg     61740
     ggcgagggct tgatgtaatc cacccgctcc cagccgttta caacggtgaa ctcggcccct     61800
     tcagcggcca gaaccggggt cagcggcgtg gtcttggccg ggcggccagc ggggcggtgc     61860
     tcatgcggga agtggaagcg gaattcgttc tgatagtctt cgattgcctt cagcgcggtc     61920
     agttccacat ttgcgtgacc ggtgaaccgg cgcgggtcga tgcaccaggt gtcataacag     61980
     gcctcgccat gtacgatcat ctgtgccagc agccagccat ggccgccgcc ctcgcccaga     62040
     ccggcgcgca gaccgatggc gcagaacgca ttgcgcttgc ccgggatcgg tccgatcagc     62100
     ggagcgccgt cgatggtata ggtgatcggg ccgttcacga tcgagcggat gccggtttcg     62160
     cgcaacgcgg gcatgcgggc aaaggcgcct tccagcacgt ccatcacccg atccagatcg     62220
     tcgggacaga gcgcgttgac gaaattcggg tcgatcccgt ccatgcccca ggtctggcaa     62280
     tcctgttcgt agaaaccgat cagaagcccg ctcttttcct gccggcagta gtagtccgag     62340
     atcgggcagc ggatcagcgg catgcggtga cctgccgcca cgatttccgg gatatcctcg     62400
     gtcaggaaat actggtgctc catcgaggcg accgggtgat gcacgcccat catggcgccc     62460
     acctcgttga cgcgatagcc gcaggcgttc accacgatat cgcaatcgat atcgccgttt     62520
     tcggtatgca ccgtccaggt gtcgtccttg tgctgggtca gcgcggtcac cggcgtgttg     62580
     cgatagacct cggccccggc cttgcgcgcg tgataggcca gcgcctggca cagctgcgcc     62640
     gggtcgatat cgccatccag cggatcccac agcccgccca gcaggttctc ggtcgaaatc     62700
     agcggatggc ggcgggcgca ttcttgggcg tcgatgacct cgaaatgcac atccatcccg     62760
     cgtgccatcg aggtgaaatg gcggtacccc tgcatctgct cgggcgtatt ggccagccgg     62820
     atgccgccat cgccgtggtg atagttgatc gggtattcgg ggttttcggc aagcgccttg     62880
     tacagcgcga tggagtggct tttcagcccc accatcgtct ggttcatgcc aaagttggtg     62940
     acctgggcgg cagagtgcca ggtggtgccg ctggtcagct cgttgcgttc gaccagaacc     63000
     acatcggtcc agccttcttg tgtgaggtga tacagcgtcg aacatccggc gataccgcca     63060
     ccaataacaa cgacccgtgt acgcgatttc atgttggggt gcctccaaaa ctctgcgcca     63120
     attagggcac gggatattcg tcaccggcaa caatgcgatt gtggatcaag caacatcaaa     63180
     agaagatttg aaagtttgaa attcgcgcca cccccggtcg ggatggcgca ggttcagaac     63240
     cgcaacgaca gacaggacat gccgccgtca agcttggcgc attcgctgtt gtcgatttcc     63300
     acaacctcaa atccggcttt gtccagaatc tcggcggttt tcgggaaccc tgcgggcatc     63360
     agtaccagct tgttgaaccg gatcgtgttg gcggcggcct cttcgccggg ggcggtgtgg     63420
     atcacccggt agccgtcaaa acagcccgag gcatccagcc gctcggtcgc cagaatggtc     63480
     tcgccatcca ggagcgagca gtcggtcttg aaatgtagca cgccgggcgg ggtaaagacc     63540
     tcgcgcaggg tatagcccca gtcgctgacg ataccggcca gttcggccac cccggcggca     63600
     tcggtccggt ccgaacgacc caccaggatc tcgcgcccgg tgaccaggat atcgccgccc     63660
     tcgatatggc cggggccggc aatctcgcgc agctcgccat aacaggcgcg cagggccggg     63720
     gccatctcgg ccacctcgcc cattcggctg ggggcgccgg gtcgcatcag aacagcgccc     63780
     cggggcaggc agagcgcggt atcctcgaca aacagcgcgt cgggataggc atcgagcggg     63840
     ggcagttcga tcacctcggc gccggtgctt ttcagggtgg cgacatagtg gtcatgcgcc     63900
     ttttgcatgc ggcccagatc gggagtgccg atatcctcgg ccctgagccc gtcgatcacg     63960
     ctgggcgccg ggcggcgggt gatcgcgcgc gagaattcat aggtcgggtc ggtcatggcg     64020
     gatcaatcct gttccggcgc atagggcgcg tcgatttcga tgagggtggg gccagcatgg     64080
     cgccgggcct cggccagggc agcggcaaag cccgccgggt caccggcggc gcaggtggcg     64140
     tagggcatgc cacaggcggc ggcgatggcg gcgaaatcgg gcggggtcgg gtcgcaaccc     64200
     accacctcga cacctaccgc gcgcatcgac atgtcgatct cgcgatagcc gcgactgttc     64260
     cagatcacga atgtgatggg cagtgcctcg tcgcgggcga ccatcagctc gctcaggctg     64320
     aactgcgcgc cgccatcgcc ggcgatgcag atcaccgggg tctcgggggc ggcaatggcg     64380
     gcgccgatgg cggcaggaat agcatatccc agcgcaccga acccggttgc ggcgttgaac     64440
     cagccaccgg ggcggtcatg gtcgtaaacg aggtttccgg catagatcgg ctgggtcgaa     64500
     tcccccacca tcagcgcgcc gggcacggcg tcgcgcgcgg cctccagcat ctcgaccatg     64560
     gagcgcatat aagggccgat ttcctcgcgc gccgcgtgcc gggcggcggt ggcgcggctg     64620
     gcgccgtcgt gggtgcgcgc accctcgggg agccgcgcca acagccccac cacggtggcg     64680
     cctgcatcgc cccggatcgt caggtcggcc gggtggcggg caagctgcgc gtcgcagata     64740
     tcgatgcgga tcagccccgc catcgacggc atggtgccgg tggcatacat gtcgtaatcg     64800
     gtcgggccca actcggtccc gatggccagc acccggtcgg cgccagagat cagggcgcgc     64860
     acggcatcaa ggctggggct ggcggcaacg gtcagaggat ggccatgcat cagcccgcgc     64920
     gcgttcaccg tctgcaccac cggcgcatcc agccgttcgg ccagcgcctg tagggccgtt     64980
     tccatgccct ttgccccgcc tccgatcagg atcaccgtgc ggcgcgccgc gtcgagccgc     65040
     gcagcggccg tgtcaagcag cgcggcctct ggttcatcgg gcagtgcggg ggtggctgcg     65100
     ggcaaggcac cgtcgaagcc agaccccgcc acatccaacg gcacctcgat atgacagggg     65160
     ccgccgcgac ctgttgcgag ccggtcaaac accgatccca gcgccggggc cagctgatcc     65220
     gcctgcgaga cgcgatgcgc ctccaacgcc acctgcgaga ccagccccag ctggtcgggc     65280
     aactcgtgca gatgccccat gccgcgcccc aggctggcgc gggtgttcac gcccgagacc     65340
     accaacatcg gcacgctgtc ggcgcgggcc tgtcccatcg cggtcagcgt gttggtcact     65400
     cccggaccgg tgatgacaaa ggccacgccg ggccgcccag agacccgggc atagccatcg     65460
     gccatgaacc cggcgccctg ttcgtggcgg ggtgtgacat ggcggatgcc cgaggcggcc     65520
     agaccgcgat acatctcgat cgtgtgaacg ccgggaatgc cgaacacaca ggtcaccccg     65580
     cgtgcggcca gcccggccac cagcgcctct cccaccgtgg tcatcaggcg tcctcgctct     65640
     ggaactctgc cgcatgtgcg gcgatgcgct cgcaggcggt gtcaaaggcc gcgtcatcgg     65700
     cggtcagcgc cacccggacc cagccgtcaa tggtgtcgcc gaacgaggcg ccgggcatca     65760
     ccgccacccc ggcatgatcc agcaagtgtg cggcataggc ctcgcccgtc atgccggtgc     65820
     cgctgacgtc gatcatcgcg aacatgccgg cctgcggttt cagaacgtgc aggcaggtcc     65880
     gcccgttcaa ccgcgcggcc agccggtccg cccgcgcggc gtagcgcgcc cgcatgcccg     65940
     gcgcgaccga ggaaccgttg cgtaccgccg cttcggtcat gtcggcgata aagggctggt     66000
     tgccgaacag catggtttcc gacagcggca gaagcgcggc cgtaaatgcc tcagacccga     66060
     tgcaccagcc actgcgaaag cccggcgcgg catgggattt cgagatcgac gagaccacga     66120
     tcacccgctc ggccagatcg ggctgcgcca gcggcgagga aaagccttgc ccgtcgaaca     66180
     ccagctgttc gtacacctcg tccgagatga tccacagatc gtgcttgcac gcgaggtcgc     66240
     cgattgcggc gatatcctcc ggcgtcagga tggcgccggt ggggttgtgc ggtgtggtaa     66300
     gcaggatggc acggctgcgc ggggtgatgc gcgcggcgat atcggccgcc gtgatgcgaa     66360
     agccgttttc gggccgcaac ggcaccggta ccagatcggc accggtggcg cggatcaccc     66420
     cggcataggt ggcatacatg ggatcgccca ccagcacctc gtcgccttcc tcggccacgc     66480
     ccatcaacac cgcgtaaagc gcggtctggg tgccagggaa acacatgacc tgatcggctg     66540
     agatcgcccg tccggtgctg gcgctgtaac gttcggcgag ggccgcgcgc aggcccggct     66600
     cgcccgcgcc atcggaatag gtggtgcgcc cggcgcgcat cgcggcctcg gccacatcca     66660
     tcagctcggc gggagggggc acgtccggcg cgccgatggt caggctgatc acatcggcgc     66720
     ccttggcgat catcgccttg gcgcgcaggt agatgcccca tttggcgccg cccagatcag     66780
     tcaggcggcg ggtaatggcg gtggttttca tgcctcttct cctggatcgt tcagggtcag     66840
     ccccagaatg gcgccgaccg aggtcaggcc gatgttcaca agttcgcccg gatcaaaggc     66900
     ttcgggcagc gcgccgcctt ctagccagag cccgtcgatg accgcgttgc aggcgatggc     66960
     cagcgcgcgc agttgctcgg gcgagggggt ttcgcccgcc tcctccagcg ccggggcgat     67020
     cagcgcctgc aggcggtcgc ggaaatcgta ataggtgcgg ctgtgcacct cggccatgcg     67080
     cgggtcgcgc tgcaccatgt tcaggaaccc ggcccagaga ccaaccgcct gcgggctgct     67140
     gaccggcggg gtcaggctgg cgcgtacgat gcgggccagt tggtgcgccg ccggttcacc     67200
     ggcctgacgg gggcaatcca tcgtggcatc ggtcagctgg ctcatatgtg cctgataggc     67260
     ggcatagatc agctcgtcct tgccatcgaa atagtgccgg atcaggccca gcgtcactcc     67320
     cgcctcctcg gcgatgctgc gcacggtggc cgcctgcaca cccttgcgcc cgatcagggt     67380
     cagcgtcgcc cggatcagcg cctcgcgccg atgttcggcg gattcgcggg taaagctgcg     67440
     gcgtgaactt tccaagggcg gggcctccgg cggtgagaaa agcgtgcttg atttgcatca     67500
     cgcatattgt tatacgtttg tataaatata agcagagccg ggccagatag gcaaccggaa     67560
     agtcaggggg gatcgcgtga cggcaacgca gaaactgacg cccgaagcgg gggccgccag     67620
     cgatttggcg ggcaccctgc tgattgagga tctgcataaa tcctttggcg atctcgaagt     67680
     gctcaagggc gtgtcattga ccgcgaaccg gggcgatgtg attgcgatca tcggcggctc     67740
     gggctcgggc aagtcgacca tgctgcgctg catcaacttt ctggaaaccc ccagcgcggg     67800
     ccggatcgtc atcggtggcg aggaaatcca gatgcgcgcc gatggcaccg ctgccaaccg     67860
     caaacagctg gagcgggtgc gcacccggtt ggcgatggtg ttccagtcct tcaacctgtg     67920
     gactcaccgc accctgctgg aaaacgtgat cgaggtgccg gtgcatgtcc tcaagatgcc     67980
     gcgcgcgcag gcaatcgaaa aggcgcgcgc cctgctggaa cgggtgggcc tggccgagaa     68040
     ggaagacacc tatccgttgt tcctgtccgg tggtcagcag cagcgcgcgg ccatcgcgcg     68100
     cgcgctggcg gtggacccgg cggtgatgct gtttgacgag ccgacctcgg cgctggaccc     68160
     cgagcttgtg ggcgaggtgc tgagcgtgat gcgcgacctg gccgccgagg ggcgtaccat     68220
     gttggtggtg acccacgaga tgaactttgc ccgcgaggtc gccgatcacg tgatctatct     68280
     ttaccagggc cggatcgaag agcaggggcc gcctgcccag atattcggca atccgcaatc     68340
     cgagcggctg aagcaatttc tgaaatccat caactgaaca ccaagaatga aaaacaggga     68400
     gaccaacaaa tgaacttcaa gacatcgctg ctggccggtc tggccgcatt agccctgagc     68460
     gctggcgccg cggccgccga agaggtcaag atcggcatcg cggccgagcc ttatccgccc     68520
     tttgcctcgc ccgattccgc aggcaactgg gtcggctggg agatcgaggt gatcgacgcc     68580
     gtttgcaagg cggccgcgct ggattgcgtg ctgacccccg tcgcatggga cggcatcatc     68640
     ccctcgctga ccggcaagca gatcgacgcc atcatggcct cgatgtcgat caccgaagag     68700
     cggatgcaga ccatcgactt ttcgaatgcc tattacaaca cgcctgccgt gatcgtggcc     68760
     gacaagtcgc tggatatcga tgcgtcgccc gcctcgctgg ccggcaagat catcggggta     68820
     caggcatcga ccatccacca ggcctatgcc aacgcgtatt tcggcgatgc cgagatccgc     68880
     gtctatcaga cccaggacga ggccaatcag gacctttacg ccggtcgcat cgacgcaacc     68940
     caggctgaca gcatcgccat ggccgatttt gttgccaccg atgcgggcca gtgctgcgag     69000
     atcaagggca atgtcgccaa tgacgaagcg atcctgggca agggcgtggg tgccggtgtg     69060
     cgcaagggcg acgacgcgct gcgcgaggcg ctgaacaagg gcatcgccgc aatcctggcc     69120
     gatggcacgc acgaggcgat caccgcgcgc tacttcgccg cgcccatcta cagcgaataa     69180
     tcgctgtcga tggaggggct tctggacctg ctcggcctgg cgaaaagcgc cgagctgctg     69240
     tcgctgtcgc cgccgggctg ggggatgaac ctgctgcgcg gtctgggcaa atcgctccag     69300
     atcgcgttcg gggccttcgg cttcggtctg gtgatcggat tgttcggagc ctatggaaag     69360
     ctttatggcg ggccggtcgt tcgtgatctg ctcgccatat acaccaccgt tgtccgggcg     69420
     gtgcccgaac tggtgctgat cctcattctc tatttcgtcg gtaccgacct gatcaaccgc     69480
     gcgtccgagg cgctgggata tggccgggtc gagatcagcg gcgttgccgc cggtatctgg     69540
     gtgttgggcg tggttcaggg cgcctattcg accgaggtgc tgcgcggcgc catcctggcg     69600
     gtgccgcagg gccagatcga ggcggcgcgc gcctttggca tgccgccggt gatgctgatg     69660
     cggcgggtga ccattccggc catgttgtcg tttgctctgc cggggctggc gaacctgtgg     69720
     ctgatcgcca ccaaggatac cgcgctgctg gcggttgtgg ggttcagcga actgacgctg     69780
     gaaacccggc aggccgcgtc gagcacgcgg gcctatttca cctttttcct cgccgctggc     69840
     gggctttacc tgatggtaac gctgatgtcg tccgcgctgt tccagctgct tgagaggcgg     69900
     tcacggcgcg gtcagccctc gctcaagggg gcgggtcgat gatgcggctg atccgaccga     69960
     tgctgatgcc gcaccgtctg gtgctgattg cgctggccgt ggcgctggcg ctgtggtgcg     70020
     ccctgacatt gcgctgggac tggctgccga aatacctgcc gctggcgatg gaggggctgt     70080
     ggcgcaccgt ctggctgctg gcggcaagta cattcctggg gttcctgctg gcggttccgc     70140
     tgggctttgc ccaggcggtg gggccttggt atcttgccgt tccggcgcgg gtgttctgca     70200
     ccctgatccg ggggacgccg ctgctcttgc agatatggct gctgtattat gggctggggt     70260
     cggtctttcc ccagatcgac ggtattcgcg acagcgttct gtggccctat ctgcgacagg     70320
     cctggcccta tgcgctgctg gcgctgacgc tgtcctttgc cgggtatgag ggcgaggtga     70380
     tgcgcggggc cttttcgggg gtcaaccgcg gccagctgga ggcggcgcgc tcgttcggga     70440
     tgccgcgctt taccctgttc cgccggatct ggctgccgca ggcgatcaac aacgtgctgc     70500
     cgacgctggg gggagagacc atcctgcaac ttaaggcaac gccgctggtg gcgacgatca     70560
     ccgtggtcga gatcttcgct gtctcgtcgc gggtgcggca ggacacattc gtgatctacg     70620
     aaccgctcct gttgctggcg ctggtctata tggtcattgc ggggctgatc gcgctggcct     70680
     ttcgctggct ggaaaaccgg gtgcctaccc ggcggccggg cggctgatcg cgcattgcaa     70740
     cacgttgccc atcgcaaacc catggtgtag gtctgtcccg atctatcgaa caggcacccg     70800
     tgacgatgag ccgtatctct catatcgagc tggatgacag caaccttccc ccgccaacgc     70860
     ccgagatcga gcaggaacgc aaagtcgcga tctacgatct gttggaggaa aacagctttg     70920
     ccctgccggc gcgcgacgac cgcgccgtgc ccgaggggcc ctatcgggtg aacctgtcga     70980
     tccgcgacaa gcggctggtc tttgatatcc agaccgagga cgaagagaag gcggccgaat     71040
     tccacctgtc gctgggtccg ttccggcagg tggtcaagga ttacttccag atctgcgaga     71100
     gctatttcaa cgcggtcaag accctgccgc ccagccagat cgagaccatc gacatggccc     71160
     ggcgcggcat tcacaacgag ggcagccggg tgttgcagga gcggctggac ggcaaggccg     71220
     agatcgacac cgacaccgcc cgacgcctgt ttaccctgat ttgcgttttg catttcgggg     71280
     gctgaatggt gcacccgctt ccgcagtcgg tcctgttttg ctgcgaccac aacgcggtcc     71340
     gctcgcccat ggcggaaggc atcatgaaga aattctatgg caccggcacc tatgtgcaat     71400
     ctgccggtgt tcacaacgac atggaaatcg acgggttctg catcgccgtc tgccaggaga     71460
     tcgacgtcga actggcgcgc catcgctcgc gatccttcga catgatgcag gaatggggag     71520
     acgacctcag ctcgttcgat ctggtggtgg cgctgtcgcc cgccagccag cgcagggcgc     71580
     tggaactgac ccgttttttt cacctcgatg tcgaatattg gccaattatg gaccctaccg     71640
     gactgggcga gacgcgggcg gagaagctac accactatcg tcagacccgc gatcagatca     71700
     tcaaacatct gaaagagcgc tggggagagc caacggagag atcatgagcg agaccgtcaa     71760
     acgctatttc gatgccttca acgcagggga tgtgcagggc atgctggact gcctgtccga     71820
     agatgtggcc catcacgtga acgaggggca aatccgcgtc ggcaaagaga aattcgccga     71880
     attctgcgcc catatgaacc gctgctacaa agagctgttg accgacatcg tcgtgttcga     71940
     ggccgagggc ggcacccgcg cggcggcaga gttcatcgtg aacggcacct atctgcagac     72000
     agattccggc ctgcccgagg cacatggcca gacctatcgc ctgccggcgg gctcgttttt     72060
     tacgctcgag ggcggcaaga tctcgcgggt gaccaccttc tataacctgg ccgattgggt     72120
     gaaacaggtc agcaatggct gaggtgaccg gggtccgggc gctgactggc gcggcgctgg     72180
     acgccgcgct ggaggatgtc gcccggctgc ggatcgcggt gtttcgcgcc tggccctacc     72240
     tttacgacgg cgacctggac tatgagcggg actatctgca ggcctatcgc aacagcgacc     72300
     gtgctatcgt ggtcggcgcc tttgacggcg accggctgat cggtgcctcg accggcatgc     72360
     cgctggccga tcatgccgac gatttcgcgg ctgcctttgc cgatagcggg ctggcgctgg     72420
     accaggtgtt ctattgcgcc gaatccgttc tgttgcccga ctatcgcggc catggtgtgg     72480
     ggcaccggtt ctttgacctg cgcgagggcc atgcccgcgc actgggattt gccaaatgcg     72540
     ccttttgcgg agtgcagcgc cccgccgatc acccgctgaa acccgacagc tatcgcccgc     72600
     tcgatgcatt ctggcgcgca cgcgggtacg agaaactgcc cggtgcggtg gctcatttca     72660
     gttggaagga cctggatcag gagaacgaga cagacaagcc cctgcaattc tggatacggg     72720
     atctctgatc ccacctaatg gagagatcgc atatgaagat cgccactgcc gcctatccgc     72780
     tcgactggct cgatagctgg gcacactacg aggacaagct ggccggatgg gtctccgagg     72840
     cggcggggca gggggcggat ctgctggttt ttcccgagta tggcgcgatg gagttgagca     72900
     cgctggcggg gccagccgtg gccgccgacc tggaacgctc gatccatgcg gtcagcgaac     72960
     ggatggaaga ggccgccgcg ctgcacctga aactggccgg cgaatatggt gtgcatgttc     73020
     ttggcgcttc ggcgccggtc agcaccggcg atggccgtcc tgtgaaccgg gcagagcttt     73080
     ataccccggg cggcgggcgc gaccatcagg acaagcagat catgacccgg ttcgagcgcg     73140
     aggattggga tatcgttccc ggagggccgc tgaagctgtt cgacaccgaa ctgggccgca     73200
     ttggcgtgct gatctgctat gacagcgaat tccctctctt gggccgggcc ctgtccgagg     73260
     ccgatatcct gctggttccg tcctgcaccg aggcattggc gggatacagc cgggtgcgga     73320
     tcggcgcgat ggcacgggcg ctggaaaacc aatgcgtgag tgtgatgtcc tcgatcgtgg     73380
     gcaataacga ctggtccgac gcggtcgacc gcaacaccgg catgggcggt attttcggcc     73440
     cgcccgacaa gggatttccc ggcactggca tcctggccga gggacagttg aaccggcccg     73500
     gctggaccta tgccgagatc gacctgactg ccatcgccca tgtgcgcgcc gatggcggcg     73560
     tgcttaaccg tagccactgg gtggaacagg atgggcgcgc ccaatcggtc acaaactctt     73620
     gcctgagcgc aaaagcaccc ttgaattagg gggggaatga gcgcatttaa gcgccaatgc     73680
     ctgcggattc cgcgggctaa acgcaatgat ggagacaaca tggccaagga agatacgctc     73740
     gaatttcccg gtgtcgtgaa ggaactcctg cccaatgcga cgttccgggt cgagcttgaa     73800
     aacggccatg agatcatcgc acatacggca ggcaagatgc gcaagaaccg catccgtgtt     73860
     ctggctggcg acaaggtaca ggtcgagatg accccctacg atctgaccaa gggtcggatc     73920
     aactaccgct tcaagtaacg ccgttcgcat ggcgttcatt ctcggatcgg gcagcccaag     73980
     gcggctggac ctgctggcgc agcttggcat cacgcccgat gcggtccgcc cgcccgagat     74040
     cgacgaaacc ccggctaagg gcgagttgcc ccgcgcctat tgcacccgta tcagccgcga     74100
     aaaggtggcc gccgtcgagg ccgggccgga cgatatcgtg ctatgcgccg ataccaccgt     74160
     ggcgcttggt cgccgcatcc tgggcaaacc cgccgacgcg gacgaggcgg cgcggttcct     74220
     ccgctccctg tcgggccgtc gtcaccgggt gatcaccgcc gtggcggtgc gccggggcgg     74280
     gcgcctgtgg gaacgcgacg tggtcagcca ggtcaaggtc aagcgcctgt cggaaggcga     74340
     gatctctgcc tatctcacca ccggcgattg gcagggcaag gccggcgcct atgcgatcca     74400
     gggacctgcg ggcgccttcg tgccctggat ctcgggttcg ttcagcgcca tcgtcggcct     74460
     gccgctggcg gaaaccgcag tcctgttggc cgccgcggga cactcaaaat tcaaaggtga     74520
     cacatgaagg gccgtaccat cgtactggac catatcgcag ggcgcgaggc cgcggccctg     74580
     atggtcgatg gccagttgga cgatttcctg atcgccagcg atgcgccgcc ccccggcacc     74640
     atctatcgcg cccgcgccga ccgcccggtc aagggccagg gcggcatgtt cctgaccacg     74700
     cccgatggcc cggcctttct gcgccaggtc aaggggctgg cccccggagc ccatctgctg     74760
     gtgcaggtca ccggctatgc agagccgggc aaggcgattc cggtcaccgc caagctcttg     74820
     ttcaagagcc gctatgccat cgtcacgccc ggggcgccgg gcctgaatct gtcgcgcaat     74880
     atccgtgacg aggcagagcg tgaccgcctg ctggaaatcg cgcatgaaga gatggagggc     74940
     cacggctttg gcctgatcct gcgatcgtct tgcgccgagg tcgagggcga ggtgatcgcc     75000
     gaagatatcg ccgccatgat cgcccaggcg cagcaggtgc tggaggatga cggcaaggac     75060
     tgcgaaaccc tgatcgaggg cgacggcccg catgtgctgg cctggcgtga ctggaccgat     75120
     ccggccgagg tggtgaccgc ggcaggcggg ttcgaggatc atggcgtgct cgacgcgctg     75180
     gagcgggtac gtggtatcgc tgagccactg cctggcggag gtcatctcta tatccagccc     75240
     acccgtgcgc tggtagcggt ggatgtgaat accggcagcg atacctcgct tgcggccggg     75300
     caaaaggcta atttcgcctg cgcgaaactg ctgccgcgtg tcctgcgcat acggggcctt     75360
     ggtggccaga tcacgctgga cctcgcgccg atggccaaga aggaccggcg tgggttcgaa     75420
     gccgccctgc gggccgcgct gaaggccgat agcgaagaga caacccttgc cggctggacc     75480
     ccgctgggtc attacgagtt gcaacgcaaa cgcggccggg tgccggtggc ggaggccctg     75540
     tcatgacctg cccgatctgc ggttccaaaa ccgctccatc ctaccgtccc ttctgctcga     75600
     aacgctgtgc cgacctcgac ctggccaagt ggctgaacgg ctcatacgcg atcccggcga     75660
     gctcggaaga cgaggaagaa ccccttgatc aagaggcgga aactccggta gcgccgcggc     75720
     actgaaaaaa cttgaaaaag cctctggaca ccgcctcggc cacgtcctag aaggcctcca     75780
     cccaacggta gatgccgttt ccgtgcccgg gtagctcagg ggtagagcag tggattgaaa     75840
     atcctcgtgt cggtggttcg attccgcccc cgggcaccat tttaccaaat aatatcaatg     75900
     cattatgtga atggcgctcg ctctttagct gctcattctg ccgtgtgggt atcatttggg     75960
     tatcattaag aagctatatg cccagaggcc gcttgagacg cgatttgtag ttgggacgtg     76020
     tatgccgcga accccacacc gcaagtagga cacaccgcat catggttccg ctgttagagc     76080
     tccgcagatc gagcaacacg gatttgctac ggggcgaagg gggctgagtt caatctcccc     76140
     gtacccagaa caataacggt gcagtggttc tttgtacgtg tcattgcatt atagagcaag     76200
     cgccgtttgt gctcatcact tccggttgct gactgtggcc acaggacgat caccctgtcg     76260
     aattctctgt tttttgctcc atgtatagac atagccttga tcttcgcact cttcttgaag     76320
     ccaaggcgtg tatttgttct gacagcatcg gagataaagg aaaccagttg agccttttcg     76380
     aattcgcttt ggcctgtcac cctttggagc ctgcggatac gccggatcac tgttttgacc     76440
     attggctgcg ccgagtgctc ttccaacaat gcacaaacct cgtcgtatgg cgctgtatct     76500
     ggaaaaccga ttgcctcagc caattcgtcc gcaacgctgc tatcaccgcc ttcccaactg     76560
     actgaaaacg cgttgtgcgg ccatggcctt tgcttgcttg cgacagttcc aattgcgttc     76620
     cgtatgatcg tgttcgctga atctggcgtg aggagtgcaa cgtcatcaga gcctagtctc     76680
     aattgaaacg ccagattcca tgcgagcagt cctgaatttc ttgccgtggc tggaacttcc     76740
     acaagctcaa taccttcgcc gatccaatga accctgttag tcttcccgat agcttcctca     76800
     ttcaatacgg cccgaatgtc ttcaccgttt ctcacagcca aagcggcggc cagcaaacct     76860
     gccttgttcg ttcggtgact ttgggtcagg gtgtgagtgg ttcccgcgcg tagtaaccgg     76920
     tcgatgaagt ccgccgtctc ttggccgtcg ctcaagcact gaaaactgtc tgcggcaaca     76980
     acagtcgtac agcattcctt caaaccaaga actatccctt gccgatggac atcaaggtct     77040
     tgagcctcat cgaccagcac caagggataa gttcgagcca cccaacgacg aacctcaaca     77100
     tcattcaaga gttcacaggc caagaaacaa ggaccgtgaa attggcctag ctcttcggcc     77160
     tgctgccgca tttcgtcggt cagtttggca cttcttcgtt tggccaacga ctgagcaaaa     77220
     gagtcaaagg tgagacagtc aaattttcgt ctgaaagacg cctcggcgtt caggttagaa     77280
     gtgagccgcc gtcgcgcacc attcatgaag gtaagtgcaa gcatacgttg accctcaccc     77340
     aacgcatcgc tctcaatcaa ttgccgggca tgagccacca tgctgaaggt cttgcccgat     77400
     ccagcgggcc cttcgaagaa gtcaaacgtc atcgggaggc tcgaaccgga aggtcggcat     77460
     aacagcaccg tcttcggtct cccggacgaa aagtggagaa ctctggactg atgggtcaag     77520
     cagagtgtca cacagtgcat taagtagctg cgctgcccgc ttgcggcatg cggattctcc     77580
     catcagtatc gccgacgtga tttcttgtgt gggggcgtaa gacttcctgc tttctaagaa     77640
     agcagaaagc tctgccgcgt tctcgattgc cgtgctattg gcctcagcta actggggcaa     77700
     aactagcgca aggtttgctt ccgcaatcca agcgaccacg tgttcaattt tccaatctgt     77760
     ttgccatatg attgccgcgc taggcgatgg atcagccgca ttcagttccg ctaggtagtc     77820
     ccttcctgct tgatctccgt caacaaggat cgcgcaatga tgatgaaccc gtctgacgac     77880
     atcgtgcgtc tcagcgatct ttgcgtcgtc tgtcggcacg accccaacaa acgtcgagaa     77940
     cttcgattgt tcgtcttcag gcgaatccca actttgccta agttccaagg cagtttggag     78000
     cgcctctagc caagcgacat cgcttattcc ctctggtatc aggacacgct gatgcatcag     78060
     cgcggcaatt agtttttgtc gccaagcgaa aaagaggtgt tgcttgtgat tggtcggacc     78120
     agcgggcgct gtctttgaca atggagagac agacatttgt ccatcgtcgt tatcgacaaa     78180
     ataagttgct tctacaggga acatcgccgc aaccagcggt gagtgtgtag tgacaatagt     78240
     ctgatcacag agagcgttta gccggttgac gagccgcttt tgttgagaag gttggatgtg     78300
     cagctcaggt tcctctaccg cgaggacgaa tgacttattc gcatctgctc tggcctttcc     78360
     gaactgcatc agcaacaaaa gactttgcaa ggaagtcaaa ccagttccat gccgcgcgga     78420
     aggaagagtt ggaccatctc cgtgtgcaaa atggggtacg acactttcga ggacagagtt     78480
     gctgtctgta cctgtaatgc gaagccgaag ccttggtgat gatggcatga gcttgccaag     78540
     ttcactattg gcctgctcca cgattgctgt tagcccgtct tgttcttcca gtcgctggcc     78600
     tacttccggt tcccaaagac gttcccttgc atcgcgtatc gcagtcgcag ggaggccacc     78660
     caatgtcgct acaagacgac gaaaaagctc tgatgtgaag gaaatccatt tgtcccacgt     78720
     tctagacgct gggaccatga agaagccaag ctcttggagc gtctttgacg aaatctgagt     78780
     gtagcttgtt tcatcatgga atggatcacc aagggttgct tcatcatcaa cgaagaacct     78840
     tatggtttcg gcctcaagct cttggagatc atatcgagcc gcaaacgcaa tttgaacact     78900
     aagatctgtg tgttctccgt ctgccgacgc ggcgaggtcg cctgtggctg ggttgagcca     78960
     cttctcaaca cctccgcgcc ccatggcaaa ccaagaggga ctatgctgtg ggtcattctc     79020
     tgggaagcct gagatggttg cgatgattag gatgcgagat gtctcgattg gtctgctttg     79080
     gtaaaagtca tgttcggtca agcgccgaac caatcggtct cttcccagca gcagggcaag     79140
     agcctcaaca atcgttgtct tgccgttatt gtttggaccg acaaggacag agtgtttccc     79200
     aagcgtaatg tccgcgttct gaatgccgcg caggcctgaa accttgaggc ggtgaatatg     79260
     catgttttca tctctgtttt ggtcggtgaa aagtcacagt gttttaagtt ttttgtcagc     79320
     ttgatgagtc ctgtgtaacc tattctgttt attggttttc ggtcatccgt tgctatctac     79380
     acgtcgcgcg catgccacgg agcaacgcta accatgtgag gctctgagtc caccgacaaa     79440
     acttcagcct tgacaagcac tgccagcgtt tcggcccagc gcactccgat ctcattcagt     79500
     tccagtgcca gccgatgctc aactatttct ccgccgccca tatcgccaaa tgaaaactct     79560
     ccgtcaccca attccagcag gcactcacct tcgagttcat cgtcgtcaat ttccatgccc     79620
     gtctctgtct caatcgcaat aaagctttca tgccagatct ggaattcatt tccgtcgaag     79680
     tcttctatcg tttccgggta gcggaccatt tctgccctag tttcaggtgt aaatttcacg     79740
     taggggaacg ccaatgccag ttcacccatt gaatattgcc agtgagtacg aaacaactcc     79800
     cagtcaccgt cctgctcgcg agcttcgaaa tacgcttcgg tcctcatctt ggaaatccat     79860
     ttaaccacgg taaggcgtgc ttgaatgccc tgctgctgac acctgctcaa ccattgcaca     79920
     acagatgagt cacgcaagaa tcgagcaatc tccttgtcgt tctcatttct tagggactgc     79980
     ctaaggattg gaacaagatt cccgtgcaaa acggtacgaa aaaactcgtt gtcgagttca     80040
     tttttcttgg caactttcac tctgacggtt ttttgttcca gagttaggat gtcagcgcca     80100
     aaatgggcgc ctacccactt ctgcaagtca atagccaaga aacgatcaac gctttcgata     80160
     tacagagcaa gatatgtcgg ttgcacattt agataccaga acctcaagtg cgcgacttcc     80220
     aagtccagag ccacttcctc aacagcgtca tattcttcgc ggctcaaagt gccatccatg     80280
     attcctttca tttggaacca gatcagcgcg ggggtcacta tttttccatc tcggttggag     80340
     tctggttgtg tgaggtgaag cccaatgtcg cgtccagcgc ggtcgcgttc atactctaca     80400
     aaaacaccat agttggcggc taaggctctg aacttgccca tgtatctgtt ttcaaagtcg     80460
     tcgcgaccac cgatcttcaa atgctttgcc ccttagtaga tttcgattta ttgcaggcaa     80520
     ccgtagcccg tttgccatgt ctcgacacac tctttgcact acatcctccc ggcttcgacc     80580
     attctcttgt aagggaaccc catcagttct tcgcactcgc cgaagatgcg gtacttgcgc     80640
     tcaaaaataa agggccgcac taggcggccc agctattgat aagcatagag ttggttaggt     80700
     cgccaatgcc tttctcgctt ctttctcggc ggcagacccc ttcacccatt gccaaggagt     80760
     gcgtggcttc ctcgcctttg ccagttccgg gttcgccttg gcgtcgctgg cggcggagcg     80820
     caggcgttcg cgtgcctcgc gcgggtcgat cttgagttcg tcgcagatgg ccttgagcgt     80880
     cacgatgtcg gtcatgtcga tctcctaagt tgctgatgca gatcgataag acgcaagatc     80940
     ggagcgtgtc agggataacc ctagttcggc ttgaagattt ccgagacgtc cacaccgagt     81000
     gccttggcga tgcgctcgac caccaagatc gacgggttgc gcttcccggt ctcgacgccg     81060
     ctcagatagg tctggtgaat gtccgcgcga tgggcgacct cttcttgcga aaggtccttc     81120
     tccctcctga tcctctggat atttctcgaa acgcgcgatt gaattgacat gcgcggcatg     81180
     gcgcatggcg gtcacgctct cgaccataga ctatgagtca tattcgactt aggctcacgg     81240
     aaggcccgaa gtcactggcg acattcagga atgcaggaag aggcaggggg acgtgcgccc     81300
     tcttggttga ctcatagtct atctgacgag gcgagggccg tcctgtcgcc tgacaccctg     81360
     ctgctgcccg atcatgtctt ggatttcatc gatcggcacg cggtcacgca cggcgtctat     81420
     ggctggtggt tcgacaaccg cctgcctctg gtgccgagga acgggtgcat cgagcgcgac     81480
     gggaagcacc tgctctacat tggcatcgca cccccgaaag atcggccaga gcgccgaggc     81540
     gggccaacgc ccgtgaaaag ccgactttgg cgcaaccacc tacgcgggac cgtgcgctcc     81600
     tcgaccttga gacattccct tgcggcgctt cttgaacaag aacttgaact ggcgttctgg     81660
     cgcgtcgagc ggaaccgcgt tcgcatggac cgccaccacg aggacaagct gtcggaatgg     81720
     attgccacgc acgccgcgat ctcggtcgtc cagcatgacg aaccgtggtc ccttgaggaa     81780
     atgctggtca ggaacgggcc acccttgccc ctgaacctga gcatgtccgg gcatccgttc     81840
     agatcgacgc tgagcaacct gcgccgcgct ctggggcgaa actgaccgcg cctgcaacta     81900
     accccgagga tcgagagcga aacgcgcgcg cggcggcgtt gtattgagcc aggagcgccg     81960
