(data stored in ACNUC7421 zone)

EMBL: CP000039

ID   CP000039; SV 1; circular; genomic DNA; STD; PRO; 214396 BP.
XX
AC   CP000039;
XX
PR   Project:PRJNA13151;
XX
DT   31-AUG-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Shigella sonnei Ss046 plasmid pSS_046, complete sequence.
XX
KW   .
XX
OS   Shigella sonnei Ss046
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Shigella.
OG   Plasmid pSS_046
XX
RN   [1]
RP   1-214396
RX   DOI; 10.1016/j.plasmid.2005.03.002.
RX   PUBMED; 16122562.
RA   Jiang Y., Yang F., Zhang X., Yang J., Chen L., Yan Y., Nie H., Xiong Z.,
RA   Wang J., Dong J., Xue Y., Xu X., Zhu Y., Chen S., Jin Q.;
RT   "The complete sequence and analysis of the large virulence plasmid pSS of
RT   Shigella sonnei";
RL   Plasmid 54(2):149-159(2005).
XX
RN   [2]
RC   Publication Status: Online-Only
RP   1-214396
RX   DOI; 10.1093/nar/gki954.
RX   PUBMED; 16275786.
RA   Yang F., Yang J., Zhang X., Chen L., Jiang Y., Yan Y., Tang X., Wang J.,
RA   Xiong Z., Dong J., Xue Y., Zhu Y., Xu X., Sun L., Chen S., Nie H., Peng J.,
RA   Xu J., Wang Y., Yuan Z., Wen Y., Yao Z., Shen Y., Qiang B., Hou Y., Yu J.,
RA   Jin Q.;
RT   "Genome dynamics and diversity of Shigella species, the etiologic agents of
RT   bacillary dysentery";
RL   Nucleic Acids Res. 33(19):6445-6458(2005).
XX
RN   [3]
RP   1-214396
RA   Jin Q., Yang F., Yang J., Jiang Y., Yan Y., Chen L., Zhang X., Peng J.,
RA   Tang X., Xiong Z., Nie H., Dong J., Xue Y., Xu X., Zhu Y., Shen Y.,
RA   Qiang B., Hou Y.;
RT   ;
RL   Submitted (29-OCT-2004) to the INSDC.
RL   State Key Laboratory for Moleclular Virology and Genetic Engineering,
RL   Microbial Genome Center of Chinese Ministry of Public Health, 6 Rongjing
RL   Eastern Street, BDA, Beijing 100176, P. R. China
XX
RN   [4]
RC   Protein update by submitter
RP   1-214396
RA   Yang J., Chen L., Jin Q.;
RT   ;
RL   Submitted (30-JUL-2007) to the INSDC.
RL   State Key Laboratory for Moleclular Virology and Genetic Engineering,
RL   Microbial Genome Center of Chinese Ministry of Public Health, 6 Rongjing
RL   Eastern Street, BDA, Beijing 100176, P.R.China
XX
DR   MD5; 719945eb30f6a5813c5242fffe48f480.
DR   BioSample; SAMN02603602.
DR   EnsemblGenomes-Gn; EBG00001189208.
DR   EnsemblGenomes-Tr; EBT00001767661.
DR   EuropePMC; PMC1278947; 16275786.
DR   EuropePMC; PMC3071730; 21483688.
DR   EuropePMC; PMC5382810; 28663823.
DR   EuropePMC; PMC5447701; 28611956.
DR   EuropePMC; PMC5544247; 28727722.
DR   EuropePMC; PMC5913960; 29378707.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00042; CopA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01999; group-II-D1D4-2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..214396
FT                   /organism="Shigella sonnei Ss046"
FT                   /plasmid="pSS_046"
FT                   /strain="Ss046"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:300269"
FT   mobile_element  complement(219..564)
FT                   /mobile_element_type="insertion sequence:IS2"
FT                   /note="partial"
FT   gene            complement(275..493)
FT                   /locus_tag="SSON_P002"
FT                   /old_locus_tag="SSO_P002"
FT                   /note="SSOP002"
FT   CDS_pept        complement(275..493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P002"
FT                   /old_locus_tag="SSO_P002"
FT                   /product="IS2 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P002"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91023"
FT                   /db_xref="GOA:Q3YTZ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTZ0"
FT                   /protein_id="AAZ91023.1"
FT                   /translation="MVHATGLMKHASSPGCWDFVEPKNTAVRSPESNRIAKSFVKTIKC
FT                   DYISIMPKPDGLTAAKNLAEAFEHYNE"
FT   gene            485..949
FT                   /locus_tag="SSON_P001"
FT                   /old_locus_tag="SSO_P001"
FT                   /note="SSOP001"
FT   CDS_pept        485..949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P001"
FT                   /old_locus_tag="SSO_P001"
FT                   /product="putative resolvase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P001"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91022"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTY9"
FT                   /protein_id="AAZ91022.1"
FT                   /translation="MNHYPSVTSLETPEARCRSGVPPLPACRQRESIYGLIELFIQIVH
FT                   RLSVRSERRLVKTLLADFQRVHGKTALLFRIAEAALNNPDGLVKEVVYHLHIVEPDRSG
FT                   KRSSSYLAQLRDVSARGDAVKNGRTLPEQDSGLPALVSDPGLPRMISTVL"
FT   gene            1176..2042
FT                   /gene="ospB"
FT                   /locus_tag="SSON_P003"
FT                   /old_locus_tag="SSO_P003"
FT                   /note="SSOP003"
FT   CDS_pept        1176..2042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospB"
FT                   /locus_tag="SSON_P003"
FT                   /old_locus_tag="SSO_P003"
FT                   /product="OspB"
FT                   /note="protein secreted by the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P003"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTY8"