     gggcgtgcct cgggcgtggt gatcccgtcg caatcccggc tggcgcgctg tgcgccgcgc     82020
     tgaggcgcac ttgatctatg tgggatggtc ggcgcgggtc cacgagggcc aagccgctcg     82080
     tcagcgccac ggagagcgcc gctgggcgtg gtccatgcgc aagaccacct tctgccccac     82140
     ccgaaaacgt cctcccgccc ctttgcgccc gctacggacc ctgcaggagg tctgacctgc     82200
     caatgcgtgc cgggacggac attattgcgc ctgtggcctt cctcgtcgtc ggaggatttg     82260
     ccctgacacg gagcagcctc agatcttatc gcgcttgcgt cgaacctgaa agcaaggaga     82320
     cggaaatgac gatccgcgcg acgtgggcct tcaatggcca gacgaaaact atcttgggga     82380
     actggcacag gctatggtgc ctaatcttcg ggccgctcta ttacctgttc aaaggcatgt     82440
     tctggtgggc gctcttgtcg ctaatcaccg cgaacgggtt gtgggtcggc ttcccgttgt     82500
     tcaatcgcag catcgtactg cgccactttc accgcaaggg ctgggttcaa gaatgaccgc     82560
     cagcacctcc gcccaagcag tttgccaccc gagtggaacc cggcgcacta tgccgaaacc     82620
     cagcgtgaat gcggaccgta tgaaaagact cggcaattcg gatccggctc gcatccgaca     82680
     gactgataga tagtcctcgt gtcaccctag acaggtctga cgggcaccct aagaggtgct     82740
     gacacaaggg cttgggggag gcgttttttt aacggcgcgc gccctacggg cagacgaggg     82800
     gtcatacata ccgccgaggt ttttggcccc tagccgctcc gccgtccggt ccagcgccga     82860
     ctactggaaa agcgaaagac gggccgaagc ccgcctctca ttcgatataa aaattgttgt     82920
     acacgaatta ttataacgat cactcatcgg tgcggggttc gccgagtttc cagcgggtgc     82980
     tttttccctt acccacctgc acgatctcac cggattttgc catgtccgcc cgaagcacgt     83040
     tcaaagtgcc aacagacgcg aggctgcggc tcgtcacggc gctttcgact gcctcccacc     83100
     tgactggctg atcggataga aactcgagga tgaactctcg cgcagagtca gtggctgacg     83160
     caggcctgcc gaccgaattt gtctcgaccc tgcaaacctc ggcctcattg gcgtcagaga     83220
     actccaccgg gtgcaggacc ggcgtctcgt ctcgcccgcc cccaaagcgc tcgaaaatga     83280
     tcgtcttgcc gagttcactg gcgttggcct tgccgtgcgc caaagcgaag cgcgaccgat     83340
     ccgtcgggtc cgtgccatag aacagcgcag atcgaatact ggcggcgaag ccaattgagc     83400
     cgacaattcg gaatagtgga tgctctgacg actgtttgtt caagtgacca atggccagca     83460
     ccgcacaccc ggcatcctcg gcgatctccg tcaggcgccc cagaaactcg ccaacctcgt     83520
     tttgccggtt catgtcgcgt ccactgccca tgtaggcggt cagcgtgtcg atcacgacca     83580
     gtttgggccg ctcttcgtca atgtagcgcg ccattgcctc aaggttgtcc gggcatagga     83640
     tcttgaatct ctgcatcatg cgtatttgcg aaatatctgc cccatgctct aacagcctcc     83700
     caagggttac cctttgccag ttgtcttcgg ccgaaagtaa tagaactttg cctttcggag     83760
     cgcattcgtc cgaaagcggc caagggctgc cggaggtcac tgcagcgatc aatcggctta     83820
     ccagcaggga cttacccata ccgggattgc ccgcgagcag cgttacgcca aaatatggga     83880
     tgtacgggta gtacaggaac tccatcggca agggctcggt tgtctttggt ggcccgaaca     83940
     gggctgcagt gtcttcgaca tagttcccgc tgctctggat gaccgagcgc aactcgcttg     84000
     gcgacaacgg ggcttcggtg aaatcgttgt tcagggtttc cagcatggcc tcaaccgcat     84060
     ttttatcatc gaaccttcga cgcaagaagc aggccgtacg aaagaagaaa tcgttgcggc     84120
     taccgctctt gatgacgagg tccgttgatg ccgtttgcgg tccctctttc ctatgctgcg     84180
     ttcgatcagg tttgagcttg ctcaagtttt tcggcatagc ggccataccg gaaggcgatt     84240
     gcgaggagta acgatagcgc ttgcccgagg gatgggtgct gggaggaacc atcaccatcc     84300
     tgttcgcgcc ggtcaggacg tcaatctcat cacctttgaa cgcgccacca gaacattcac     84360
     cctgatagta caagtgatag ccgcgcccgg tgaaaacctt gaccgttttc ggcagatcaa     84420
     gaccctcaac ggcctgtttg cccgctttcc cgtccacatc gaccaccgtc aatccggcga     84480
     gagatatcgc gagattggca cggggatgcg ttcgcagggc tttttgcacc agttcgatat     84540
     catcggtcgc actatatacg ccgttcggaa agtacttgga caaggggtgt ttgccgggtg     84600
     aggggcagtc gtcacgcttg cacgagcatc gcccgtcctc gccaatgcca tatgtcaaaa     84660
     tcacttttcg cccggcggcg atctgcgcct tggcagcgtc tagtgtattt cgggagcgca     84720
     tctgttttga cacgcgaaaa tgttgtcgca tggtgtttcc tttgatttct tctggaagaa     84780
     agggggctgg aaagccccca atcagtactc agcgtaatgg gtgcgcacgc gctcggctgc     84840
     gcggtcagca agccagtcct cgatctcgga caggaaccac gcaacgctgg tcccggccat     84900
     cctgatacgc cgagggaagc gcccacgggc ctcccagcgc aacagggtcg tgttgctcac     84960
     gtttatgcca aggcgcttga ggtccgcgcg tgtggccaag gtcttgcgac cgtctgaaat     85020
     cttcatctgt cttttccttc agcaagttag ggtttgcgaa ggagcgctcc gacaaggaga     85080
     aagatggcgc agatcgtgac tcgtttcgag cgaaggtcct gaaagcttca ggtcgatttg     85140
     cgttgggatc ttcttacatc ttgaagggca agttggatgg ggccatccag ctgttcatgg     85200
     tcgcccgtgg tctccaagaa gacgcgccgc acgtaatcgg gcaaaatccc aacttgttta     85260
     tgttctgggt cccagttgcc ccgtgacaac ggaaattcgg gaaagaaatc gtgcaggtcc     85320
     caaatggcgt catagacgat ggtgaaacgg atttcgtcgg tcgtctgaac cttcatccca     85380
     agatcacatt cgagcttcga gattacgttt atggcttgca ccttgagcgc ggccaagcct     85440
     gacagaagct caacacagtc aacgggaaca attccatctt ggggttcccg aagctgatcc     85500
     tcccaatgga cgaaatgtgg tgcgttctca tttgccagcg cgctttccaa tctttcgacg     85560
     ggatgcagga cgttccgttt cagccacgtg atgcgctgcg ttgccgacat gtcgaacggg     85620
     gaaatggcga aggcagacgg cgacatttgc agagcccggc gtttcacctt acccgatgca     85680
     ctgatctttt cccagaaatc tggaaagcgt ggatcgtctt tcaggccgag aattgcgccg     85740
     acatctttcc ggcaagccga tccgaatggc cctgtgtcat cttggtcaga tggcggttcc     85800
     actgttccaa tgcctcgcac ttctcgtccg tgtatgaata gacattgtag atagcggcaa     85860
     cgcctgagac cacacccgtc ttgtggttca gcaacgcctc ggtgacgggc tgcggcacgc     85920
     ccagcatcgc catgttcgtg gacatcgtgc ggcgcagatc gtggatgatc cacggttcgg     85980
     tgccttcggg cagcgccttg tcgagccggt ccttcaggcg accgaacccc gaaactggcg     86040
     atttgccggt ggtcgtgaac acgtagtccg acccgaggaa cctcggcacc ctgcgcagca     86100
     cgtcaatcat cgcgtcggtg atcggaaccg tgtgctgcct gccgtttttc gcgcgctgcg     86160
     aaggcagggt ccacaggcgt ttttcgaggt cgagttccgt ccagcgcatc tcggcgacct     86220
     cggcgcgtct ctggccgctg aggatcaaca gcttcatgca atccccgaaa ggatagcctt     86280
     cggcgtcaca ggccgtccac agcgcgccca gctcatcgtc ggtcaggaca cgctcacgcg     86340
     accgttcctt ggacaacggt ttcattccgg cgatggggga agcatcgatc atgccgcgct     86400
     cgacacacca gcccatcagg tgcttgaggt gggccagcgc gcggttcgcg ctgaccggcg     86460
     cggatttgtg gatcagatcg caggctttca cgacatcggc gcgcttgatc tcgtcgatcc     86520
     gtttgacgtg cagggcggcg aacttcgcca gcagggcttc cttgcgcttc cagtcgcggt     86580
     tgtgaacctt ggcgtgcttt tcgatgtaat cggggatcac gtcgcccagc gtgggcttcg     86640
     tttcgacctc gacgccagtg cggtcctcga accgtcccgt ctcgatttcg tagagcacct     86700
     ttcgcacccg ttcacgcgcc tcggccagcg acacgacgcc gaaccgtccg atggtcaggc     86760
     gacgcatctt accgctgatg cgcttgtgca ggcagaacgt cttggtgccg gacgtgctga     86820
     tgcgcaggac cagacctggc atcaactcgt cgcggaaatc gagccgtttc gacgggttgg     86880
     gcttctggct ttcgatgaac ttggtggtga gtttgcgttt cataagccta tgataagatg     86940
     ggcggacaag ccgcgtcagg gacaactcta gacggcttga aacgcgctgg cctcaaaggt     87000
     gacgttttct tgtagctaag aaaccgaatg aatgctctcg gtacaggtca gattctgtcg     87060
     actatcagat ggacacggcc acttcattca tgcattttta cgacgattaa gtagtggaga     87120
     acgcatgact cgttcggata ccgaaaatct cccacaagtg accatagcca gaatgttgat     87180
     tgctgcgata cccggagtgg gtggaagtgc aacggttcta ttggaaaaaa atctacagga     87240
     acgtcgcgaa gctcgaacgc ggcaatacct tgacgagctc gcggttcgtg tccggcaact     87300
     agaaaactca agtctaccag gagattccac agttcagctg ggctatgaag cagcaaggca     87360
     ctcgaacgaa ccgtggaaac caattttcct tgcgagtatc gttaccgcgc gaccaagtga     87420
     gattgataaa ttcctgcgtc atgctttgat agccgccgct agtgacctca atgaactcga     87480
     agtttgcaca ctgacaacac tcgcactcga tcggcctgag ataacgattg tgggacgatt     87540
     tttggagttt cgagaaacca ttgcgaagct agaggaggag tccaaagaca tcgagagcct     87600
     aaaggaaaca gcgcttcgga agttggagtt ggctggactt gcctcgcaga caggtgaagg     87660
     atacaagatt tctaggcttg gtgaaatgct attgggagtg ctttcaagtt gaggcttaaa     87720
     gtacatgcac cagttccgaa ttctataaga acgcgcgagg aaaagatatt agctcgattt     87780
     ccgaaatcat cttctctgtt aaactcggtt cgaagcagaa cagacaggta caaatttgga     87840
     atttcagata gggaagtaaa taaattttac cgattctcag attacaaaaa ttcagaatca     87900
     ttctttgcgc acaaattccg gcaatttgga aaaaattata tagacaagac agatgtagaa     87960
     atagatatag caaattcagt gaatacaata ggccctggaa ccgaatcctt acctcccgcc     88020
     gatcgattta ttggcctggc aaaaaaattt agcggcgaac tactgcaggc gcggcaactc     88080
     aaaacgcctt atgtatcaat tctgactggc ccgactggga gtgggaaaac cgcatatagt     88140
     aagtgcctgt tctcatcggg agcgcaagtc ttttgggcaa acggaattat tccctcaaga     88200
     gtagagttca ccaagttttt caaagccgga caagagctct ctagccagca aatacttgat     88260
     gctatccatc aatgccagac gcgagacctg ctaatttatt tgtgcttttc tgaagtcgga     88320
     gttccaagca aagatgcgtt ggaagggatc ctttcttcac atggcgaata tagagagcac     88380
     cataataaga tacggggaat ggttgcgcta gctgagggca agaaaatcga tggctcaagc     88440
     ttcactctat ccgaagctca caatatttgg aaggagcaag taggctattt tccagaagaa     88500
     gtttgccgca atatacttgg caagatcaag agtcccagct tccatattca atttctagtt     88560
     agtcttgacg gttttgacgc ccttaagaca aaggactttt tgatttcgga tcggtatcac     88620
     ggcccaatta gtgctgttgc tgacctactt agcgacgcgc taaatcaggt ggcgaggtat     88680
     ggtggaaccc cttcaagtca caatacaaac ctagttgttt ttatgagaga tacgacgtat     88740
     gcgcgcatcc gacttgaact taatttaacg ccgaacggtg agcgaagaat tcctgttcgt     88800
     tggattgtgc ctccacctta caagatcctt gccgagacaa ttgtttccgc tgttgacggt     88860
     gatgtcagtt cctcggtggg tcaggagggt ctagacagct ttgttgtaaa cgttagaaaa     88920
     aatttgatca atgttctgaa aggtacttcg gttggccttt ccataaatca accaataagc     88980
     agtgctttct cctggaacgc acgtcatatg aaaagacata ttcgtagaat atgcatctgg     89040
     tcactagaga attatctcat ttcacatgga gatcaattag acgaaaggca gaagtctgcg     89100
     ggtctcagtg aggcttggct ttgggagaaa acgattaata atcgtgcttt aaaagacatg     89160
     gccgcatata gtgtgcttga ggcatttttt ctcgatgata ctaagtgctt acagagtaag     89220
     tttcgattga atagccggga aataagcaac ttccttgagg gttctgatct tgtttctgcg     89280
     ttggccgcaa tagatgaaag acctgaacta gaaggcttgt ttgatagcat ttttaattat     89340
     atgacaaagg ggctagatga atcggaaggc aagtgctacc cacatacttt ggtgtttgtt     89400
     cgcatacttc agattctaaa attcgatcca ggcatcacaa ttgaggacct ccatgacgag     89460
     atttcctgtt tttatgacaa tatctctctc gaagagcttc gattttatac tatctgcctt     89520
     tgcgagaacg aatatgtcgt ttttgaggga gtggaaaact cagcgagcct tgatgagtgc     89580
     cgattctttg taagcaattt cggcttcata cttttaaaca aagtaatcta ctccgtgtct     89640
     tacttttcac agtctttgat gatttcagag ctaattagat caggatttgg cacgcacttt     89700
     cgtgagagaa actttcgcac aaatgaagac tggatagcaa attgtgtatt taattctatt     89760
     attgcctaca acatcgtgca ggatgctgaa ataggcgagc ggaaatgccg acagtcggct     89820
     ggcaaagact ttgaaaaatt ctccttatgt aaaaggcttc gggaatctct aatatgggag     89880
     gctcagcgta ttttcagtcg tcgcagattt agtgggaatc tagagtggca cttcaacaat     89940
     attccggaaa aacttaagcc tttattaggt gagtttccga atttcgacac cttagaggag     90000
     atatggaaat gagtgacata gatgatctgt ccaagttgga cgtccatcaa ttgtctgcct     90060
     tactacaaga tctggatata gagttagaga aggaggtcga tgatgctaaa ctagcttttc     90120
     ttcgtcggca gtggagttca ctggttctac taatcaattc taagctgcaa gttaaagagt     90180
     ctgtgtaggc taacgcagtt ttgacgtact attttttgag aattgtgttt tggcgcattt     90240
     gtcacgccac cacttgggaa atacatgttg gaagccacga acgttttcgg gtattgctcg     90300
     ggtagcgtta gcctcgagct tgaacgttca ggcgtgagac ggcgtgagac gatctgccag     90360
     gcgcaaaggt caaggttttc aatcggctac gttgcaggtt gagcaatcct gagacagcac     90420
     gcgcggatca caaggctaat tgaaaatcct cgtgtcggtg gttcgattcc gcccccgggc     90480
     accattcatc caacatagcg acggaacccc gcccctaaag gcttgatttt gttgaaagta     90540
     gcgtgatccc gcgttcagct ggaatcggcc agtctggaca atttctggac aaagggatcc     90600
     ggtctcatgt ggggcactca tctcaaacag aaaggtcgct ggtggcacta ctatcgttcg     90660
     gttccgcgtg agtttgcaga cgttgaacga aagcccctga tcagtttctc tctcaagact     90720
     ggcgacttca ccgaagccaa gcgcatggca gccgatattt cggcgcggct tgaacaagat     90780
     tggcgcgacg ccaaggcgcg aggcgtttcg ctctgtgccc aagacgctgc cgagcaatac     90840
     cgagcggcgg cggctgtgca acggcagttt gggtttgccc caaagccagc ggcagacctg     90900
     acggatgaag agctcttgga gcggttgcgg cttctgattt cgggtcagca atccgcgccc     90960
     gagcgagggg ccgttctcgg gttgaccgcc gagcctcagt attcgctctc cgatgccttc     91020
     gaccgttttt gggactacat caaagacgaa tggatccgtg acagtcgcga tcagcagcgc     91080
     gtgaagcgca acatctatct aggctccaga cccattgatt tcatgcttct ggcgtgattc     91140
     aggctccgca aggagatctg atcgatgagc aatctgtatt ggctgaccga cgcccagatg     91200
     gagcgcctga agccgttctt tcccaagagc catggcaagc cccgcgtcga tgacgcgtcg     91260
     cgtcctcagc ggcataatct tcatcaatcg caatgggttg cgttggtgtg acgcgccgaa     91320
     ggaatacggc ccggccaaga ccctctacaa ccgttggaaa cgctggagcg acaacggggt     91380
     cttcgcccgg atcatggtgg gcctggccac cgaaagcgcc gagcacaaga cgatcatgat     91440
     cgacgcgacc tatctcaagg cacaccgcac tgcgtcgagc ctgtgcgtga aaaagggggg     91500
     cgcgggcgcc aaatcgggcg caccaaaggc ggtatgaaca ccaagctgca cgccgttgcc     91560
     gatgccaagg ggcggccgat cgggttcttc atgtccgccg ggcaggtcag cgattatacc     91620
     ggcgccgcgg ctcttctggg cagtctgccg aaggcgggtt ggctgctggc cgacaggggc     91680
     tatgacgccg attggttcag agaagcgttg aaagacaagg ggataaaggt ttgcatcccc     91740
     ggccggaaat cccgcaagaa ggccgtcaaa tacgacaagc ggcgctacaa acggcgcaac     91800
     cggatcgaga tcatgttcgg ccggttgaag gattggaggc gcgtcgccac ccgatacgac     91860
     cggtgcgcgg aaacgttctt ctccgcgatc atgctagccg caaccgtttt gttctggtta     91920
     tgacccgaga acgagtcctg agcctagtca gcggcaccgc gatcccgtcc gccaacaggc     91980
     cctcatggag cgtccggatc aattgccgtc ctccgttcgc cattgtgctc gaaccaatgg     92040
     cgcatcaatg gctcaccatg agggccgcca gcttttttct cgcgcgcagc tccagcatcg     92100
     cctcgccgta ggcctcctgc aggtccttga gctgcttctc gtattgctcg cgaatgtcga     92160
     gagggttggc gcgcagggaa ttctccatgc cacgcttcgc atcctcgacc cagccctcga     92220
     tctcggatgg ggtcaggtcg aacgtcctgc tcgcctccgc caccgtggtc ttgccctgga     92280
     tgatctcgat caccaaggcg gtcttacgct tcgccgtcca tcgcttgatg ctgtcgtcca     92340
     tcgtcatact catcgctacg ttctcccttg tagcatgagc aggatttcac tgggtcaata     92400
     cacgcctgca ttcccggccg gaagcaacgc aagacgccga tcaagtacga caagcgccgc     92460
     tacatgcggc gcaaccgccc ctctcgtgac attgctgcgc aatgcactgc caggcagtga     92520
     tcgagatcat gttcggcagg ctcaaggatt ggcggcgtgt ggcgactcgc tatgatcgat     92580
     gccccgaggt gttcctatcg gccatcgccc tcgcggcgac cgccatctat tggttatgaa     92640
     ccctgaccct agcatgttga aagaaggtgt tttcatagtt caaacatttg ctcgaaggtg     92700
     tgtttcgggc ccgtgccata ttccagttaa cggcaaggaa aagtttgttc ttctccatgt     92760
     cggtgatggg cttttcatag gcttcgacaa tgcgcggagc atctgaagcg acgaggtgat     92820
     cccccagcag ggcgaccttg ctgtctagat cggcgatctg gcgtttggtc tggcgttcaa     92880
     tcccgttgga ccgcccttcc tgcttatccc aggcgaattc gtcggcggcg cggtcgaatg     92940
     cgaggaggaa tggcattgag ttgccagctt ggattgtctg acatcggcga ctgtgggcct     93000
     gatcgagagc caggaggaca cgattgcccc tgtcgggcaa gccggtcagc tggaatcatt     93060
     gatacctggt gtgccgctct ccatattgca gggcgcgggg tttgtctcac agatcgaaga     93120
     gccgggcgcg tttcagaaag cactgatttt gttactgcaa tccattgtca gccagcagca     93180
     ggagatatca gcagatgaag aggtttagca gaagagccgc cttgctgggg gccggtggcg     93240
     tggctggatg ggggttgtca cgatggctgg gtgcggatct gccaggcgat ggcggcacca     93300
     gccggatcac ggctccgtct ggcgaggctt ggctgaatga tgccagcggc ctgtccgcta     93360
     caccgatcca tgaacacctg atactgcaac acgactctgg tgatgatctg atcgcggcta     93420
     tccgccgcga gctcgccgag gccaaggccg acggtcgccc cgtcaatgtc ggggcggcgc     93480
     gccattccat gggcggtcag gccatcccgc gcaacggcac cgccatcacc tttgacaatg     93540
     ggtcggtgga gatcgatagc gcgagccaga cttatctggt ccatgcaggc gcgcgctggt     93600
     cacaggtgat tgccgcgctc gatcctgctg gatggtcacc caaggtcatg cagtccaaca     93660
     atgactttgg ggttgccgcc accttttcgg tgaatgccca tggctggcct gtgccctttg     93720
     gcccgatggg atcaaccgtg cggtcactgc gcatggtgct gccgtccggc gatctggtga     93780
     catgttcagc caccaagaac gccgatctct tcaatctggc catgggcggt tacgggctgg     93840
     tcggtgtcat cgtggatctg gaggtggaga tggtgccgaa tacccgtctg acaccgacat     93900
     tcgagctcat ggatgcaagc gcatttggcg aggccttccg cagcgcaacc gaagaccctg     93960
     cggtcaccat ggcttatgga cggctgaacg tcgaacgtgc ggcttttctg caaaaggcac     94020
     tgttggtgac ctaccgcgaa accgcggatc agacggacct gccagcggcc gcaggctctg     94080
     gatggatgtc acatgccgcc agccgcctct atcgggctca gctcggcaac gagaccttca     94140
     aatcctttcg ctggtggaac gaaacccggt tgggtccagc cctgggatca ggagaggtaa     94200
     cgcgcaacac gcttctcaac gagcccgtcg ccacgctgga tgaccgcaac ccggaccgca     94260
     cggatattct gcacgagtat tttgtgggtt tcggtgcctt tgacggcttt ctggctgcct     94320
     gccgcgacgt gattccggcc tcgtatcagg agttcctcaa tgtgaccctg cgctatgtgg     94380
     cgcaggacga tcagagtgcg ctgtcctttg caaccgagcc caggatcgcc gcggtcatgt     94440
     ctttcagcca ggagctgacg cagcgcgctg aggccgacat ggcccgcatg accagcgcgc     94500
     tgatcgaccg gatggtggcg cttggcgggg cctattatct gccctacaga ccacatgcca     94560
     cggtggacca gtttacctcg acctatccag gcgcagggga tttcgcgcgc gccaaacggg     94620
     ggctcgaccc gcagctggtg ctgcgaaaca acctttggga caactatttg gggcagctat     94680
     gaccacactg caaaaactgt ctctgggcta ttttcttgcc ctgatgatcg ccgcatcgct     94740
     gaactatgtt ccgggcctca ctgatgaaaa cggactggcc ttcggcatct tcgcacttga     94800
     tatctatgat gacgcgctac acgtggcctc ggccctttgg gcgctggtgg cagggatgtt     94860
     gtcgcaccgg gcggcgcgga gctttctcat tctgttcggg cttgcctacc tgggcgatgg     94920
     catattcggg ttttttaccg gttttgggta tctcgatctg ggcatcttta ccaatgatcc     94980
     ggccgggatc gacctgtcgc tgccccgttt cctggccaac ctgccgcatc tggcccttgg     95040
     cggtgtcgcg gtctgggccg ggtaccgtaa cgccggtcag accccgtgat gctgctgtgg     95100
     cgctggacca aacggctggc cttgctgttg gcggtgctgg caatcggtct tggcgccccg     95160
     gtggtctatg tggaaaccat gtgccgcggc aacggcctga cccagcccta tgacgccctg     95220
     atcagcccgg cccatcaccg tcctgaaagc cgtaccctgt tgacctatcc cgaatggcat     95280
     atcgttcacg cctacgagga ttatgcaaag gtcctgagca gcggcgaccc gcacgattac     95340
     gggtttctgc gcgcgatcgg tggcttctgg aactcgctct gcaccctgtc ccggatcgct     95400
     cctgaacatg gtggcgttga tggcggcacc aagcagatga actatgtgat cggggtgagt     95460
     ttcaccgccg agctggcgct caaggcggct tatgaagaaa cccttgggcg gctctttgcg     95520
     gccttgcgcg gcccgcatcg ggcgccgcta gacgatctgt cagcggacca ggcggcggca     95580
     tacgccaagt ttctgcagca ggtgccctgg tacaaatggc agtttcgcga agacgtcaaa     95640
     gacctgcgcg accgtcccag caccgtcttg cgcgacagcg agcggcggtt ggcgcttggc     95700
     ctggagtacc gcgccaaggc ggcctatgcg gatgtgatcg cacaggccgt tgcgcaggtt     95760
     gggcaggatg agctggtttt gcggatgatc gtcaccggcg tcgaggccgg gcaactggcc     95820
     cgataccagg gcgttcgggt gttgcaagag cggccggagg ggatcgagat cgagaccccg     95880
     cgttaccgtg cgttgacgca tctgattcag cagttggcgg ctgaaaaggt gaatctggtc     95940
     gagatcgccg gcaatgacga catcctcttc accgcaattt cgaaccggcc ggccgagccc     96000
     ggcgcgcttt tcagcagcga acggcaaggg tttggcgact atcgtcacct gatcctggtg     96060
     aaagttccgg agttggccga gcggctgcgc ctactgaatg aatccggtct gaggctggaa     96120
     catattcatg actattagat cggttctgct tgcgctgccg ttgcttttcc tgggatggct     96180
     ttccgttctt ctgacggtgg caatgctgac ggatgaagct cccgcttacg tggtgatctt     96240
     tcccgggaaa gcattccttc ggggcttgcc cgaggatgcg tccgtcattg ctgtttcaag     96300
     gctcactgtc acactcacgt cggatgcttc gggctttgca agatcacttt acggcagcgg     96360
     cgcatggatt gtcttgcccg ccggcctgcc aggttgcctg ccgctgccac aggtgcggtg     96420
     aaagggatcc gctgtgccaa gccggtgcgg ccacttctgc ccgcgaagag aaatttgctt     96480
     tgaacagttt atcaatcccg gttctgaggg ttttcatatg gattgacggt gggctggcgc     96540
     gcggccttcg cacgcaaggc cgccgcgtat gacactgaag agtccgatgc accgtcaatc     96600
     cgcgaacgat gcaaatgtgc ctttcccaat agtcggcgca gcgctgttgc gcgctgctag     96660
     agggacgctt tgaagcattc aagtcgctgg cgctggaaag caacgaaatc cgccggcggc     96720
     tggttggcct ccgccacagc gcgaaacggg tcgaccacct cgctttccac cccggccaag     96780
     gtacgcacga cctcgtgggc acaaaagggc actaccgcct cggcataccc gccctcatgg     96840
     gcacaaacca gccggccgcc acaaaggtca ttcgccgctc ccattacggc ccgggtcaaa     96900
     tagccaaagg tgccgctatg cgcagtcatg cggctgagcg ggtcgaagtt gttggcatcc     96960
     agcccgcagg cgacgatgat cagctcaggc ctgaaggcat gcaacgccgg cagcaccagg     97020
     atgtccatcg cgtcgatgta gctctgatgt cccgcgccgg gcagcaggtt gacgttgagg     97080
     ttcgcccctt cccccgcacc tgcgccccgc tcgctgccgc ttcccgatcc gggggggaag     97140
     cagttttcct gatggatcga gatcgtcagt acatcttccc gttcgtagaa gatgtcctgc     97200
     gtgccgttgc cgtgatgtac atcccagtcc agtaccgcga cgcgggtcag accgcgctcg     97260
     gcacgggcgg cctcgatcgc gatggcgata ttggccagca ggcagaaccc catggatcca     97320
     tcccgcatcg cgtggtgccc cggcgggcgc gacaaggcat aggcgttgtc gaaggtgcca     97380
     tcaactacgt caaacaccgc ccgcttgacc agcccggccg acagtgccgc gatctcgtaa     97440
     ctgcccgatc cgaagggcga gaattcaccg gcattgccgc cacccgcgtc gctgagggtc     97500
     ttgaaccggt ccagataggc ctcgctgtga acacgtgcca tgtctgtctc ggtcaccggc     97560
     tccgcagatt gcacgctcag ttgcgcggtc aggcccgaga catccatcag tgacttgaac     97620
     cgccgcttgg attcgggaga ttccgcatgg ccagcggcgg ccggaggctg gatccatcca     97680
     ccgaccggca tgatcagcgc atgttctccg gtcgtgtgcc acaggcagtg ttcgtcaaaa     97740
     tagaagccgg tacgtggcat gggtttatcc ttccttgaag tgtcttttcg aagccaggtt     97800
     gcccaggcgc gggatcagcc cgtcgatacc cctgggcgca aagatcatca gcagcatggc     97860
     gatcagcccc agcgcgatca ggttccagcc cggcgaggcc gagagcgcct cgcgaagggc     97920
     gacgaacagc atcacgccaa tcaccggccc ccggatcgta cccagcccac cgatcacgca     97980
     gatgaagatc gcgtagaccg tccagttgat gtcgaaggcg gcgatgggcg agacatagag     98040
     actgcccatg aacccgatgg cccctgccat gccactgccc gcggcggaca ggatgaacag     98100
     aagcgccttg atacggcctg tcttgacacc cagcgagcgg gccgcgattt cgtcatcgcg     98160
     catggcgtgg acatgcagcc cccaggggct gcgacccaac caccaaaggc cgacgcacaa     98220
     cccagccgtc agcgccaggg ccagccagta gcccatcgaa ggcagcaggc tcgtgtcgat     98280
     ccggcgggcg gcaaacaaag gcaggccgga agaggcgcca aagtaatcca tccggctgac     98340
     cacgatcttg acgatctcgg cggcgaccca catgccgacg gcgaaataga cctcgcgcag     98400
     gcggaaaagg atcggggtca gaaccagcgc cagtaacgcc gctccgaccc cgcaaaacgg     98460
     gatcatcgcg tagggagaga tcggcagatc ccgtgtgacg gcaaagagca ggtaggcccc     98520
     gatggcgaca aaggcgtggt ggcccagcga cagcagccct ccgaaaccgg ccagcagatt     98580
     ccagctttgg gcgatggcca gaaggatcag catctcggtc accagcgcca gcgcgccgcc     98640
     gcccagccag tagggtacgg atgccaggac cagtgcggcc agggcaagga tcagacgggt     98700
     catcgtgtca ccacctttcc ggcgataccc tgcggcctga gcagcaggaa cagcagcagc     98760
     gtcagatgcc cgtaaagaag ccccgacgcg gggtcgaaat agaagctggc cacatgcacc     98820
     agagccagcg cgatgccgcc caggtagctg gcccagatcg aacctagccc gccgatcacg     98880
     atcacctcga aggcgatcag caaccgctcg gcgccggaaa agggcgtgat ggttgagcgc     98940
     atcgccagca gcatcccggc cagcgcggca aaacccgccg ccagcgccat caccagcgca     99000
     aagacccgtt tctgccggat tccgaacagc gccacgatgt cggcatcctg agaggtggcg     99060
     cggatcgccc gacccaggcg tgtgtgttgc aggccaaggt gcagcaggcc aaaaagcacc     99120
     agcgccagca gaaatatcgc aagcggcaga tagcccagcg tcacgccgcc gatctggaac     99180
     ccggcggttt tgatggtgcc gatgtcgatg ctgcggttgt cggcgccgta gatttcgacc     99240
     atcagattct gcagcaccac ggaaagacca aaggtcaaaa gcagcgccgg catcggatca     99300
     gcgctgagca cccggttgat gagctgcgct tgcagcagcc accccagccc gaaagccagc     99360
     accatgacga ccggcaaaag aacaagtgga tgcaccggca ggttgccgcc aagggtaaag     99420
     agcgccagcg ctccggcaac ggcgatctcg ccatgggcga tgttggcgat gcgcatgaca     99480
     ccgaagatca gtgtcagtcc aagaccgaag agcgcgtaaa gcccgcccag aaacagcccg     99540
     ttgatcagaa tgtcgatgac gatgctcatg cggcttctcc aaaataggcc cggctgacgg     99600
     catcgaaggc cgcaggggcc gaggcacccg caagagcgac tcgccccgat agcatgcagt     99660
     agaaccggtc cgagacatca agagcgcggc ggatgtcctg ttccaccacg accagcgtcg     99720
     ttttccgctc tttcaattgc gccaacgcgg catagacgcg gtcgaccaca accggggcca     99780
     gccccagcga gacctcgtcc accagcagaa gatccgggtt ggtcatcagg gcccggccaa     99840
     gcgagaccat ctgctgttgc cctccggaaa gaagcccagc gggtcgatgc gccatcacgg     99900
     cgatttcagg gaagaggtca aagaccgcgt cgcgcaccca gtggccgccg cggcccagat     99960
     cggctccgat catgagattc tctgcaacac tcatgccagt gaaaagccgg cgcccctcgg    100020
     gcaccatcga gatccccatc cgcgcaagtt cctgcggact ggcgctgccg atgtcgcggc    100080
     cattcaggcg cagcaccccg gcgtggtatt gacccaggcc ggctatggcg cgcagcagtg    100140
     ttgtcttgcc tgccccgtta gcgccgacaa gggcgatggt ttcaccgcgt ctcacattca    100200
     gcgaaatacc gaagagcgcc tgaaagtcgc cgtagcgggc atccagattt tcgatctcga    100260
     gcatgctcat gccggtgtcc ccagatagag cgcccgaacc tgcggatcgg cgaccaccgc    100320
     ctgtggcgtg tcctcgatca ccttgcggcc aagcgccagc atcatgatcc ggtccgaggc    100380
     ggcctgaagc gcgtgggcga tatgttcgat ccagagtacg gcaagaccgg cctctttcag    100440
     gcggtgcacc aatgtgacca tttcggcagc ttccctatcg gtcagcccgc cagagatctc    100500
     atcgagcagg atcacttgcg gatcggctgc caatgccttg gccagttcca gccgcttgcg    100560
     gtcgagaagg cgcagtgcgc cgcccatctg gtgccgcatg gcggtgagac cggtgatttc    100620
     cagcacggcc tccaccttgt cgtatgcctt ctgcggggca acgccgtgac cggcgtgctg    100680
     ggccagatag agcgtctgtt ccacgctcag cgaggcaaac gcccgcggca cctggaaagc    100740
     gcgggccatg ccggatttga cccgacccgc ggtatccagc ccggtcacgt cgcggcccgc    100800
     aaccgaaact gtgccgctgt cagcccgtgt cacatccatc agcaggtcga acagcgtact    100860
     cttgcccgca ccgttcggcc ccatgatgcc caggcagatg cccggctcga cggtcaggga    100920
     cacgtccctg agtacctcga gccctccgaa ggacttggag aggttgcgcg cttccagcat    100980
     ggctcagacc tgcggcagcg cgatggtttc ggactcgaca ccgatatccg gtgccagcgt    101040
     gttttcggtg atcaccaact cgaaggcgtg cttgcccgag gacttgcgcc actgaccgcc    101100
     cgcaagctgg gttctggcgg tgttcctgat cgggctgtcg gcaaagttca ccgggccgac    101160
     caccgtatcg agcctggtcg aggcgaagac atcgcgcaca gcggcgcggt ccttgggcgc    101220
     cccggattgc accagggcgt tcagccctgt ttcgaatagc gcatggctgt agccaagcgt    101280
     ctgcacccat tgcgcattgc tttctgcttc ccaagcgtcg gccagttcgc gggccgtctg    101340
     accggtcagg gacgaggcga acggcacgtt cggcgtccac cagacctcgg tcgtcatacc    101400
     gtcgccccgg tcgcccatcg cctcgatggc ctgtggaaac aggaaggcgg cagcgaaagt    101460
     gcaggccttt ggggtatagc ccgcctgccc tgcctggttc cagaaagtga tccagtgcgg    101520
     cgggaagccg aagccggtga cgatatcggc ccctgcctcc ttgaaccgcg acacctggcc    101580
     cgagtaatcg tcggcgtcga tcttgaacat tccgccatcg acgcgcgagt aaccgccgcg    101640
     ttcgatgaag ccgggcaggc ccatcgccgg atcggcgaag gcattgccga ccgggttgtc    101700
     gaggtagaaa tcccccacca ccttgttggt gtcgatctgg tcccagagtc ttgtgaacgt    101760
     gctcattgcg tcatcggcac cccagaagaa atggaaggtc cacggaaagc cctgttccgg    101820
     gttcgatccg cgcgggaaca tccaggcctg ccagggctgc atggtgctca tcgtgggcac    101880
     accatggata tcggcgatct cgcccaaagc gacagccgcg tcgccgtcat tgatcagcag    101940
     catgtccacc tgatcgcgca gcaagagctc gttgcccacc gaaatcgacc ggttcatgtt    102000
     ggactggttg tccttgacga tgatctcgac ctcgtggctg gccccgccgg agatgagccc    102060
     gccggaaaga tgcttgctga tggtctcgac catccactgg tccgaggttc cgaaagaagc    102120
     acgcggcccg ctgagcggcg agatgaagcc gatgcgcagc ttcttgctgg cggcggtgac    102180
     gattgaaggg gcggccagcg tgccgatgaa agcagcgctg ccggcaagaa aactgcgacg    102240
     gttcaaggat tggtttctgg tcatgttgct ctcccttttc ttcagcgtag aagagccgac    102300
     cgatggcaag acatagtgca gatgcactaa gttcgggtcg cagatcggga gaaccaggag    102360
     gcttggctgc cacgttcgtg gtcaagcctc gtcgggtgcg gcctcggtca gggtgggatt    102420
     cgccagtcgc aacagttgaa cccggttctc gacgccggtc ttgcgataga tcgagctgac    102480
     ctgatttcgg acggtgttca ccgacacatc cagcctttcc gctgcctgcc gcatagtcat    102540
     gccttgaacc agacagttcg ccaccagctt ttctcgccgg gacagatcgc cccagggatt    102600
     gggcggcgtc agccgcaaca gccaaaggtc gtcagaatac cgctcgcgcg tgaaaaccgc    102660
     gccatcgcgc ccgacatgcg acgcggtggc ggcggcggcg cgcagcaggt ccggcacccg    102720
     gccacggctg gtggccgaga actcggcgcg gtgctgaaag ccggtcgaag acagaaaaag    102780
     ctccccggtg gcgtcgacca gtgcccagtc ggtgttcgga tcgacccgca tccccagatc    102840
     cagttgcagg ctcatcgaca gcgcctgttc aatatgacga aggatcgcca gaaaatcggc    102900
     gttctcggta tcggtaaagg gttcggcagc gccccgccgg tacagcgaca taaagaaatt    102960
     gaagcgtccg tcgcgcacct tgcagtggcc gttcaacatc tgggtcaggt tgaaatggcc    103020
     cgcaaagtca cgaaagctgg gatcggtgac cgcctcggcc acggtgatcg accgcgcata    103080
     gcgctgcaga ttgcgtcctg tccgcacgaa aggatcgttg gcaagctggg ccttgacccg    103140
     cggctcgaaa tcttcgggca ggtcgctgac atcggtatgc accatcgcaa tccgtccgcc    103200
     ccggaacaga gaccagcccc accatgccgc gtcgaaccgg gttatgtcgc gcaccaggtc    103260
     catcatgaac ttctggaaat gcagcggtgt gtgggtattg gccttgtcca tcagcttaag    103320
     gacaaactcg ctgaggtcat agcggttcat gccggcgtcc tcgctacttg gtcatagtgc    103380
     atctgcacta tatctggttc tcgcgccttc tggctagcct tgcctgcaat gcaaccggcc    103440
     ccgcggactg gagagggccg ttccaagtgg aggaagacat gccagaagcc ttgaaggaca    103500
     tcatcgcagc caagtcgcgc aggttcgagg aaaactttgc caggggcgat gtgcccgcat    103560
     tggttgcgga ttactacaac aacgatccgg tggtgatcgg gcagggcgtg gccaccttca    103620
     ccggacgtga gggggcaacg cagtacttta ccggcgcggt cgaagcgatg aaatcggcga    103680
     agctgacgac ctacaccatt caggaaggcg aagacagtgc catcgagacc ggcggcgtca    103740
     agctgacccc gcgcgaggac ggcgctgcgc agatagacct gacctatgtg ctggtctggc    103800
     aaaggcacgc cgacggctgg gccgtgcaca tggattattt catgcctggc gtcgtgcgct    103860
     gaggtctcgg aaagggtccc cgatgagtta ccatatgacg attgatgcgc aggccgtcgc    103920
     cgccgcatcc gaattcgaag ttgccaatcc cgctggcggg attgcaggtc atgcgccaaa    103980
     tgccacgctt gaggatctgg atcgcgcggt tgccgcagcg cagggcgcgt tcacactctg    104040
     gtcgcggcag gatgacgcaa ccctgcgggc cgcctgcgag gcagttaccg ccaagatcgg    104100
     cgaacatgca gaggaactgg cgcagttgat caccgccgag cagggcaagc cgctgaatgg    104160
     tctggggtca cgctgggagc tgggcggcgc gcaggcatgg gcaggctaca ccagcagcct    104220
     ggccctgccg gtcaagatct tgcaggacga tgacgcgggc cgggtagaaa tgcatcgcaa    104280
     acctctgggg gtcgtcgggt cgatcacgcc ttggaacttc ccgttgatga tcgcggtctg    104340
     gcatattctg cccgctctgc gtaccgggaa tacggtggtg atcaagccct cgcccctgac    104400
     cccgctgtca accctgcgtc tggtcgaatt gatgaacgag gtgctgcccg ccggggtggt    104460
     caatgtgatc accggcgatg acaaggcggt caatctgggt gctgctatgt cggcgcatcc    104520
     cggcatccgc aagatcgtct ttaccggctc ctgcgccacc gggcaaaaga tcatggcatc    104580
     agcggcggac agcatgaagc ggctgacgct ggaaatgggc ggcaacgatg cgggaatcgt    104640
     gctgcccgat gtcgatcccg aggcgattgc cgaaggtttg ttctggggcg ccttcatcaa    104700
     caacggccaa acctgtgcgg cgatgaaacg gctttatgtg catgaggacg tacatgatgc    104760
     ggtttgcgag gcacttgttg cattcgcccg caacattccc gtcgggcgcg gcgacgacga    104820
     acatgcgatt ctgggtccgg tgcagaatgc cgtgcagcac gccaaactgt gccgtctcgt    104880
     ggcggcggcg aagaacaagg gcaatgttct gcttggcggg gaatcgggcg aggggctttt    104940
     ctttccgccc acgatcatct cgggtttgga aaacggtgat ccgctggtgg acgaggaaca    105000
     attcgggcct gtactgccaa tcatccgcta cagcgatctg gaggccgcga ttgccgccgc    105060
     caataacagc ccaaacgggc tgggtggctc ggtctggtcg ccggatatcg acaaggccag    105120
     atcggtggcg cagcggctgg aatgcgggtc ggtctggatc aacaagcatg gcgcgatcca    105180
     gcccaacgtt ccttttggcg ggatcaaggc ctcgggcctg ggcgtggaat tcgccgagga    105240
     agggctggcg gaatacaccg acatccaggt ggtgttttcc tgactgaaaa ccggaccgtc    105300
     ctcgccgggg cggtccgggc tacccggccg cgtcgaacgc cctgcgcgcc tcgatgatct    105360
     gcggctgttt ttccaccgcc cattgcgcca tcgccccgat cggcgcgaac agagacctgc    105420
     ccagcgttgt aatcgcgtaa tcaacccgcg gcgggattgt tggcgtcacc gtccggctga    105480
     ccagcccgtc acgctcaagc ttgcgcaacg tctgggttag catccgctgc gagatatccg    105540
     gaatcgcccg ctgcatttcg gagaaccgct gccctccgtc gcgcagcaac aggatgatca    105600
     aaaggctcca tttgtccccg atctgggcca gcacggtccg gatcgggcac aggtcaagcc    105660
     ccagttcttt ctcgatttct tcgcgccttt tcatgagccc tccaatattt tttagttact    105720
     aaaaagtgcc tacttacttt tagtaatcaa cttgaatacc catagctcac cgcccgaaac    105780
     cgggcaagca tcaattcaaa ggagaaccag atgatcatgt cacttcgcac cacttctgcc    105840
     gccgccgcgc tggccctgac cgcgctatcc gccgccgccg acagcgccgc caacaaggag    105900
     atcgccgttg gactgctgga gcagggattg gccaagggtg accgcgattt catcatgacc    105960
     catgtcgccg agggctatat ccagcataac ccgcaggccg ccgacgggcg tgaggggttg    106020
     ctgggttttg tcagcttcct ggaaaccctt gatccgccgg tcacggtcaa cccggtgcgg    106080
     gtcatcgcgg atgacaattt cgtcgtgatc catcaggagg cagagttttt cggtcccaag    106140
     gtcattatcg acgtgttccg ctttgaagac gggaagatcg ccgagcattg ggacagcatc    106200
     caggaaacgg tgacggaaac cgcaagcggg cgttccatga ccgatgggac gaccaaaatc    106260
     accgatctgg acaaaaccgc tgagaacaag gcgctggtca ctgggttggt caaggacgtc    106320
     ctgatgggcg gaaagatcga ccggatcgac gactacatcg ccgagggata catgcagcac    106380
     aatcccttcg tacccgatac ccgcgaaggg ctgaaaggct tcgtggccta tctgggcgag    106440
     aacaacatct cgttctggta ctcggagttg catctggtgg tggccgaggg caactttgtc    106500
     ttcacgcagg ccgagggcgt ttatgacggc acgccgaccg cgttctatga catctggcgg    106560
     atcgaggacg gaatgatcgt ggaacactgg gacacagtac agccgatccc gaccgaattc    106620
     gcccacgaga atggcatgtt ctgaaacggg ttcgtccggg gcgctgtagc gtgcgccccg    106680
     gatggtttcc agttgatcga accaggtgac ggcagtagcg caacacgagg ccactttccg    106740
     ccaggtcact ccgttgatga acaggagcga gttgaacctc tcccatcagt gatcaccctt    106800
     acgggtgcac cggcaacggt ttctgaaacc cacgccttgg agcaacgcag atcgatgcgg    106860
     accggtgcgg gcatccgacg cccagcagca ccgctaaagg atctggtgtt gctctccgct    106920
     gagaagtgac ccggtaggcc cataactttc cactgagatt tgacccatgt gcacacgctg    106980
     ccccgacgga atcggtcggg gagagaagga gtgatcgaca tcggattttg agtgttattc    107040
     gacgctggac attgcgtgaa aaaatgccaa tccgcgaaat ttcaagacgc aacgggctgt    107100
     ctcgcaacac catcggaatg tatctgcgcg agggcgcggt cgaaccgaat ttcaagacgc    107160
     catcgcggcc gagcaagctg gacccatacg cgatcggccc agaccagcca tctgcggtag    107220
     tcttcagcgc cgcaccgcag cttcaccaga ccggccgttc ctccatcttg cagcattttc    107280
     taagacttaa ggtcggcaga gtgggacatt gctgccgctc atcggcgaac accaaacggc    107340
     tggaaactca cttctggtgc atctgctcga ctgcgcacgc agcgcagagc cacttcacaa    107400
     aagccttcac cgcaggtcgg tcgaacgttt cgggtagcgc gaccgcatag taggcaaatt    107460
     tcgttggcca acttccgggc aagagctgaa caagccgccc atccgccagt tcttcgcgga    107520
     catagatgtc gttgatgaga gcgagaccct gccctcgtga ggcggctttc accgtcaaga    107580
     acccgtcctt gaacgcagtg ccgtatgacg gagcgaccgc gttcacgcga tgagcttcga    107640
     accagagcgc ccaatcaagc ccggtctcat cgggcaggag cgtgaagcga aggcagtctt    107700
     ccggctcttt aaccggatgt tgggattcca acagcgccgg gctgccaacg acgatcagtt    107760
     cgggagcaca tagccactca gatctgaggc cggcatagtc acccaaccca tggcggatgg    107820
     cgaggtcaat cggttcggat cgcaagtccg ccagccggtc ttctgtctcg atattgaacc    107880
     tgatccccgg atggtcctca ttgaatgacg caaggttcga gaccaggaag gaatgcgcga    107940
     aggtaggagc agcactgatg cgcaggatcg tttttccatc cttgccgatg tgtcggttat    108000
     gcgaagtttc gatctgagca aaggcgcttt ttacctcttt ccagagtgct ttcccggatg    108060
     ccgtaagcga aacgccgtcg cggctccgaa cgaacaggcg cttgccataa cggtcctcga    108120
     ttgatctgat gcgctggctg atcgcgcccg gcgtcacacc cagttcgtgc gcggcggctt    108180
     gcatcgcgcc ggctctggcg acgacaaaga atgtatagag atcgcgaatg ggcagcggca    108240
     tgcctgactt tagctgagct aaagcaaaac ggccagcttc tcgttttccc aagttttggt    108300
     agtccggcag aatgtctccg aaagggagac atcaatgcgc gcacccacca taaatcaaaa    108360
     ctggaccatc gtcctgttcg gcttcctggc tttgtcgctg gcgttttcgg cacgcgcggc    108420
     gcttggcctc atcatgccgg tctggcaggc ggagttcgga tggtcgagcg gctatatctc    108480
     cggtgttggc gcagcagccc tgatcgtcat ggctggtgtt gccccgtttg ccggacgtct    108540
     tgtcgataca agaggaccgg gccttgcgtt gaacctcggt atgggactgc tgggagttgg    108600
     ctgtgccgtc gttgccgcga tgtccagcaa gtggatgttc attgtcgggt tcgcggggtt    108660
     tggagcggtg ggtttcggca tcgtggcgac ccatgtcgtc gcgacggccg ttacgagatc    108720
     atttgacagg aatgccggtc tggccattgg catagcgact tctggcgcca ccggcggaca    108780
     gttcctcatc gtgccgttga tcgcagcact tctcgccttc gcgagttggc gttggagctt    108840
     cggagccttg tcggtgatga gcctggccct ggtcccgtgc atacgggcaa gccttccgcc    108900
     gcgcgtggaa actgatggag gtggggatgg ggacgcccgg accaccatgg cggcggattt    108960
     cgtcaccatt gtccgactgc ccgcatttca tatcctgttc tggagctttc tgatctgcgg    109020
     tttcacaaca acgggcgtca tcgagacgca cctcttgccc tttgcttcct tctgcggttt    109080
     tccaccggtc ccaagcgcga cggcttacgg tgttttgtca ctagtcaatc tgtttggcat    109140
     gatcgctgcc gggtggctaa ccgaccgcat gaaccgcccc ttgctgcttg gcgcgatcta    109200
     cgcgctgcgt gcgctcacct tcgtattcct gtcgaacctg ccgggtatgc ccatcgaaat    109260
     gctgttcgcc ttcgccctgt tctttggcgc ggtcgactac gcaacggtgc cggtgaccgc    109320
     cagtcttgtg gccagccatg tcgggctgaa ggtgatgggc cttgccatgg gaatgatctc    109380
     ggcaggacac gcaatcggtg gcgcgatggg tgccatggcc ggcggctatc tgttcgatca    109440
     aactggcaac tatgatctgc tttggacggc gtcattatgg ctcgcaatcg gcgcaggcgt    109500
     gatggttatg tttcttcggg aacgcgggcg gcaacccgcc ggtgcatagc acagaggtga    109560
     tatgggggat cgatgccgca gcaaatatcc aaggttctgg tcagcgcgtg cctgctgggc    109620
     caaccccttc attacaatgg gcaagcgttg tcacttgagg gcggtctgat accacgctgg    109680
     agggcgcgag gaataatagt cccgctttgc ccacagattg cggcggggtt tgcgacgcct    109740
     cgaccacctg cgaaaatcgt gccgggattc gatggtgccg atggaattga cgggcacggg    109800
     ggattgtcga gagcatcggc gtagacgtaa gggatttgca cggctaggac cttctgcctg    109860
     cggcagagcg tggaaaagtc gggaactggc gggcgtcccg accgaccgtc atgtggcgcc    109920
     cgccaggtca ggtccttgtc gatccagatc agcagcggtc ctcgcttgcg caaaggcgta    109980
     aggcccgtat cctgacagag gcagcgatcg accttgagtc ggctgcgagt atcgttgttt    110040
     acaagctctc acggaatgct gagcgcaatc tgcaatcgca ggtcagtttc tctgaaaacg    110100
     gtatgaagga attgtgggga atgcatgatc tcataacccg aaatctggaa cgcgcgttaa    110160
     cggtgctgac aacgggtgac gcgaatgttg cgcggcaggc ggctgaaacc aagggtcaaa    110220
     tccgagagct ggaacggcgc agccacaaac gccaccttaa gcgcttgcac gaaggcgtcg    110280
     ctgacggcca caacagcagt gcggcccagc tcgacgtgct ggatgcctaa aggaatcgaa    110340
     cgccaaaaat taccacgctg acctagcccg cgctcgcagc agatgggcaa ttgctggatt    110400
     cgcgtcttgt gcccctggac agactccaca gttaactctg tgagatgctc ttgaacagct    110460
     agccgcttcg gcgagtacct cacttcgaaa aaatgaccga tcccgcggga gcaagagggc    110520
     gaagagaagg atgcggctcg aaaccgtgcc tgaatgaggg gcattggcgc gaaaatgatt    110580
     ccgagtttct gagaaaagtg acccgtcaag cctcaagggt caaagcgcac taataatccg    110640
     tctttccttt aagtatctca cccaggacct cgatgcatgt ctggagcttg tccgggtcga    110700
     cattgccaac caattccgcg tggaaatcat tgataagtgg cgatatctcg gccagtttct    110760
     tctttccctt tctcgttaga acaaccgtcc ttttcctttg atcagcgtca gaaatcgacc    110820
     gggctgccaa gccttcatca accagctgat ctactgtgcg gctggttgtc gattgttcca    110880
     tcacacccag tgttgcgagt tggccgacgg tcagttcccc gtaggctgac agacttgaaa    110940
     gaagccgcag cttgggagtg ggcagcttct cgctggccag cgcctgattc agttccgagc    111000
     tccagatatg cgtgatcctg gtcagtagat acgggagaaa tgagttaagc tcgccgggtg    111060
     acccgtaggg gaaactcggc tttgggattt ttcgcgcctc agtcaaggct tgcacccgtt    111120
     tgcatcgatt caagtatccc acgcaatgcc gcgcttgcct ctaccatgtc ttggtcggaa    111180
     actgctctca atagctcagc gagaatacga ttgtgggctt cgctggcctg cttgaacgtc    111240
     gtgagaccag catcggtcag ctttgccgag aacgagcgcc gatcgtcggc agacatcgct    111300
     ttgacgacca ttccgtcctt gatcaaacgg ttcaccaggc ccgaaacatt tccgttcgtg    111360
     accttcaacg cacccgacaa tttccccata ctgaggccat cgggatttct agcaagctga    111420
     gccatggcat cgaacttggc gaggctcagt cctgtttcgt ccaacaactg tctgttgaga    111480
     tcaccgaaga ccaacccgtg caagcgcagg atgttcagcc aaagacgcgt ttggttctgt    111540
     tgccggtctg attttgtggc agcttcgccc atgaactctc aatgtgctcc aatcaatctt    111600
     tgtccaattt atatgcttct gcataggtca gcaatgcttc taggatgtca tcagggattt    111660
     cggtcgactg atgcgcatct agattggtcg tcactgttgt aagcgtcccg cgaaccgcct    111720
     cgcgctgatc cttcacgagg tgaaccgata gcgtgtaaga tttagtgccg atcttgtcga    111780
     cagcaacaaa ggcctcggcc tcgtcaccca tcatgaaggg tgtaaagaag gttgccgatg    111840
     cggcaacata ccccagcccg atacgacggc gcccgatcac gtcctggtag ggaatttgca    111900
     aggcgtcgtc gaaccattcc tcgattgccc ggttgaagac atcgaagaag tttggggtat    111960
     agacgatccc ggcgggatca cactggccgt ggcggaactt tgtcctggtc gaccacatgt    112020
     cgtccggaaa gtcgtccatt tcaaacggtc gcggggtatt gtgtgtcttc atggggtgca    112080
     cggtttcttt caaaaggatt ggattgtctt gattgttccg tcgaggttgt caccgtcccc    112140
     gtccttgaga gcggagcgca gcaatcgatc cgcccacatg gcggcatcgt cgcgctgcga    112200
     gatcgacctt atggtttgca tgactttgtc gaacttcgaa tgaccacggg cgtgggtgtc    112260
     cgaatagccc ttgatcaggc ggcgtacctt caggatcgaa acggcaagat cgtagttgga    112320
     ttgaagggca ccggtggctt ctgtcagcca tcgcgtccgg tgttcggtct cttcagcatg    112380
     gcgcaacgac cggcggcgca gacgcttcag cccggcaaga aaaaagagca tcagaaatcc    112440
     cgggagggag taggttcgaa cccgtctccc tttgtcgact ctgcggtcaa gccaggcgta    112500
     aagctcgcgc ttgcctcgca accaacccgc caagccagct ggaagcgccg aggataactc    112560
     ctccagtcgc ggatgcatga actccgtggt cccgaaaatc tgtccttcgg agagcttcag    112620
     atcatcttcg atgcgcctgc gccgttctgc ccgcgtcttg agatccgcta cacggaaaat    112680
     gtcgtcgtaa gccatcgcat tggccaggta ctttgccgcc gtattggtga aggtgaaccc    112740
     gcgattatcc ccgcctgcgg ctctgtcttt ttcggcgatc tccgcaagcg tttccaggta    112800
     ctcctcaccg taggctgcat cctgaaaatc gaccaccttc ttcaggccaa gataggccat    112860
     tgcctgaacc tcaaccggca gatcggtgcg gagacgttgc aaaagcgcgt tggcgcgggg    112920
     attggcaagt gaccggggca gggcggcggg cattgtgtct ctctgttcca acgtccccgg    112980
     agcttcgcct ttctcgccag cttcgacctg ggccacggcg gcgtcaaaag tgcgaatgct    113040
     ggccgcgaca cctttgccac ttttctggat gacggcgtga tagtcctcgc gcgggaaggg    113100
     caacgcgccc gaggctgaga ggcttccaaa gagggccgag gatatgacgg acccgttttc    113160
     gacggccatg cggttcatat cgaagacgat ccggcgcttg gcgacgatgc cgatcgcatc    113220
     cgttaccgcc ccgctgtcag cgatgccttc gcccggcgcc atcttctcta tcgtggacag    113280
     ggatcggtgg tcggaggcga tcagggtggt tcggtccggc gtgacgattc cgcgcaagat    113340
     cgagcgacca gcctccatgt attctgctgc tatgacgaca tcgacgtcgc caggtgtcgg    113400
     catttgtgcc agcacgggcc tttggccgtg ccggcccggt ttcatcatct cgacatagta    113460
     gatcgtcgcg ccggtgcgtt gtgcaacgcc gggtacggag gtggattgtg caatccaccc    113520
     ctgacattcc gccaattcca cgatccagtt agtcagcacg ccgccgccct gtccgcccat    113580
     ggcgacgatg gcgatagaca ggggacggtc tgtcgcgtcc gcttctggtc gcaatggcag    113640
     ctttacggta tcgtccttca acgtgcggcc tcctcaaagt tgacggcgcg ccgcgcgcgt    113700
     cgtttttgca gataggtgat tgcgggcagg gtgaaactcg acttgaacct gtcccatgag    113760
     cttgggttgt ggataacctc ggcgcggtag aaggaggggc agagcacggc cgcatccgcc    113820
     acctccccgc aattgccgca ggcaacacag gttgtatcga tcgaagcgac aggatcatcg    113880
     cgcagggggt cgtccagctc cttgaccgaa agagaggggc agccggacag ccgaatacag    113940
     gcgtgatcgc cggtgcagac atcttcatcg acgccaaagc gttccttgac cgtccgttta    114000
     ccggccttca gcgcctttgc aacttgtggc ttcacgcgcc gttgcttgtt cagcatgcat    114060
     tcagacgagg cgacgatgat ctttgggcct tcggcgtctg tcgtcagggc ctcaatcagg    114120
     accgcgcgca tccggttcac atcataggtg cggtcgatct ggcgcaccca tttggcacca    114180
     actcctttca cggcatcgac gatcgaattg ttcgtggttc gccgcttgtt gaaagcccgc    114240
     gacgacagga tgtcctgccc tcccgtggcc gaagagtagt agttgtcgat gatcaggaac    114300
     acgccgtcat gcttgttgaa gaccgcgtgc ccgatgccgc tggtcagccc gttatgccag    114360
     aacccgccat cccccatgat cgagatcgac cgcttggccc ccttgacatt gaacgccgcc    114420
     gaagaggccg caccgagccc gtagcccatt gttgtcgcac cgatattgaa gggcggcagg    114480
     atcgagaaca ggtggcatcc gatatctgcc gagacgtgat gctcgcccag ttcctcgaag    114540
     accagtttca tcgcagtgaa gattggccgt tccgggcatc cggtgcaaag ccccggcggg    114600
     cgtggcggga ccacgtcctt gagtgcggca acagccggat tggtcaggat cggcaccggg    114660
     tccggcgcgg gtgcacggtt tcccagcagg ctggcttcat agtcctccag gaactgcccg    114720
     ataccttttg tgagggccgt aaccgtgtag tcacccgcca tgggcaggta tttcttgccg    114780
     tgaacctctg tgggctttct aagccgcgaa atattggttg tgatggattg ttcgataaac    114840
     tccggctggc cctcttcgac gaccagaacc gcatcgaggc cctcgcagaa cgcctctatc    114900
     tcgctgggga tcgtcggata gcagacgttc atcacgtaaa tcggcagctt ggaattgccg    114960
     taggcatcgc tgaggccaag gaactgaagc gcccgaatgg tgctgttata catgccgccc    115020
     tgaacgatca gaccagtttt accgctcttg tcctttccgg tgggcccgaa gaattcgttc    115080
     aacttgtttt ccgtcacaaa gtcgatggcc gcaggcaggc gccgctcgat cttctcgacc    115140
     tcatgttcat aggcagcggg cggcaggacg atccggtcaa ggtcacgctt ggggctgttc    115200
     atggcgtcct tcagggtgaa gtcggggcgc acattgtcct tgcagacgaa ctcccccgtc    115260
     atgtggcagg acctgacccg cacctgaagc agcacgggcg tgttggaggc ctcagacagc    115320
     tcaaacccct tctcgatcag cccgaccatg cattcctgat ccgggcgcgg atccagaagc    115380
     cacatctgcg acttcatcgc aaaggcatgg gtgcgttcct gcatgatcga ggagccttcg    115440
     ccgtaatcct cgcccacgat caccatcgcc ccgcccgtga ccccgcccga cgccagattg    115500
     gcaagcgcat cggatgcgac attggtgccc acggtcgatt tccatgccac cgcaccgcgt    115560
     aagggataca tgacagaggc cgacagcatc gcgccggcag tggcttcgtt tgcagagctt    115620
     tggaagttca ctcccaggtc gtcgaggatg tcattcgcat ccgccaaaac atccatgaga    115680
     tgcgagatcg gcgatccctg gtatccaccg acatatgaga tcccggactg caggagtgcc    115740
     tttgtgatcg cgaggatccc ctcgcctcga aagacgtctc cctctcccag cttgagatgc    115800
     tccacttcct tggcaaacga acgttcggcc atctgtgcct ccaaaaatat atggaaatga    115860
     ataattttat atgtaaagta agtcaagaag tttcggatta atgatgaagc cccgaagcgt    115920
     cgagagtaag aaaaaaggtt gaaaaacatg caagtagccc gccccgatag cctggtttcg    115980
     caaattcttc cggcagttgc ggactatctt gattcgcctg caaagttgct gttgggcggc    116040
     acgtccaccg ctgcgtcgga tggtcggacg atggatgttt tcaatcccgc aacgggaaag    116100
     aaacttgccg aagtaccatg gggcggcgca gcggagatcg accttgccgt gaaggccgcg    116160
     caggcggcac tggaaggcga ctggagccgg atgcggcccg tggagcgcca acgcgtgctg    116220
     ctgaatctgg cggatctgat cgaggccaac ggcgaagagc tggcgcaact cgagacactg    116280
     aacaacggca agtcagtgat gttgtcgcga ttggtcgagg ttgggaactc gtccaactat    116340
     ctgcgttaca tggcgggctg gtccaccaag atcgaaggct cgacaataga tgtgtcgatc    116400
     gctgtgccac cgggcgcaaa ataccaggcc tacacgcgca aggagcctgt tggcgtggtt    116460
     ggggcgataa cgccgtggaa cttcccgctc aacatggcga tctggaaact ggccccggcg    116520
     cttgcctgcg gcaatacggt ggttctgaag cccgccgagg aaacgccgct gacgtcgctt    116580
     cgcttgggag agttgtgcct cgaggcgggc ctgccgcccg gagtcgtaaa cgtcgtttcg    116640
     ggaaccggag ccgaggcagg tgcagcgctc accgcacatc ccggtgtcaa caagctgacc    116700
     ttcacaggat cgaccgaggt cggcaagatc atcggcatcc aggcgatgcg ggacatgaag    116760
     cgcgtgacgc tggaactggg tggcaaggcg cccatggtca tgttcgacga catggacctt    116820
     gatcaactgt ccgaggcggc ccggattggc attctgttca actcgggtca gacctgctgc    116880
     gccggaaccc gcatctatgc gcagcgcggt atttacgacc ggatctgcga aactatggcc    116940
     aatgtggtgg gcgcgctgtc tgtcggttct gggcttgatc ctgccaacgc aatcaacccg    117000
     atggtatcgg ccaagcatca ggcgcatgtg tctgcctgca tcgcgggcgg cgtcgaagag    117060
     ggggcaaccc cattgctcga cacgggcgca tacgatggag agggatactt cgtcaggccg    117120
     caaatcttca ccgatgtccg ccaggacatg aggattatgc aggacgaggt ctttggtccg    117180
     gtcttcacca tcacaccatt tgatgaccca gacgaagcga tccgcatggc caacgacacg    117240
     cgctatgggc ttggggcgtc aatctggacg accaacctga acaccatgca tcgctatgtg    117300
     ccgcaacttc aggccggcac ggtctgggtc aattcccaca acgtgcccga cgcgaacatg    117360
     ccctttggtg gctacaagca gtcgggcatt ggccgcgaac acggtcgcgc cgcgctggat    117420
     gcttatctcg aaacaaaatc tgtctgcatc gcggtgaggt aaggccaatg accacgacac    117480
     agcacactcc caccccgcgc gacaactttc ttcgtgagaa caacgggcgt catcagatcc    117540
     acccgatgac ccacccgctg atcatcgaaa accgcccgcc acgcatcatc gtcaagggcg    117600
     aagggtccta tgtcacggat atcgacggca agacctatgt cgatggagtt ggcgggctct    117660
     ggaacgtcaa tgttggccac aaccggcccg aggtaaaggc ggcgattacc gctcagatgg    117720
     aagagatcag ctattactcc agctttgccg gcaccgtgac gccaccctcc atcgagcttt    117780
     cggccaagat catggagatg acagccgatg aggacatggc gcgggtcctg ttctcggcca    117840
     acgggtcgga cgctgtcgaa accgcgctga agctcagccg tcaatactgg aaactggaag    117900
     gggagccgga acgcaccggt ttcatctcgc tcaagcaggg ctatcacggc attcagtttg    117960
     gcggcacatc cgtgaacggt tcgacacttt accgctcggc ctatgggccg cttcttcccg    118020
     gatgctatca ggtcgacagc ccgtggactt accgcaaccc ctattccgaa gaccccgagg    118080
     aacttgccga ggcggtcatc acgcagatcg accggctgat ccagcatcag ggggcgcaca    118140
     cgatcgcggc cttcattgca gagccggtgc agggggccgg gggcatcatt gttcctcccg    118200
     caagcttctg gccccgtctg cgccaggttc tggacaagta cggcatcctg ctgatctcgg    118260
     acgaggttgt gaccgggttc ggacgcacgg gcgcgatgtt cggcgcgcgc gggtggggtg    118320
     tgaagcccga catcatgtgt ttcgcgaaag gtatcaccgc aggatacatc ccgctgggtg    118380
     cgacggtgat caatgaacgt gtctttgcag cctggcagaa gggcatcgac ccaacggggt    118440
     tcatcatgca cggctacacg gccacgggcc atgcgcttgg atgtgccgcc gccaatgcca    118500
     cgctgaagat tgtcgaggac gaagaccttc ccggcaatgc cgggcgcatg ggccagcggc    118560
     tcatggaagg gctcaaggac attcccaact ggtcgtcact cgtaggtgag gtgcggggca    118620
     aggggctgat ggtcgggctc gatctggtgg ctgacaaaga cacgcgtgaa ccaatcgacc    118680
     ccggcaaggg gcagggcgaa atggtggcga ccttcgcacg tgacgagggc gtgatcgtgc    118740
     gccccgccgg cccggtcatc atcatctcgc cgccactgac tctgtcagaa aaggaaaccg    118800
     acaagatcgt cgatgcactg atcaaggcgc tgcgccggta cgaggaggag aagtagagat    118860
     gcttccattg caggatttcc caaagttcac cgccgccgct gttcaggcca gtccggtttt    118920
     tctggatgca cacaagacgg cgcagaaggc ggttgacctg atcgcggagg cggcggggaa    118980
     cggcgccgaa ttggtcgttt tcccggaggt gttcatcccg ggctatccct attggaactg    119040
     gatcaccgat ccggtgacgg gcggtgcctg gtttgaaaaa ctggtgcggg cctcggtctt    119100
     tgccgacgga cccgaaatcg acgtgatccg cgatgcggca agggcgcatg ggtgtcatgt    119160
     ggtgatgggg ttgaacgaac gcagcccggt gtcgctgggg gcgctttaca acactctttt    119220
     gttcatcggg ccggatggcg aggttatcgg caagcatcgc aagctggtgc ccacatgggc    119280
     ggagaagctg acctggaccg gtggggatgg gtccagcctg aaagtctacg atacggccat    119340
     cggcccgttg ggcgggctgg cctgcggcga aaacaccaac acgctcgccc gtttcacgct    119400
     gctggcgcag ggcgagttgg tgcatacggc cagctacatt tcgctgcctg tggcaccgcc    119460
     ggattacgac atggccgagg cgatcaagct gcgcagcatg tcgcacagct tcgagggtaa    119520
     ggtctttaca gtgaccgcca cctctacggt gtccgaagag atcatcgagg cgatggagca    119580
     ggtccgcccc aatgcccggg agttgctgca gcgcaagtcc agtgcctatt ccggcgtcat    119640
     tggcccggat gggcgcgagg ttgtcaccgg gctgatcgac gacgagggca tcgtctatgc    119700
     cgagatcgat ctgggcaaat gcattcagcc caagcagatg catgacatca ccgggcacta    119760
     caatcgcttc gacatcttcg atctgagggt gaaccagaga cggcagaccc ctgtcgccct    119820
     ttccggcgcc gccgtcacat tcaccaacga acacgaacag gctgacggtt ctacggaacc    119880
     ggccagcgag tagacgcaag gaggtaaaag gatggcaccg accgagatca aacccgaaga    119940
     cgatatcctg ggccgcgccc gggtccgcga cacgccagag ctcgaggcct attacgacga    120000
     tctggccaag atcgagacgg gcgcgctctg gaccgtggcc aatgacatcg agccatggga    120060
     gccgaccccg aaatccgccc cggtgcactg gaagtggtca gatcttcggc gcgaggtgtt    120120
     gcgcgcgatc gaccttgtgc gccccgagga tgcgggccgc cgggtggttt acctgcgcaa    120180
     cccgcagcgc aaggatgtga gtgctgcctg tggctggctg ttctcgggca tccagaccat    120240
     gaaggccggc gagcgtgcgg gcgcgcaccg gcacgcggct tcggcgctgc ggttcatcat    120300
     ggagggatcg ggggcctata cgatcgtgga cgggcacaag gttgaattgg gcgccaatga    120360
     cttcgtgctg acgcccaatg gcacctggca tgagcacggc attctggaaa gcggcacgga    120420
     atgtatctgg caggacgggc tggatattcc gctgaccaac tgcctggagg cgaacttcta    120480
     tgaggtgcac cccaacgact accagaccac cgacatcccg ctgaacgaca gcccgctgac    120540
     ctatggcggc ccggcgctgc tgccgcagtt ggacaagtgg gacaaaccct attcgccgct    120600
     tctgaaatac tcctgggagc cgacctatga ggcgcttctg aattatgcca aggccagcga    120660
     cggatcgccc tatgacgggt tgatcctgcg ctacacgaac ccacagaccg gcggccatcc    120720
     gatgctgacg atgggggcct cgatgcagat gctgcgaccc ggcgagcaca ccaaggcgca    120780
     ccgtcacacc ggcaacgtga tctacaacgt ggccaagggg cagggctatt cgattgtcgg    120840
     cggcaagcgg ttcgattggt cggagcacga catcttctgc gtgcccgcct ggacgtggca    120900
     cgagcactgc aacacccaag agcgcgacga tgcctgcctg ttctcgttca acgactttcc    120960
     ggtgatggag aagctcggct tctgggcgga acaggcgctt gaggacaatg gcggtcatca    121020
     gatcgtcgcg gactgaacac gaaggaaaga acaatgaaac tcgtaactta tcgcgatagt    121080
     gccgccggag aaggacgcct tggcgtcgtc gtggatggac aggttgtcga tgtcgaatgg    121140
     ctgggcgaag ctgcaggcga agccctgccg gacagcatgc tcgatctgat cgacatgggg    121200
     ccggatgcgc tggccgcgat cacccgtgcg cttgacgcga ccaacgccgc gcgccccgcc    121260
     gggcttgcag tgcccgagga gaacgttcgg ctgctcgcgc cgatcccacg cccgcgcaag    121320
     aacatcttcg gcatcgggct gaactatgtg gaacatgtcg ccgaaagcgc gaaatcgctc    121380
     gatacctcca aggagctgcc gaaagagccg gtggtcttct ccaagccgcc caccagcgtg    121440
     atcgccagtg gtgaaggcat ccagcacaac gccgccatga cccaacaact cgactgggag    121500
     gtcgaactgg ccgtgatcat cggcaagcgc gccacccgga tcgccaagga taatgccatg    121560
     agccacgtct ttggctactc ggtcatcaac gatgtctcgg cgcgcgacaa ccgccgtgcc    121620
     gggcagtgga tcttctccaa gggtcaggac acgttctgcc ccttcggccc ggcgatcatc    121680
     accgccgacg atgtgccgga cccgcacaac ctcgacctct ggctgaccaa gaatggcgtg    121740
     gaaaagcagc gctcgaacac gcgccatctg ctcttcgata tcccgacgct gatcgcggat    121800
     atctcgtcgg gcatcacgct ggaacccggc gatatcatcg ccaccggcac gcccgcaggc    121860
     gtcggcgcgg ggcgcgatcc gcaggaatgg atgtggcccg gcgatgtgat cgaatgcggc    121920
     gtcgacggga tcggcgtgct gcgcaacccg gttgtgaaga tcggagactg acatgagcgc    121980
     gatacaggac aacatgcaca agaccctgcg catcgggcag atcgtgccct cgtccaacct    122040
     gacgatggag cgcgaaatcc ccgccatgat gcgtgcccgc gaggcgcaat tccccgagcg    122100
     gttctcgttc cattccagcc ggatgcggat gaagaaggtc accaaggagg agctgaaggc    122160
     aatggaccac gacagcgacc gctgcgcgct tgaactcagc gacggcgcgg tcgacgtcat    122220
     gggctacgcc tgcctggtcg caatcatgtc gatgggcaag ggataccacc gcgaaagcca    122280
     ggcgcggctg catcaggtca cggtagacaa tggccacccc gcgccggtgg tcagctcggc    122340
     cggggcgctg gtcgatgggc tgcatctgat gggagcaaag cgcatctcga tcgttacgcc    122400