FT                   /protein_id="AAZ91024.1"
FT                   /translation="MNLDGVRPYCRIVNKKNESISDIAFAHIIKRVKNSSCTHPKAALV
FT                   FLGEKGFCDSNDVLSIMGQQIPRVFKNKMLYDYVFKNEKSKNDFLKMAESWLPQSEPIV
FT                   INNDDDALNAAAYFSVKKAKIKTVNDTDFKEYNKVYILGHGSPGSHQLGLGSELIDVQT
FT                   IISRMKDCGILNVKDIRFTSCGSADKVAPKNFNNAPAESLSCILNSLPFFKEKESLLEQ
FT                   IKKHLENDESLSDGLKISGYHGYGVHYGQELFPYSHYRSTSIPADPEHTVKRSSQKKTF
FT                   IINKELD"
FT   gene            2371..3111
FT                   /gene="phoN2/apy"
FT                   /locus_tag="SSON_P004"
FT                   /old_locus_tag="SSO_P004"
FT                   /note="SSOP004"
FT   CDS_pept        2371..3111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoN2/apy"
FT                   /locus_tag="SSON_P004"
FT                   /old_locus_tag="SSO_P004"
FT                   /product="PhoN2 (Apy)"
FT                   /note="periplasmic phosphatase, apyrase, ATP
FT                   diphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P004"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91025"
FT                   /db_xref="GOA:Q3YTY7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTY7"
FT                   /protein_id="AAZ91025.1"
FT                   /translation="MKTKNFLLFCIATNMIFIPSANALKAEGFLTQQTSPDSLSILPPP
FT                   PAEDSVVFQADKAHYEFGRSLRDANRVRLASEDAYYENFGLAFSDAYGMDISRENTPIL
FT                   YQLLTQVLQDSHDYAVRNAKEYYKRVRPFVIYKDATCTPDKDENMAITGSYPSGHASFG
FT                   WAVALILAEINPQRKAEILRRGYEFGESRVICGAHWQSDVEAGRLMGASVVAVLHNTPE
FT                   FTKSLSEAKKEFEELNTPTNELTP"
FT   mobile_element  3218..3347
FT                   /mobile_element_type="insertion sequence:IS629"
FT                   /note="partial"
FT   gene            3363..3581
FT                   /locus_tag="SSON_P005"
FT                   /old_locus_tag="SSO_P005"
FT                   /note="SSOP005"
FT   CDS_pept        3363..3581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P005"
FT                   /old_locus_tag="SSO_P005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P005"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91026"
FT                   /db_xref="GOA:Q3YTY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTY6"
FT                   /protein_id="AAZ91026.1"
FT                   /translation="MWCCRGTVCTIPYVDQYNRNDNFRFRAQPKYILGHLSNRLPDTAP
FT                   FFNKKSIIFESLLFIALSSIVSPLFAF"
FT   gene            complement(3464..5233)
FT                   /pseudo
FT                   /gene="ospC4"
FT                   /locus_tag="SSON_P007"
FT                   /old_locus_tag="SSO_P007"
FT                   /note="SSOP007; contains IS630 insertion; original product:
FT                   OspC4, probably secreted by the Mxi-Spa secretion
FT                   machinery"
FT   mobile_element  3625..4783
FT                   /mobile_element_type="insertion sequence:IS630"
FT   gene            3729..4760
FT                   /locus_tag="SSON_P006"
FT                   /old_locus_tag="SSO_P006"
FT                   /note="SSOP006"
FT   CDS_pept        3729..4760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P006"
FT                   /old_locus_tag="SSO_P006"
FT                   /product="IS630 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P006"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91027"
FT                   /db_xref="GOA:Q3YTB7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB7"
FT                   /protein_id="AAZ91027.1"
FT                   /translation="MPIIAPISRDERRLMQKAIHKTHDKNYARRLTAMLMLHRGDRVSD
FT                   VARTLCCARSSVGRWINWFTQSGVEGLKSLPAGRARRWPFEHICTLLRELVKHSPGDFG
FT                   YQRSRWSTELLAIKINEITGCQLNAGTVRRWLPSAGIVWRRAAPTLRIRDPHKDEKMAA
FT                   IHKALDECSAEHPVFYEDEVDIHLNPKIGADWQLRGQQKRVVTPGQNEKYYLAGALHSG
FT                   TGKVSCVGGNSKSSALFISLLKRLKATYRRAKTITLIVDNYIIHKSRETQSWLKENPKF
FT                   RVIYQPVYSPWMNHVERLWQALHDTITRNHQCSSMWQLLKKVRHFMETVSPFPGGKHGL
FT                   AKV"
FT   gene            complement(5491..7200)
FT                   /gene="ospD2"
FT                   /locus_tag="SSON_P008"
FT                   /old_locus_tag="SSO_P008"
FT                   /note="SSOP008"
FT   CDS_pept        complement(5491..7200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospD2"
FT                   /locus_tag="SSON_P008"
FT                   /old_locus_tag="SSO_P008"
FT                   /product="OspD2"
FT                   /note="probably secreted by the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P008"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91028"
FT                   /db_xref="InterPro:IPR012927"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTY4"
FT                   /protein_id="AAZ91028.1"
FT                   /translation="MPLNKTFSSSIFSTKNSLSTDMSVNRDNRTITSSIMRVSNSSELI
FT                   QFKNKTAPYFSEKRNVKVNINGVAKDIYGRQIVCRHLASYWEMNFMETNGKVNYQLLST
FT                   PDAIAKNVCLEKTEDFSKSPAYIYFVENKKWGTVITNFFYNMKKNGDFVRTLSACTLNH
FT                   QMALGLKIKRVQESEKWVVQFFDPNRTVTHKRTVFTCDSHFELSQLSAKDFFDDFYWKI
FT                   YGLEQPGQVIFEDRHNSPLTNTVKLLPDELINSRVIYHAITKNLTEVLFILMEKYKNGE
FT                   ISQSKLVNLLATRSSDGTPAFYIALQNGCSDIIQVYGKILNMCNLSQETILTLLAAVGA
FT                   NNVPGLCMSFMNGHVDTIKAYGEIVFKTPLTSDKRLYLLAAKDSHDLPGLFFALQNGHA
FT                   DSIRMFGSLLNKKMLSSEQIKELLKVKHGLFMALQNGHTKAIMAYGDILKILPPHQEYI
FT                   DELLWIKNPNGTSGLFMAFYNGHTETIRAFCNILKNYSFTTRRLVEMLSATNKDGIPGV
FT                   FVSVVNRDKETILEYCRIIKENNLEPDTIAEQFSKKMKKTFIEIINRFNHFL"
FT   gene            complement(7632..8351)
FT                   /gene="ospF"
FT                   /gene_synonym="mkaD"
FT                   /locus_tag="SSON_P009"
FT                   /old_locus_tag="SSO_P009"
FT                   /note="SSOP009"
FT   CDS_pept        complement(7632..8351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospF"
FT                   /gene_synonym="mkaD"
FT                   /locus_tag="SSON_P009"
FT                   /old_locus_tag="SSO_P009"
FT                   /product="OspF, secreted by the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P009"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91029"
FT                   /db_xref="GOA:Q3YTY3"
FT                   /db_xref="InterPro:IPR003519"
FT                   /db_xref="InterPro:IPR038498"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3YTY3"
FT                   /protein_id="AAZ91029.1"
FT                   /translation="MPIKKPCLKLNLDSLNVVRSEIPQMLSANERLKNNFNILYNQIRQ
FT                   YPAYYFKVASNVPNYSDICQFFSVMYQGFQIVNHSGDVFIHACRENPQSKGDFVGDKFH
FT                   ISIAREQVPLAFQILSGLLFSEDSPIDKWKITDMNRVSQQSRVGIGAQFTLYVKSDQEC
FT                   SQYSALLLHKIRQFIMCLESNLLRSKIAPGEYPASDVRPEDWKYVSYRNELRSDRDGSE
FT                   RQEQMLREEPFYRLMIE"
FT   gene            complement(8476..9060)
FT                   /locus_tag="SSON_P010"
FT                   /old_locus_tag="SSO_P010"
FT                   /note="SSOP010"
FT   CDS_pept        complement(8476..9060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P010"
FT                   /old_locus_tag="SSO_P010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P010"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91030"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTY2"
FT                   /protein_id="AAZ91030.1"
FT                   /translation="MLNWLSKLRAARIHLPNAVEKIAFDRFHVAKQPGEVVDKTRQNEH
FT                   PHLPVESRRQAKGTRFLWQHSNKWMTESRQEKLIWLRAQMKLTSLCWALKELAKDIWSR
FT                   PWSEERRNDWQRWLSLAANSDVPMMKNVAKTIGKRLYGILNAMRHGVSNGNAEALNSKI
FT                   RLLRIKAKGYRNRERFKLGVMFHYGKLNMAF"
FT   gene            complement(9390..9968)
FT                   /locus_tag="SSON_P011"
FT                   /old_locus_tag="SSO_P011"
FT                   /note="SSOP011"
FT   CDS_pept        complement(9390..9968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P011"
FT                   /old_locus_tag="SSO_P011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P011"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91031"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTY1"
FT                   /protein_id="AAZ91031.1"
FT                   /translation="MKVSFKSLGYIFHDIYNKKHTIDEFNDVVRKAVLSGKINELNACH
FT                   KVAIFLAEKDNEITKKDKAKIIDTLTENYSIEFQQLMNISERTLNSSLYITPGESGFVS
FT                   FVNREGKICHTAYVKSSDNSMAYYHANYSSIDKYITDMCGLICMRHIESTGIIFYMLDE
FT                   KVLSAIAEFMNEKGWRAAFCSAKNLYKCV"
FT   mobile_element  complement(10014..10238)
FT                   /mobile_element_type="insertion sequence:IS2"
FT                   /note="partial"
FT   mobile_element  complement(10367..10514)
FT                   /mobile_element_type="insertion sequence:IS21"
FT                   /note="partial"
FT   mobile_element  10526..11684
FT                   /mobile_element_type="insertion sequence:IS630"
FT   gene            10630..11661
FT                   /locus_tag="SSON_P012"
FT                   /old_locus_tag="SSO_P012"
FT                   /note="SSOP012"
FT   CDS_pept        10630..11661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P012"
FT                   /old_locus_tag="SSO_P012"
FT                   /product="IS630 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P012"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91032"
FT                   /db_xref="GOA:Q3YTY0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTY0"
FT                   /protein_id="AAZ91032.1"
FT                   /translation="MPIIAPISRDERRLMQKAIHKTHDKNYARRLTAMLMLHRGDRVSD
FT                   AARTLCCARSSVGRWINWFTQSGVEGLKSLPAGRARRWPFEHICTLLRELVKHSPGDFG
FT                   YQRSRWSTELLAIKINEITGCQLNAGTVRRWLPSAGIVWRRAAPTLRIRDPHKDEKMAA
FT                   IHKALDECSAEHPVFYEDEVDIHLNPKIGADWQLRGQQKRVVTPGQNEKYYLAGALHSG
FT                   TGKVSCVGGNSKSSALFISLLKRLKATYRRAKTITLIVDNYIIHKSRETQSWLKENPKF
FT                   RVIYQPVYSPWVNHVERLWQALHDTITRNHQCSSMWQLLKKVRHFMETVSPFPGGKHGL
FT                   AKV"
FT   gene            complement(11667..11846)
FT                   /locus_tag="SSON_P013"
FT                   /old_locus_tag="SSO_P013"
FT                   /note="SSOP013"