     ttacatgcgc ccgctgacca acttggtggc ggagtatatc gaagccgaag gcgtcgaagt    122460
     ctccgacagc atcgcgctgg aaatccccga caacctcgaa gtcgcggcac aggacccgac    122520
     aaacctgctg gaaatctaca agcgggtgaa cctcaagaac atcgacgcgc tcgtcctgtc    122580
     ggcctgcgtg caaatgccat cgctcgcggc aatccagaag gtcgaggacg aatgcggcat    122640
     tccggtgctt tctgcatccg ttgcaacgac ccatcagatg ctcaagtccc tcggtctgca    122700
     cgccgaggtg aaaggatgtg gtgctttgtt gtcgggggca tacgcctagc tcgggaaaaa    122760
     atcattcttc tagggaggaa aagaccatga ccagattgaa gacttttcag gagctttttc    122820
     gaagagaccg caggccggga gacctggttt ttgcctacat cttccttggg ttctgcctgt    122880
     tccttctgtt caaccttcgg gatcaggcgc aatggctgga caatgccaag actgttgccc    122940
     agccggcgtt ctggccgacc gtcgccgttg tagggatgac cctgttcgct gggctgcatc    123000
     tggtcggttc gctggtatct ccacgcattc ccgggcgcct aaaggaaggg gcattctgga    123060
     tccgctccgg tgaatatgtg gtctacttcc tgatctatgt ctggtgcgtc ccgatcgtcg    123120
     gctacctgtt gtcgacaatc gtgttcgcgg tctttctgac aatccggctg ggatatcgca    123180
     gcaagcaagc ccttggtttc gcagcgttct tcggctttgc ggtcgtcctg gtgtttcgcg    123240
     caggactgca ggtgaaaatc ccgccgggac aaatttatga acatctgccg gacgccattc    123300
     gcacgttcgc catggtctat ctgtgagggt ctgaacaatg gaagctattc ttggtggaat    123360
     tcaaatcctt ctgtcatggc aggtcttggt tgctttgctc gtggggtccg tcggtggcgt    123420
     gatcatcggt gcaatcccag gtgtcggagc cgccgtcgcc attgcaatcc tgctgccggc    123480
     caccttcgca tttgaaccaa ttgtcggact gacgatcctg ttggggatct acggcagttc    123540
     gatgtacggc gggtctatcc ccgcgatcct gctcaacacg ccgggtacac cggtcaacgc    123600
     cctgaccacc tatgacgggt atccgatgac caaacgcggg caggcgcatc gggcgctttc    123660
     gcttgcctat tcggccagtt tctttggcgg gatctttgcg atcatctgcc tgatattgct    123720
     ggcgccggtg ctcgcatgga ttgccccgaa tttcgggagc cgcgagatct tccttgccgc    123780
     ccttctgggc atcatactgg tgatcctggc ccatcgcggg cagatcatgg cggcgggcat    123840
     gatggcgttc ttcgggatat tcctgagcac ggtgggactt gaatccgcca agtacaccca    123900
     tcgtttcacc tttggtcagg attggctgac gggtggcatc aatctgattg ttatcgttct    123960
     tggcctcttc gctgttagtc aggcgttgat gctcttgctt gagcaagaaa aggagccgga    124020
     atcggctcgc gtcgagggaa gtctttgggg cggatttgcc gagttgttgg ggctgaaacg    124080
     ggtcgcgagc gtagcatcga gcctcggcgt gatgatgggc actattccag gcgttggtga    124140
     gttcacagcc cagttcttgt cttacacata tgcccagaag acttcgaaga caccggaagc    124200
     ctttggcgac gggtctcccg aggggctcgt ggcgtcggaa tgcgccaata acgcggtgcc    124260
     tgcggcggcc atgattccgc ttttggcgct tggtgttccc ggcgaagcgt tgacggcgat    124320
     gatgctgtcg gtcttctacg ttcacaacgt cattccgggg ccgcaactgt tccagaatga    124380
     actggacttc gtgatggccc tttatatggc catgcttttg ctgaacgtga tcgtgatcat    124440
     cttcctgctg tcatccacaa acctgctgct gaagatcacc cagattccga cccggttcct    124500
     gggcatgatg atcctggtgc tgagcttcgt cggggtctac tcgatgcgga actctgccgt    124560
     tgattgcgcg atggcggcgg gtttcgggat attcggcctg atcctgaagc gactcaatct    124620
     tccgattgtg ccgattattc tcggcgttgt cctcggggcc atcatggagg tcaaactccg    124680
     cagcgcgatg gcgcggatcg aagagccgct ggattggttc aatcgtccga tctctgtgat    124740
     cctgatcctg ctgatcctgt tcgtgatcgg aaatcactat cgggcgctca ttcttgagca    124800
     caggtcgcgt ctgcagaagg cggccgatgg tgaacccgaa gatgcagccg aaggcaaggt    124860
     tgcccccgag gggttctgac tttgagtcaa tgtctatgca aatgcgaagg tttacatata    124920
     aaataaaatc ctgtatcatg tttgcgaaga ccaataacca aggatgcgcg gcacaaagac    124980
     cgcacatcca ccagccgaca gagaggacgt ctgaatgaaa aagctatttt cagcactagc    125040
     gcttggcgca agtttgatgg gaaccgctgc ggttgcggaa tatcccgaaa aaccggtcga    125100
     gtttgtcatt ccattcccgc cgggggacct tgaggacctg ctgacgcgga tcatcgccga    125160
     tgagtttcag gacacctatg gtgttccggc cgcggtcgtg aacaaaccgg gcggcggcgg    125220
     cggccctttc ccgggagcgg tgtcggtcgc aaacgcgccg gcggatggct atacgatcgg    125280
     gtcttttgtg atcggcgtcc cggttgtcgg gcccacaatt ggtattccgg atttgcagcc    125340
     cgaccccttt gaacccattg gcatcttcct gacctacccg tttgtcgtgg ccgcgaaggg    125400
     cgatgccccc tattccacga tggaggagtt ggccacccat gcgaaggaca acagcgtcct    125460
     gttcggacac ttcggcgaac gctcaattcc gcgccgccac atgatcgcag tatcgcggca    125520
     gcttggcttt gaattctcgt ccgaggccgc gttcgatgcg ctggattgca acacattggc    125580
     atcgggtgac gctgacgtga tctcgacgac ggcacagctg atcttcccgt gcctcgacaa    125640
     tctgaaaatc ctggcctcgg cgacgaacga gcgtatctcg atcatgccgg atgtgccgac    125700
     gatgggagaa atcgcaccag aactcgacct gtccacctgg aacggtctgt ttgttcacaa    125760
     ggacacaccg gcagacgttc gggagaaaat cgaggcggtt gcgatcaagg ccttgaattc    125820
     cgatgcagcg aaagaacttg cggcgaacac cggcgcggtc atctattgga agtctgcaca    125880
     agaggccaaa gctcagatcg aaagcgatat caaggtcctc aagatcatcg acgatctggt    125940
     tgcaggcaac taaaccggat gccgccgggt tcgtgctcgg cggccttttc atctacaggc    126000
     acggaatcca tgacccaaaa ccgcaacatt ctgtggatca tgtgtgacca gctgaggttt    126060
     gattacctca gctgttatgg tcatgagcgc ctgaatacgc caaacatcga caagctggcc    126120
     aagcgcggcg tgcgttttac caacgcctat gttcaggcga cggtatgcgg gccatcgcgc    126180
     atgtcggcct ataccgggcg ttacgtgcgg tcgcacgggt ccacgcaaaa cggtatccca    126240
     ttgcgtgtgg gggagccgac attgggtgac catctgcgcg atgtggggat gcggaatgtc    126300
     ctgatcggga aaacccatat gcgccctgat ctggacggga tgaaacgcct ggggatcgac    126360
     ccggactccg aaatcggtgc gcgcgttggc gaaggcgggt tcgacgcctt tgaccgggac    126420
     gacggcgttc accccaccgg atatcgcaag aaagaaccgg cctacaacga ctacctgcgc    126480
     catgcaggtt ttcaggccga aaacccctgg gaattctggg ccaactcggc ggaaggcaag    126540
     ggtggagaaa accagagcgg atggttgttg acccatgccg acaagcccgc gcgtgtgccc    126600
     gaagagcatt cggaaaccgc gtatatgacg cgccgcgcga tggagttcat ggaggcggcg    126660
     gagaaggacg ggcggccttg gtgtgcccac ctgtcctata tcaaaccgca ttggccctat    126720
     atcgtgcccg cgccctatca tgacatgttc gggcccgatg acgtcaaacc tgccgtcagg    126780
     agcgacgaag aactgaaggc cgcccatccg ctcttcaagg cgatgacgga agaagtctat    126840
     tcccgcaact tcgcccgcga cgaggtgcgc gagaaggtga tcccggccta catggggctg    126900
     atcaagcaga ttgacgacca attggggcaa ctgtttgcgt tcatgcagga acggggcctc    126960
     gatgagaaca cgatgatcgt tttcacggcg gatcacggcg attatctggg cgatcactgg    127020
     atgggtgaaa agtatctgtt ctacgaggcc gccgcgaagg tcccgctgat catctacgac    127080
     ccttcggaca aggcggatgc gacccgcgga acggtttcgg atgctctggt cgagatgatc    127140
     gaccttgccc ccacattcgt ggactatgcc ggtggcgtgc cgcccatgca tatcctcgaa    127200
     ggcaagtctc tgttgccgct tttgcacgac gacgacagtt catgggaccg acagtatgtg    127260
     ttctcagagc tcgattactc gaaccttccc gcccgactaa agctgggtcg cgacattcag    127320
     gattgccgcg cgacgatggt tttcgacggt cgctacaagt tggtcgaagt catgggcttt    127380
     gcgcctatcc tgttcgatct tgaggtcgac ccggacgagc tgaaggacct gggccgcgat    127440
     ccgtcggcag aagaggtccg gcaacgtctt acctccgcgc tggatgcatg gcaccgcaac    127500
     actcggcagc ggattacgaa aagcgacgcg gcctatcggg ccttggaccc ggttcttcgt    127560
     gaaagtgacc cggatctgat ggcgggtgtc atcatcggct attgggacga agacgaggtc    127620
     gaggccgaaa aacgcaggat cgcgcgcatt cttggtgaaa actcgtagga gctgtggtca    127680
     ctggccagga cagcggggaa cgctttccag taagatgcag gatcgcgcat gatttatctc    127740
     agtgacaatg tgccatttga gcccacagaa ttctccacac cataacctcc tgatttcgct    127800
     ggtgcagaaa ctgtcgcaaa aatcacttgt tgggccaaga catccaaggt cggctgtgcg    127860
     ggacattgct gcccttcgga cttttgttac gaatgtccac tctctggcgt tcgcgaccgc    127920
     ggcgaaaagc atttggacgg gtaccggata ttcgctgcaa ctcataacct aattgggacc    127980
     aagacagaaa gaaggcgttc acagcattga ctcccgggtc ttttaagacg gcgcaaccgc    128040
     acatttccgc cgcccaaggg ctctgttgca caaatcagct gagggccggg cttccccttt    128100
     ccccggacag agtcatccca tagcatctgt gatgggcgtg ccgagcgcgg tgaagccgtt    128160
     caggacggca acacggagct ggaactctgc gacctgacgg tcgaagtccc gcgcggtcag    128220
     acgctgaccc aggagcttga cgcagtgcat cttggtctcg gcccggcttc gtcggtgata    128280
     gccgctccat agtcgccaga tggtccgccc gacgcgcttc gatgtccgaa ggatctcgtt    128340
     tcgtgcgatg gccccggcgg tgtcgggttt ccacggcttg gcgttcttgc ggggcgggat    128400
     gattgcggcg gcccctcggg cggcgatggc ttcatggcac ttgcgggtgt cgaaggcgcc    128460
     gtcggcggtg acgctgccga tctcttgctc gggcgggatc tggtccagca gttcgggcag    128520
     catgggcgca tcgccgatct cactggtggt gaactcggcg gcccggattt ccaaggactt    128580
     ctcgtcaatt ccgatgtgga tcttgcgcca gacgcgccgt ttcgtgccgc catgcttgcg    128640
     ggcgttccac tcgccttcgc cctcgacctt gatccccgtg ctgtcgatca aaaggtgtaa    128700
     cgggccgtct gatccgcgat aggggatatt gaccttcagg gtcttttgac ggcgcgacag    128760
     cgtgctgaag tcgggcaccg cccagtccag gtcgatcagg cccaaaaggc tctcgacgaa    128820
     ctcggttgtc tgcctgagcg ccatcccgaa cagaaccttc atcgtcaggc aggtctggac    128880
     cgcagcatca ctgtagtcgg gctgccgccc gcgcttgccg gttggcgcgg cgtcccaggt    128940
     catggcgggg tcgaaccaga tcgttagcga gccccggcgc ttgagcgcct tgttgtaggc    129000
     cggccagttc ctggtcttgt aggtaggagg tgtcggtctg ctcatgcctc acagctacca    129060
     tgctggattc acgagatgaa tccctcacgg atttgtgcaa cagagccccg cccaaggata    129120
     aactctcggg aaatttgcca atactttcga tcgatgaggc cgtcggtttc ggcttactcc    129180
     agtacctagc gcagcaggct taacaagcac gacctcgtag cttatacatt tggagttagt    129240
     tatttagcgc cggttcagtc aactggcaga aattttgcgg cggcagtttc ggtgcctgcg    129300
     ccccggacag tccgcagaga tggctttggg tggcatgaca aaaattacat ggcaaagcag    129360
     cgaatccttc gaggttgaag aagccggaac ccaccatgtc aggcgcggcg gtctaggaca    129420
     gggggccgac gatcccctga ccggcctctt cgcgcagccg gaagtccgga aagtcttcga    129480
     agtcgtcgaa gcgcagcggc acgtcgtccg tccgaccaag cgctccgccg ggccgaacga    129540
     gatcgcggtg cggctggatg tggacgacgg ggcggactat atccttgccg ttcgacatcc    129600
     ttcgggggcc attcagttca tcggcggcca ggaaataggc gcgggcggca agcggtcgaa    129660
     ttcggccctg cggacgcggc gcaccaggaa ttacgctatc gaattccgcg cgccgatttc    129720
     gttctacgcg gagaaggatg tgcgcagggg catcgtcggc gacatcaaag acgccgtggt    129780
     cgatgcgatc gtcatcaagg tcaaggactt catcgcgaag aagaccgtgg accttgccga    129840
     ggccgcgatc tggaaattgc tgggacgcga accgggcatg aaacagcttt ccatcgaaaa    129900
     cgggcgactg aatctggcgc ccgtgtccgg acggattaag cccggcccga acgggcgggc    129960
     gctcttgttc atccacggca cattttcgac caccgacggc agttttggcg atctggcgag    130020
     tgccgaattc tttggcgaac ttgcgaggac ctatggcaac gccatctatg gcttcgacca    130080
     ttattcggtc agcgtcacac cggagaagaa tgcaagcgac atcctgaaaa cgctgcccag    130140
     cggcggtatc gactgcgatg tcgtcaccca ttcgcgcggc ggcctcgtcc ttcggacact    130200
     gaacgagcgg caaggcgatc tgtcccaggg caaacgcttc cgacttcaga gggcggccct    130260
     tgtcgcctgc ccgaacgagg gcacccaact agccacgccc gaccgctggc agggcaccct    130320
     tggctggtta gccaacctcc tcgatctctt tccgcccaat ccgataacct cgaacgcggc    130380
     tctggtcatg cattgggtca cctggttcgc caaggtcggc gtcgccgccg ccgagggctt    130440
     ggacgcgatg aacatgaccg gcgcgcagat ccggcaactc caatccccgc cctctccggc    130500
     gcccgggcaa tattccgcgc tggtgtcgaa ctgcgaaccc aacggcaagc tctgggcaag    130560
     ggcgctcgat ctaggcatcg actggttctt cgacgaggcc aacgaccttg tggttccgac    130620
     ctccgggggc tggcgcatcg accgggtgcc ggacttcatc ccgaaggatc agatcggcgc    130680
     ctacggcccc ggcgggaata tccccgcagg cccgcgtcag gtgacccata tcagcttctt    130740
     cgaccgagcc gagacgctgc agttcgtgct gcgcgccctt tccggcgcac ctcaacacct    130800
     tccagagttg gacttggcac gggcgctgcc ggtctcgcgc agcgccgacg gtgccgtgct    130860
     gccagccatg gcagaggagg tggaaccgca ggtcgcagag ttgcccgcgt ttgagaccgt    130920
     gctgcaccgc gcggaggccg ctgcgccccg gaaggctccc gcgcggcggc ttgcggcgca    130980
     tcccaattca tcggtcttcg aacttatcgt gctcgacccc gagcagatca cccggatggg    131040
     ttttccgcgc gtcgaggagg aagaggccga agacggtcac ggcacgccgt ttctctatgc    131100
     cgcgtatggc ggtgcccgcg tcatggtgcc cttctactta aaaaaagcgc atctcccacc    131160
     caagacgggc aacgaaaccg aggacaagcg actgaaatcc atggcggccg agatgggcca    131220
     gagatggggc aagttgttcg gctttcaccg gcgggtgcaa agcgtcctcg atggcaatcc    131280
     gcgcgccaga gaactgagcc cggatgaact acgcatcttc ggcgaactgt tgttcgaaac    131340
     gctgttgccc caggaagttc gccgactgta cgacgtcgcc cgttcacgag agcacgacaa    131400
     actgttcgtc atcttcacct cgatgatcca ctgggtcttc gacatgcctt gggaatttgc    131460
     tcgcgacccg gaacgcggca cctatcttgc caccgaggac gtgcatttca tccgcaacgt    131520
     cctgacacag accccggtcg aaaaactgag cccgcgggaa agcctgaaga tactgatcgc    131580
     aacctcagaa ccacgagatc agagacgggt ctctgcgacg gaagagattg ccaagctacg    131640
     caaggcgata accgaactgc agcgggacgg gcttatcgaa ttcgaaatcc ggaagaatgc    131700
     gacgccgcgt aacctgcacc acgaaatcgc taccggaaat tacgacgtgg tccacttcat    131760
     cgggcacggt tactggaaca ctaaatcggg tgaatccggt ctggtgctgg aggacgagac    131820
     cggcaattct aggcccttgg gagggcggcc cctgcgcgaa atcctgtcgg gccggggcat    131880
     tcggctggtt ttcctgaacg cctgcgacac cgggcgcagc cgccgcgctt ccggcgtgga    131940
     aacaacctcg ctggctgggg tggcgcaaga tctgttcggt cgcggcgtgc ctaatgtcgt    132000
     ggccaaccag tttccggtcg gggacaatgc ggcggtcgcc ttcgcgcgca cgatctacga    132060
     ataccttgcc cacggcaaga cgatcgcgca atctgtccgc gaggcgcgga tctcggcaaa    132120
     ctacgagaaa gacggtcaaa gcatggattg ggcgatcccg gtggcctatg cacgcgatcc    132180
     cgaggaccgg ctggtggtgg aaagaaaggc tgcggggggc gatggtcttg gctgacgcct    132240
     ttcgcctggc tcaatgcaag gtgttcacgg gatgaggttt cgtgtttttg cggttctgtc    132300
     gtttgcggtg cttgttgcgc tggctggcac aggtgtgccg caggcgcaat ccgtttcgga    132360
     agctccctac agcatctcgc gctttcggct cgacgatttt tccaccccga tactgcaccg    132420
     gaacgaaacg gcgtccggtt ccctcgagat atttttcgta gtcccgcaat tccaggttcc    132480
     cgaaggcaag gaacgccagt ttctgaccga gatggtcgac aattactggc gcggtcttgc    132540
     cgtggttccg ggatccggca ccgcgccggt tggtatcgtg tcgtccgcca acagtgtcgt    132600
     gttgtccgcc aacaatacca ccatggagtc gatcaagacc cactcggaac tcgtgtggaa    132660
     cgtggaatcc tttggcgacg ttcaggtctt gggcgaggaa gtcgccgcgc aagacggcgt    132720
     ttcgttgtcg ctgttctacc aggccgtccc cgtcagggtc gttcaccgga gcgataccaa    132780
     cgcggatccc tcgtcgatca cgcgcgcatc gaacgcgata agcctgcaat accgagtatt    132840
     tgacaacacg aagctcggcg cattgatcgg cggtttcgcc ggcctgcttg cggcgtgggt    132900
     ttatttctac cttcggacga tccggcggat tcgcgaccgc ggcagagctt ccctacgatt    132960
     gcaggaactt cagacccggc tggagaaggc cgaactcagg gccgagcgtc tgaccgacca    133020
     gccggaacgc caatcgacga gcattccgcc cctcgacgtg ccgcgcccgc ccgtgcctcc    133080
     ggccttgctg gacgccctgg cggacaagac ggcgatggtc gccttcggct cgggggcttc    133140
     ggcgcaggcc gggctgccaa cctcgcatga gctgattctg cgtctcgtgg acaggttcga    133200
     cacgcagata tcggaccggc tgcgccagaa catccaatac gccacaagcg ccaatgagga    133260
     gggcgtggtc gaacccgacc gcttttccgc gattgtcgaa gccttgagcg atcaggtctc    133320
     gcgcccggcg ctgatcgagg cggtgcagga catcttcgcc gatatgcggc gcaacaccgg    133380
     gttttacgag acgctttcgc gaattggctg gtcgggcgcg ttgtccctgg tctgggacga    133440
     catggccgac gagaatttcc tggcggccaa tccgccgttc ctgcggttga accccgaaga    133500
     cacggatgaa atgcgtcagg caatcaaggc gggcgagaag ctgcttctgc gcggatgggg    133560
     cgggctgacc gaggccagcg gtgagaacat cgtgctgacc ttcgaggaat tccgaaagct    133620
     cctggaagaa cgcccggaat tcggccgtca actgacgctt ctcttgcaga cacggacctt    133680
     cctgttcctg ggcctcagcc cgatttcgct gagggaatac ctgaccgccc tgaacccgta    133740
     tctggaagtc acgcagggcc gccatttcgc gcttgtcccg gcatcctacg agaatgagtt    133800
     gtttgtccgt ccgctcgagc aatacgggat cgagcttctg gaatacgacc cggccggcga    133860
     ccacgcgcag gtaaagaact tcatcgacga cctgcttcag caggcgcgga accttggcca    133920
     ataccggcag cccgaggaag atcgggcgaa ccctctagcg tggcagccgc tcacgcgact    133980
     ggaactggaa aacatcggcc ccttcaatac gcttgagatt gaccttccca cgggccgaat    134040
     accgaatgac acagcggaag tgcatggcga gccatggacg atcatcactg gcgaaaacgg    134100
     aatgggaaaa accgtgatcc tgcgggccat tgcgctggtg ctctcggcca gcgatcccct    134160
     tgtcgccgcg cgggcggggt cacttctgaa actgggcaag caaagcgggc gggttacgct    134220
     gagtgtcggc acacgaaaga tcgaggtgcg gctggtgaga gaccggaagg tcatcgtcac    134280
     gtcgcggcag atttcgccac tcgccgcagg acagtttctg gtgcttggct tcccggcgct    134340
     tcgcggcgcg ccaagcggcg aaccggcagg accgcgcgaa cttgacgagc agccgcccgg    134400
     gccgcaggac gtctatcccc ttgttctggg cagcgtcgat gaccggatgc tcaacctgaa    134460
     acagtggatc gtgaacgtgc ttagcgcagc gcgcggcggc gatgcgaaga accggcggct    134520
     ggccgagact ctggattcga tagtatccca gatcatgccc ggcggtgtcg tcggtttcgc    134580
     gccgctgtcc gaagccaacg tccttaagct ctcaatccgc acgccgggcg acggcggtgt    134640
     cgaacgcgag gtgccgttcg agcagctcag ccagggcatg tcggcgatct tcaactgggt    134700
     cggggttctg ttgcagaggc tgcacgacat ctccggcgag gacgaagacc cgtcaaaggt    134760
     cgcggcgacg gtgattgtcg acgagatcga cgttcaccta cacccggaat ggcagcgccg    134820
     tgtggtgacc ttggttaagg atattttccc gaacgtgcaa gtcatcgcct cgacccattc    134880
     cgccctgatc gtgtcgtcgg tgacggcaga cgaggtacgg attttccgcc gtatcgacga    134940
     tggggagttc cagctagtcc ggcccactcg cgagacctat ggtcgaagcg ccaccgatct    135000
     gatgcagggc gaggcgcttg gggtccaaaa cgccagaacg gtggatttcg acgaaaaggt    135060
     cgttgagtat ctggaccttc ggaagcttgc ctcccgcaac cccgaccagg aagaccgata    135120
     ccaggatttg cgcagcgaac tgcaagacgc caattgggcg ggtatttccg aagaacccgc    135180
     accggtggtg acagcggaag acattcagcg tttgagtcag aagtatttct aggtaaggca    135240
     tcgaaatgca caggcttgat ccgaactaca caagcgaggc gctgaagaag ctgatagaaa    135300
     tcggtcagga aaaagccaag gaactgatcg atgccttcga agaagacccg gcttcggtgg    135360
     aggtcggcac gttctatacc aaattcaagg acgatctgat tgcgtgccaa aatggcaact    135420
     gcgcttattg cgaacagctt gtgtccggcc atcccggcga cgtggaacac taccgtccga    135480
     agaaccgcgt cacgctggat tccgggaagg tccttacgat caagcacccc aaacatggcg    135540
     agatgaatca tccggggtat ttctggagag catatagctg ggacaatctc tttctgtcct    135600
     gcggtgactg caacaaggcg cgttaccact ccgaccaaga cggcaggacg aaattcggca    135660
     aacaggatcg gttcgacatc ttgggaaaac gagccgttga tccatgtgac gacctgaacg    135720
     acgaattacc gctattggtc catccggtgg atggcgaccc gcagaaggac ctcacgctgg    135780
     acggcgagaa cctgtatcag gcgcacaacg accgcgggca atacaccatc gaccttcttg    135840
     gcctgaatcg ccgcgcggac ctgatcgagc gccgcagcgt cgcattggag cgcggccaat    135900
     tggtcgtctg ggaattcctg gatgccgtaa agaacgaaaa ggcgaagaag cagatggaga    135960
     aggcggaact gcttcagaag atcatcgacg ggtccatcga gttcctgtcg gcttaccggc    136020
     ttggattgtt cggcgaattg aagaagctgg atgacttagg ggtcgacctg aaaatcggtg    136080
     agttggtcca gaaagtccta aagaccggag gcgatccatc agcagatgcg ccgcggtgat    136140
     tgcccccgcg caacgccgac ttttttgtcc acgacctcac acgcgtgaat ttccggaata    136200
     tcgtaccgcg gcgcgacaat cccaagtctg attgaaaaac ggcttcggga agaccttgcc    136260
     aaggtcaatg tcggctttag atacttcgct gcactttgta caagatgcag cattcgacac    136320
     aaccgggctc actgtcgcca atttctgctc ctgcgaagaa tagacggctt gtcctgcgat    136380
     cccgcactct gccggtttct accccgacaa gcccgcgaga cttgtcccgc cgcatacgaa    136440
     cagcacctgc cccgttacga accccgcctt gtcatcaagg aaaaacaagg cagcattggc    136500
     gatatcgtct gatgtcccaa tccggcgcac ggggatacca tttgcgattt tctgctgctg    136560
     ttcaccgtct ttgggcacaa tagcccagaa attatccgtc agcacaggac ccggagcgat    136620
     cacattcacc gtaatgccct ttggggcaag ctccagcgcc caggtgcgcg ccagcccgtt    136680
     gatccctgcc ttggtcgccg aataggccga ccgggtcggc atgccttgta gtgaccgcga    136740
     gctgatgaaa acaacgcgcc cagccccgcg ttcgaccatg ccgggcagcg ccgcctgggt    136800
     cagggccatg ggggcggcaa gatgcagctg agccagcgtc agaacatccg ccgggtcagc    136860
     gtcctcaagc aggttcggca ggatcaggcc ggcattgtgg accagcgcgt cgatctggtg    136920
     atccttgcaa atacgcaagg ccacctctgc cgtagcgtcc gcgtcggtca gatcagcggt    136980
     atagccatgc aagtcattat ggcggtcttc tggcatctca agcccaaggg ataccacggc    137040
     ctctccgcgc tccaacaatg cttgcccgat cgcggcgcca atgccggaat ttcctccggt    137100
     gatcagtgtt gtgcgtttgc tcatgcctgc gccctttcca caagggcgat cacccgcaat    137160
     gggctgcccg atccgccctc gatcttcagc gggcaggcga cgatcagcgc gccgaaagtt    137220
     ggcagcttgt cgaggttcgt caggcattgc agaccatatc gcccgttgcc atgcagaatg    137280
     gaatgggcag gaagcggcgg gtcaaaatga aacgcctgtc ctgcatccgt gccaacggtt    137340
     tcgaccgcaa ggccgatgca gttgcgctga tgcacaagaa aatccatcgc cccaccatca    137400
     ggtccgggag agtgcgcgcc gtcttctttc aggttcaggt aatccggcgt tccgacgcgc    137460
     ttgtaccaat ccgtgcgcag ggcgatccag tgccggtccg ggatctttcc atgcctggct    137520
     tcccaatcct ccagaaaggc acgggtcacg acaaagtcct catccgccgc ggcttcgtcc    137580
     gagatgtcga tgaccaccgc tggcgccacg aaatcctgca caggcaccgc gtcaaccgtg    137640
     tttgagggca aatccttgcc ggtcacccaa tgcgccgggg catcgaaatg ggtgcccgtg    137700
     tgttcgttca tcgagatgtt gttccaatac caggccgggc cgttgtcgtc atagcgagag    137760
     actttctcca tccggaaggg cgcgcattgg ccaaactcgg cgggcaggac aatgaccggg    137820
     aaatccgggc tgagtgtgtt ggtcagatcg atgcattcga caccgcctgt gatcagtgct    137880
     tgggaaagtg cggccagcgg cgtttgggtc atctgttttc ctccctcatg gtcagcagcg    137940
     ggtctgcccg ccaacgcgcg aacaggtcct ttgccacatc ccccgcgcag ctgatctctt    138000
     gcccgtcgcg caaggcggca acgacagttc gggcaaggtg cgatggggcg gtttttggtt    138060
     gcggcagacg ttggtgccag gcgtcgtcca ccgggccggt cagcacggac atgacgcgaa    138120
     tcccggcttt ttgcatttct ccgcggaacc cggacaagag cgacagcctt gccgccgcgc    138180
     tggccgccgt gccggaatac ccggactgcc cgctcagccc tgacacaggg accacatcaa    138240
     gaaatgcggc agcggaattc accccgtcat ctgaccgagc gccaagagcg gggccaaaag    138300
     cctgcgccag ccgcatcaac ccgacgacgc cagtgtcaag cccggcttga aggtcggaca    138360
     gcttggcccc aaaggctacg ccaccttcgc ggacctgtcc ggcggtattg atcacaatat    138420
     cgatccgccc gcccaattgt gccgcaaggt ttccgacgct gtgtgtgtcc gtcacgtcca    138480
     gcggcaccag ctctgcccca tcaagggcgg caagctgctg cttgcctgca aaccgcatca    138540
     ggggggcgca gtcgcccaca aaaaccttcg cggcacctgc gtcgagaagg gcgcgcgcta    138600
     tcgcctggcc cgtgtcggtg cggccgtccg tcaccagaac gcggcgatgt ttcggatcag    138660
     cggtaaagct gcggaattgc gggtcatcct gcatgttcgg aacatcccct cttggcatgg    138720
     cgaacagggc ggggttgcca ccccggtcga gtttcagaac catattcacc cggtctccga    138780
     ccccggcttc gccgtgaaga tgcacgattg ccgtcggccc tgcgtccagc cggaccgttc    138840
     cgatccgcca gggcatgtga ttgcgaaagt aggtgtcggt tgaatgccgg atggtggtct    138900
     ccgccgcgac ctgtccgccc gcgtcctgct cacgccacac cagctctccc cagcaattcg    138960
     ggcaccgatc gcgcggtgga taggtggccc gatcgcagct ttcgcaggtt tgcagaacaa    139020
     atcgcccctg cgccgcatgg gtggccatct ccatggcggc gcggctgcgc aggcgcggcg    139080
     gaacatggcc cagcgtcgta cgccgaagcg ggtccttgcg ccggggtcgt tgcaacggat    139140
     ccgtcatcgt agcgcctcgc gttgcaaaac ggccgcgccc gtacaggtgc cgcgatcata    139200
     gttcaccaga ccaaatcccg acaccagggc gcgatgcgca tcggatacct gttcgcccag    139260
     cggacattgc aggatctggc gcaacccttc tgtgacattc tgaaatccac ccgcagcacc    139320
     ggcctgtccc gccgagagct ggccgccatt ggtgttcagt ggcagcgagc cggatatcgt    139380
     aaactcattt gccgcgatga aatcattcaa gccgggcttg ctgcaaaacc ccagatcggc    139440
     aagctgcatt gccacgatca cggggtagtc gtcataaacc tgcacgcatt gaacgtcccc    139500
     ggggccacag ccggcacgat cccacagcgc ctcctgatca cgctcccatc cgccgcgaaa    139560
     ctgaaccgta tcatcggcaa atgcgttgtg gcgttcgatt gtcgacagga tcctcgccgt    139620
     ggacagtccc agttgctctg ccttgtcagg ggtcgtgacc aggaacgctt cagctccggc    139680
     gcagggcatc acacagtcaa acaagtggac cgggtccgat attggacggg cattcatgta    139740
     gtgttcaatc gtcaaaggtt tcttcatcaa tgccaaaggg ttggacagcg cgttttccct    139800
     ctgggccacg cagagtttgc caaaagtttc tcgtgtcgtt ccgaattggc gcatgaagtt    139860
     gtcggtgatc agcgcaaaag tcgcattcgg gccgccaaag ccgtagggat atgtcgcgtc    139920
     ctgggaaaaa cgtgaaaaac ccgccagggt ctggcgatag ctgtcgatct gattggtgtc    139980
     ggcggccaca caggcgacca cctcggcatc gccgcattgc acggcacgcg ccgcccggcg    140040
     cagcgccatg ataccgctgg cgccgccggt cgggatgtga tccatccagc gcgggctcag    140100
     acccagatgc tgtaccatgc ccacgaccgt atccggagct gaggaaaagc tggcaaagca    140160
     aaacccgtcg atatcaccgg cattcagccc ggtcttttga ccaagcgccc gcaacgccgc    140220
     gcccgtccac caatgggcag actccggcga aaaccgcaca taaggcacgg tgatcggtgc    140280
     gcagaccgca acgccgtcat atcgcgcctg catccccatt attgctgccg cttcttgagg    140340
     tgacgcgtgt cgatgaaacc cgatcgggcg gcggtatctt ccagcagcga tttgagcttg    140400
     ccgcgcagaa ttttctgggt ggcggtcagc ggtaggtctt cgacaaaggc gatccagccc    140460
     ggaaccttgt aataggccat ctggcccagg gcccaggtca cgatctccac ggcctttgcc    140520
     tcgtcaccgc cgccgttctc gagaatcaag aagacggcga cttcatcgcc gcgcaggtcg    140580
     tcagagtatg cggccgcggc cgagatgcga atatccggat gccggttcag gatgctttcg    140640
     acctcgaccg ctgcgatgtt ttcgcccgac cggcggatca cgttcttctt ccggtcgaca    140700
     aaatgcagcg aaccatcctc atcctgcagc acgacgtcac ctgtgttcag ccagccgcct    140760
     ttccacaact cctcggttgc ctccgggttc ttgaggtaac ccgcgcagaa gccataccgc    140820
     gggttgtcgc ctgcgcgccg caccagcagc tcaccgggct gtcccggcgc cacgtcctgc    140880
     ccggagtcat cgacaacacg aaccgctaca ttgtcgcaag gccggccaaa gcaggatgtg    140940
     cccacctttc gcggttcttc atgcgcactg atcacgcctc cgctccctgt ttccgtgcag    141000
     gcccaggcct cgataagggg gaacccgtat cgttcttcga acgcggcatg gagcttcgga    141060
     tcgacccccg caccaaagcc aaagcgtaca tcgtggtcgc gatcggcctc agacggctcg    141120
     gcccccatca gcatcggcgg catgacgcca agatagtgca caaccgtcgc tccggacttg    141180
     cgcaccgctt cccaccagga gcggggatgg aaccggtcca gcatggtcag gcagccgccg    141240
     gtggtgatca tcgccatcac cgacaccgcc atcgcgttca tatgaaacag aggcagtggg    141300
     gtcagcatgc gctcagcgtc gcggcggagg ctgatatagc cgccagtttc ggcgtaccaa    141360
     tccccggagt gcaggaagta ctcgttagtc aggatgcacc cctttggacg tccggtcgtt    141420
     cctgacgtgt aaagcaacgc gcattcggtc tcagggccga gatccacggt gggcgtagac    141480
     ggcgcagggg caggggggat gtcggtgtct gaagtgatca ccagggcctc agacccggca    141540
     ttggcgactg cttcggacat ttcctggtgc cgttctggca agacgatggc caacgccatt    141600
     tctgaatgcg cgaccatgta ttccagttct gccagccgaa ggtctggatt aatcgggaca    141660
     accgaagcgc caaggctgtt caatgccaac cagatttcta gaaagacggg cctgttttga    141720
     agcaacaagc ccaccctgtg cccatgtccg aacccggcca aggacaaccg atccgcccag    141780
     tccgcaatcc gcgcgcccat ctcgccatac gaaatgtctc cggcgggaat gccatagatt    141840
     acggcggttt cctccaacac atgcaggaaa ggcgcgtctc cgcgtcgatg cgccgtctct    141900
     gtgaaacgtc caaagactgt cttgttcatc ctgcgcatct cagatgaaca gctgcaaatt    141960
     gccgaaggga gcatcgaagt tgatcaggtc gacccgcttg agtttgatct tcagcgcacc    142020
     gtcgacctcg acaagcttat ggcttaccca gcccgaatag cgctccagat tgtcgccccg    142080
     ggtttccgtg tagatgaagg atgtccgcag tctgaagata ccgtcaccct cacccagcga    142140
     cagcacgcgc gggcgctgca acaggtggtg acagcggctt ttgggcttct ggctgaaggt    142200
     acgttcgccc gacagccttt ccacccgcac cgtcagcaag agctggtctt catacatcag    142260
     cgaaggttgc aggatcgggt cctgttgctg ccactccagc ggcatccaat agcggccatc    142320
     ctcgtggaac agcgcaagcc agtcctccca ccgcatctca tccagggtgg ccgcctcgtc    142380
     atagacgaaa tcgatcagcg tctcaggggt catgcgctga cctcctgctt ctgttccatc    142440
     ccctgaacca tgaacttccg ccaagcatag aaggtgttgc gcatctgccg ttccgaggtg    142500
     ccattgacca cctcggtcac atcctccggt tcgccttcct cgtagagcct gcgcagattg    142560
     atccattcat tggcgtccga aagcaggcct tcctgcgcgc gctcatacat ttccagatcg    142620
     tcatgtccga caatcgacgt gggcgcgttg atgaaccggt tatacatcag cgcgcgctca    142680
     tagatcttgt ccggcgcccc aaccagtctg aacgcccagc tttccaccag cgtcctgtcg    142740
     accgctacgg ggatgaagtt gcgcaggatg ccaaccggcc ccttgaccat gacattcggg    142800
     aaatacagcg tgttgtgccg gatatcgcca aggatctcgc gggcgcgggt ctcgccgtag    142860
     gcctcgacca tcatctccag atagccatca acgtcgtcgt aatcctgatg gatcgagccc    142920
     gagacgccgg aatgcccgtg cccgttaggc cagacgcgga tgcccgcgct ttcgtagaat    142980
     tcataggggc tcatgaaagg cgcataaagc tgcaccgcca tcggtgtttc cgtaaagcgg    143040
     tgcttttcgc gctcccacac gctgacggcg gttcccgcgc tgctctcatg ggcgaccatc    143100
     gggtggcagg tgtcggtctg gttatcgacc aacatcttcc agttgcaggt gtgcatatag    143160
     cggatcggcg cggcgatgat ctcgacctcg cccttggggg accggtccac catgttgtcg    143220
     atcgtcgaga gggaatcgcc gaaatagtct tcgaagctca ggccggtgtc agagaggcgg    143280
     gcaaagatga acccccggta gatgtgcacg ttttcgaccc ggggcagccc gtcttttgcc    143340
     ctgtcattgt caaacccggt gccctcgtag cccttcttca gcgggatcgc caaaagcgat    143400
     ccatcggtct tgaagctcca cgcgtggtag gggcagcgaa agaactttcc ggtattgccg    143460
     cagggctcgg acgcgatctt gacccctttg tgaggacagc ggttgtgcag aacgtggatg    143520
     gttccgttct tgtgccgcga aatcagaatg ggctgatggc cgatcttgct ggtgatgtag    143580
     tcgcccgggt ctttcagctg gctttcatgg ccgacataga cccaggagtt cgggaacaac    143640
     tgctccatct ccagatcgaa aacctccttg tcgacataga catcccggtg cacggcatgt    143700
     cctctgacca ggttcttgac ggcctcggca ttgccacgat agcgatccat gctgctctcc    143760
     ttcgtctgtc ggttaaaggt caaggaccag tttcggcgtc ttggaccgcg aaacgcagat    143820
     ctgcatgacg gtgttcgatg ccttttcggc gtcactcagg atgacgtcgc ggtgatcggg    143880
     aatgccctcg atgacatcgc attggcaaat gccgcaatcc ccgcgctggc agtcgtaaag    143940
     cgggtccaga ccggcctctt ccagcgcttc gatgatgctt ttgtcggcag gcacgtggat    144000
     gatctggccg gtatcgctga cctcaatgtc aaaggcggtg ttctggcttt cgtcggcggc    144060
     cgtcgcgaac agttcgaaat gaatgcgctc gtcgctccat ccaagctctt tcgcggtgcg    144120
     tttcaccgct tcgatcatgc ccgacgggcc gcagaaatag acatgcgatc ctgtcggcgt    144180
     attttccagg attgcctgga tgttcatggc gcttggctga tcgtcatagt gaatgtgcag    144240
     cgcatcgccg cagatagcct tgagttccgg aacaaagcta agcgcgcctt cggtccggcc    144300
     ggcatagtgc atttcgaacg aacgatcggc cgccacaaga tcggacgcca tggacaggat    144360
     tggcgtaaca ccgatgcctc ctgcgatcag caccgcgtgt tcttcgtggc cccctagggg    144420
     gaactgattg gccgcatccg aaaccttgac catgtcaccg ggtttcagcg catgcatgaa    144480
     tttcgagcca ccggcgcttt tggcctccaa caagacgcca agcgcgatct gatcatcgga    144540
     caagtcgggc aaccgcagca aggagtaggc gcgggtgctg ccgtcggaaa ccacgactcg    144600
     caggtgcgcc cctgcttccc atgtgcacag accctggtcc tgaggtttca gaataaatct    144660
     tttgatgtca cgagtttccg aggagacggc gatgacttct gcggcgacgg acggcatgta    144720
     tgctcctcat gaatcattcg tatgcatttg caaaggttta gttataaaat aaagtttgtc    144780
     aagcatgcct gctcaagaag ggtggattcg tcatcttgcc ttagacaaat tgcttttgcc    144840
     gtgaccaacg tcgagtttga cacccagtag agacacctgc agaattgcga cggcgtgaaa    144900
     ggtattgttt gaactgcttg gtttcggccg tgcgcccgga tgatcacaga atgctggacg    144960
     ccattgtaat cgccgcattc ggtcctggga ccgacagctg gccagcgcat ctatccgcca    145020
     acatctacag atgatgagaa tggtggtgtt ttcatattaa ctcgagcagc ttgtgagcga    145080
     acgtagcggt cgattctcag gcgacatttg acgcatagtt ccaggcctcg agtgcttcga    145140
     gacggtggta tcggatggtg agggcggcgc ggcggcgggc tggaactgag aaacgactac    145200
     gggttgcgga ctacatggaa acgaagcgtt gtaatgcccc cggcgatcga aagccctgca    145260
     tcacccgctc gcgttctcga aaaggtagat ggctgttctc tgcgcgcttg ttcagcccct    145320
     gatgtgacca atgtcgaggc caggcgcgac ctcgcgcttt gcggccccat atgagcgcag    145380
     tttgtccgtg ctgacccttt tgggaacgaa gccccaccgt ttcatccgct tgaccagaag    145440
     ccgatttccc gcgcgtttgt cccgcctggg ctgcaggata tcatcaagaa cggcgccgtg    145500
     ttgatcgacc gcacgccaga gccagtacgg ccggcccgcg atcttaacga cgacttcgtc    145560
     caggtgccag acatcgccag ggcgcggctg ccgtctctgt agagcatgga cgatcacggg    145620
     tccgaacttg acggtccaaa gcgcctcgta cacttatgac atcgaggaca accttgttca    145680
     gactatcgac aggctaggct ccagacccat tgatttcatg cttctggcgt gattcaggct    145740
     ccgcaaggag atctgatcga tgagcaatct gtattggctg accgacgccc agatggagcg    145800
     cctgaagccg ttctttccca agagccatgg caagccccgc gtcgatgacg cgtcgcgtcc    145860
     tcagcggcat aatcttcatc aatcgcaatg ggttgcgttg gtgtgacgcg ccgaaggaat    145920
     acggcccggc caagaccctc tacaaccgtt ggaaacgctg gagcgacaac ggggccttcg    145980
     cccggatcat ggtgggcctg gccaccgaaa gcgccgagca caagacgatc atgatcgacg    146040
     cgacctatct caaggcacac cgcactgcgt cgagcctgtg cgtgaaaaag gggggcgcgg    146100
     gcgccaaatc gggcgcacca aaggcggtat gaacaccaag ctgcacgccg ttgccgatgc    146160
     caaggggcgg ccgatcgggt tcttcatgtc cgccgggcag gtcagcgatt ataccggcgc    146220
     cgcggctctt ctgggcagtc tgccgaaggc gggttggctg ctggccgaca ggggctatga    146280
     cgccgattgg ttcagagaag cgttgaaaga caaggggata aaggtttgca tccccggccg    146340
     gaaatcccgc aagaaggccg tcaaatacga caagcggcgc tacaaacggc gcaaccggat    146400
     cgagatcatg ttcggccggt tgaaggattg gaggcgcgtc gccacccgat acgaccggtg    146460
     cgcggaaacg ttcttctccg cgatcatgct agccgcaacc gttttgttct ggttatgacc    146520
     cgagaacgag tcctgagcct aaaagacccc tcaggaagta tgaagattcc gtaattgaag    146580
     tgatagctgt tcagacggga aatccaaggc tctctcgcgc agcggccatc gatagaatgg    146640
     agcacgggaa agaagcgcag gagcaaattt atgaggattg atctatttca cccacaccgg    146700
     catcgctgca gaacttaggc ttgaggcgtg ctgtcccctt acctcattga catcaggcga    146760
     tgctaacgat ctaggcggcg ttgaagcggt tcatgagcac gatgtggatg tcggccgtct    146820
     ggcggtcggg gtctctggcg gcgttgcgtt ctctgaatgg gactgttgca ttacacggtc    146880
     ggcctatcaa ctgtgatccc gcgctccgcc agcagttcaa ccacatcctg gtaggactgc    146940
     gggtagcgta gataccaccg caccgcacaa aggataacgt cacgtggaaa gcgttggtgc    147000
     ttgaacggtg atctactcgc caagatcgac ctcaaaaccc aaatctcgcc aagttaggtg    147060
     attaatgcaa cagtcccacc ctgtgtcagt cgcccaggtc ccggaacggg tgcccatacc    147120
     actccgctat gtgaaaccgc tcttctgcca atgcgttgcc tccgcgcctt gcggtgcatt    147180
     gggcagattc cacaacatgt agtcaatgtt tcacccgggc tcaggtccac ccgggtaacc    147240
     ctagggtaac gcagtgctgt cccgccaccg gtcccgtaag tgcttgcttt cgtagggtgg    147300
     gtggtgctgc tggacaggat tgaactgtcg acctctccct taccaaggga gtgctctacc    147360
     actgagctac agcagcccgc tgtaccgacg cggcaggacc ctctggtggg ccgcagcgtc    147420
     gcggtgagcg ggtgattaga ctcaaacgaa acgcggcgca agggcatctg gacggttttt    147480
     ttcgcctcct gtagagaaag gacatggcag agcaaaaaaa cccttcgaaa agcaaatccg    147540
     caccggctga ccgcgaggac aggctcaagg ccgcgctcaa ggccaatctg gcccggcgca    147600
     aggcgcaggc caaggcgcgg accgcgcagg acggcgcgga tcacaacaaa aaaggttaag    147660
     agcagatgga ttcgattctc gttaccggca acgggccgct gaatggccag atccccattg    147720
     caggggccaa gaatgcctgc ctcacgctga tgcccgccac gttgctcagc gacgagccgc    147780
     tgacgctgac caatgcgccg cggctgtcgg atatcaagac gatgacgctg ctgttgcagt    147840
     ctctgggggc cgaggtgtcg tcgctgcagg atggcaaggt gctggcgatg tcgagccatg    147900
     acctgaccag ccatactgcc gactacgata tcgtgcgcaa gatgcgcgcc tcgaacctgg    147960
     ttctggggcc gatgctggcg cggctgggtc aggcggtggt gtcactgccc ggcggctgtg    148020
     ccatcggcgc ccgcccgatg gacctgcata tcgaggcgct cgaggcgctg ggggccgaga    148080
     tcgagctgcg cgatggctat ctgcatgcca aggcgcccgg cgggctgaaa ggggcggtgc    148140
     acgaaatgcg cttcgcctcg gtcggcgcga ccgagaacat ggtgatggcc gccactctgg    148200
     ccaagggcac cactgtgctg aaaaacgccg cgcgcgagcc cgagatcgtc gatctggtac    148260
     gctgcctgcg tgcgatgggt gcgcagatcg agggcgaggg tacatcgacc attgaaatcc    148320
     agggcgtcga ccgtctgcat ggggccaccc atcaggtggt gaccgaccgg atcgagctgg    148380
     gcacctatat gctggccccc gccatttgcg gcggcgaggt cgagttgctg ggcggccgtc    148440
     tcgacctggt tggcgcattt gtggaaaagc tggatgcagc cggtatcgac gttgccgaga    148500
     ccgacaaggg tctcaaggtc agtcgccgca atggccgggt cagtgcggtc aatgtcacga    148560
     ccgagccttt ccctggcttt ccgaccgatc tgcaggcgca gatgatggcg ctgttgtgca    148620
     ccgccgaggg caccagcgtg ctggaagaga agatcttcga gaaccgcttc atgcacgcgc    148680
     cggaactgac ccgcatgggc gcccggatcg aggtgcatgg cggaaccgcc accgtgcgcg    148740
     gggtcgaacg gctgaaaggc gcgccggtga tggccaccga tctgcgcgcc agcgtctcgc    148800
     tcattctggc ggggctggcc gccgagggag agaccctggt cagccgggtc tatcatctgg    148860
     atcgcggata tgagcatgtg gtgcaaaagc tcgaagctgt gggcgccaga atcgaacgga    148920
     tcaagggctg atgtcggacg caacattcaa ggacgggcgc gaggcgccgc tgaacctggg    148980
     cgcagaggac ggcgatgacc tcaagatcat ctcgaccctg gtgcaggatg cggtgtttcc    149040
     gatcaccgaa atgtcctggc gtccgggaac gcgccggttt gccctgctgc tgaaccggtt    149100
     ccggtgggag gaccgcaccg ccgccgagca gcgcgggcgc ggctatgagc gggtgcaatc    149160
     gctgctggtg atcgacagcg tgctgggcgt cgccagccag ggcatcgacc ggtccgacac    149220
     cgatacggtg ctgtcgctcc tgtcggtgac attcgagccg gagaccgatg gcgccggaca    149280
     gatcctgctg acgcttgcgg gcgacggcgc catccggctg accgtcgagg cgctggatgt    149340
     cacgctcaag gatgtcaccc gcccttatct ggccccctcg cgccaggccc cgcatcactc    149400
     ggactgatgc agaacaagcg ggggatatcg caggcctttt cccccgccgg caccgggggc    149460
     gagttgttgc ggcgtgccac cctctttgac ctctttgaca tgtcccgggt gctgacgcgg    149520
     tcgatcagcc agctgtgcac cgccgatcac ggcggtgatg cggaggcgat tgcgcgctgg    149580
     tgcgccaaca agacaccgca ggccctgcgc gcgcagatga tggacgaggg ggcggagttc    149640
     tggctgctca cccgcgccgg ccagatcgcg gcggtgggtg ccctggccga gatcgaccag    149700
     accgcgggca ccgggcgcgt cacgctcaac tatgtcgatc ctgcctgtcg cggtcagggc    149760
     gccagcgccg ccctgctggc ggggctggag gcgcggctga gcgaacaggg catagagcgc    149820
     gggctgctga ccagcaccgc caccgcgcgc gatttctatc tgtcgcgcgg ctggcggccc    149880
     gatggtccgc cgcgccgggg ccgctggatc ctgggccacc cgatggccaa gaccctcgca    149940
     ccctgatcac ccgcaccctg cgtgtgccgc ctattccacc gtgaccgatt ttgccaggtt    150000
     tcgcggccga tcgacatcaa tccccctgag cgtgccgatc aggaacgaga tgtaatgcgc    150060
     aaccaccagc gtcaggatgg tgttccagac ggggccgaca gcgggaacgg tgatcaccgt    150120
     cattgcctcg gcatcctcga tttcggtggg ttgcaggtcg gaaatgacaa tgcattgcgc    150180
     cccgcgcgcg cggacctcgt tgatgttgga aaccattttc ttgcgctgcg cctggtcggt    150240
     caggatgcac agcaccggca tgccatattc gatcagcgat atgctgccat gcttgaactc    150300
     gcccgcattc atcgcctcgc aatgcagata cgaggtttcc ttgaacttga gcgcggtttc    150360
     cttggcgatc gaaaagtcga ccccacgccc gatggcaaag cagctttgat agcccgagat    150420
     ccgatcggcg atgctgcgga actcacgctc ccgcccgacc atttcggcca gcgccgcgcg    150480
     aaagtcctcg gccgaggtga accagctctc gtcgcgcgcg ccgctcaggg cctgccgcat    150540
     ggcgtcgagg aagaaataga ccgcaaggaa catgttggtc acggttttgg tgctgggcac    150600
     cgagatttcg gggcccgccg aaagcggcag caccagatcc gagacaaatt ccagcgtact    150660
     gcccgcgaca ttgacgaaag cgacgacctg cgcccctttc tgcttggctg ccttgaccgc    150720
     gccgatggta tcggcggtct cgcccgattg gctgatcgcc agcaccagag tggtggacga    150780
     aatgatggga ggattgtacc gcatctccga acccacctcg gaaatcacgt cgaccggcag    150840
     ttcgaactgc cgtgccaggg cttcggcaaa gatcgcgctg aacgaggccg aaccgcaggc    150900
     cacaaccacg atcttggtaa agctgtgttg cttcagatag gcgtcaagcg ctgccctgtg    150960
     attgcggatc tcgcgacaga acgcctgcgc cgcagccggc tcctcgtgga tttccttttg    151020
     caggaaagtg tcatagccat cctttcgcgc cttttcgacc gaccagttga tggtgatcgc    151080
     aatcgcctcg gattcggcgc ccgactcgtc gaacacctcg accccctcat tgccaaggat    151140
     cacgcattgc ttgtccttca ggcaaaagac gtccctgcca taggagacca gactggacag    151200
     gtcggacgag atcgccgatt ggccgtcgtt ctggatatag ttcagcgggc attcgttgcg    151260
     gatgccgccg atcaggtcgg gcgcgtcggc gaactggatc accaccgcat aggcgcccac    151320
     cagccggctc tgcaagcgcg acaggacctg gcggtaactg ccggcgccgc actcctgata    151380
     gagtttcgcg gccagattgg cgatgacctc gctatcggtc tcggactgga acacatagcc    151440
     gtcatcaagc agctgttcct tgatcggttt gtaattctcg atgatcccat tgtgcacgat    151500
     ggcaaccttg ccgtcgctgg acagatgcgg atgtgcattg atgtccgagg gcgcgccatg    151560
     ggtggcccag cgggtgtggc cgatccccga agagccgtgc aacgggaccg agggtttggc    151620
     cagttccttc ttcagctctg acagcgcccc ctgccgtttg acgacatgca gccgcccgtt    151680
     gctgagcacc gccatgcccg aagagtcgta gccgcgatac tccagattgg tcagcatccc    151740
     gaggatctct ttctgtgcgt cacccacacc ggcgacaccg accactccac acataggcgt    151800
     ttcccttgtc ctgcccgggc ccttgtgacg cccgcaattg tcttctgata tcgcgatggc    151860
     aatcgaaccc gaaatcacgc gctgtttcag aactgtaggg tgtgagctgc ggcgccttgc    151920
     atcccgcgaa aggggaaccg gccccgccaa atgcctgtct ttccgcgacg aagcgatacc    151980
     ttcccggggg cggagagggg gaaacacccc ccctgagata ccgcgcggcc agcagaattt    152040
     tgctcaaatt cgctgcctgg aaccggcggg cgcagcggcg agccgatccc tatgcccctc    152100
     tgacgatcgg gtaccttcgt ctgatccaag acgggcagcg ccttgtaatt cggcgattat    152160
     gacgctatat atcgtcaaag ttaccggcga ggcgcagtta tgcacatcac aaaatttgcc    152220
     gaagggggac agttcgaacc gcgcaagatc gccgcggcgc tgcggacctc ggccgaagag    152280
     gtcgctatga cggtgggtct gggcaaggac gcgctgcaac gccgtgcccg catcaattcg    152340
     gacaagaccc aacgccgcct gcgggaactg gtggaggtgc tcaacaaggt cgagccgcgc    152400
     tttggatcgg aactgatggc ctatgcctgg taccgatccg aaccactgcc cggttttgat    152460
     ggccgcacgg cgatgcagct tgtgcaagag ggcaaggtgc agcaggttct ggactatgtc    152520
     gacgcggtcg atgcaggcgt ctttgcctga tgccattgcg gcacgggcgc tatagggggc    152580
     cgctctaccg tgccctgaac ccggtctatg cccgcgagcc cttgtccggg cgcggcgctg    152640
     aacgctatgg cgggcggttc aacgccaggg gtatcccggc gctttatacc gcgcttgatc    152700
     cggccagcgc attgcgcgaa gccaatcagg tcggcagctt gcaaccgaca atcctggttt    152760
     cataccgcgc cgatcttgga cccgtgtttg acagccgcga cacaggagaa ctggaacagc    152820
     ggggcgtcag cgcccggatg cttgccgatc ccggctggcg tcaggcaatg ctggacgggc    152880
     gagaggtgcc gacacaggat ttcgcgcgcg ggcttgtggc agatggctat gtgggtcttc    152940
     tcgtccaaag ccatgccaag ggcgcctcgg acagcgacct gaacatcgtg ctgtggcgat    153000
     gggcggggga tggctgcacc ctcggggtaa tcgacgagga gaaccgtctg ggccgcatgt    153060
     aaatccccgg aggatataga tttccacgtt gaggcggtgc gaagccatct gagatgttca    153120
     agaatgcaag acggctacaa atgacaagtg gcatgatcgg gccactcacc ggctggtcat    153180
     gctgtagcgg gaaaaagagt tcacgcccgg accggcggct ccgtagcacg ggtcgccgag    153240
     gagttcggtg cgatcggcac gctcgcgaac ccctcgcacg gcgcggttct ggcacaacca    153300
     aaagggcacg ctgtttggcg agacccccga actgggtgag ggccttcgcg gcatcttcgg    153360
     ggcactggac aacgttgcaa agtctttccg ccgaataggc cggccggcgc gcgccgcggc    153420
     ctggccattg gtcggtcatc gtgccgatgc tgagcctggc acgtgcgctt gtcagcgata    153480
     cgcatgcccg ggtgggcttg ctcgtcgacc tgctcgttgc tgctgcccca atgagtcatc    153540
     gcaatcatgc atagtcatga ttttaccttg cgctcacgcc tcatcggtgg aggggcggat    153600
     gctgacggac aagggcgcac ccaacctgcg tgacaggtcg agcgcggcgt cgcgcacgat    153660
     attgccgatc tcggtcagcc gcgcgtcggg catccggtca gaggggcccg ataccgagat    153720
     gccgccaata gcctcgccgg tgaaatcggt gatcggggcg gccacgcagc gcatgccatg    153780
     ggtgcgctct tcgtcatcca gcgcccagcc ccggcgatgg atcaggtcga gctcgctcag    153840
     cagttgttcc ttgtcgaacc gggttttcat cgtgaactgt tccagccgca tctcgggcag    153900
     cagcctgtcg atgcgggcgc ggtcatattg cgacaggagc gccttgccga tgccagaggc    153960
     atgcagcggc gcgcgggtgc cgggctgaaa gaaggcgcga atgttggatt gggtttccac    154020
     ctggctcagg aacaggatct cgccgtcgcg ctcgatcccg atattggcgg tctcgccggt    154080
     gacttccatc agcttgcgca aaaccggccg ggcgcgctcc accagggaac tgcgcaacag    154140
     aaaagccgag cccaggcgga acaggtcggg cccgatatgc caggtctggg tttccggatc    154200
     gatctcggtc aggcgacggc tctcgaaagt gtgcagtgcc cggtacaccg tggccggcgc    154260
     cagatcgagc cgctcggcca cctctgacag cgccagcccg cgggccgagg cgaggcattc    154320
     gaggatgtcg atggcccggt caagcgactg attggtgttc tgctcgctct tgtcggcaaa    154380
     gcttttgggc cgccctcttt tccgcttctc cgtcgccaaa ccgctgcact cctgccgatt    154440
     tttcgtttct ctgatctttg aatgttacaa gtgaaaaatt ataaatcgct gctatcaaag    154500
     caataatgtc tcttcatcag taaatgaaaa acaatttcaa aaaaattgtc aagtggtttg    154560
     atccggtcga tgatggggca tcgaatccgt tgaacgaggc acaagatgag tttccagaac    154620
     cccgttttca tccctgggcc gaccaatata ccggaaagcc tgcgcaaggc ctgcgacatg    154680
     ccgacgatcg accaccggtc gccgctgttc gggcaaatcc tgcacccggc gcgtgcgggg    154740
     gtccgggcgg tgctcaagag tgaaaccgcc gagatcttca tcttcccctc caccgggacc    154800
     gggggctggg aaaccgcgct gaccaacacg ctgtcggcgg gtgacggagt gctggccgcg    154860
     cgcaacggca tgttttccca tcgctggatc gacatgtgcc agcgtcatgg gctggcggtc    154920
     gaggtggtcg aaacaccctg gggcgagggg ctgccggcgg atcgctacga agagatcctg    154980
     gccgccgaca cgcatcaccg gatcaaggcg gttctggcca cccataacga aaccgccacc    155040
     ggcgtgcgct cggatatcgc agcggtacgc cgcgcgctcg acaaggcggg ccatccggcg    155100
     ctgctgttcg tcgatggggt cagctcgatc ggctcgatgg acttccgctt cgacgaatgg    155160
     agggtcgatg tggccgtcac cggctcgcaa aagggattca tgctgcccgc cgggctggca    155220
     attgtcgggt tcagtgccaa agcgatggag gccaccgcga ccggcactct gccgcgcacc    155280
     ttcttcgatg tgcatgacat ggccaggggc tatgccaaca acgcctatcc ctataccccc    155340
     gccgtgggcc tgatgaacgg gctgaaccag gcctgcagga tgctgctgga cgagggactg    155400
     gagaatgtct ttgcccgcca tcaccgcatc gccgaagggg tgcgcgcggc ggttcacgcc    155460
     tgggggctgg agctgtgtgc cgcctcgccg gatctctatt ccgacacggt cagcgccatc    155520
     cgcacgcccg aggggttcaa tgccaccgat atcgtgaccc atgccgccag caaatatggc    155580
     gtcgcctttg gcgtcgggct gggcgaagtc gcgggcaagg tgttccgcat cggccatctg    155640
     ggcagcctga ccgatgtcat gacgctgtcg ggcatcgcca ccgccgagat gtgcatggcc    155700
     gatctgggtc tcgacatagg gcttggatcg ggcgtggcgg ccgcgcagga gtacttccgc    155760
     tcccatagcg cgacctccct gctcgcggcg gcctgagaga ggtgagagat gtatataccg    155820
     acctttgagg acatgcttgc cgcgcatgcg cggatcgaac cccatatccg ccgcacgccg    155880
     gttcgggtct cggattacct caacgagctg accggtgcgc agctgttctt caaatgcgag    155940
     aactttcagg agccgggcgc gttcaagata cgcggcgcta ccaacgcggt gtttggcctg    156000
     gacgatgccc aggccgcaaa gggggtcgcc acgcattcat cgggcaatca tgcctcgtgt    156060
     ctgagctatg ccgcgatgct gcgcggtatc ccctgcaacg tggtgatgcc aagcaccgcg    156120
     ccgcaggcca agaaggacac ggtgcgccgt tatggcgggg tcatcaccga atgcgccccc    156180
     tcgaccagcg cgcgcgaaga gacctttgcc cgggtgcagg cgcaaaccgg gggcgatttc    156240
     gtgcatccct ataacgaccc ccgggtgatc gcggggcagg ggacatgcgc gcgcgaactg    156300
     atggaacaga ccgatggtct ggatatcgtg gtggcaccga tcggcggtgg cggcatgatc    156360
     tctggcacct gcctgaccct gtcgacactg gcgcccgaga cccgagtgat cgcggccgaa    156420
     ccggaacagg ccgatgacgc ctatcgcagc ttcaaggcgg gccatatcat cgccgatgac    156480
     gcacccaaga ccattgccga tggtctgctg gtaccgctca aggatctgac ctggcatttc    156540
     gtcagcaacc atgtggccga aatctacacg gcctccgagc aggagatcat cgaggcgatg    156600
     aagctgacat ggaaacacct gcgcgtggtg atggaaccct ccagcgcggt gccgctggcg    156660
     acgatcctga agaaccgcaa ggcatttgcg ggcaagcgcg tgggcgtaat cattaccggc    156720
     ggcaacgtcg atctggacaa acttccttgg atgaacgggt gagcgagatg aaagacatga    156780
     ccaatctgga caatttcgaa gtcggcttcg acattccggc caaaccgggc atggatgcgg    156840
     ccgaaattca gaccccctgc ctggtgctgg acctcgacgc actggagcgc aacgtcaaga    156900
     agatgggcga ttatgccaag gcgcatggga tgcgccaccg ggtgcatggc aagatgcata    156960
     aatcggtgga tgtggccaag ttgcaggaac gcctgggcgg cgccgtgggc gtgtgctgcc    157020
     agaaggtgag cgaggccgag gtgtttgtgc gcggtggcat caaggacgtg ctggtgtcaa    157080
     accaggtgcg cgacccgctc aagatcgacc ggctggcaca actgcccaaa ctgggcagcc    157140
     gcatcatcgt ctgtgtcgat gatctggcca atgtggccga tctgtcagcg gcggcgctca    157200
     gacatggcac cgaactggag gttctgatcg aaatcgactg cggcgccggg cgctgcgggg    157260
     tcggcacgac ccaggatgtg gtcgccatcg cccgggcggt cgatgcggcc gaaaacctga    157320
     aattcacggg cattcaggcc tatcagggcg cgatgcagca tctggataaa tacgaggacc    157380
     gcaaggccaa gctggatatc gccatcgaga tggtggaaag cgctgttcag ggtctgaaag    157440
     cggtggggct ggaccccgaa cttgtgtccg gcggcggcac cggcagctat tacttcgagg    157500
     ccaattcagg cgtctataac gagcttcaat gcggctctta cgccttcatg gatgccgatt    157560
     acggccggat cctcgatcag aacggccagc ggatcgacaa gggcgaatgg gaaaacgcca    157620
     tgttcatcct gacccaggtg atgagccacg ccaaagccga caaggcgatt gtcgatgccg    157680
     ggctgaaggc gcagtcggtc gatagcgggt tgccctttgt ccatggtcgc gacgatgtgg    157740
     aatacatcaa atgctcggac gagcatggcg tggtcgccga cccgaacggt gtactcaagg    157800
     taggcgacaa gctgcgtctg gtgcccggtc actgcgatcc caccgccaat gtgcacgact    157860
     ggtatgtcgg cgtgcgcggc ggcaaggtcg aatgcgtctg gccggtctcg gcccgcggca    157920
     aggcctattg atttacctcc cctgactggg gcgggtgcgc ccgccccgtt ttttcacaag    157980
     aggcacagag catgtacatc gttccggaag ccatcatcaa agaccatatc agccgccagg    158040
     actgtttcga ggcgatcgaa caggtctttg cctccatggc ggcggggacc gcccgcaatt    158100
     ttccggtgat ccgcgaggcg atcggccatg cggatgcgct ttacgggttc aaatcggggt    158160
     ttgatcgcca ggcgctcaat ctcggtctga aatccggcgg atactggccc ggcaacgccg    158220
     acaaggggct gacaaaccac caatcgaccg tgttcctgtt cgatgccgac acgggcagat    158280
     gccaggctgt ggtgggcggc aacctcttga ccgcgctgcg cacggccgcg gcctcttcag    158340
     tctcgatcaa gcatctggcc cgccaggacg ccaaggtgat cggcatgatc ggcgccggac    158400
     accaggccaa gttccaactg cgcgcggcgc tggagcagcg caacttcgag aaggttatcg    158460
     gctggaacct ccatcccgag atgttggtga acctgcagga agtggcggac gaagccggcc    158520
     ttccctttga ggcggtagag ctggacggca tgcgcgaggc ggatgtgatc atcacgatca    158580
     cctcgtcctt tgacgcgatc ctgaaggcgg atcaggtcag ccccggcacc catattgcct    158640
     gcatgggtac agacaccaaa ggcaaacagg aggtcgatcc ccaactgctg gtgatggcag    158700
     acgtgttcac cgatgaggtc gcacagtcca tctctatcgg cgaagcgcag cacgcggtgg    158760
     cgcatggcct gatccaggcg gctgacgtgg cacagattgg cgcggtcatc aacgggacca    158820
     acccgggccg gacctccgat gcgcagatta ccctgtttga cggcacgggt gtgggattgc    158880
     aggatctggc ggtcgccgcc accgtggtcg agcgcgcccg cgccgccggc gctggcaccg    158940
     agatcgcgtt ctgacgcggt ccacaggcgg agcggcggcg gagcggccga catgttcgac    159000
     agacgcgccg gcagagtgat ccgcccggcg cgtctgcgca tgtcgggctt cggttctact    159060
     gcgcgggttg gcgcagttcg gccacctttg ccccacgcca ggccacagcc caggtgagcg    159120
     ttaccagcag ggcagcaaag accgtcatcg caggcaacag gccaaaccga tcggccagcg    159180
     cgccgctgcc aatcgtgggc agcgagaacc cgacataagc gtagacaaac agcccggcgg    159240
     cggcgcgggc gcggttgtcc ggcgcgcgca gggcgaactc ggccaggctg gcgagatagg    159300
     tgaacccgta gcttgccgcg ctggttatgg cggttccggc cagaaccagc ccgatggatt    159360
     gcgtccagac ccccagaagc aaggtcacaa aacccgtcgg aaccagcacg aaacccaccg    159420
     acagcgccac cctgttaccc agcctgcgcg ccaggggttg cgacagaaag cccacgaaga    159480
     tcgccagaaa gatcaccatg cctgtatagg cgcccagccc ctgcgccgcg agttgcagcg    159540
     gtaccaccgc gatggtcatg ccggtggccg accaggccag cgccagcgcg gcgccgaatt    159600
     gccagctgcc cgccggaaag accggcagcc gcaacagcgc gaccgggtgg ggtgtatcgg    159660
     cgcgcggcaa gccaagcacc gccagcgcca gcaggggcgc ggccacgaac agcgcaacaa    159720
     agctggccgg catcacgctt ggaccgccca ggctcaggca cagcccggtg gccagcgcgc    159780
     cgccaccaaa gcccagcgag gtcgccgatg tgacaagcag cgtggcctgc cgggtccggt    159840
     cggcaccaaa cagttcggcc atataggcgg tgcccgcggt ggtggccagc ccggtcgaga    159900
     caccgaggag caggcgggcc agcaccagag acggccaggt cggcacaaca gccagcagcg    159960
     ccgttcccgc cgcgcccaga cacagcgcca gcgcgatcgg caggcgccgc ccgatccggt    160020
     cggacaggcc acccaacagg atgagtgtcg gcatcagccc ggcgacatag gcggcaaagg    160080
     cgacggtcac tgcggcggca ccaaccccgc tgttcccggc ataaaccgca taaagcggcg    160140
     cttgcaggtt caccgcatag gtggccgcaa acagggcact ggcaagaatg gcgcggctga    160200
     catgatcccg catcggtttc cctttctcgg agcgatgcag caatggttga cccgcgatca    160260
     aatgcagtac aataaactta ttgtatcaag tacgctggaa gcgctccgag ggccgtgatg    160320
     aaatattcca aactcgtcga aacgctcgcg gcccggatca aggccggaga gatcaggccg    160380
     ggcacccgcc tgaagacgca tcgcgccttt gccgaggaac atggcgtcgc gctggccacc    160440
     gccacccgtg tctataacac gctgaaacag cgggggctga tcgtgggcga gggcggtcgg    160500
     ggcatgttcg tgcgccagcc agaggtgccg ccaacgcttg ggatcgaaca gcccgaggag    160560
     gcgcccggca tcgaccttgt cttcaacatg cccggcgatc cgggcgatgg cgaggttctg    160620
     cgcgccgggc tgcgcgggct ggcgggccgg ggcgatctga acgcgctgct gcgatatcag    160680
     ccccatggcg gcgtgctggc cgaacgccgt gtcatcgcca actacctgtc accgcgcctg    160740
     ggcaagatcg agcccgagcg gctgttcatc acctctggcg cgcaacacgg cctttccgtc    160800
     gttgcgtttg gcctgctcaa acgcggcgac gggatcgcaa ccgatccgct gacctatccg    160860
     ggctttcgcg ccgttgtcgg gctgcgcgat ctggaactgc atccggtgcc cgggcagctt    160920
     ggcagcatgg atccgcttgc cttgctgcgg gtctgcgcca aaacgcggct gcgcgcgctt    160980
     tacctgatgc ccagcgtgca caacccgctg ggcacggtga tggacgaata cagccgccgc    161040
     gccatcgtcg ccattgcccg gcaccacgac ctgctgatct tcgaggacgg ggcctatgac    161100
     tttctcgaaa ccgatccccc gcccagcttt ctggaactgg cacccgagcg gacggtctat    161160
     atcggcggcg tctccaaggt gctcgccacc ggattgcggc tgggctatgt cgtggtgccg    161220
     ccggatttgg ccggggcgct cagcatggcg atccgggcga ccacatggaa cacgccagcg    161280
     ctgatcaccg cgctggtgac ccagtggatc gaggacggca ccatcgggca tttcgaacag    161340
     acccgccgcg ccgcaggcgc gcgggcgcag gcgatctgcc gggcctgcct gggccaccac    161400
     gatttcagcg cccatcgcaa cgccggcttt gcctgggtgc cgctgcccgg tcgactgcgc    161460
     gccgaagagg tggtggccag acttgccaat cgcggcatcg ccgtttccac ggcaaaaccc    161520
     tatgccgtcg gtccaaccac gccgaacgcc ctgcgtctgg cctttggcgg gctgaacgac    161580
     gcgctgttgc ggtcaagcct gacaaccatc agcacggttc tggacatggc gtaaccggca    161640
     ggccacggcg atgcgggctc acgtcttgcc cagcgaacgc gcccggaagt ccctgggtgt    161700
     catcccctcc aacgccttga aggcccgcgt aaaggcgctg gtttccgaaa atcccagcct    161760
     gtgcgcgatc tcggtgatct gaatgccggg gtctgccaga tgcgcgcggg cggtttcacc    161820
     cagcacctcg ttgcgcaaat tgcgaaatga tgtcccgcgt tcggccagcg tgcggtgcag    161880
     cttgcgcacc gacatattga gggcacgcgc cgcccgaacc gtgtcgaagc caccttcggc    161940
     cagatgagcg gtgatcatca ggcgcagcct gctgacgatc tcttcctgct gtctgagcgt    162000
     ggcaacgatt ccgtcggcct gccgcttcag gatctccagc agaaccgggt cggcgccggg    162060
     aatggcaagg tccagatcgc gcacgggaag ctcgatctgg ttggtcttgt gatcgaaatg    162120
     cagctctggc ccaagcaggg cttcaagcgc cgatgtatcg gcggggcagg gcgtgctgaa    162180
     ccggcagcgc gcgggatacc aatcgcatct tgtcgcgacg cgaatggcgt gcacgatcat    162240
     cccaatgctg ctccagatat cctgaagcgg cgtgaacccc gcaaccggaa ccgggctata    162300
     cccgacaacg acgctgccct gcgcgcgcat aaccgaaatc tcggcatcct gcgaaaacac    162360
     cgcgttatag gtggtcagat gatgcagcca ggtgccaagg ctatccgaat tctcgagcag    162420
     atagcccagc aggccaaaat cccggctggt cagatgcgcc gcgatctgga tgcccagatc    162480
     ggggtttgcg gtgacgccgg cgccccattc gaacaagcgg aaatactgct ctgacggcag    162540
     gaccgtccgg tcccgatgat ccggcggcag ccgttggccc agccaggcct cgatctcggc    162600
     tagcggcacc ccggcctcca gcagcgccgc gaccagccag ccgcagggcg tgaccggggc    162660
     atgggtgttc tgcatagaga gcgtggcacg attcatggcc gaaaatgtca attctcttgc    162720
     cgagcctgtc aatatttccg ccgcgtccct gcataggctt gttcaaatcg ccgcttcaga    162780
     agggtcccgc cgccgatgat ttttcgcgca ttctcagtcc ttgtcctgcc tgtggcgctg    162840