FT   CDS_pept        complement(11667..11846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P013"
FT                   /old_locus_tag="SSO_P013"
FT                   /product="IS21 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P013"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91033"
FT                   /db_xref="GOA:Q3YTX9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX9"
FT                   /protein_id="AAZ91033.1"
FT                   /translation="MNKRAFFGAFLIFWGFKFLSMNCRYEKASIILTSNKGVADWGEMF
FT                   GDHVLATAILNSCA"
FT   mobile_element  complement(11686..11785)
FT                   /mobile_element_type="insertion sequence:IS21"
FT                   /note="partial"
FT   mobile_element  complement(11785..12383)
FT                   /mobile_element_type="insertion sequence:IS91"
FT                   /note="partial"
FT   gene            complement(12094..12450)
FT                   /locus_tag="SSON_P014"
FT                   /old_locus_tag="SSO_P014"
FT                   /note="SSOP014"
FT   CDS_pept        complement(12094..12450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P014"
FT                   /old_locus_tag="SSO_P014"
FT                   /product="IS91 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P014"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91034"
FT                   /db_xref="GOA:Q3YTX8"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX8"
FT                   /protein_id="AAZ91034.1"
FT                   /translation="MLPRFADIFQQGNRWLNWLEKQSVQMSRLEHYAGQDEIGLRYNSH
FT                   RTKREENLVMSGDEFMERFSWHVADKGFRMVIRGPESGEAAITGRCGVRHNGDSEKNGE
FT                   ANHKERDVSAVTEG"
FT   mobile_element  complement(12381..12713)
FT                   /mobile_element_type="insertion sequence:IS91"
FT                   /note="partial"
FT   gene            complement(12450..12635)
FT                   /locus_tag="SSON_P015"
FT                   /old_locus_tag="SSO_P015"
FT                   /note="SSOP015"
FT   CDS_pept        complement(12450..12635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P015"
FT                   /old_locus_tag="SSO_P015"
FT                   /product="putative IS91 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P015"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX7"
FT                   /protein_id="AAZ91035.1"
FT                   /translation="MDAGNKKLVFWFVRVDDEGYPEIARCMEREFATIPAGISADGMYC
FT                   PECGTVHWPDGVIPPF"
FT   gene            12798..13082
FT                   /locus_tag="SSON_P016"
FT                   /old_locus_tag="SSO_P016"
FT                   /note="SSOP016"
FT   CDS_pept        12798..13082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P016"
FT                   /old_locus_tag="SSO_P016"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P016"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91036"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX6"
FT                   /protein_id="AAZ91036.1"
FT                   /translation="MEYRTWITEALRLHFEEHLPRVVAGRRLGVPKSTVCGMFVRFRNA
FT                   GLSWPLPAGMSEQELDALLYGSASTVPVVLTESTVMPKLPVVKKRPRRP"
FT   mobile_element  complement(13080..13718)
FT                   /mobile_element_type="insertion sequence:IS4"
FT                   /note="partial"
FT   gene            complement(13093..13665)
FT                   /locus_tag="SSON_P017"
FT                   /old_locus_tag="SSO_P017"
FT                   /note="SSOP017"
FT   CDS_pept        complement(13093..13665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P017"
FT                   /old_locus_tag="SSO_P017"
FT                   /product="IS4 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P017"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91037"
FT                   /db_xref="GOA:Q3YTX5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX5"
FT                   /protein_id="AAZ91037.1"
FT                   /translation="MKLKTSPQARKKWPGLGNEVTARLLTVTRKGKVCHLLTSMTDAMR
FT                   FPGGEMADLYSHRWEIELGYREIKQTMQLSRLTLRSKKPELVEQELWGVLLAYNLVRYQ
FT                   MIKMAEHLKGYWPNQLSFSESCGMVMRMLMTLQGASPGRIPELMRDLASMGQLVKLPTR
FT                   RERAFPRVVKERPWKYPTAPKKSQSVA"
FT   gene            13793..14140
FT                   /locus_tag="SSON_P018"
FT                   /old_locus_tag="SSO_P018"
FT                   /note="SSOP018"
FT   CDS_pept        13793..14140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P018"
FT                   /old_locus_tag="SSO_P018"
FT                   /product="ISSfl4 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P018"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91038"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX4"
FT                   /protein_id="AAZ91038.1"
FT                   /translation="MISFPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLFI
FT                   FRGRRGDQIKVLWADSDGLCLFTRRLERGRFVWPVTRDGKVHLTPAQLSMLLEGIDWKH
FT                   PKRTERAGIRI"
FT   mobile_element  complement(13838..14145)
FT                   /mobile_element_type="insertion sequence:ISSfl4"
FT                   /note="partial"