     ttggccgcca gcgccgccga cgccgatggt gctgcgcttt acgcagagag ctgcgcgggc    162900
     tgtcatggcg aaacgggtca gggcaatggc gagctgcgcg ctccggcact ggcggcgctg    162960
     gacgcgggct atctgatccg gcaggtcggg catttccgat ccggcgttcg acaggtgaac    163020
     ccggacaacg acatggccgt tgccatggtc gaactgctgc ccgatgtgag cgaggcggat    163080
     accgccgaaa ttgccagcta cctggccagc ctgccgctgc cggtgctgga ggatgacaac    163140
     gatccgcccg gatttcgcag ccggggcctc tattccggct gcatttcgtg ccatggcgcg    163200
     cgggcgcagg gcatcgaggc attgaatgca ccccggctgg cccggcaata tggctggtat    163260
     ctggccgagc aactggacgc cttccgcgtc gggcggcgcg gcgcgcatcc cgaggatgac    163320
     ccgggtcggc agatgaaggc gatggccgat gcgatcggat ccgaggccga tatcgccgcg    163380
     ctggtatcct atatcgcgac gctggacccc tgagatgcgg gcctggctct ttctcatggc    163440
     actggccgcg cccgtcatgg cggacgagat cacgctggca gaaacctgtc cgcccagttt    163500
     tcagttgctg gccgacggca cttgcgagtt ggtgacgctc taccagttct acgacagccc    163560
     gcctcagcat ggcgggctgc gcgcccggct cgatccgcca gcgaaccgct atacgccgca    163620
     acagatcgac cttggccgct atctgttctt tgatccaatc ctgtcgagtg gcggcgatct    163680
     cagctgtgcc tcgtgtcacg atccggcaca gggcctgtcc gatggccgca agcgcggcct    163740
     tggtgtgacc gagctgaacc gctcgacccc gagcctgtgg aatgtcggct ttgcgtcgtc    163800
     gctgatgtgg gacgggcggg ccgagacgct ggaacagcag gcgctgctgc cgctgttcaa    163860
     ccccgccgaa atggcggcaa acgccgatgg gatcgaaacg gcactgaacg ccgcaccggg    163920
     ttacgtttca ctgttccaga ccgcctttgg caagagcccg agccttgaga ccaccgcaat    163980
     tgcgctggca gcgttccagt cgagcctgat cagcctcaac agccgctatg accgctatgc    164040
     ccatggcgat gccacggcgc tgaacccaca ggaaattcgt ggcatgaacg cgtttcgcgg    164100
     ctttgtcgca cgctgctcgc aatgccacat cccgccgctg ttcaccgatt tcgaactggc    164160
     ggtggtgggg gcgcccgctg atgagcgcgg ctttgccgat cccggcgccg gggcgctcgc    164220
     ggcggacccg gcgcgtctgg gcgcgttcaa gacgcccacg ctgcgcaaca tcacccgcac    164280
     cgcaccctat ttccacgcag gccagttcga cacgctgaag ggtgtggtcg atttctacaa    164340
     caacaccgcc ggccatgccg cacccgaggg gcaggacctg cgcattcact ggcatgtgca    164400
     catgaccgat gggcccaagc tgagcgccgg aaccgtggcc gatatcgtcg cctttctggg    164460
     tgcgctcgaa gacgagagcc tgatgccccg ccgccccgac acgctgccat ctggattgct    164520
     tccccaggat tgagacaagg agagacttga gatgaccgga tatggaaaga cattcgcctt    164580
     gctgggcacc tgcgccacct tgctgggccc gccgctttcg gcccagaccg gatcggtcct    164640
     gtcggacctg caaaacgaag aggtgcaggc gagatatcgc gccgccgccg ccgaacggat    164700
     cgcttgcccc agaatcgaag gcgacgcggc gctgatggcc gcctttgcca aggacgcagc    164760
     cagcaaatgg gaccgcgccg cgatgggctg cgccaccgag tacggggcgc gcgcgatgga    164820
     ggccctgtcg ctgccgacca acctgatctg ggcagtcgcg acctttcgaa ccgacaatat    164880
     cgagacccat ctgcaggtgt tgggtgccca tctcgattac ttcgaggtcc tcgataagag    164940
     ctattcagcc cattatcagg gcatcgaaat ggcaaccgaa ctgggcctgc gttgggagca    165000
     ggcgcgcgag cggtccgaaa cgctgatgac ccggatcgac ccgctggtcc ccaagctgac    165060
     cgaggcgcgg ttgctgcgcg ccgcctatct tctggcctct acgttgcgtg aaactccgcc    165120
     agaggtgcag aatactgccg tggcggctgc gctcgaggat ctgcagatcg ccatcgccga    165180
     gaatcccgag gccctcgacg ggttggggcc gctgttgctg gggcaggtcc tggcggtgct    165240
     gcccgagttc ctgggcggcg atatcctggc cgcgatcgac ctgctcgaac aggcccatgc    165300
     gctcaatccc accgatctga gcgtccatca caccctggtc gaggcctatc tgggcgagcg    165360
     cgagaccgac aaggcgctgg cgcttctgcg gcacgcggcc agcatcgacc cttcgacaga    165420
     gaacccgcag gattacgcag acgagatgaa atatctcggc ggcctggccc tgcgggccgg    165480
     tgcgccggat ctggcccggc agatggccgg gcaccgcagc gcgatactgg cggcgcatcc    165540
     gcaactcgac ccccgcaagg aaatggcggc ccttggccat ggcggcgccg acccgctgac    165600
     cggcaagaag cccgacgacc tcaactgagt gaacggagac acgcgatgaa aaacactggc    165660
     attctgcgag gggcggtgat cgcctctctt ctggggtcga ccgcgatggc ggcggagctg    165720
     accgtaccct cgggcggcga tattcaggct atcgtcgatc tggccgcacc gggcgacacc    165780
     attctggtcg aaccgggcgc ctatcaccag tcggtctatg tggacaaacc gcacatcacc    165840
     ctgcgcgggt tgcgcaaggg cgacgcctgg gcgctgctgg atggcgagat gaagctcaac    165900
     gacggcatca tcgcctcggg ccattccatc gtcatcgacg ggttcaaggt caccggttac    165960
     aagggcaacg ggatcatgac ccagggggcc aacaacttcg agatctccaa caactatgtc    166020
     gaaggcgcct tttacggcat tttcccgcaa ttcggccgca acgggctggt ggtcggcaac    166080
     accgtcaccg gtgccgagga cgcaggcatc tatgtgggca tgtccgacaa tgtggacgtg    166140
     atcgacaacg tggccttcgg caatgtgatg gggatcgagt tcgagaacac ccgcaacgcg    166200
     ctgatggcgg gcaaccatgt ctacgacaat gccgccggca tcacgctgac gctggtgcct    166260
     ggcctgccgg tcaaggacgc gcattctcag gtcatccgcg acaaccgcat cattggcaac    166320
     aaccacgaga actttgcccc cgcaagctcg atcgcggcgg gcgttcccag cggcaccggc    166380
     attctggtgg tggggcccga caacatcacc atcgtggaca acgagatcgc cgataatgac    166440
     aatgtcggcg tgttcgtggc cgacctgatc acctttggca tggacagcga ccccaagctg    166500
     gacccctatt ccgacggggt ccgggtgctg ggcaacacct ggcgcaacaa cggcgagaac    166560
     atgaacggga tgctggccga catgctgacg gcgaccggcc ggaccgggat cgaggttctg    166620
     gccatgggca agggccgcga cagctgtgtc ctgccggccg acggggtcga tacgctgggc    166680
     accaaccgct ggcaggactg cgccgacgag aacagtgccg ctcttgtcac cgcgcggatc    166740
     gagggcggtg cggacgagcc ggtctatacg cgtgaacaga agggtcgatt gacctatctg    166800
     gcggtctgca ccggctgtca cgcctatgac agcgtcctgc acggcccctc ggtacagtcg    166860
     atccaggcgc tctatgacgg cgacccgagc ggcatggtga actacatctc caatcccgtg    166920
     cgcaagcgcg acggctttcc cgaaatgccg ccgcagacct atcttggcga agagacgctg    166980
     gacgcaatcg cccgctacat ccttgaagaa ctgggtcagt aatgccgtgg atcaggacat    167040
     gttggcctga tccacgctct gagcaaagaa gccaccgcgt cagatgccgc ggtggcggtg    167100
     gtcacgggca acgaccccgg cgggcggccc cggacagatc tttgcctgcc cgatagccga    167160
     tgccggtccc tagcctcaga ccaagggcag gtcccagatc cgcacatcct gatcgtcgaa    167220
     gcggaagtat tccacgtcga tcaggctgtc attgccatcc gggccgacca ccgtcacgcg    167280
     gttctcggca gtccgtgtca gcgtgtaatc gaccagatca ccatcgaaca gcgcatagtc    167340
     cgaagacccg ccaccgtcga tcgtgtcatt gccggcgccc cccttgagat agtcgatatt    167400
     gccgaagcca aacaggaagt cgtccccgtc gaggcccgag agctgatttc ggtcggcaga    167460
     ccccgtcaga tggtcgccaa agttcgaacc gaccaggttc tcgatctcga aatacaggtc    167520
     ccgcgcggcc cagccctggg tcccgtaacc ggattcgttg ccgttcacga cggccccgtt    167580
     acgcaggttc gccgtcaccg cgccgggcgc gttgaaatag gtcaccgtgt cgacaccgtc    167640
     tccgccatag tagcgttcac gcccgccatc cgaggataca aaccagtcga aatcgcccag    167700
     accccggaaa tcgttctgcc cgtcatcgcc ataaaagaca tcctgtcgcg ccgagccggt    167760
     cacccgctcg acgctgacaa gggtcagccc gcttgccaga ttggtgtttt gggtcgggtt    167820
     ggccagattg acgagaacac cggttgcctg cgcgcccgtc ggcggggcgc cgttcggcgt    167880
     aaaggcgtcg ctgatcgtgt tcgggtcggt attctgccat tccaggaacg agatcatgtc    167940
     ctgaccgtta ccgccgtcga tcgtgtcggc gccctcggtc gcgacgatcc agtcgtaatc    168000
     gcccagaccc cggatgtaat cgtcgctcga gctgccggtg atgtgatcgg caaagatggt    168060
     gccggtcagc cgctcgatat tggcgaactg gatccgctcg gccccgtcat ggctgacggc    168120
     cgttcccgcg cccatgtcga tggtcaggcg ataatccagg ttggtccgcc ccggggtgtc    168180
     gggcaggttg aaaaagctca acatgtcatt gcccggacca ccatcgacgg tatccgaacc    168240
     accacccgga gagatccagt cggcgccctc cagaccgttg atgatctccg tcgcggtggt    168300
     gccatccacc gcctcgcctg cattggtgcc gttgatggcg ctggggacgg ttccggccag    168360
     cgccgccgcc tgagccaagg tcagagtgcc atcgttgaac tggacgaatt cgatgtcgga    168420
     cccgaggaaa tcgaccccct gcgacgaggt gagctgaacg cccccggtca cgttctgacc    168480
     ggacacaaac tgctgcgacg tggccaggat ggcggtgtcg gaacccgcgc caccggtcat    168540
     cgaatcgtca cccaggccgc cgatcagcgt gtcatccccg ccgccgcctt cgagcgtgtc    168600
     attgtcggcg ccgccatcca gcagattggc gtccgttgtc gtcactggcg gcaccgtgac    168660
     ccccgtggcc gagatgttca gggttgccat ctgcgtcgac gagatcgtcc caccaccata    168720
     acgttgcagg gcgatgatat aagtgccatc ggccgcaaac gtgtgctgaa tgaaggaatc    168780
     ccgcccgctg gtcgaaccac cggcaccatt cgaggtgctg ctgtcgtcgt tcgacgtgat    168840
     ctgcgtgccg ttgttgtcgt atagcgccag cacggtatcg aaatccgcac cgtcgatatc    168900
     aaaggtccag atctgtccgg cagtggcggt aaagcggaag gcctcctgcg tttcgtcgga    168960
     accggtgatc gcaagcgtct ggtgcggtac ggtggtcgga tcggcgacat cgccaaacgc    169020
     atccagcgac cagttctcgg gcagggtcat cgggttcgac accgggttgc ttaccgtatt    169080
     gtcgaccacc gtgggggcga tcgtctgcgt aacccgcaaa aggtcgtcac ccggtccgcc    169140
     cagcaatgtg tcctggcctt cgccgctgtt caaaacgtcg ttgtccagcc cgccgtccag    169200
     ctcgtcgtcg ccgtcgagac ccagaatggt gtcgttgcca tagctgccgc gcaacgtgtc    169260
     gttcccgggc gtcccgatca gggtctgatc gcgcaaggcc tgcaggtcag tgaggttgaa    169320
     cgtcctgtca gtgaagcgca cgaattcgat gttgcgcagg gtgacaatcc cctggccggt    169380
     gtcgaccctc agcgcatcgt ccggcccatc gaccgaagcg ctggcgctgg taaggtcgaa    169440
     caccgccgta tcggttccgt cgcccccgtc cagggtatcg ttgccgccgc cgccggaaag    169500
     ctgatcggca ccctcgccac cattgacggc atcatttcca agtccgccat tcagggtgtc    169560
     attgccgccg ttgccgttga cggtatcgtt gccctcgcgc ccccagagcc ggttaccatt    169620
     ggcatcgccg tccatgctgt cgtcgccacg accaccgaag gtattgaccg tcgtcagcgt    169680
     ggccagagtc gacaccgcca tagtccggtc gaggaaacgc acgaactcga cattgctgat    169740
     gaccacatcg ccatccgggc tctggatggt gatgggatcc gagctgccga tgatgttcac    169800
     atcggtgctg ttggcattca ccacaaccgt gtcggtatcg gcgccaccat caactgtgtc    169860
     atagccagcg tttccgcgca ggctgtcgtc gccggccccg ccattgagga cgtcgtcgcc    169920
     cgggccgcca gacagggtgt cgttgccacc cgcgcccgaa atcgtgtcat tgccggccag    169980
     acccccgatc gagttggggt tatcgtcacc ggtcaggctg tcgtcaccgt ctgtgcccga    170040
     cgacgcattg atggccgcga tgacattctg ggccgcctgc gagggatcgc tggtgcttgc    170100
     gttgaaaacc tgcccgttgg tctgatcggc cagcgattca agatccgagt tcgccgtcga    170160
     gctgttgccg atcaccaccg gcaggatctg tagcggtgcc gcgccatagg gatccgagaa    170220
     gggggtgtcg gtataatcga cgaaattcgt cccctgaacc tgctcgatcg cgctctgcaa    170280
     cggcactgca ttgccgacag gcggtggcgg caccgcgata tccgcggcga gtgccttgct    170340
     caccacttcg gcacgcaggt gcgggtcgtc ggcatcctca tcggtgaaca cgatgatctt    170400
     gttggatttg ttgcgggtat cccaggtgcc cgcattgcca ttgatggcat gcaacagcgc    170460
     cgtgttcagg ttctcggtca tgcccgaagt cgaggtcgac aggttgttca gcgccgccag    170520
     cgccgccgcc ttgcggtcgg ccacgctgtc atgcttggtg aacgacaggt tggtgaccgt    170580
     gttgctgtcc caataggtga cgatcgccag ggtactggcc accggtttct cggtggttcc    170640
     gaacagggca ttggcgatct cgatcgccgc cgcctttgcc gccgcgatgt cattggacat    170700
     cgagccggtc ttgtcgatca cgatcaccac gttctgacca gggcaggcga actcgccggt    170760
     ggtcaggttc atctcgccat cggcgaaacg ggcatattcc acatctttca gcgtatcggt    170820
     accatccggg ctgttggccc ggttgtccgc aatcgtgatg gtgccattgg cattggaggt    170880
     gatcgtgtag tcgctgcaat tgccgctgaa cacggcccgg tcagtcccgg tgccaccgtt    170940
     caccgagtca ttgccgccgc cgccttcgag gacgtcattg cctccattgc cgtaaagata    171000
     gtcggtgccg ttgcccgact tgaaatagtt gctgccgttg ccgcgacccc aaagcaggtc    171060
     gttggtggcc ggattgttgc ccgaagtgtc ctcgttgccc gagcgcgcca atgccaggtc    171120
     gatggcagcc ccgccggtgt aatcggtgcc gggaatgatg gcggtgtcgg aatcgacgcc    171180
     ttcataggac aggcggttcg atttcgacat ctcgtcgttg atggcttttt caaataccag    171240
     cgtcggcccc ttggcgctgt cggtgctggt cgtgccccgc gggctgtccc cgatcccctg    171300
     gagcgcgtga acaagttcgt gccgcaagac atgttcgatc tcgaccgcaa cacctttgcc    171360
     gttggcatcg aaataggcca gattggcaac cgccgcgaaa tccagctcga cccgaccggt    171420
     tcctctaaag gcctgggcct ctccggcaac gaacttgatg tcgagcggca aggcggcggt    171480
     gaccttgtcc aacaggatct tgcctgttgc cgaattcgcg tacatgtcgc gcagcgcgtt    171540
     ttcgagaatt gttcgctgcg cggccgtgta accggtgaat gtcgtatgcg acaaaactgt    171600
     ttcaatagtc atgttcgttc ccccaaatgt gtaatctgct gtcggtgcgg cctctctttc    171660
     cgcaaccggt caattcctac ctcgtacccc acgagatcac tcggtaacct cacgcaacgc    171720
     atcgtgccac caggcgtcac cgctcccggc ttcgctggcg agaagcgcaa ctccatggcg    171780
     gataagcgcg cgatacaggg cttcgtaaaa tgcagtgctg ctgccgcgcg cggcttcgat    171840
     ccgtttcatc acggtcatgt cgaacggagc gaaaaagttc tgtggcgccg aacgaaacaa    171900
     ccaggccatc ggcccggcaa atgtcggggg cacgcattct tgcccggcga cccagctttc    171960
     gggcggctgg ctggcggaaa catgcgatac ataggactcc gcagcttgcg ccagacagga    172020
     aaatgtcatg ctgcgccaac ccggtcctgt ccggtaatcc gcgggcgcgg cgccgcgcgc    172080
     ctgcaaggcg ccgtctgcga tcacgcgcag gtcggacacg aacagggtga gcgtcaggcg    172140
     ccccgtcccg gtccgtgaca ttgtcagcca gggcgaagcc agctgtgccc ctgccggtgg    172200
     ccaggaaacc ggtcccgctg tggcatccgt aaaggccgga gccgtcacga caaagatatc    172260
     ggcggacgcg ccgcgctgac ccgctgcggt caaagccgcc tcaagcaagt cgcgatgctg    172320
     acctgccaga gcaagcgtat tctcatccgc ttcgcgctga ttgctgacac tattcaggat    172380
     gtcgccggat gctgccgaca cagtcatttt ccaaccgccg tcttcattgc attccccctt    172440
     tgcaacgagt tccgtaccga gaaaaccaag caccaaaaca agacccgaga gcaggcgcgg    172500
     ccctatcatt cccttcgctt cacctgccat ttcgttgcgc atgcaactca ccaatcaggt    172560
     ctttcaatcc gtttcccccc tagggcagaa gcctgtatcc gcatcctttt cacctgctga    172620
     tgcgcatctc cccaggatcg acttattcca ttcttaatat ggatcgcatg cgcgagaatt    172680
     gacgcagatc aatcttcgaa aaactgcccc cggacagggt aacaacaatc aatggtcaac    172740
     agagttttat tctggttttt taacaactaa gcgtccaaag ggctggcttg acgattttgt    172800
     ggaaacgatc ctaggcgatt tgctgacaca tttcaaatcc cgaatggaag gaggaatcgc    172860
     tctcctcgcc actccgtcaa cggcatgaca acgggaccgg tctacgcccg gtccccgcta    172920
     catgtccgca gggcgatcag accccgccca gcagaacgaa accgatggcg atagccagca    172980
     ggaacagggt ttcgaccacc aggatcaccc catagctcgg cttgacatgc gcgatggtgg    173040
     ccaggctggt cttgaccccc agcgccgaga tcgcgatcac caggcaccag cgcgacaggg    173100
     tgccgatggc gtcgatcacg acctgaggga ccacgccggc attggccagc accgccagaa    173160
     cgatgaacat gaccaggaac cagggcaggg tgacccgctg gctttgcgcg ccgcgaaaac    173220
     taaacatcac gaccagcatc accaccggaa gcagggccac ccgcaccatc ttgacgaatg    173280
     tggcgatcac ccctgcctcg tcgctgatgg aatagcccgc gcccaccacc tgcgccacgt    173340
     cgtggatggt ggcgccgatc aggaaccccg attgcaggtc gctcataccc aggctggcga    173400
     acaggatcgg ataggcgatc atcgcgatgg tcgacagcgc ggtcaccccg atcaccacga    173460
     acagcgtgtc ctgctcgcga tcggcccgcg cgggcaggac cgaggcgatg gccagcgcgg    173520
     ccgaggcccc gcagatagcc accgacccac ctgccagcag gccaaaggcc atgcggcgac    173580
     caaaaagata ggacagcatg gcgccacagg cgagcgtggc cagcacaaag cccccaaccg    173640
     cgcccacggc gccatagccg atgctttcca catcgccgat gctcagccgc aggcccagca    173700
     acccgacccc gaaccgcaac agtgtcttgg ccgagaagtc gaggccgggg gcaaaggcgg    173760
     catcgcgatg cagaaagtga aaggccatgc cgataagcag cgcgaacagc atcgccggcg    173820
     ccccgtaatg ctcggacaga aaggtagcgg cggccgccac aacgcaaacc agtagaatgc    173880
     caccgaagtg ggtgtcccaa cgggacttga gcgccgatac catcggttat gtccttggca    173940
     ggaaaggggg ggtaggggtg gccttaggcc acccagcgtc ccgaatagtc aaaggcgttg    174000
     tcatagccga acagcgccac agcgccgccg gtatgcagga acaccacccg ctcgcccttt    174060
     ttgaaatgac ccttgcggat caggtcgatg aagccagccg cgcccttggc cgaatagacc    174120
     gggtcaagca ggatcgcctc aagctcggcg aacatgcgga tcgcctccag cccgctttcg    174180
     gtcgggatgc catagccttc gccgacatag tcggtattgg ccaccacgtc ctcgcgcgcg    174240
     acgacaccgg ggcaacccag cttctcggcg gtggcgcagg ccaggttata gacattctct    174300
     tcctgcttgg gcttgggcgc acgcacgccg atgcccaaga gcgggatctg agcgttcatc    174360
     gcctgaagcc cggtgatcag ccctgcctgg gtgcccgcgc tgccggtggc atgcacgata    174420
     tggtccacct tcagcccgcg ctcattgaac tggttcagca tctcgaaagc gcagttgaca    174480
     tatcccagcg cgccggtcgg gttcgagccg ccgccgggga tggtatagac cttgcgcccg    174540
     tcggcgcgga acttctcggc caccttttcc atctcggcat tcatgtccag accgctgccg    174600
     gggcgctttt cagtggtggc gccatgcaga tggtcgagca gaacgttgcc gttgttgttg    174660
     tagttggcgt tgttcgagcc ggtccggtcc tcgagcagga tatggcaatc catgcccagc    174720
     ttggcggcga atgcggcggt ctggcgggca tggttggact gggtcgcgcc ctgcgtcatc    174780
     accatgtcag cgccttgcag ctcggcctcg gccatcagga attccagctt gcgggtcttg    174840
     ttgccgccgg tggacaggcc ggtgcagtcg tcgcgcttga tccagatctc gggcccgccc    174900
     agttcggcgg tcagccggtc cagccgttcc agcggcgtcg gcagatgggc gatgaagcgg    174960
     cggggatagc gggcaagatg catgggctta actcctgaat tgggtttagg gcaacttacc    175020
     ctcgaattta cgggcaatct aatgcaaact gcgcgggata acatgcatga tcggcatatt    175080
     agtggggcag ggcgatgcaa ctggactgga tcgacgacat cctggcggtg attgacaccg    175140
     ggtcgcttgc ggcggcggcg gaacgccggc tgttgaccca gccggccttt acccgccggg    175200
     tgcgcgggat cgaggaacgg atcggcgcgg cgctgttcga ccgcagccgc aaaccggtgg    175260
     cggtgctgcc cggcgtgctg gcactggaac ccgatctgcg cgaactcagc gggcggttgc    175320
     ggcggttgca gcaggatctg cgggtctcgg ccgaggatgc ccggcgcggg gtcaccttgg    175380
     tctgccagca tgcgatcacc accaccatct cgccccggat cgtgcgggat ctgacggcgt    175440
     ctcaggatat ctcggtccgg gtgcgttcgg gcaaccggga tgaatgcctg atgctgttgt    175500
     tgtcgggcga ggccgatttc gcggtcgcct acgaggtgcc gggcgagcgt gacccgatgc    175560
     tgccgcaggc ctttgaccgg gccgagctgg aaaccgacct gctggtccct gtccatgcgc    175620
     cggggctgga ggcagcgggc gcgcgcaccg caatgccggt gatcggctat ccgccggatg    175680
     tgtttttggg gcaggtgttc gaccgctttg tcgcgccgcg cctgccggcg ggtttcacct    175740
     acgaggtgcg cgccgagacc gcgctgacac tcgccgcctg cgaatatgcg ctggggggca    175800
     tcggggtggc ctggctgcca ctgacactgg tggcgccgca tctggcggcg gggcggctct    175860
     gccgcgccga tggcctgccg gaacagccgc tgacggtcac ccttatgcgg ctgtcgggcg    175920
     ccagtgcgcg ccggggcgat cgaagctggc tgatgctgtg tggccagccc ggtgtttcgt    175980
     caggcccaaa ggactgatcg cctcgccggg caataggcgc cctccatccc aaatttgtgc    176040
     cgcatgcgca tttgagcagg gccttatctg gcattctggg tcagcagttc gggcagccat    176100
     gtgaccagcg cgggaaacag cgcgaacagg atcaggatcg caacttggat cagaaagaac    176160
     gggatcactc cgcgatagac ctgcccgatc ccgatgcctt cgggcagcac gcctttcaga    176220
     tagaacagcg tatagccgaa cgggggcgtg atataggcca tctgggcggt gatcatgaac    176280
     agcaccccga accacagggg gtcaaagccc agtgtgtcga cgatgggcag aaacaccggc    176340
     acgcacagca ggatgatccc gatctcgtcc aggaacaggc caagaaagat caggatcagc    176400
     accatcgccc ccagcacgac ccagcgcgag gcctcgagcg tttcgacaaa ggtcaggatc    176460
     gaatccgcac ccccggtggc aacgaagacc gagatgaagg cacgagcgcc gatggtgatc    176520
     caaaggatca tcgcagtgac acgcaaagta tcggtcgcgg cgtctgacag gaccgacagg    176580
     cgcagcttgc cggtgaccag cgccgacagc atcgcgccaa gcacgccaac ggcggcggcc    176640
     tcggtcgggg tggcgatgcc ggcatagatc gacccgagaa cgccgataac caccagggcg    176700
     ggcaaaatca ggcttttgag tttgccgagc ttgactgcca gcgggatcgg tttcaggtgg    176760
     acaggtttcg gcgcaagcgc cggattgaac caggtccgca ccagaacata agccatatag    176820
     ctgcccgcca gcatcagccc cggcacgatc ccggcggcga acatctggcc gatcgagatc    176880
     tgggcggtga tcgcataaac gatggtgacg accgatggcg gaatgagaat gcccagcgtg    176940
     cccccggcgc agatggcgcc aagcgcgaga ggcgggtgat aaccgcgcga caacatcgag    177000
     ggcagcgcaa gaatgcccat cgccgcaacc gccgccccca ccacgccggt catggccgcc    177060
     aggatggtgc agatcgcgat ggtgcccacg gccagcccgc cattcaaccg cgaaaaccag    177120
     gtttccattg cgtcatacag cgcgtcgatg atcgccgatt tctgcaggat cgaggccatc    177180
     agcacataaa gcgggatcgc catcagcgct tcggatgtca tggtctcgaa cgtgttcagc    177240
     accgcaacga tcagcgccgc ggggccccaa agcaggatcg tcgagataaa ggcgatggca    177300
     cccagcacga atgccagccc cgcgccgctc agcatgaagg cgacaagcga ggtgaacatg    177360
     aacagaagga cgaaagagct ttccatcagg cgtgtatctc ttccgcgaat atgtcgatgg    177420
     catccgcgat ggcctgcaac accagcaaca gcgcggaaag aggaaggaac gccttggcgg    177480
     gccacagaac cgggttccag gcggaatagc tggtttcgcc gtactgatag gattgcagaa    177540
     ccagcggcag gctgaaccag agcaggatga tgccgaaagc cgccgccagg accagaccgg    177600
     cgagccgcaa gcccgtcgcc agtcgcccct gcgcacgcgc cgagagcacg tcgaccgcga    177660
     catggccgcc aagatgcaac agataagggc cgcccagcaa gaagaacggg ccaaagataa    177720
     gtgttgcaaa ctccggtgcc caggatgtcg ggtgctcaag aaaatagcgc gatagaactt    177780
     cccacagcat catcagcgca atgatgaaaa cgagccatct ggcgcacatg aacaggttgt    177840
     ggttgagcgc ggtaatacgc cgggcgagag atgtcatgaa ttacctcgag agacgcaacg    177900
     accccggcac cgcgtgccga ggtcgatagc tgttttaccg gttcagagca ggcgcagttc    177960
     ctgcatcagg gccatctgcg attccatcat ccgcttggac aggtcatcgg ttgccgcctt    178020
     ggcccaggac tccaccgctc tttcgcgccc ttgcacaaca tcggccggat caaagtcaat    178080
     gatctcgaca cccgcatccg cgaatttccg caggtattcg ccgttggaca caaggatgtc    178140
     ctgacgcagc gcgcccgaga cttcgcgcgc ggcgacggcc agcgcggcct tctgctgatt    178200
     gtccagcgct tcgtaggcgc ctgtattggc gatgtaagag gttgcggtcg tcggctggtg    178260
     gacgccggga aggatcaggt atttggcgac ctcgtgaatg ccttcctcgt aattggcctt    178320
     gatgtcgccg cggtcggcca cgtcgatcag ccccttgtcg agcgccgaat agacctccga    178380
     agtgggcagc ggcgacaccg caaccccgaa atcggccatc accgcggacg caagcccgac    178440
     aaagcggccc ttgaggccct tgaggtcggc gatttcccgg atctcgacct tggaatggat    178500
     cggctcttcg ccatagacgg tgggcgccac ataggtcagc ccggccgccg catagctttc    178560
     gcgcgccagg tccagaccgc cccgctcata gaaccatgcc tcgtactggt ccggttcggg    178620
     aaagccgaac ggcaccgtgg acgagaagcc atgcgccggg atcttgccgg cggtatagcc    178680
     atcaaaggtc ttcatcatct gaaacgcacc gccccggacc gcatcaaagg cctgtgccgg    178740
     cggtacgatc tggccgcccg aaaacggcgt gatctcgagc gtgccgccag tcagttccaa    178800
     aacccgggca cagaacttct cttcatagag catgggcgtc gtgccgccgc cccaaagggc    178860
     ctgcatccgc cactgggtca ccccctgggc gcgggcggct ccgccggtaa gaatggcagg    178920
     cgcggctagt gccacggcac ccagttgcaa cgcgttccgt ctgttcaaat ttgtcatttc    178980
     ttttcctccc ttatgaagct gtcaggtgtt ttccagcacc tgttttgcac gggccacgct    179040
     gacgtcgccc gcttcgacaa tgacccgggt gacgcggtcg atatcggcgc ctgttgcgcc    179100
     ggccatgatc gcgatgttgc gcgcatgaag ggtcatgtga ccgcgctgga tgccttcggt    179160
     cgccagcgcg cggatggcgg ccatgttctg cgccagaccc acggcggcgg tgacctgggc    179220
     cagttcggtt gcagtctcta cctgcatcag ggccagcgcc gcccgtgcgg tcgggtgcgt    179280
     cttggtcgcg ccgccgacaa ggccaagcgc caggggcagt tcgatcgtgc ccacaagccg    179340
     cccgtcattc gccagttccc agcgggtcag cgaggtataa tgacccgtgc gggcggcata    179400
     ggcatgggca cccgcctcga tcgcgcgcca gtcattgccg gtggcgacga cgaccgggtc    179460
     gatgccgttc atgatcccct tgttatgggt cgccgcgcga taggggtcga cgatggcaag    179520
     cgcgcaggcc tcgaccatgc cccgcgccac gtcggcgccg tcatagccct gcgttgtcag    179580
     tgtttccggg gccagttcca cccgcgcccg gaccaatcgc aggtcggcga ggttcgacag    179640
     gatgcgcagc cgcacggtgc caccggcaat ccgctcgacc tcgggggcca gccgttcggc    179700
     catcgtgttg accgtattgg cccccatcgc gtcgcgcaca tcgacgatca ggtgcaggac    179760
     gaccatcgcg cccaccggcg tatcccggaa cacgtgaacc tcgatatcgc ggcagccgcc    179820
     acccagcccg acaagcaccg gatcgacagc gtccgccgcc tccatgaacg cggccttgtg    179880
     ggcgaggaga cgctgccggg cgccctcggg atcacccaac ccgaccacct ggatctgggc    179940
     gcgcatcaag ggcgcggtgc catgcgcggt gaatccgcca ttctcgcgcg cgatacgcgc    180000
     catataggac gcggccgcca ccaccgaggg ctcttcgacc gccatcggga tcagatagtc    180060
     gcggccgttc acagtgaaat tcgtggccac gcccagcggc agttcgaatt tgccgatgac    180120
     gttctcgatc atcccgttgg ccagcgagag gggcagggcg ccgttacccg ccagcgcgct    180180
     gatcgcctcg ggctcgaggc ccgccgcctc ggcaacgcgc accagccgtt gtgcggggtc    180240
     gagatctcgc atcttttcaa tgcgcgagtt caaaccatcg atgtgacccg tcttgcctgt    180300
     catctgatcc tccagttatt cgccagacct atctgcgaaa accgggcaaa ataagttaca    180360
     gttgccagca gttcttgaaa actgtacccg ttcaaagaag ggatcagtgg caggcgcgcc    180420
     gagatgaaga agatcgatcg agtgatcgaa agcatccaaa gcaggataac cgagggccgc    180480
     ctgaaacccg ggcagaagct gccgtcgatc cgccaggcgg ttgacgagtt cggggtctcg    180540
     aaaaacacgg tgatcgaggc ttatgagcgc ctctcggcac gtggcctgat acggtcggtg    180600
     catggcgctg gcttttttgt ctgcgccagc acgcccgccc cattgagcaa ggccacgcaa    180660
     cccgcgcata tcgtcgaagc cgtggaccgg ctgacgcttc tgacggcgca gcttgaccaa    180720
     gagaagctgc ccgttcgcgt cggcgatggg cgcccgccgc aatcctggat gaatgacgct    180780
     ctgccgctgc ggatgaaggg gaatatcttc aagaatttcg tcggcgatcc gtcgggttat    180840
     ggcggggtga gcggccattt gcagctgcgc gagttgatcg cggcgcgcag caatcgggcg    180900
     gatatgagcg tgcacccgga ccagatcgtc acgacctttg gggccaatca cgcgctggac    180960
     ctgatcatcc gccgctatct ggaacccggc gatgtcgtgc tggtcgacga cccgggatat    181020
     tacccgctgc ttggcaagtt caagcttgcc aagatccggg caatcggcgt tccccgcacg    181080
     ccaaccggac ccgatcttga cgtgatggag acgctggccg cggcgcatgg gccaaagatg    181140
     ttctttaccc agtcgacctg tcagaatccg accggaagct cgatgtccct tcccgtcgcg    181200
     catggggtgc tgcaagtggc ccagcggttt gggctgatgg tcattgataa cgacccgttc    181260
     accgatctgc cgggcaatgc cggtgtcccg ctttcagccc ttgatgcgtt caactcggtc    181320
     atcgcgattt caagcttttc caaacttctg tcggccagct tccgcgtcgg ttatgtcatt    181380
     gcccggcccg aggtggcgcg cgagctgacc gaactcaagc tgctgacggt cgtcaattcc    181440
     tcgcgatttt ccgagatggt gatcgccgaa ctgatcaaga gccagcgcta tggccgccat    181500
     ctgaacaagc tggtgaaccg ccttgaagag gcgcggcggg actatcaccg aaaggtgcgc    181560
     aaactgggtc tggatgtctt ctgcgcgcag gagacggggt attacagctt tctgcaactg    181620
     ccacataccg tcgacgaggg ccaacttgtg cgcaaggcga gtgctgccgg tatcatgctg    181680
     gcccccggac ggctttttgc ggtggacgag aacccggcgc gcccggcgct gcgtatcaat    181740
     gtgacccgcg ccgacgatcc ccgtttctat cgttttttga agcgacaggt gatcgacggg    181800
     caggtttgag cgcgcattga taggaccgat cgaaccgcac cctcgccccc gagggatcgg    181860
     agacctagct gtgatcggcg attatctcac gcacatggtc gctccagcca tcgacaaagt    181920
     cctgcgccag caaggacaat gggcgctgtt tcggggtcac gatcgaataa ccaaagcgga    181980
     ccgaaggtag gaaacgggca aaccagattc cgacctcgcc accattcatg cgcttgtatg    182040
     tttccgcgct cagcgggtcg agcacggtac agatctgccc ggcttcgaca aaacgcagaa    182100
     gggggataaa gtactgcgcc tcgaccctgg gattgaatac cgcccccgcc tgttcgaatg    182160
     cggcgcgcgt atcccggttt gtcgaatgag tgccagcaag aacgcccatt ctttcgccgc    182220
     tcagctgccg cgcgtcgatc accgcgcgcc cggcaagcgg atgctgggcg ggcaacgcgc    182280
     agagacagtc gctcatgatc gttttggtgt gatagaggct gctgttcaga tcctcggcgg    182340
     acatgtcaca gaaaccaagg tcacaaaatc cgacgtcaaa ggcctgggcg gcgatcaggt    182400
     tcaggatttg cggagaactg cgcgtcgaca gcgaaatctt cagatcatcc gccttcgacc    182460
     cgaaccggct gacaaaatcg ggcagcagat agaccgacgg gccgggcatc ccgacaacgc    182520
     tcaacgagcc tctggtgcga ttgcgcatgc caacaaggtt catttccgtg gtgttcacgc    182580
     gcgcaaggat ttccgccgct tcggagagca ggtaatgcgc ttcgggcacc ggcaccaggc    182640
     gccgtccttc cctctcgaaa agtgcgatcc ctagattgac ctccagcgcc ttgagcgacg    182700
     cgctgaccgc gggttgggta cggccaagat tgcgcgcggc cgcgctgacc gagccggttt    182760
     ccatgacttc gcgaaagacg gcgagctgtt gcaggttcat accgcgagta tatcagcaaa    182820
     atctattaaa accataaaat taccaattgg attttatgac tgtgatttcg cattgatggg    182880
     cgcaagcgcg ctctggctct gcagaggctg ctgacacgac ttgataacag ggagaaacaa    182940
     atgggacttc agaagtattt catcggggcg gcccttgcca cgctggtttc cgcgggctct    183000
     gtcgcggcgc aggatccgac ctttttccgc atcgggaccg gaagcgccgg cggcacctat    183060
     ttcccgatcg gcggcaccat cgccaacggc atctcggccc cgccgggctc gcgcccctgc    183120
     gaggagggcg gtcagtgcgg cgtgccgggt ctgatcgcca tcgcgcaatc aaccacagcc    183180
     tcggtctaca acaacaccgc cgttcagaac ggcgagcttg aggccgggct ggccgcggcc    183240
     gatgtgaccc gcgacatgta tcttggcgag ggcaagttcg agggcaagat ccacgaaaag    183300
     ctgcgcgtca tcgcaaatct ttaccccgag gacctgcatc tggttctgcc aaaaggcgtc    183360
     acaatcaaca atcttggcga tctcaagggc aagcgcgtcg gcatcggcca ggctggctcg    183420
     ggcacccagg tcgcggtgct gcagatgctc gagaactggg gcgtgacccg cgacaatatc    183480
     gaagaggccg agctgaatct ggcacaatcc tctgagcggc tcgccgacgg tcagcttgac    183540
     gcctatttct atgccgcagg ctggccggtt gccgccgtgg ttcagcttgc ctcgaccaag    183600
     gggcttgagc ttcattcctt taccgaagag gacatgaaag tcatcaacga catcatcccc    183660
     gcctatatcc cgtcgaagat cccggccggt gtctacgaag ggctggatta tgtcgttaac    183720
     acgcccgctg tcagcgcgct gctggtcgtc tcctcggacc tgagcgagga gctggtctat    183780
     ggcatcacca aggcgatgtg gaacgacaac acccgtaacc tgctcgacaa cggccatgcc    183840
     aagggcaagc tgatcacact ggaaacggcg cttggcggca tggacaatct tggcgtgccc    183900
     ctgcacccgg gtgccgagcg tttctaccgt gaggccgggt tgctgaaata agcgccagca    183960
     gtttcgctcc cggtttgggc ggcggcctct cacaccgccg ccccaattta ttgatagcgt    184020
     gccagggaaa ccgccatgac tgacgccacc tctcagaaga ccgacaccct tacagccgag    184080
     gaactggccg cgatcgagga aaaatacgac gagagcgccg caacccggcc ggtttcgccg    184140
     ggctttgccc gctttctgaa agtggtcgcg ctaagctttg ccacttatca ctatctgact    184200
     gccggtttcg ccctacccac agaccactgg catatgggct ggcacctgtc gggccttttc    184260
     atcctgacct atgcgctgtt tcccgcgatc cggacacgtg gaacctatga cctcaagacc    184320
     ggcctgatgc attacggcgg cgttccctat ctggacatcc ttctgatggg gcttggcgtg    184380
     gcctctgcgc tttatctcgg ttttgcctgg cgtggcgtgc cctggctggg gatcgaggag    184440
     cagacattcc gcatgggtaa tccgaatggc tatgacatgc ttttcggcag tatcctgatc    184500
     gttctcgtgc ttgacatcgc ccgcaggacg ctgggctggg tgctgcccgc gatcatctgc    184560
     gtcttcatgg cctatgcgct tttcggtccg gtctttcccg gcatcctgca acatcccggc    184620
     gtcaagatcc gcacctttgt ttcgtcgatg tacttcccgc aagagggcat ctttggcgtc    184680
     accctctggg ttgtctcgac catcgtcttc catttcgtgc tgttcggggt gatcgcacag    184740
     cggaccgggc tgggtcagct tttcatcgac aacgcaacca tcctggctgg gcgttatacc    184800
     ggcggaccgg ccaaggtctc ggtggtgtcg tcggccttct tcggcaccat ctcgggctcg    184860
     tccgtggcca acaccgtctc gaccggcgcg ctgaccatcc ccaacatgaa gcggctgggc    184920
     tatccgggcc atttcgccgg cggggtcgag gccgcagcca gtgccggagg ccagatcacg    184980
     ccgccgatca tgggggccgc ggccttcatc atggccgagt tcctggaggt gccctatacc    185040
     accatcgtca tcgcggcgat ctttccggcc ttgctgcatt acgtcggcgt cttcagcgtc    185100
     gtccacctga tggcccgccg gctgaacctt cagggcctgt ccaaagagat gctgccccgc    185160
     cttggcgcag tctggcgcga aggctgggcc aatatggtgc ctcttgtcgg gcttctggtg    185220
     gtgctctttt ccggctacac gccctatatg tcggccttct gcggcatttc gctggcaatt    185280
     gtcacaggca tggcgcgcag atcggcgccg gtcacgctgg cctatccggc cgctttcatc    185340
     gcctttgttg tctggaaatg cacgggcggt ggctttgacc tgccgatgtc ggcccttctg    185400
     gtcgcgctga cgctgttggg aagcctgaac ccccaagagc ggatccgcct gccacaaatg    185460
     gccgagacct ttgaaaccgg cgtcaaatac gcgctggcag tcggcgctgc tgccgccgcc    185520
     gtgggtatcg tcgtcggcgt catcaacacc accggcgtcg gctttcgcgt tggtttcatg    185580
     gtcacgcaaa gcgcaggaga actgggcgcc agcctgcatt ccctgctcag ctttggcagg    185640
     ttcgagctgt tctcggtcac cgatatcacc ttgttcatca gcctgatctt catcgcggtc    185700
     gcctgtatcc tgatgggggc gggcataccg accacggcgc tttacatcat gctcgtctcg    185760
     gtcgcgcagc ccgcgctggc tcagcttggt gtgccgccga tcgccagcca tatgttcgtg    185820
     ctttattacg gcgtcgtggc cgagatcaca ccacctgtct gcacctcggc ctatgccgcg    185880
     gccgccatcg ccaattcgaa tccgttccgc accggcatat ctgccttcac gctggggctg    185940
     ggcaagatcg tggcaccgat ggccttcgtt tatgcgcccg tccttctgat cgtttcgcag    186000
     accgggttcg acctctggac cttcagctat accgcgacca gttgtatcct gggcgtgatc    186060
     tgcctgtctg tggccgttgt ggggtactgg ctggcgccaa tgggtgcgct atttcgtgtt    186120
     cttcttgcga tggccgggct ggtctttatc gcgccctcac tgcaggctga cctgatcgcc    186180
     gccctgatcg ccgcaccagc ggtcctgagc cagatcgtcc tgcgccggcg caccaccgag    186240
     gcgggatgag gcgatgtcag aggaaatcac cgttctgggc gctggtatcg tcggaatctg    186300
     cacggccctg tccctgatcg agcgcggctt gaaggtcacc ctgattgacc gcgacgcacc    186360
     tggacaggcc acctcgtttg gcaatgcagg cgtcatttcg ccctggtcgg tcattccgca    186420
     atccatgccc ggcatgtgga agaaagtccc cggcatgatg ctggacccgg tcggcccgct    186480
     tgcggtcagc cccacctatc tgccgcgtct ggcaccttgg gggatgcggt ttctggcgga    186540
     gggccgcgaa gcccgcgtgc gcgcggtttc agcagcgatg gagttcctga accgggattg    186600
     catcgacctc taccggcgcc atctgaaagg caccgggcac gaggggctga tccgcgacag    186660
     ctattacgtt cacgcctatc gcgatgccag cgccgcacgc ctggatacgc tggatacgga    186720
     attgcgccgc cgcgccggtg ccgaggtcga acggatcgac gccgccgatc tgcgcgcatt    186780
     ggagccggcc ttgtcaccgg atttcaccgc ggcggtcctt atcaagggac aggcccgtgc    186840
     gctgtcgccc ggccagctgg gcgcggtcct ggccgacaag ttccagcagc ttgggggcag    186900
     gttgcgccag acgtcggtgc aatcgctgca ccggcaggac gatggcggct ggctttgccg    186960
     cacggatcag ggggacctca aggcggctaa gatcgttctg gccatggggg tttggtcggc    187020
     acggcttctg tcgccgcttg gagtccatat tccgcttgaa gccgagcgcg ggtatcacgt    187080
     caccttcacc aagccgggga taacactcaa tcactcggtc atggatgccg agatgaaatt    187140
     tgtcgcttcc tcgatgaccg acgggctgcg ggtcgcgggc acggcagagt tcgcaggtct    187200
     tgacgccgcg ctcaacaaac ggcggcttga cggtttggtc agactggcat gtcgcctgtc    187260
     gccggatctg actgccgagc cccacgccac ctggtccggc cagcgcccca gcctgcccga    187320
     cagcctgccc tgtattggcg aggtcgaagg cctgccgggc cttgtcgctg cctttggcca    187380
     cagtcattat gggcttatga tggcgccaaa gaccggcgag ctggttgccg atatcgtgac    187440
     gggacggatg gcgaacaccg atctctcacc ttacaaggca acgcggttca aacggttctg    187500
     gccagtgagc aatacctgaa gcgcgactct ttttgacaaa gagggtagcg cgctctgctg    187560
     cacatctaga agctcataat gatgattatg ttaatacatc aaccaatgcg caggctctac    187620
     tttgtgagca ttgagaaatc cgagcgttga gttctatcgg ttggccaaca gccaatcagc    187680
     cgatcagtct cgcgtccgta tcttcatgag tttccccggc agccattcgc gcgaaggctg    187740
     atcgccatcc ttcggccaaa accacaagtt cagccaatgc cgctgcatct ttcgatgtga    187800
     tgcggcgagt caggcgcgcc cgcgtgaccg tttcaacggt ccattccggg tgatggcgct    187860
     caataaggct aatctgatca cccggggata cctgccctgg ttccaggacc cggtaatacc    187920
     agccggttcg gccagttttc tggaacagat aggccatctt ggcgttaccg gtatgctcgc    187980
     tgaccttcca acagggttga cgaccctgac tgacctcgac aattgcagtc cccagacgca    188040
     gcctgtcacc gatgcagata ttggtctcgg tgatgccgac agacacaatg ttttccccga    188100
     acgccgcggg cacggcctcg gccgggatct ggccttcggc aatccagctc gggtaatggt    188160
     cagacggata gtgatggatg gccttgtcgt gaccgccgtg atggtcaaga tcagcctgcg    188220
     catccccgat aaatccgaat tcattgattt cccggcatcc cccgacagct gtctttccga    188280
     tggccgatgg cgggcgtccg ggccatcttt cggcgacact gcccaggaaa ataccatcaa    188340
     ttcgagcgtt caatgttggt tcggtcataa ggggtcctgt tcgtgacaaa tctgttcggt    188400
     ttccggcggc gccagttttt ctgaaagcag gttgcaatag ccaccgccat tgctgctggt    188460
     gaaatgcctg cactccttgc acaagccgaa gggttgcccc ttgttctgtt ccagcaaact    188520
     gttcagcgtc gattgcagcg tagaaagcaa cgcgttctgt tcagagctgt ccagactttc    188580
     cagaccggaa atcagcaaac gggggcgggc gagcagcgcc ctaccctttt gcgtcagatc    188640
     gaaactgata acccgcttgt ccgactgaga acgcttttca gtgacgtagt tcttttgcaa    188700
     caacgccttg aacgtctggg aaatcgtgcc gcgcgtcgta cccagaaacg cggccacatg    188760
     tgaagggctg cgcgaaaact tgtttgcgcg tgacaggtat tccagaaccg ccctttgcgc    188820
     cgggtttaga tcttcggccc agctttcaga cacatccagg cgggcgagtc gcatgatcag    188880
     ctctcgaata tggtattcct tgctcatcag caaatggtag cgacccgaaa taaaacttgc    188940
     aatagtttag actcgctact aaatattctc caccacacag aaaggaactt cgaatgaaaa    189000
     ccacatcagg attcgctctc gctgctttgg ttctatcagc ggcgtcagca acagctggcg    189060
     gtgatcacgc caaccatgca atcaaacagg aaggcgccat caaatccgct gtcgatggtg    189120
     ggaaagtcgc tgcctttgac atcctggctg cccacgctca tcgaactggg aatgtggtca    189180
     ccttccacat gaccacaaac ggtaaagccg gtgaaaatgt gcccgccgcg accggtgcgg    189240
     ttggaggatc ggatgtctgg acctatgtct ggccaacatc gcttgaacct tctgccgtcg    189300
     gctttgagga aggtaccgga attctggcca tggccgccac aagccatccg gatttcgatg    189360
     ataccccact ttatgacgaa aaccttgacg gtgacccggc gaatgacggt gtcatctggc    189420
     acagccactg ggtggttctg accccgaccg aagaatgcgg tacaggcgcg ctggcggtgc    189480
     gcgatatccc cgaaggcgca accccgaaac ttcccgcgac atggccgggc tttccgatct    189540
     tcctggacag cccgggattc tcgccggtct tcgacggccc ggagattacc gtcaaagccg    189600
     cattcaacag cgacatagag ctgggcggcg tcagctatga tggcgtaaca tcggccctga    189660
     aggtcaacgc caatgtccat tcgccactgc tgtgcgtcgt ggacgtcttt gacgttgcct    189720
     cgggcaatct gagccttccg ggcaaaatcg agtaaactga aggtgcggcg gaaacgccgc    189780
     gcttcaacct acctggaaag gaaagcgaaa aatgtccgaa acatggttgc cgacattggt    189840
     aacggccacg cctcaggaag ggttcgatct ggcggtcaaa ctctcgcgca tcgccgtaaa    189900
     gaaaacacag cctgacgcac aggttcggga cacactgcgt gcggtctacg aaaaggatgc    189960
     caacgcactc atcgcggttt cagcggtcgt ggcaacccat ttccagacga ttgccgcagc    190020
     caatgattac tggaaggact gaccatgaag gctccggaac tgcagataca gcagtggttc    190080
     aactccgcca ctgacctgac gttggcggac ctgcgcggca aggtcatcgt tatcgaagcg    190140
     tttcagatgc tttgcccggg ctgcgtcatg cacggcatac cgctggcaca gaaggtccgc    190200
     gccgcattcc ccgaagacaa ggttgcggtt ctgggcctgc acacggtctt tgagcatcac    190260
     gaagcgatga caccgatctc actgaaggcg tttctgcatg aataccgcat caagtttccc    190320
     gtaggcgtcg atcagccggg cgatggcgcc atgcccagaa ccatggccgc ctatcagatg    190380
     cgcggcaccc ccagcctgct tctgatcgac aaggccgggg acctgcgggc gcatcatttc    190440
     ggcgatgtct cagaacttct gctgggcgcc gaaattgcca cgcttttggg cgaggccgcc    190500
     ccgagcgttc agaaacaggc cggaaccccg cagggcgatg caaactgcga caatgacggc    190560
     tgcaccgtct agatcggcgg gcctggccct cgcccgtcat tcatcgtcat cttctgcaag    190620
     accgaacgga ccaagggaaa atgcacatga gctggaaggg tatcgtcatc gggctgcaca    190680
     tcgcgccacg gtcgtttctg ccgatgaaaa ccgtgcctca gctggagctg gttgcaaacg    190740
     tcgggatcac gggtgaccgg tatgcttccg aggacgggta ttactcggac cgccccgagg    190800
     aaggccgcca aatcacgctt ttcgaggccg aaaccctcga ggcactcaaa cgcgattgcg    190860
     ggatcgacct ggccgcggac gagcaccggc gcaatgtgac cacccgccat gtgcctctga    190920
     accatctggt cgggcagcgg atcaggatcg gtgactgcct gctcgaagca acccgcctgt    190980
     cgacgccctg ccgacatatc gaacagatca ccggcaagga tattttcgag cccctgttgc    191040
     accggtccgg cctgcatgcc cgtatccttg agggcggcat catccgcgcc ggcgatacga    191100
     tctgcccggc gtaaggagaa cgcgacatgg tcaagcctat tcaccgggtc acaaccgtta    191160
     tcaaagagac ccgcgacatc gcgcctgggg tgcggctgct gcgtctttcg gacccggatg    191220
     gttgggattt gccgccgttt tcaccgggtg cacatatcca cattcacctt cccgatgggc    191280
     ttgtcagacc ctattccctc tgcggtgacg cggcggaccg gtcgagttac ttcatcgccg    191340
     ttcagaaaga acccgacggt cgcggcggat cgcggcaggt ccatgccctt caacagggtg    191400
     agcgcatact ggtctccctg cccaagaacc ttctgccatt gaccaacgcg ccccatgtga    191460
     tcctgattgc gggcggcatc gggatcaccc ctttcatgcc gatgatccac gagatgtccc    191520
     ggcaaggccg cacctttgag ctgcattatg ccagccgcca aagcgatgcc gccttcctgc    191580
     ccgaacttga agcgctttgc gcagggcgca tgacccgcta tgacgccgag cgggggcaac    191640
     ggctcaggct ggacgatgtg atttccgcca tcgacgccac cgggcatctc tactgttgcg    191700
     gtccggaacg gatgatcgga gagcttctgg ccaagaccgg ccatatgcgc gaccgggtgc    191760
     atgtcgaata tttcggggtc tcggccgatg tcggccagca agcctatgaa atccgcctcg    191820
     cccggtcttc tcgaaccgtt ccagtgaagc agggccaaac aatgctcgaa gccttgcggg    191880
     ccgctgatgt cgacgtttcc gcgtcttgcg agggcgggat ctgcctggaa tgcaagaccc    191940
     gctacctgga gggaaccccg gtgcatcgtg acatcaccat gcccaaatcc gagcgcgaca    192000
     cccacctgac cccctgtgtt tcaggctgcg cgggtgcgtc gatcaccctg gacctgtaga    192060
     cttgtgacga aagcgacacc catgacggac cccgcccaac ccatcctgtt tttgctgagg    192120
     cccgactttc tggatccggc gaccggcgat ggcgctttct tttgcccgca ttgccttcgc    192180
     ctcgaggggt tgctttcgat ctatccggtg ctgcgccatt ccctgcaaat ctgctatgtc    192240
     gatttcccga aaccacgcgg tgcgctggca cagctggccg gggcggaaag ccaatcctgt    192300
     ccgcagctgg ttctcccggc gggcgatgat gagctttcag gccgatggtc ggtggctggc    192360
     gcggcggatg cccggcgcat tgagaacacg gcggacatcg aagactatct tatccttcgc    192420
     tacgggcttt cagaccgcca cccctgacgg cacctaaatc cggcagcgtc ccgaccccgg    192480
     caagcgccct gccactgccg aaggttagat gccgtgcaag ctctggttca tccatttgag    192540
     acccgagaaa ttctgcgaat ttttccaggt atctggcccg cggatcgctg ttgcgccatg    192600
     gtctgatcgc gcaggcaatg ttcttccgac agcaggacaa gttcggcacc gcgcacgtcc    192660
     gcccaggcca cgggctggcc cggcgtcctg ccgtgatcgg cgggacaggc cagcgcaaac    192720
     ggttcaaaga acagcccggc cgtttccaga tgctgatgtt tcggttccgt cgcgatcagg    192780
     atggcatcca gttcccggtc cgccagcatc tgctcaagaa ccgtcgtggg ttcctcggaa    192840
     aggcgcagcc ggatttgcgg atatcgggat ttgattgacc ccagcaccag aggcagcaga    192900
     taggggccaa gcgtggagat cacgccaaca cgcaactcgc cctccagatt gtcactcaga    192960
     cccacagaca tatccagaag ttcccgtgcc ccggcgagga ccacctcggc cttgcgcagg    193020
     aactgcgcac cacttggcgt caacgacacg tgctttccct ggcgttcgaa aatggcaaag    193080
     ccaagacgcg cttccagctt cagaacctgc tggctgatcg ccggctgcga aacgccgcaa    193140
     cccactgcgg cggcgccaaa gtgaccttct tgcgcaatgc tttgaatata ttcaagatcc    193200
     cggagtgaca aaccactcat cgaggttttc ccggtcatgt atcacctgtg attatcaacc    193260
     gcataatttg tatgacttgg acgatttcga ccggttctgg tttgctgcat ttcgacgcca    193320
     aatcaggaga tcgaaatgac aagcaaacct aaactgacca ccgcattcgg cgcgccggtc    193380
     cccgacaacc agaacacgct gacggcgggc ccgcgctgct gcaggatgtc tggttccttg    193440
     aaaaaatggc gcatttcgac cgcgaagtga tccccgaacg gcgcatgcac gccaagggct    193500
     cggccgccta tggcgccttc accgtcaccc gggacattac ccgttacacg cgtgccaaac    193560
     tgttttctga cattggcaag aagaccgatc tgttcctgcg gttttccacc gtcgcgggtg    193620
     aacgcggtgc cgcggatgcc gagcgggaca ttcgcggctt tgccgtcaaa ttctacaccg    193680
     aagagggcaa ctgggatctg gtcggaaaca acacgccggt cttctttcta cgcgatccgc    193740
     tgaagttccc cgacctcaac catgcggtca aacgtgatcc gcgtaccaac atgcgcagcg    193800
     ccgacaacaa ttgggatttc tggaccaatc tgcccgaggc cctgcaccaa gtcaccatcg    193860
     taatgtccga tcgcggtctg cctgccacct accggcacat ggacggattc ggcagccata    193920
     cgttcagctt catcaatgcc agcgatgaac ggttctgggt caaattccat ttcaagaccc    193980
     agcagggcat aaggaacctg accgatgaag aggccgggca aatcgttgcc ggggatcgcg    194040
     aaagccacca gcgtgatctt tgcgacagta tcgagaacgg cgatcactgg aaccatcgcg    194100
     aggacgagga ttacttctcg caatccggta acctgttccg cctgatgacc cccgagcagc    194160
     aacaggtgct gttcgaaaat accacccgtc cgattggccc ggcatgactt gagatcaaac    194220
     accggcatat ccgcatctgc accaaggcag acccggccta tggcgcaggt gtcgcgcagg    194280
     cacttgggct cgatatcgga accatcgcgg cagaatgata aaagcctccc ctgcaggcgc    194340
     gtttcaaacc ctgcgcgcct gccggccgaa ccgatctgac cgggatcggt tcggcctttt    194400
     ttttggcaag agtgaacaga atggggccga accatgcatc agggggcgcg gatacacccc    194460
     cctgacattg tgctgttcgg aaccggctca ctgaagcgtt ttgagatagg ccagaagatc    194520
     agcaagctgc tcttctttct tgacccctgg aaaggtcatc tttgttccgg gcagatactt    194580
     cttgggggcg gcaaggaagc ctgccagatg ttcctcgtcc caagtatatc cggcctcggc    194640
     catgggttgg gaatacttga aaccctcaac cgcaccggca ggccgctccc agacaccaaa    194700
     catcgagggt ccgaccttgt tcttaccctc ctcgatcgca tggcaggcag cacatttctt    194760
     gaataccttc tttccttcct caggatcgcc gtcagcctgc gcgctgcagg ccagaccagc    194820
     gatcacgagg ccgctcagca tgaatgtttt catttcgtgt ttcctttctt tcaggggggc    194880
     caactaagaa tgatacgcaa accggctcac ccggcgttca ttcgggcttg ccatgggcgc    194940
     tcttctcgat cccggtgtca ctgaaacttg gcctggacgc agcgccccaa tagccgaaac    195000
     ccatgatcac ggcgccggca aaggtattgc caagagtaac ccaggttaga ttccagattg    195060
     ccccggcaat ggaaattcca tcaggatggt tcgacagaag cgccactgaa aatacggtca    195120
     tgttggcgac gctgtgttcg aacccagcag cgatgaaagc gtagagacac cagaagatca    195180
     gcacgcattt ggtgacatcg tcgcgcgcgc gcgccgaggt ccagagcgcc aggcacacaa    195240
     gccagttgca caggatggcc ttggcaaaaa gctccggcgc ggtgccatgc atcttcttcg    195300
     cggcaacctt atacagcaaa gcctcgtccc ccgcggccag gatcagacca ccgccgccga    195360
     tcacgaagat cgccgccagc aggatcgcac cggccagatt gccagcccag ctggcacacc    195420
     agcatcgtgc aagatcacgg atgctggctc tgcccgtcag aacaccatgc atcatgtaca    195480
     tggtgtgccc ggtaaaaagc tcggccccgg caaacaccac cagggtcagg gcaatcccga    195540
     aacttgcccc catcacgatc ggccggatcg aggcatccac cccctgcccg accgaaaaga    195600
     tcagaaggat gccggcgccc acataggcgc ccgccttcag cgtcaggatc acgaacccca    195660
     acggatcggc attcagatgt tcggctttcg ccctggcaat ccgggcaaaa cccaacacgg    195720
     tatcagcgta actcatgatt tgaggtcctt tgcgcccgga aatgaccacg gcggtgatgc    195780
     gtcctgctct gcctgtccga acagcacggg acagacccag agacaggtca ggccggcagc    195840
     agcaatcaga aacccgacgc ccagatcctg ctggtcagag acaaggtagg aattgcagat    195900
     ccggatcggc gcgtgaatgt agagaaaccc aagcaccccc agcatggaca gcgcattagc    195960
     ctgcaagaac ccgcgcagca caggcccgag ccagggccag gacaggcgca agggaacgcc    196020
     aagcaacaag ggcaggctga caagttttgc aacttcgccc gccctggtca gggcccagtc    196080
     gacactgcgc ggcagcatcc agaacagaaa gacgctgagt gccaggatga acaggggcaa    196140
     ggcccagtca cgccgcgcct tcaggttcca ggccagtaaa gcacccgcca gcaccagaag    196200
     cggcatctgg atcaggacat gctggatcgg gctttcggcc gcgccccatc gcagggccag    196260
     cgccgtaaag aaagccggtg ctgcgaggac acaccgcgtc atgatggctc tccagcaacg    196320
     cgatcgacca cggcggcgac cgcatcggtg tcgaacaccg ccgaaaacct gccttcaccg    196380
     tcgatcacat ggattgcggc attatgctga aacccgcccc attcgtccgg tatgaccgtg    196440
     accccaaaga gggtcagcag ggcctccaga tcgtccagag cagggcgcgc gacggtccag    196500
     atatttccgt cagcgtcatg gttctcgcca tagatgcgca tttgctcagg cgtgtcgcga    196560
     agcgggtcga aactgaccga aatcaggcgc acatccgcgc cctgtgcgcg aagcttgtcg    196620
     cggatggcgg cgaaatcacc cgccgcgatc tgacagatgt caccgcagac cgtatagatg    196680
     aactcgacca ggaccacctc gccgttttgc ggcgtcagcg cgatggtccg atcattcata    196740
     tcttccagac ggaccgcggg caccggacgc ggcgaccgcg ccacgtccag ccggcgcgca    196800
     gcctctgacg taaaggcctg cgcgccatct gtcgcgtacc acaggaaccc gccaccgata    196860
     acggcggcga gaaccgaggc aagcgccggg cgcaacatca cccgtcgctc cgcccgagcc    196920
     gcgcgacaaa gcgcagcacg aacagaagcg tgcccatcac cacaagggcg ccaaaggccg    196980
     ttccgatgcg atcatgggtc agccagtctt cgtagtgcac ggcccagcgg cgcgggatcg    197040
     aggccgcccc cgagaacaga aacaccagga taaagccgct ggcaccggcg aggtaggtat    197100
     agaacgccac gcggtccagc cccaccattt ccgagattgc cttgccgcgc accagccagg    197160
     ccatgaaccc aaaggccatg gcgacctcgc ccagcaacag ataggtgtgg aaatgccccg    197220
     gcacccacat ggtgttgtgc atgaccttgt tgacactgat catcccgtcg atcgaggccg    197280
     ggatcgagcc aatcgaccag ccggcgaccg acaataccag caatgacgac gccagatccc    197340
     aggtcatttt cgacccgcga atgtacagga aggttgaaaa cgcggtgacc gcaatcaggg    197400
     gaatgccgct gaaatacgag accaactgcc cgaccacaag catccagggc ggcatgacca    197460
     catcctgcag caggtggtgc cagtagacgg ccatcacaaa gatcagaacc acgttccagg    197520
     caatcgcgaa gacccggttc gatttccacg gacgcccggt atattccggc aggatttcat    197580
     agacggcagt caccgccata tagatcgacg cgttgatgaa cacgtgcccg aagaaataga    197640
     tcaggttctt ggccagcagg gcgtttactt cgaagccggg caccagcagg tgcaccaggc    197700
     tggccaccag aacggcagcg cccagaacga tcccgatcga gttgaaaatc gtgaccgatg    197760
     ttgcggcgat gatcgtgggc gggggcacat catcatccgc cttgcccagg atcagactcc    197820
     agccaagggc gcgcgtcaga ttgccgtacc gcgcccggat acgccggccc agctccaggt    197880
     agtacagcag gaatcccacc ccgatcgagg tatagcccag catgaaggcc gcggcggcgg    197940
     ccggccccca tgcgccaccg gaattggcgg gcagcggaaa caggaaggtc caggccccgc    198000
     caaatccgcc caggaaaatc gcgctcagga tcagcacaac gcccagcaga aaaaggccaa    198060
     ggaacgccca gaaaataccc gcgctgagcg tgaggtgccg cccgcagaaa taccagagga    198120
     tcgcggcacc cgacagcgcc gccgtcccga ccatccctgc cccgtgagcg gtgagaagct    198180
     ggtagaaaat ggccggatca agctcgatcc actgggcctg cgcggcgcgc atggcaaggc    198240
     cgaagatcat cataagggca aatactgcgc cggacaggat catcgtcagc ttgacggccc    198300
     cggcctgagg tgtgtgtgct gtggtcattt attcctccac cgaaacaact tcgaattcgt    198360
     tgaccatttc gtgatgcgcg atgccgcaat attccatgca gaggatctcg tactggcccg    198420
     gctcgtcgaa cgtgtaggtg atctcggtcg tgtatccggg tatcgcctgc acctgggtca    198480
     gcagccgcat gtcggcattg taaatgccca gcccatgggt cacgtcctcg gtcgtcacgc    198540
     tgaagttgac gggcttgccg gccgggatct cgaccgtgtc gatttcccac caccactgcc    198600
     cgctggtgat cgcaacattg atcgtatcat ccgtgcttgc caacgcatgc ggccacggac    198660
     gcagcgtgcc gactgacaca aggactccga cgacgagcat cgcccagatc agaccggtcc    198720
     gtttcgaatt ggcacgaggc ccgggttcgg gcccatccga cgcgcgggcc gcaacgtaga    198780
     aaacaaccgc catggccgcc atcagcacaa gcgatatcaa aagaacgttt gattgcattt    198840
     cttcgcccta tattaggtat tttaaatacc taatatttag agtcgcgtgg cctgtcaaca    198900
     aaatgcgcct tcacaagtcg cattttctat gtgagaaatc cccatgcaga tctccaagtt    198960
     ctccgactat gccctgcgca tcctcatcca cctcgcgacc agcgagggcg gccttatgtc    199020
     gacgcgcgaa atcgctgacc tgcagcaatt gccgttcaac catcttgcca agatttcaca    199080
     atggctgacc cacgaaggat acgtggaatc cgtcaggggg cggcatggcg gcatgcgtct    199140
     ggcattgccg cccgacgcta tttcgatcgg cggtctgctc cggaaatccg aacgcggaac    199200
     accgctggtc gaatgcatga aagagggcgg cggatgctgt gtcatgacac cggcctgcgg    199260
     gcttcttcca attctgatcg aagcgcagga agccttcttt cattcgcttg acggcagcac    199320
     gctgcaggat gttctttccg ggaatcgcgg catgcagaac ctcatccgcg ccctcggcgt    199380
     caggtcaaaa tacgatccgg gttccgcagc ggtacaagat gcctgatttc cagttaccaa    199440
     gccctgttga cgtctaccct ttcgcgccgg ttatcctgcg acggcaagcg ccggtttccg    199500
     gcctggtgca gtcgtttccc tccgccgagg tgagccgcgc ggcagaacct ctgcaagtcc    199560
     gctcccagag catgtatcat ttggcactgt atttcgtgtc cggcaggctt tgaccttccc    199620
     aggcttctag cgcgacaaga atgtgccagg atttgaaccc gccatagccg atcagcaaaa    199680
     gcagcatgaa aacatacatg gccctgcgaa accgtggtgt ttcgtcagtt gccggcattg    199740
     tcggcctgcc aaagaaggta aagggtaagc atccggatct gtttgtcatc cagcctgttt    199800
     ttccaggccg gcatgacacc ctgcctgccg cggtaaatgc tgtcatggat atcatcgcgg    199860
     ctgccaccat agagccatgc ggcatcgccc agatccggtg cgccgctctc caacccgccg    199920
     cgcccgtcat ccccgtgaca gcccgcacag ttttctgcga acacattctg cccgcgaccg    199980
     gcggccaccg cgttgtgatc cccctcggac agcgacagaa cgaactcggt cacgtcttca    200040
     atctgttgcc tgtcgagcag ctgatccgtg ccaaacgccg gcatctgcga cactcgcgta    200100
     tcctcgtctg ccgcgttgat cccgtggcgg atcgtgtatt caatctcttc cggcgcgccc    200160
     gaccaaagcc agtgcgcatc gcgcagattg ggaaacccgg tctgccctgc cagatcaacc    200220
     cggtgacagg cggagcaatt gtcggcgtaa agctttgaaa tcgcatcgct ataccgcgtc    200280
     tccagtgccg tatcgccggc cagggccgca atatccccgt ttgcaaaggg tgcgaaattc    200340
     atggcccgtt gggcatcggc ctcggccaga acccggccga cttcggcacg cgaggaatac    200400
     cccaccagcc ccttcgcata atccgtaaca agcggaaagg acgggtagaa aacccagaac    200460
     agcgcggcaa tggcaatgct gacccacaag gcccaccggg cggcccaggg caccggcgta    200520
     tccaactcgg tgatgccatc ccattcatgc ccggtcaggg ccgtgccggt gacagggtct    200580
     ttttccttta ccgacatggc cggtcctcgt ccttttgcag gggcgactgc gccgcctcgt    200640
     cgtaaagccc acggcgcgag ggccaatagg tccagagtac ggcggcaaca aagacaacca    200700
     gcaaatagat cgcaccccag gtcttggaga aaaccagtac cgcgtcatgg gtcatcggtt    200760
     gatctcctcg gggtccagtg tgtcgaaatt caccagcgtg cccaggacct gcagataggc    200820
     cacgagggca tccatctcgg tcagttcgcc gggcctgccg tcgaaatcac gcagctgcac    200880
     attgtcgccg aaaagttcct gcagctcgga ttcgtaagcc tgctccgcat ccgcctgcca    200940
     gcctgccgcc tgctcggcgg tggcaatctg cgcatctgta taaggcaccc cggcgcggcg    201000
     cagagcctca agagcggcgg gcaggtgacc ggtgtccagc cgcgttgcag acaggaaggc    201060
     atagcccggc attaccgacc ccggcacaag cgcgcgcggg tcttccagat gcgccacatg    201120
     ccagtcatcc gaatacttcc cgccgatccg ggccagatcc ggaccggtac gtttcgaccc    201180
     ccattggaac gggtggtcat acatgctttc cgccgccaga ctgtaatgac catagcgctc    201240
     cacatccgac cgcaaggtgc ggatcatctg agagtggcag gcataacatc cctcgcgcac    201300
     atagatatcg cgcccggcca gttccagcgg cgtatagggg cgcatcccct caacttcctc    201360
     caccgtgttt tcaatggtga acagcggggc gatttctaca atgccgccga tcgaggccac    201420
     gaacaggatc atcatcgcaa aagcgatcga gtggcgttcg agtttctggt gtgccgtgct    201480
     catcgcccta ctccgctggt tgccgggcca gcggcccgga tttacgggtt gtctcgcgtt    201540
     tcggcccact gatcgtcatg tagatattgt aggccccgat cagcgcgccg atcaggtaca    201600
     acaacccgcc gatggcgcgt gccgcgtaat agggatgcat cgccaaaaca ctgtcgagga    201660
     acgaataata cagcgcgcca tcggcatcat aggtctgcca catcagcgcc tgtgtcatgc    201720
     cgctgttcca catcgcgccc acgtagatca gcgtccctgt gagggcgagc cagaaatgcc    201780
     aggcctccag ccgttccgaa tagatcccgt cgcgccgcca gatccagggc accatcttgt    201840
     acatcgcccc gaaggtgatg aacgcaaccc accccaacgc accggcatgg acatggccga    201900
     cggtccagtc ggtgtagtgg ctgagtgaat tgaccgggcg gatcgccatg aacgagcctt    201960
     cgaaagtggt cagcccgtag aacaggatgg ccaccatcat gaagcgcact gccggatcgg    202020
     tgcgaacctt gtcccaggcg ccattgatgg tgaggatgcc gttgaagacc gaggcccagc    202080
     ttggcaccag caggatgatt gacatgctcg tgcccagata ctgaacccaa tcgggcaatg    202140
     cggtgtaatg caggtgatgc gacccggccc agagatagag gaaggtaatt ccccagaacc    202200
     cgatgatcga catgcggtag gaatagaccg gccggttcac cgctttgggc agaaaatagt    202260
     acagcatgcc cagaaagcct gcggtcagaa ggaagccaac ggcgttatgg ccataccacc    202320
     attgcgtcat ggcatcctgc acccccgcga acagggaata gctcttggga taggcgatcg    202380
     acaccggcac cgccagatta ttgacgatat gcagcatcgc gatcaccacg atgaagccaa    202440
     gataatacca gttcgagaca tagatatgcg gctcggcccg gcgcgccagg gtgcgcaggt    202500
     acaaggtcag gtatccgacc cagaccacga ccagcaacag gtcggcatac cattccggtt    202560
     cagcatattc cttggattgg gtgatccccg ccagataccc gctgacggac aggagcatga    202620
     acaggttgta gccccagaag atcagccagg gcagcgtttc gctggccagc cgcgcacgcg    202680
     aggtacgctg cacgacatag aaagaggtcg cgatcagggc gttcccgcca aagccaaaga    202740
     ttacggcggt ggtatgcacc ggccgcaacc gcccgaaatt ggaccaggac atatcgccat    202800
     tcagatccgg aatggccagt tgccacgcca gtatgtcgcc aactgcaaag ccgatgacac    202860
     cccagataaa ggtggccacg acgccgaact tggtcgcctt gtcattatag gcatgcggca    202920
     cgtcctgtgc cgggtccgtg gcgcgattga tcatccagat cagaccccag cctgcagcgc    202980
     cggcaatcag ccagccatgc atcacgtaga cggtgggcac accccatccc agaatggcaa    203040
     tgccggtcag catcacggca gaaagcgcca gcagcaccgc aagatcttcg aacgtcagtt    203100
     tgcgtggcat gttcacacct cctccccgac aatccggaca tgttcggaac cgggttgcgg    203160
     ctttgccccg ccgccctgcc ggaacagatc gtcataggcg tgccaggtgg cgtatccgag    203220
     cagcgggaag atgatgacca gacccagaaa accggtcaga atacccaagg ccgtcagcgc    203280