FT   gene            14160..15392
FT                   /locus_tag="SSON_P019"
FT                   /old_locus_tag="SSO_P019"
FT                   /note="SSOP019"
FT   CDS_pept        14160..15392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P019"
FT                   /old_locus_tag="SSO_P019"
FT                   /product="putative IS orf, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P019"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91039"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX3"
FT                   /protein_id="AAZ91039.1"
FT                   /translation="MDTSLAHENARLRALLQTQQDTIRQMAKYNRLLSQRVAAYASEIN
FT                   RLKALVAKLQRMQFGKSSEKLRAKTERQIQEAQERISALQEEMAETLGEQYDPVLPSPL
FT                   RQSSAHKPLPASLPRETRVIRPEEECCPACGGELSSLGCDVLEQLELISSAFKVIETQR
FT                   PKLACCRCDHIVQAPVPSKPIARSYAGAGLLAHVVAGKYADYLPLYRQSEIYRRQGVEL
FT                   SRATLGRWTGAVAELLEPLYDILRQYVLMPGKVHADDIPVPVQEPGSGKTRTARLWVYV
FT                   RDDRNAGSEMPPAVWFAYSPDRKGIHPQNHLAGYSGVLQADAYGSYRALYESGRITEAQ
FT                   QRIGELYAIEAEVRGCSAEQRLAARKARAAPLMQSLYDWIQQQMKIHSLKMECLHGEHY
FT                   YPSGNSAGNSV"
FT   mobile_element  complement(14621..14831)
FT                   /mobile_element_type="insertion sequence:ISSfl4"
FT                   /note="partial"
FT   mobile_element  14915..15132
FT                   /mobile_element_type="insertion sequence:ISEc8"
FT                   /note="partial"
FT   mobile_element  15316..15513
FT                   /mobile_element_type="insertion sequence:IS3"
FT                   /note="partial"
FT   gene            16042..16200
FT                   /locus_tag="SSON_P020"
FT                   /old_locus_tag="SSO_P020"
FT                   /note="SSOP020"
FT   CDS_pept        16042..16200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P020"
FT                   /old_locus_tag="SSO_P020"
FT                   /product="putative transposase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P020"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91040"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX2"
FT                   /protein_id="AAZ91040.1"
FT                   /translation="MISNEGEFMNEKQLTSNKLRALANELAKSLKNPEDLSQFDWMLKM
FT                   KPYSMLI"
FT   gene            16197..16367
FT                   /locus_tag="SSON_P021"
FT                   /old_locus_tag="SSO_P021"
FT                   /note="SSOP021"
FT   CDS_pept        16197..16367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P021"
FT                   /old_locus_tag="SSO_P021"
FT                   /product="putative transposase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P021"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91041"
FT                   /db_xref="GOA:Q3YTX1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX1"
FT                   /protein_id="AAZ91041.1"
FT                   /translation="MTHHLGCEKNQLRSGSNSRNGCLTKIITTGDEPLEIRTLRDRNGT
FT                   FEPQQLKKNQP"
FT   mobile_element  16449..16607
FT                   /mobile_element_type="insertion sequence:IS630"
FT                   /note="partial"
FT   gene            16954..17631
FT                   /gene="ospD1"
FT                   /locus_tag="SSON_P022"
FT                   /old_locus_tag="SSO_P022"
FT                   /note="SSOP022"
FT   CDS_pept        16954..17631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospD1"
FT                   /locus_tag="SSON_P022"
FT                   /old_locus_tag="SSO_P022"
FT                   /product="OspD1"
FT                   /note="secreted by the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P022"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91042"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTX0"
FT                   /protein_id="AAZ91042.1"
FT                   /translation="MSINNYGLHPANNKNMHLIIGSNTANENKGMKSNIINVTNSAISH
FT                   AINEEKSGGGYSGVSFRKLAKIQSISIPTKNNKEYNRHNLFSLIWHGNADAARKYGESL
FT                   LAAEIPKEEKLEVLAARNNAGESALFIALQEGHSAAIQAYGDFIKTFDLSPKETIKLLD
FT                   VRDNEGLPGLFLAAGKGNIEAMMAYINICHHSGIKLTEIADRLNNNEQDMFNIISDKIQ
FT                   ELF"
FT   mobile_element  17967..18095
FT                   /mobile_element_type="insertion sequence:IS3"
FT                   /note="partial"
FT   gene            complement(18113..18337)
FT                   /locus_tag="SSON_P023"
FT                   /old_locus_tag="SSO_P023"
FT                   /note="SSOP023"
FT   CDS_pept        complement(18113..18337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P023"
FT                   /old_locus_tag="SSO_P023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P023"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91043"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTW9"
FT                   /protein_id="AAZ91043.1"
FT                   /translation="MPGATVADEFDKTLAFLEAIVNADNETTIGEIRSFADALDAVRFN
FT                   RNKINRQLSKPNLASLALEHEVIWLGRSR"
FT   gene            18740..19306
FT                   /gene="ipgB2"
FT                   /locus_tag="SSON_P024"
FT                   /old_locus_tag="SSO_P024"
FT                   /note="SSOP024"
FT   CDS_pept        18740..19306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipgB2"
FT                   /locus_tag="SSON_P024"
FT                   /old_locus_tag="SSO_P024"
FT                   /product="IpgB2"
FT                   /note="probably secreted by the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P024"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91044"
FT                   /db_xref="GOA:Q3YTW8"
FT                   /db_xref="InterPro:IPR004959"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTW8"
FT                   /protein_id="AAZ91044.1"
FT                   /translation="MLGTSFNNFGISLSHKRYFSGKVDEIIRCTMGKRIVKISSTKINT
FT                   SILSSVSEQIGENITDWKNDEKKVYVSRVVNQCIDKFCAEHSREIGDNLRKQIFKQVEK
FT                   DYRISLDINAAQSSINHLVSGSSYFKKKMDELCEGMNRSVKNDTTSNVANLISDQFFEK
FT                   NVQYIDLKKLRGNMSDYITNLESPF"
FT   mobile_element  19813..21073
FT                   /mobile_element_type="insertion sequence:IS3"
FT   gene            19878..20177
FT                   /locus_tag="SSON_P025"
FT                   /old_locus_tag="SSO_P025"
FT                   /note="SSOP025"
FT   CDS_pept        19878..20177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P025"
FT                   /old_locus_tag="SSO_P025"
FT                   /product="IS3 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P025"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91045"
FT                   /db_xref="GOA:Q3YTW7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTW7"
FT                   /protein_id="AAZ91045.1"
FT                   /translation="MTKTVSTSKKTRKQHSPEFRSEALKLAERIGVAAAARELSLYESQ
FT                   LYAWRSKLQQQMTSSERESELAAENARLKRQLAEQAEELAILQKAATYFAKRLK"
FT   gene            20174..21043
FT                   /locus_tag="SSON_P026"
FT                   /old_locus_tag="SSO_P026"
FT                   /note="SSOP026"
FT   CDS_pept        20174..21043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P026"
FT                   /old_locus_tag="SSO_P026"
FT                   /product="IS3 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P026"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91046"
FT                   /db_xref="GOA:Q3YTW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTW6"
FT                   /protein_id="AAZ91046.1"
FT                   /translation="MKYVFIEKHQAEFSIKAMCRVLRVARSGWYTWCQRRTGISPRQQF
FT                   RQHCDSVVLAAAFTRSKQRYGAPRLTDELRAQGYHFNVKTVAASLRRQGLRAKASRKFS
FT                   PVSYRAHGLPVSENLLEQDFYASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGW
FT                   SMSPRLTAQLACDALQMALWRRKRPRNVIVHSDRGSQYCSADYQALLKWHNLRGSMSAK
FT                   GCCYDNACVESFFHSLKVECLHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPE
FT                   QFENQNLA"
FT   mobile_element  21329..21746
FT                   /mobile_element_type="insertion sequence:iso-IS1"
FT                   /note="partial"
FT   mobile_element  21745..22795
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="partial"
FT   gene            21831..22835
FT                   /locus_tag="SSON_P027"
FT                   /old_locus_tag="SSO_P027"
FT                   /note="SSOP027"
FT   CDS_pept        21831..22835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P027"
FT                   /old_locus_tag="SSO_P027"
FT                   /product="IS100 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P027"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91047"
FT                   /db_xref="GOA:Q3YTR0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTR0"
FT                   /protein_id="AAZ91047.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGLSRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVPGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGSTVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHPGENLVSFDNPVTLFVPLIMGC"
FT   mobile_element  complement(22881..24254)
FT                   /mobile_element_type="insertion sequence:ISSfl2"
FT   gene            23027..24223
FT                   /locus_tag="SSON_P028"
FT                   /old_locus_tag="SSO_P028"
FT                   /note="SSOP028"
FT   CDS_pept        23027..24223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P028"
FT                   /old_locus_tag="SSO_P028"
FT                   /product="ISSfl2 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P028"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91048"
FT                   /db_xref="GOA:Q3Z432"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z432"
FT                   /protein_id="AAZ91048.1"
FT                   /translation="MTESSDYESVQVFIGVDVGKDTHHAVAINRSGKRLFDKALPNDEN
FT                   KLRSLISDLKQHGQILLVVDQPATIGALPVAVARSEGVLVGYLPGLAMRRIADLHAGEA
FT                   KTDARDAAIIAEAARTLPHALRTLKLADEQIAELSMLCGFDDDLAAQTTQASNRIRGLL
FT                   TQIHPALERVLGPRLEHPAVLDLLQRYPSPEKLASLGEKKLAAQLCKLAPRLGKRLAAD
FT                   IAQALAEQTVVVPGTNAAAVVLPRLALQLITLRKQRDEVALEVEQRVLAHPLYPVLTSM
FT                   PGVGVRTAARLLTEVACRAFASAAHLAAYAGLAPVTRRSGSSIRGEHPSRRGNKALKRA