     agcgatggtc atgccccaca ggacggtcag gcggaaattc tgcgtagtgg cattgaaact    203340
     aagccccatg gccgaaaacc cgtcaatgtc gcgctcgacc agcatcggca gcgaaaacgc    203400
     cgagacagcg aagccaagcg cggcgaacaa ccctccgacc agggttccgc tgaccagcaa    203460
     gacccagccg ctcgatgtgc tcagcaagag cgaaagcgtt gcgacaaacc cctcgaaagg    203520
     cttcaggccg tagacgatcg caaacagaat ggtggccgcc cggatccatg ccatggcgaa    203580
     aaccatcagg atgatcccga caagggtgat ctgtcccttc gcggcgacgc gtgttttgcc    203640
     gctggcgacg cggtaaaggc cgacggtcac caccggcccc accagcacgc cgcccgccag    203700
     catcggcagc aatgcccagg ccaacccgtt ccggaacagc agcaggatca aggcccaccc    203760
     aaacaggaca agtccaccgc cgtatagcag cgaataggtc cggttcaggc aaaagtctct    203820
     ccagcctgcg acaagccacc tgacgatggt ggccggggcc ggatcgctga tgatacgcgc    203880
     tctggagtaa tcaatattcg ccatcggtgg ttactctttc agctgtcccg ggtggttggg    203940
     catgtcaggt caaattcggt gctgcaccgt cgggctggcg gaaattctcg atccccatgg    204000
     acaacccttt gccgatccgt tgcgccagta gtgaaaatgc cgacgcaacg tctcccgtca    204060
     gctcctgctc caggactttc tggaacaggt ccagccagac ggggaaatgc tcggaacgga    204120
     tgttcgggtt ggcaatgtgg acctgcatcg ggtttccgaa atagccgggt tctctcagga    204180
     tcgccccggc ccagaacccc gagatcttgt cctcgtgctc cggccagtcg gtcacagcgg    204240
     aattgaacac cgggcccagc acatcatgtg cgcgcacctc ggcatagaac cgtcgcacca    204300
     cctggtcgat ttccgtgcgt gtgatgtcaa acagttgatg cgggcgcaaa ctggaaccgg    204360
     acatccgaat cgctccttga acaaattcgc gatctctatg gcggtttaaa taggtatttt    204420
     caagtcctat ttaaacactc aacccggctg ccaaggccgg ccgaagcgcg gtcggtctag    204480
     tctctcagcg cttccatctc cgccagttcc gagggcatgt aaacctcgtc atgcttcgcc    204540
     aggatttcgg tggccctgaa cacacccccg atgacgctgc cggtggcgat ggtcccctct    204600
     ccttcccgaa acagatccgg cacgataccg acatagctga tcggaaacga ggtctctcca    204660
     tcggtgaccc ggaacgagaa attcgcaccg tcgcgcacca ggctgccatg ttcgaccatg    204720
     ccgccgatgc gcagcacctc gttggccgcg ggcgggtccg tggccacctc ggtcggggtt    204780
     cggaaaaact gaatgccatc gcgcatcgca tagccgatca gggcggtcgc agacacaaga    204840
     gcaacaccac tgaaaaggat cagccggacg cggcggctct ttttcagcga ggccacaatt    204900
     atcgccccga tcccagcggc gtggcccatc cgatctgaag atcgcgccaa caatccacca    204960
     gcgcagaaac aaggccgtgt atcatgccat cgctatgcag gggcgacgcg gtgatgcgca    205020
     ggcgttctgt gccttttggc acggtcggat ggttgatggg ctgtacatag atcgcgtgcc    205080
     gttccagcag caggtcgctg agctgcttgc atttgaacgg atcccccacc atcaccggaa    205140
     cgatatggct gggtgcgtcc atgaacggta tgcgcgcgtc tttcagcaga gcccgcagca    205200
     acaccgcctt tcggtgcagg ctttcacgct ctgacgtgct gtcccgcaga tggcggacag    205260
     atgccagcgc acccgccacc accgtgggcg gtggcgcgct ggtaaagatg aacccgttcg    205320
     catgggaccg gatcgcgtcg ataatctcgg cattggccgt gacataacca ccgatcaccc    205380
     cataggcctt ggccagcgtg ccctggatga tgtcgatctg gccggcaagc ccttcgcgtt    205440
     cggccacgcc cgcgccggtc gcgccataca tgccgaccgc atgaacctcg tcgatatagg    205500
     tcagcgcgcc gtatttcttt gacacccgga tgatctcggc gatgggcgca atatcgccat    205560
     ccatcgaata cacgctttca aaggccacca ccttgcagcg atccgccgcc agctcgctca    205620
     ggatttcctc aagatgcgcc acgtcattat gccggaaaat gcgtttctcg gccttgctgg    205680
     ccagcacccc ctggatcatc gacgcatggt tcaactcgtc cgagatcatc acgcaatcgg    205740
     gcaagagacg ccccaaggtc gccagcgttg caagattggc cagatagcca cagccgaaga    205800
     ccagcccggc ctccttgcca tgcaatgtcg ccagttcctg ttccagcgcc acgatcggcc    205860
     cgtgattgcc cgagatgttg cgcgtgccgc cagaccccgc gccgtaggtg tcgatcgccg    205920
     atttcatggc accgcgcaca accgggtgct gccccatgcc cagatagtcg ttcgaacacc    205980
     agaccgtgat ggtgcgcggg ccatcctcgc ccatgacctg agacagcggg aaccggccga    206040
     ccaggcggtt atgttcctga aagacgcggt agtttcccgt atcgcgcaaa tcctgcaagg    206100
     catcctcgaa atgagacgag tagtcaggtg cgttcagcat catgtgaaaa tcttccatgt    206160
     ccgtggctct agttgtctga ctgagttgtg gtttcaagct gcgccagaag cgcatcgacc    206220
     gcacccgccg cccgcgggtt ggccgacagt ttcggccgca aggtcatcag ggtttcgcgg    206280
     gccgcttcgt gccgcccctg ccgcgcttgg atcaggccgc gataccaatg cgcctccagc    206340
     aggtcgggtt cctgttgcag caccgtttca acggtccgga ccagatcttc gctggggtcg    206400
     aattccgggt cctgcaaacg cccgcgcagc aacatcatct tgaactgcac attgcccggg    206460
     aacctttccg cggcgatctg caagacctcg atggcatctt cgccgcgttc cagcacgcgg    206520
     taactgcgca gcagcatctg aatgtcgtct tcggtgggat tgccgtcata gacacgctct    206580
     tccagccgcc ccaccatttc ggcgatattg ggcgcgccgt ccgggcccag tgacgccatg    206640
     acggggtcgc gaacctcatc gctggcagcg gccagcggaa tggcgcctgt cgcatggggg    206700
     gaaacggtca tgtccagatc attgacattc gccgcaaagt gaacgcccag ggccgccacg    206760
     accaccgccg ccgcagacag aaacgaaatg ccgtcgccgg ttgaacgaga ttgcgggctg    206820
     cccgggcgct gcaccagagg ccgcattttc cgcagccgat caacgaaccg gttggcctcg    206880
     gcggtcagcc ggctggacgt atcgccatac agcaccaccc ctatccgccc ttcggccagc    206940
     gcgatgtcat tgtcctgcat ctgctcgatc aaccgggcgc gctcagcctc ccattgcttg    207000
     gagggatcgg tgtcctcaag accggcgcca agatcgcggt cactccccgg gcgcagcagc    207060
     ggcaacagaa tgccggcaaa gacggtcgtc acaaggatca gtgtgaagat atcagccatc    207120
     aaagctccat ccccttcagc cccgatgcgt ccagcggaga catcagcacg ctgtccttca    207180
     gctcgcgtgc ggctcgccgc ttgtgccggg ccaggatcag catgaacact ccaagcccca    207240
     acaggaccag acccgccgga accagccaga caatgcgccc aggacccgtc atcggcggcg    207300
     acaacagcac gtaatccccg tatctcgtcc ggaagaattc aaagatttcg gcgtcgctca    207360
     tgccctcggc gatccgttcc cgcaggatca ccagcatctc gcgcgcggtc gaggaatgac    207420
     tgtccagaat gttctcgctc tgacagaccg ggcagcgcag caagaccgcc aggtcacgca    207480
     cacgcggctc ggtcgggtct tcgcttaccg acgcggcccc ggcggggaac gacatcacga    207540
     tcagcgccag gatcagcatc aggcgtttca tggatcaact ccgatcaggg gcagatactt    207600
     cgccagcacc ttgtccgtga ccggcccggc atgacgggcc tgcacgacgc cgtccgcatc    207660
     aatgaaaaac gtctcgggca tgccgtagac gccgaaatcg atccccaacc gcccgcgttc    207720
     gtcatatccg gacggatagc cgaaatgacc ctcgcggttc aggaacccgg cggcgcgggc    207780
     cgggtcgtcg cgatagttga tgcccaggat cgaaaactca tcactcagtt gcgaccgcac    207840
     gcccagttcg accagtttcg gatgttcgac ccggcaggtg gtgcaccagc tggcccaaaa    207900
     attaagcagc atcggcttgc ccgcatgttc cgctgaattc agcatgccgg cccgctgaag    207960
     ataggggatt tcaaaggcgg gcatggattt tccaaccagc gccgagggga tacggttcgg    208020
     gtcccgcgtc aggcctatgc ccagcagcaa aggcaggccc accagcgcgg ccaacagcgg    208080
     caacttccac tccaaaccgc cttttttgcg cggcatatcg acttcgatcg tcattctgcg    208140
     ggcactcctt cgatcggttc gggcgtgcgg ctccgcgccg cccggcgcga cggttttgac    208200
     aaggacagca acgcgcccag cagcagaacc agccatccca gccagatcca gttgaccagc    208260
     gggttccaga agatgcggac gacaaccgtt ccctgcccat cctcatcgcc catgaccatg    208320
     tagagatccc cggccagcga tgaccggatg gcaatctcgg tcgttgccat ttcgcggacc    208380
     ggatagaatc gcttttcggg cgccatctcg aacagcaact ccccgtcgcg gctgatactg    208440
     aaccgtgcga cccgcgcgtt gtaattggcg ctgccggtat cctgaagctc gcgcagcgtc    208500
     agcgtgtagc cgcccgcctc tgccctgtcg ccgatgcgca tggccacggt ctgggtggtc    208560
     tggaacaggc ccgatgcaat catgccagcc ccgatcatga cgaccccgaa atgaatgatc    208620
     agcgcgccga tacgctgtcg ggaatgtgtc agcacgtcgc ccgtggcgcg cagcaccccc    208680
     tgctccatca cccggcgccg agcggcaatc gcactggcaa tatccgccag tgatgcaaag    208740
     cccgcgaaac ctaccgcaaa gatcgcggca agagtgatga tcccggcctc gctgaccagc    208800
     accgcggcaa cagccgtcag cccggcaaaa gccagcggca ggcgaaaccg gcccacgaag    208860
     cgtttcgcac tcatctgccg ccagggcacc gatggcccca gccccagcag aaagaccagc    208920
     gccaccatga tggggacgat gaccttgtta tagtagggcg cgccgatgct gatcttggcg    208980
     tccgagaaga cctcgaccac cagcgggaaa agcgtaccgg ccatgaccgt ggccgtcacc    209040
     accagcagca gcaccgtgtt gccaaggatc gcagcctcgc gcgacagaag tgacgagatg    209100
     ccgccgtcat cctgcagccg gtccgcccgc agaatgatca gcccgtaacc gaccaccatc    209160
     gcgacagtca tgaagcccag catataggct ccgcgcccgg gatcgacggc aaaggcatgg    209220
     accgatgtca gcacgcccga acgcaccagg aatgttccca gcagggtcag caggaaggtg    209280
     gtgaccacca gaaacacgtt ccaggcccgg aacatcccgc gcttgtcctg caccatcatc    209340
     gaatgcagca acgcggtgcc ggtgagccag ggcatcaacg aggcgttctc gaccgggtcc    209400
     caggcccagt acccgcccca gcccagctcg taataggccc agtaaccgcc gcaaatgatg    209460
     cccgaggtca gcgccgtcca cgcaaacagc acccagcggc gcaccacggt gacccattcc    209520
     accccggtct gaccccggat cagcgaagcg atggcaaagg caaagggcac ggcaaagccg    209580
     acatagccga gatagagaac cggcggatga aaggcgaggc ccggatcctg cagaagaggg    209640
     ttcagatcac gcccgtttcc gggcatcggc gtgagcgtca ggaacgggtt tgacaggaaa    209700
     acgacaaagg ccaggaaccc cagctgaatc gccgccagcg tggcgatcac ccagggcatg    209760
     gatttcgggt agtcccgcca gtgcagccag actgcggcgg ccgaaaacag cgtcagatac    209820
     cacagccaca gaagcaggct gccctcatgc gcgccccaca ttgccgtcac cttgtagagc    209880
     atcggcagat cccggttgct gttctgcgcc acataggcga ccgagaaatc cgaggtcacg    209940
     aacgcctgga tcagaacggc gcagccaatc gtcgcaagca cgaagtttgc gaagattgcg    210000
     tttcgggccg ataccagccg tgacgctgcc cccgaccggg ccgccagcac agcctgaaag    210060
     cagccaaata cgctcaggat cagggcaagg ctgaccgcga actgaccaag ctctatcgac    210120
     gtttcgatca tgggccacta tcctgattgt tgttccgcgg cgtgcgccag aacgtcgacc    210180
     gctttcctga tgttccggtc ggacaccgcc gcatagccca gcaccagaag gtcgtcgaaa    210240
     tccgtgttcg acggcgacag ccaggccccg caatcccggg cgcggtagat ggcgatccgg    210300
     tgttccgccg ccgctttctg cagcgtttcg gcacagatcc ctttcggaag ccgcgccgag    210360
     atgtgcatgc cgccccgcat tccgtgaatt gaagttccgg ggatgcgcgt tgtcagctcc    210420
     cgggccagca gatcgcgccg cgccatatag gtcgaccgga tacggcgcag gtggcggcga    210480
     aagctgccgc cggtgatgaa atccgccatg gccgcctgct ccagccaggg ctggccgttg    210540
     ctcaggatgc ctttccacat cgcgaaagca tccgacagct ctgcggtcga taccagataa    210600
     ccgatgcgga tcgccggccc gaagcttttg gaaaaggtcc ccagatagat gacccgcccc    210660
     gcacggtcga gcccgcgcaa cgctgtcagg ggcgtgccct cgtatcggaa atccccgtcg    210720
     taatcatcct caatgacaat gctgtcggtg cgttccgccc attgcagtaa ctgcaggcga    210780
     cgttccagcg aaagggtaac gcccgtcgga tactggtgcg acggcgtcac ataaagaagc    210840
     gaacgcccgg tctccggcag cagatcaact ctcagaccat cccggtcaac cgggaccgca    210900
     accgtgtcat agctgaaatt ggaaaacacc gcacgcgcgc ccaggtaaca ggggtcttcg    210960
     tggataaagg tcctgaacgt gcgggaaaac gcccgcgcga tcagggccag cccgtcctga    211020
     gacccgccga cacagaccac atcctcgggc ttggccagaa cgccgcgcgt cggcccgatg    211080
     tgatcggcaa gcgcctgacg aaattcgcgc aaaccgcgcg ggtcatgata ttccgacagc    211140
     tggcctttgg catgccgcag cttcgtgtcc agtatgcgcc gccattcccg cgccggaaag    211200
     gcggagccgt ccgaacgccc gacccagaaa tccaccgtgt ctttcttgcg gttgggagat    211260
     atcaccgaat gttccagcag tggcatgcag gcgggcgcgg ggctttggcc ggacggctcc    211320
     gagggctgat cgtttgcggg gctggtcaga gtgctcatcg acatttccgg caaggcggaa    211380
     ctgacgaatg tgcccacatt tgcgcggctt tccagataac cctcggacag aaggtgttcg    211440
     taagcgatca gcacggtatt gcgcgatacg cccagctgct ggctcagctc ccgcgaggcc    211500
     ggaaccggat caccgctgcg cagacgcccc tcaaggatca gcgcacgtat ctggtgaaaa    211560
     acctgctgct gcagcgtgcg cgtatctttt tcgtcgattc tgagtacaac ctgcacggac    211620
     gcatcccccc ggtaccatag actaagagga actctatgag cgcatggatc cggtgttaac    211680
     gaatttcatg agtccacaat taagcttttg gaaaatctca gtttgttgcc gcgacagggt    211740
     cgatccggta gacccagtag ccgccggttt gaaaaaccag cttcgctccg ggcaccaggc    211800
     cgacacgggc ggtgttgaac ggcaacagct gccccagcag cgtggccttg tccttggcat    211860
     cggccaggaa gtagctccgg atcgtgtcat caccgatctg gctgaccgtg taggcggcat    211920
     aatcctgatc ggcgatccag gtcttgacct gccgggtcac gtcatgggca tgggtgccgc    211980
     cagggaaatc cttgagcccc accaggatct tgtccggtgc ggtgatgccc acatcgaaac    212040
     tgtcgcggac atgcaaagcg atgtaagctt cactgccccc ggccataacc tgcaaccggg    212100
     caagaccata ggcatcttcg gccaccattg cgtcgatgaa gtcacgaaac aattccggct    212160
     gctcggtttc ggagcgttcg cccagccacc gcttttccat cctcagaacg gtatcctcgg    212220
     tgcccgccgg ggcgcgatat gcctgctggc ccgccatcgc cgccagcgga tagtgactgg    212280
     gcgcaaactg gctcagacga tccgacagat ccggcatcgc aagaacaact gcatcctcgg    212340
     gcagatgcga cttcagcgcc gtgatcagcg caatttcctc ggatggcttg atatccgacc    212400
     gcaggacagg ctcggtcacc cggctttgcc agccaacgat cagatcacgc ccgcccggca    212460
     attcgatcac ctcggcccgt gccagcgcca gatcggtttc cggcaccgtc aggtcataga    212520
     tctttgcctg cgcgccttcg atcatacctg ccagttgccg tgtttcttcc gacagctcct    212580
     cctctgctac cttataggcg tagggatccg gcgtgttatc ggcgacactg ccgcctcggg    212640
     aaaaaaagaa aataccagca accgccatcg gtacaatgac cgacagaagg acagcgatcg    212700
     ttcgggaggg gagaagtctg tacatgtcag tcaccggcac cttggagggg aagagggctc    212760
     aattgccctc ctccagtttc ttgatgcggg ccagcatgtc ggccttctca cgcagggtgg    212820
     tgtctgcgtc cttgatccgg gcaaggctgc ggatcagctt ggcccagcca ttcgagtagg    212880
     tgaagccgcc cgggttgaca tgcgccagcc ccttgaagtg cttcatgata tgctgttccc    212940
     acatctcggc atattcgaca tcaatcgcgg tcggattgtt gccctgactg gcgaagaagc    213000
     cgaagaagcc accgggcgca tcctcatcgg gtgccggggg cgccggacgg ttggtggtct    213060
     gaccggtcag catcccgtca tcgtagagac cttgcatgat gaccttggct tctttcacca    213120
     gctcgatgcc gtcgatcgtg ccctgatcca tcacgtcaag atacgagcga gcaaagcttt    213180
     ccgagtggca ctgcgtacag gtggcaaccc agctttcctt acgctcctcg aaccacggat    213240
     ggtcaagatt gtcggcgatc tcgggcatcg ggttgaagcc ccagcgcacc ttctgaacca    213300
     ggttgtggcc atactcgcct tcatattcca tgtggcaggt ctggcaggtg ggcgcggtct    213360
     gcccgccctg ttcgaaggcc tgcgccagcg gcagttccca gtcccattcg tcgcccgacg    213420
     cgttgtagat cacgccatgc ttggacagca tgaagttttc gaactcgttg tggtccacgc    213480
     cgttgtggca ggtcgaacag gcctcgggct tgcgcgcctc ggcagccgag aactcatgac    213540
     gtgtatgaca ggagttacag gtgttctgcg tggtgtggca catggtgcag cctgcggcca    213600
     cttcgcgctg ctccatcccg gcccagatcg ccgtttcgac attggcgata tatgacagcg    213660
     catggctcgg gcgcccgtcc ggccactgat cctgtggcca gtccagcgtg tcacgctcgg    213720
     attctcgctc ggcaaactcc tgaacgtggc attgcccgca actcgctgca tccggcatgt    213780
     aaagatcggt cttgtgattg ccgctttcga cccccacgcc catgtggcag tcaatgcaac    213840
     cgacatcatt cagacgctga ccttcttcca gcagacccat cgagtgcagg ttggtttcga    213900
     cctgcccgat cagttcctgc ttgtaatgac ggctgtcaga ggcatccagg ccccggatct    213960
     cgtccagatt gccatgcacc gagttttccc aggaatgcac ccagcccggg gtcacgcttt    214020
     catggcattc cacgcattcg gtgcgcgaca cctcgatgtc cagatccggg ccttggtaga    214080
     aattctgcgg cgccatatag gccgaaaacg ggatcggctc ccacaggtcg gcaaaagcgc    214140
     cctcaccggc gccctgctcg ggatcgcggt agcgtttcac caacgcgtca tacaacacat    214200
     tcggcgcaac atccttgtcc agacccagcg cggtgtaaag cgcgtcgggt atttccgccc    214260
     gggccggggt tatcagtaac gcgctgaaca acacacaaag cgccggccgg atcttgttca    214320
     ggaaattcaa cttggctgcc atcattttcc tctccctgcg catggtgcgg gcaacggact    214380
     tcgtcagcct ggatctttgg gaaaagcggg ccgggggtgt agagccgccg gtatcatttc    214440
     cgataggtcc ggcgataaat aactttatta cagtagctta cgaagatagc agcgcgcttt    214500
     tcagccgccc ggaatcgctt gatcctcggg cctcagtcat caacacaaag accccctgcc    214560
     ccggcacggg tccggaacgg gggcaagggc aaacctgcgg cgacctgcgt cccgaaaacc    214620
     ggaccaattc aagctggaat tttccattta tgatcccgca tgcgggagaa ggagaattcg    214680
     atgaagagac gcaaaagcga aaattgcgtt tgtgctgaag caggttgaag ataacccatt    214740
     gatttctaac aggagtcaca cttcagtgta gcgcgctccg cggcacgtcc acgaaaccga    214800
     taatgagagt catgtataac tcataaattg cccgttcgcc gaggttaccg atactgcgaa    214860
     cacgcttggc acctgtcacc cggtgacgaa acgcctaacg cttgaggcgg gcgggcagtc    214920
     cggttatgtc accgccaaag gagagcccga tgccccagtt cctcgacagc cgccaacccg    214980
     atttcgagac cgcctttacc gccctcctgg gtgccaagcg cgaggacagc ccagatgtcg    215040
     atgcggtggt ggccgggatc atcgccgatg tgcgcgcccg cggcgatgcg gcggtgatcg    215100
     agttgaccga gcggttcgac cgggtcgcgc tgacgccaca gtcgctgcgg ttctccaccg    215160
     aagagatcgc gcaagcggtc gatgaggtgc ccgcccccga acgcgccgcg ctggaactgg    215220
     ccgccgcgcg catccgggcc tatcacgagc ggcagatgcc gcaggatgcg gactggaccg    215280
     atgacaccgg cgcgcggctg ggctggcgct ggtcggcggt ctcggcggcg gggctttacg    215340
     tgccgggcgg tctggcctcc tacccctcct cggtgctgat gaacgccatt ccggccaagg    215400
     tggcgggcgt gggtcgtctg gccatcgccg tgcccacccc cgatgggcag gtcaacccgc    215460
     tggtgctgct ggccgcgcag atctcgggcg ttgacgaggt ctatcgcatc ggcggcgccc    215520
     aggcgattgc cgcgctcgcc tatggcactg acaccatcgc cccggtcgat aagatcaccg    215580
     gccccggcaa cgcctttgtt gcggcagcca agcgacgggt gttcggcaag gtgggcatcg    215640
     acatgatcgc cggtccttcc gagatcctgg tgattgcaga ccgcgacaac gatcccgact    215700
     ggatcgcgct cgacctgctc agccaggccg aacatgacga aagcgcccag tcgatcctga    215760
     tcaccgacga tgccgccttt ggccgggccg tggccgaagc ggtggacaag cggctggaaa    215820
     cgctggaacg ccgcgccatc gccggggtca gctggcgcga tttcggcgcc gtcatcaccg    215880
     tatccgacct ggacgaagcg gcggcgctgt ccaaccgtat cgcgcccgag cacctggagc    215940
     tgtgcgtctc agaccccgag gcgttggcgg ccaggaccat acatgccggg gccatcttcc    216000
     tgggtcagta tacgcccgag gcaatcggcg attatgtcgg cggccccaac cacgtgctgc    216060
     ccaccgcgcg ctcggcccgg ttctcatccg gtttgagcgt gatggacttc ctcaagcgca    216120
     ccacaatgtc gcgaatgaca cccgaggcgc tgcgcgccat cggcccggcg gcggcacagc    216180
     tggcgcgctc ggaaagcctc gaagcgcatg ggttgtcggt tcaggcccgg ctcgaccggt    216240
     tgaacggcta gatttccaga tcgcgggcaa agggaaagaa ccaggcgctg aggctgtcga    216300
     acatctcgcg cacggtcccc gcgcggctgt cgaactccgc gagacaagcg caaagcgtgc    216360
     ccagttcgcc gcattgatcg gccacctcga ccagtgtcgc cgactggttg cggctgtacc    216420
     cgctcagcgc cgacatccgc agctcttcgg gccaatggcg ggcccgctgg gccagcgcct    216480
     cggccaggcg aagcaccacc tcgccctcct gctcctcgag gatgcgccgc aagggtgggt    216540
     agaggtcggg gttcaacccc cggaacatgc gaaacgccag gtccgtttgc ggcagcgctt    216600
     cgctggccag caaccgggtc aggtcctctt cctcgccgaa ctgacgatag agatcggtga    216660
     tatccgaaat ccccggcgcg ccatgcgccc agaatttctc cagccgcccg gccagatcgg    216720
     gggcggcttc gaacagtgca ccaaattcct cctccgcccg accagcccgc cccgccgcca    216780
     gcgacagggc acgcggagag cgagaaatgg gtttgcctga caaggggaca ccccgccccg    216840
     acgccatcaa ggcggtcttg cgtcccagcc atccgtcaag aatgctcccg gacatgcgat    216900
     aggcatccac gtaggatttg aaatcagcgc cttgcagaac atccagttcc ttgtggcgtt    216960
     gcatcggatc ggtttgctgg gcaatgaacg cgatcacgcc cggcaaggcg cgctgatgat    217020
     ctgcggagtc tagaaagacg ctggcggcct gggccatcgc ggatgtctcg accccgctgc    217080
     ccgccaccag caggcattgc cacatcgggt gtcgccagta gccgcgctgc atcgcgtcgg    217140
     catgatcttc agctatctcc ttgttgctgc gaaactccag agcctcgaaa tagcgcggcg    217200
     ccagatcggc cacctcggca aagcgggcag cggcaaaggc gcgctggatg tcgcgcgaca    217260
     ggcgcgaggc ggaccgccag tcggacccgt cgggacgata gacatcctca tgggcgcgta    217320
     cgcccagcgg atcaccggcg cggctttcgc tggcttcgct gacggtggtg aaatcctcgt    217380
     ccgccgtgct cagcccatgt tgcgcggccg aggtgaattc ctgcttttcg gccagctcgc    217440
     gcagatcgtc gcccaggtcg aacgcctctt ccttgctcaa cacccggccc agcagaacat    217500
     tgacccgcgc ccgccaggcg gcgggcaacg tttccagatc ctcgcccaac gacagatcca    217560
     gcgcgcgcgc ggtttgagca tcgaattccg gcacatcccg tggcgacaga aacgcttcgt    217620
     aatagagcgc gtgaagattg cgcatctcgg ggtccatcgc ctgccaccgc tggcgggcgc    217680
     cctcatcgga cccgtcgggc gggcccagtc ggaaatagtc gcgcgcggcg gaacagacgg    217740
     ccagcgcatc ctcgcgcagc cgcgccttgc gcttgtggtc ggcggcggta tcggcctcgc    217800
     gcgggccggc aaacaggcca gcaaccatca tccgccgcac atcggcccgg tgacgcaggt    217860
     caaagggcgg ctcgcccgga tcgaccagcc agtattcatt ctcaagcttt ttgcgcagcg    217920
     cctcggccct gccctcgggc aacacggtgc cctcgggcag acccagacag ggcaccgcca    217980
     gcacaaagcg gatcaggtcg gtattgatct gacgcagcac cagaccggga tgcgccaggc    218040
     tgcgcaattc agggtcgtcg atccggtcga ggatgcgttc ataaaggaag cgatgggcaa    218100
     attccgagcg aaaggccccg gccccgtcct cttccagatc ggcgatcagg tcggcgatat    218160
     caccgtcatg agtgcgcgcg tatttaacaa atatcaacag cgccagcggg tgccccttga    218220
     gcaggcggct gacagtgcgg cgcagggtct cgtcggtcag caccggtggg cggtcgatac    218280
     ccttgcgctg ttggtcctct tcggacaggc gccgatcctc ttcctcgatc agctgcgcgc    218340
     ccgcctcgac cgagaggcca tccagcgtga tccggcgcga ggacgggcca aatcggtcgt    218400
     ccagctcctc gccttccagc ggttcggcgc ggcccgacag cacacagcgc aggcccggca    218460
     gttcgcggcg gaactgttcc tcgaccgcca ggatcaaccg caccacctcg ccgccctgcc    218520
     ggtcgaccgc ctcgaaactg tcaaaggcca gggcgatggg ttgcgaccgc aggccatgcg    218580
     tccaatcacc cctgaaccag ccgggcagct ggctttccag gaaatcggcc tgggcaccgt    218640
     gatcgcgcac ctcgcccatc aggtcggtcg aggacaacat cgcgcgccgc atgcgcaatt    218700
     gtttcgaaac attggcggcg gcttcgggcg ggtccagcgt gcgggtcacg ccgacggcaa    218760
     tctggttgag gatctcacgg gcgatctgga acggcgcgcc ggttttcagc tgtggccggt    218820
     cgaaatcgag gatcacggtg atcggggcat cgcgccgcgt ctgccaatcc tgcaacagcc    218880
     gggccagcac cgccgatttg ccgatgcccc ctgtgccggt cagcaacagc gggcgcgtgt    218940
     ccttggtttt gccgcgcaga aagtgcgaca ggcgccggcg gatattgtca tagccgaaat    219000
     ggcggcgcgg cagcacgatg accagatcgc gccatttctg cacctcctgg atttgccgct    219060
     tggcctcgct ttcgagcgtt tcgagtgcgc gagcatccag cgccggcacc gcgcgggcga    219120
     actgtaccgc gtccagaatg gccgcgttgt ggcgcagatg ggtcagcagg cgggtctcgt    219180
     tgtcgctgcc cttgggccgg gccacctcga cctgcgcacc ggccagcagc tgatgcagca    219240
     cctgcccgaa cagatcgtcc tgccagggcg tgggcgccag ctccagcgcc tgatccagct    219300
     gcgcccgagt cagaaaccgg cgcagcgcgg cggcgcgcgg atcgggcgcc aacatccagc    219360
     catagcgggg ggacgcttcc ggcaccgggc acagaacctc ggtcacgccg cgcgacagcg    219420
     cgcccagaac atcatggcgc aggtcgggcc ggtcctcgac cccaagcgca tcacacaagg    219480
     cgtcgggttc gtaacagccg cacaccgcac tcagctcttg tgcgaggtcg atcagggcct    219540
     gccgcatcac tcgccctcca gaccctgcgg atcgcgggcg ccgacccgcc cgaacagcgc    219600
     atccgccgcg ccagccacat gggtttcgac aaagtcagac atccgctcca gcggcgcctc    219660
     ggacccggca agcgaggcga tgatgctgct gaggaaacgc aggctggtct cgtcaaaggg    219720
     cttgtcccgc gccccgcgca tgttcagcca ttcgcgaaag atctgccccg gatcggacag    219780
     gtcgctcagg cgaatggccg agtgcagcac cagttggggg tcgagcccgt tgatctggat    219840
     atcctcgcgc aagccgatca acaccagccg cagattgtcc tgccgcccga tctgttcata    219900
     cagcgtcgac aggaattcgc gccccgaggc atcggacagg tcgtgccggt ccagatcgtc    219960
     aagcaggatc cagaccatgc ggtcgcccag ccggtcgctg acctgctgca tgaacttcga    220020
     caccagccgt ttgacatagg ccggggtggt ggtgtcgggt gcctcgggca ggctggccac    220080
     cgcatcgggg gcaaagctgg ccagcgtatc gcaggccatg cgataggcat cgacctgtac    220140
     gtcgccggcg cgaaacacga tatgatggtg ttcgggcgcg gcaaagagcg cgcgcaggat    220200
     ctcgaccgaa aagcttttgc ccgggcgggt gaccgccacc tcctcgtggg attccacatg    220260
     cacgcgcaga atgcggcggt cgcccttcca cagctgctcg agcgcggcga tgtaatcggc    220320
     gcggccaaag accggtcggc gcccgtccag acagcccccc accgggctga ggccggggat    220380
     ctcggccagc ttgcccagca cctccttggc tgccagatcg gcggcgacgg cggtgagcgg    220440
     gaccgccacg ttgagcgcgg gatgatgacg ggcatcgggc ggaggggtca gggcctcgag    220500
     ccccagatag tgcagcgcca ccggttgacc attctggtcc agcgccagcc cgcccgagga    220560
     gccacgcgcc gtagtcgcct gatgaaacaa ccgctgctgg cgcggttggc catagaccac    220620
     cttgccgccg gtgatcgtgt gttcctccga acccggatga tgcaggatcc aaaccccatt    220680
     cggcacgtcc tgcgttaccc gcgccagatc gaaccaaccc cgttgcagac ccggcgcgcc    220740
     ggtcagccgg atcgcagcat agtcccagaa cccatcgacc gcgcgcagcc aggcgcgccg    220800
     cttggccagc ttgtcccagg cgtaatcctc ttccagtttg ggcccggtct cgctgtgggc    220860
     gatcaaccag tcctcggcca cgtcgaacac cgcgcccttg ccctcttcga tgccggttgt    220920
     cgcggaatag tcgaagcgga tctgcagatc gcccggctcc agcggcaggt cgatcatatc    220980
     cttgatcacg tggaaattgg tcagcaccgt cgaaggcccc gatcagaaag ccgctgccgg    221040
     tgacccggtc gcccatctcg ttcagggcct cgacccggca gagccgcctg cgccccagga    221100
     tgatgccggg caggatgttg ccgggatcgg tccagaacgc ggtctcgtcg accagggctt    221160
     cggtattggc ccgttgcagc gtggcatggg cgcgcttcaa ccccagcgcg ctgatcatct    221220
     tttgcgccag ttgacggcga tgcaccggca agggatccga ggcaccgata tcgaacaggc    221280
     ccgccgacac ggcggcggcg aaacagtcgg ccaccgcctg cggcccgccg agcgcggcca    221340
     gcgccaggca cagcgcatcg ccgtcgcggg ccgggttgag cccgccgccg cgcccggtca    221400
     ccaccatcgc atgggcaaag ctgaccggtg cccccggcag acgcctggcg gccagccagc    221460
     catcgtacca gccgcgcagc tgcgggcgcg caaaatgaag cccccgcacc acgcccagca    221520
     cgcaagagat cagccgttcc tcggtccagt cctgttccgt cattccccct gcccgttcag    221580
     caacccggtg gcaaaggccc cgtcgcccat ccccagcacc gcctgaatat catgcgccag    221640
     gttggtttcc agcgactgcc cgccgaaatg cagcccgcac agctgacccg gattgtgcag    221700
     cgacaggatg gccgaacccg agttgccggg taaggtggtc gcatcatggc tgaaggccca    221760
     gccgcgcgga tcgcccgtca ccgcgcccgg gcgcgcctcg atcatgccgg ggctgatgta    221820
     tttcaccccg tagcggtcgc cataaagctc gcccagccgc gcccagaacg ccagataggt    221880
     atcctggtcc tgacgcgggt cggggccgcg cacattgcgc ggctcggccg gatagccggc    221940
     caccagaatc ttggtcagcg ccagatcggt ggtcgagatc agaccccggt cgatcgggtc    222000
     gggcggcgga gcatggccat tgtccgggtc gatccgcatc agcgccatgt cgagccgcgc    222060
     catgttgacc gtgcgcccga tccgtgcccc gcccgccgtc gccacctcgg taagggtata    222120
     gcgggtggtc tcgtcggcgg cgtccgggtc gaagatgatc gagaccggaa agcgcagctt    222180
     gaacgggcgc tggccgttct cctcgggcat cggctcagca aaggcgtcga tcacgtggcg    222240
     gttggtcatc accaacccgt ccgccagcag gaacccggtg cccacatgca cccagacccc    222300
     ttgcggattg cgcgcgtcga tgcggcccac cgcgcgcacc agcggttgcc agcggctgac    222360
     cgccgtcagc agatcggccc gccaggtgcc cagcagcgga tcgaacagtt cggacccgtc    222420
     cgcctgaacc cggatcgcag gccgcccgct gagcttgacc agcgcctcga gcgcaaagcc    222480
     cacctcgccc gggctgaggc gcacgtcgcg atccgggtcc agatgcgatt gcaccgcctg    222540
     gcggatcttg tccgccgctt cggcctgcat gtcggtgtcg accaggtcgg gggcggactc    222600
     ggcacgggcc tggaacagct cgttcaccgt ctccatcacc gtgtccagcc cctcgcccct    222660
     gagccggtcg accgaggcct catagctgag atcggcggcg ctttcggtgg tgccgccgcg    222720
     cccggcggcc agccggcgaa aggcacggtc cagcggcgcg ggcggtgcgg cgggggccaa    222780
     caccagcccc ggctcgccca gcggctgccg gtcacccagc agcgcagcca gcgccggaga    222840
     cggcatttcg cgcatcgcgt tctcgaccgt ggccgaggcc tcgggccgtt cgcgcagccg    222900
     ccagtcgaag gcaaggtatt ccgcctcggc ctgcaggcca cccgcgtcga aatcggcgcc    222960
     gaacagcagt tcggcgggac cggcgctttc gggggcggcg ccgaccatga tatcggcggg    223020
     atcaagcgcc agcagcgcct cggcgtcaac gatgcccgcg cccatctggg agtgatccca    223080
     cccggcaggc gcatttgcac tctggcgcag ggcggcgcgg aacagttcct gcagcggcag    223140
     gccccggcgc cgcgcctctt gtcgcagcgc ggtccagccg tgatgttcca gccacagcgc    223200
     cgccaccccc gccgtcagcg ccaccgcaaa cgaggtaccc tgcccggtat cggtcacatc    223260
     gctcagatcg gtctcgcccg ggcggcggcg cgccacatgc acattctccg ccggagcggc    223320
     aatatcgacc tcggggcccc ggcacgaccc gcgccagcgc cggccggcat gatccacccc    223380
     ggccaccgcg atcacgttgc ggtcaaaggc gggataggtg acgaaacgca cgcaattgcc    223440
     cgccgccgcc agcaggatca tgtcggccga aaccgcg