FT                   LFLSAFAALRDPLSRAYYTRKMSQGKRHNQALIALARRRCDVLFAMMRDGTFYTPQGS"
FT   mobile_element  24250..24371
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="partial"
FT   gene            24497..25624
FT                   /locus_tag="SSON_P029"
FT                   /old_locus_tag="SSO_P029"
FT                   /note="SSOP029"
FT   CDS_pept        24497..25624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P029"
FT                   /old_locus_tag="SSO_P029"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P029"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91049"
FT                   /db_xref="GOA:Q3YXF2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YXF2"
FT                   /protein_id="AAZ91049.1"
FT                   /translation="MNNNNTLYVGLDVHKESITVAYAINSEPVELMGKIGTSPTDIQNL
FT                   CKRLRSKSSQVSIVYEAGPCGYGLYRRLVKSGFDCMVCAPSLIPKKPGERVKTDRRDAI
FT                   RLVRSLRAGDLSAVYVPGIEDEAFRDLARAWASARDDLRHARQRLKSFLLVHGVHYVGR
FT                   ADWGPAHRRWLSKYSFESPWRQLAFDEHRRTIEDRQAQCERLESALKEAVTEWRLYPVV
FT                   EALQAMRGIQFITAVGLISELGDLTRFEHPRQLMSWFGITPSEYSSGGSRHQGSITKAG
FT                   NSYARKLLVEAAWSYRHPARISPAIQKRQENLPRPVIDRAWDAQLRLCKRYRKLQAKGK
FT                   NVNITIVAVARELAGFIWDMGRIAMSVAQQPQCHK"
FT   mobile_element  25808..25954
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="partial"
FT   mobile_element  26089..26316
FT                   /mobile_element_type="insertion sequence:iso-IS1"
FT                   /note="partial"
FT   gene            26092..26307
FT                   /locus_tag="SSON_P030"
FT                   /old_locus_tag="SSO_P030"
FT                   /note="SSOP030"
FT   CDS_pept        26092..26307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P030"
FT                   /old_locus_tag="SSO_P030"
FT                   /product="iso-IS1 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P030"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91050"
FT                   /db_xref="GOA:Q3YTW2"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTW2"
FT                   /protein_id="AAZ91050.1"
FT                   /translation="MVTSDDWGSYAREVPKEKHLTGKIFTQRIERNNRTLRTRIKRLAR
FT                   KTICFSRSVEIHEKVIGSFIEKHMFY"
FT   mobile_element  26321..26456
FT                   /mobile_element_type="insertion sequence:ISSbo6"
FT                   /note="partial"
FT   gene            26629..27828
FT                   /gene="parA"
FT                   /locus_tag="SSON_P031"
FT                   /old_locus_tag="SSO_P031"
FT                   /note="SSOP031"
FT   CDS_pept        26629..27828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SSON_P031"
FT                   /old_locus_tag="SSO_P031"
FT                   /product="plasmid segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P031"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91051"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041250"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTW1"
FT                   /protein_id="AAZ91051.1"
FT                   /translation="MTSFEQLSKVAQRADKMLLALTKQIQEQKQEFQADVFYQVYSKSA
FT                   VAKLPKLTRASVDGAVGEMEAQGYQFEKRPAGTATKYALTIQNIIDIYAHRGIPKYRDR
FT                   YSEAYSIFIGSLKGGVSKTVSSVSVAHALRAHPHLLSEDLRILLLDLDPQSSATMFLNY
FT                   LHAVGLVDTTAPQAMLQNVSREELLEDFIVPSVIPGVYVMPASIDDAFIASNWDTLCEE
FT                   HLLGQNKHAILRENIIDKLKHDFDFILIDTGPHLDAFLKNAIAAADIMFTPVPPAQVDF
FT                   HSTLKYLARLPELVQIIEQDGCSCRLQANIGFMSKLANKSDHKYCHSLTKEIFGGDMLD
FT                   VSMPRLDGFERSGESFDTVISANPVTYVGSGEALKNARMAAEDFAKAVFDRIEFIRANY
FT                   "
FT   gene            27828..28808
FT                   /gene="parB"
FT                   /locus_tag="SSON_P032"
FT                   /old_locus_tag="SSO_P032"
FT                   /note="SSOP032"
FT   CDS_pept        27828..28808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="SSON_P032"
FT                   /old_locus_tag="SSO_P032"
FT                   /product="plasmid segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P032"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91052"
FT                   /db_xref="GOA:Q3YTW0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR014884"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTW0"
FT                   /protein_id="AAZ91052.1"
FT                   /translation="MENRKHRPTIGRTLNTNILNNTEEISAPVHVFTLNTGRKAKFTEI
FT                   KVDHDKVDTQTFVVEEVNGREQTALTPDSLKDITRTIHLQQFYPCIGIRTGDLIEILDG
FT                   SRRRAAALLCKVGLRVLVTDDELTVSEAQHLAKDLQTSLEHNIREIGLRLVRLKEAGMN
FT                   QKQIAEREGLSAAKVTRALQAASVPKDFVSLFPVQSELTYADYRQLAELSERLRLGDIS
FT                   IDEVVKNISPSIELITADDNLSEDEVKNSIMRLITKEMSSLLDSGVKDKAVVTLLWKFD
FT                   SKDKFARKRVKGRTFSYEFGRLPLEVQDKLDRMIALVLKDNLNSL"
FT   gene            29064..29549
FT                   /locus_tag="SSON_P033"
FT                   /old_locus_tag="SSO_P033"
FT                   /note="SSOP033"
FT   CDS_pept        29064..29549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P033"
FT                   /old_locus_tag="SSO_P033"
FT                   /product="putative transposase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P033"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91053"
FT                   /db_xref="GOA:Q3YTV9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTV9"
FT                   /protein_id="AAZ91053.1"
FT                   /translation="MSEQKITGIDLAKTNFYLFSINAHGKPAGKTKLSRNQLLNWLVQQ
FT                   PKMTVAMEAGGASHYWAREIRKLDHDVILLPAQHVKAYQRCQKNDYNDAQAIAEACQHG
FT                   TIRPVPIKTLEQQDVQTFLNMRRLVSMERTQLINHIRGLLAEYGIVFSKGAADLRQK"
FT   gene            complement(29838..30437)
FT                   /locus_tag="SSON_P034"
FT                   /old_locus_tag="SSO_P034"
FT                   /note="SSOP034"
FT   CDS_pept        complement(29838..30437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P034"
FT                   /old_locus_tag="SSO_P034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P034"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91054"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTV8"
FT                   /protein_id="AAZ91054.1"
FT                   /translation="MDGKRISGVPFERYADDIVVHCSRMSDATRLKNRLSERFSEVGLV
FT                   LNAGKTNIAYIDTFKRRNVATSFTFLGYDFKVRTLKNFKGERYRKCMPGASNAAMRKIT
FT                   ETIKKWRIHRSTAESLLDFARRYNAIVRGWIEYYGKFWSRNFNYRLWSAMQSRLLKWMQ
FT                   SKYRLSNRKAQRKLTLVRKEYPKLFVHWYLLRASNE"
FT   gene            complement(30380..30964)
FT                   /locus_tag="SSON_P035"
FT                   /old_locus_tag="SSO_P035"
FT                   /note="SSOP035"
FT   CDS_pept        complement(30380..30964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P035"
FT                   /old_locus_tag="SSO_P035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P035"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91055"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTV7"
FT                   /protein_id="AAZ91055.1"
FT                   /translation="MFDQQRDGNLYKIWNRLCSGTWFPPPVLEKRIPKSNGKERILGIP
FT                   TVSDRIAQGAIKLFMEEKLDPIFHADSYGYRPGKSAHDALKQCAIRCWRYSWILEVDIS
FT                   AFFDHVRHDLVLKALEHHGMPKWVILYCRRWMEAPMQSCENGELITRTRGTPQGGVISP
FT                   LLANLFHHYAFDLWMEREYRGYRLRGTLTIL"
FT   mobile_element  31492..33621
FT                   /mobile_element_type="insertion sequence:IS21"
FT   gene            31617..32765
FT                   /locus_tag="SSON_P036"
FT                   /old_locus_tag="SSO_P036"
FT                   /note="SSOP036"
FT   CDS_pept        31617..32765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P036"
FT                   /old_locus_tag="SSO_P036"
FT                   /product="IS21 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P036"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91056"
FT                   /db_xref="GOA:Q3YTL1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTL1"
FT                   /protein_id="AAZ91056.1"
FT                   /translation="MIKQMRQQGAYIVDIATQIGCSERTVRRYLKYPEPPARKTRHKMV
FT                   KLKPFMDYIDMRLAENVWNSEVIFAEIKAMGYTGGRSMLRYYIQPKRKMRPSKRTVRFE
FT                   TQPGYQLQHDWGEVEVEVAGQRCKVNFAVNTLGFSRSFHVFAAPKQDAEHTYESLVRAF
FT                   RYFGGCVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLADHYNFLPRACRPRRARTKGKVE
FT                   RMVKYLKENFFVRYRRFDSFTHVNQQLEQWIADVADKRELRQFKETPEQRFALEQEHLQ
FT                   PLPDTDFDTSYFDIRHVSWDSYIEVGGNRYSVPEALCGQPVSIRISLDDELRIYSNEKL
FT                   VASHRLCSASSGWQTVPEHHAPLWQQVSQVEHRPLSAYEELL"
FT   gene            32765..33562
FT                   /locus_tag="SSON_P037"
FT                   /old_locus_tag="SSO_P037"
FT                   /note="SSOP037"
FT   CDS_pept        32765..33562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P037"
FT                   /old_locus_tag="SSO_P037"
FT                   /product="IS21 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P037"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91057"
FT                   /db_xref="GOA:Q3Z4V9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4V9"
FT                   /protein_id="AAZ91057.1"
FT                   /translation="MHELEVLLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQE
FT                   WNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERSENVILLG
FT                   PPGVGKTHLAIALGVKAVDAGHRVLFMPLDRLIATLMKAKQENRLERQLQQLSYARVLI
FT                   LDEIGYLPMNREEASLFFRLLNRRYEKASIILTSNKGFADWGEMFGDHVLATAILDRLL
FT                   HHSTTLNIKGESYRLKEKRKAGVLTKNTTPISDDEMVESGQHQ"
FT   mobile_element  complement(33848..35157)
FT                   /mobile_element_type="insertion sequence:IS629"
FT   gene            complement(33890..34777)
FT                   /locus_tag="SSON_P038"
FT                   /old_locus_tag="SSO_P038"
FT                   /note="SSOP038"
FT   CDS_pept        complement(33890..34777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P038"
FT                   /old_locus_tag="SSO_P038"
FT                   /product="IS629 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P038"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91058"
FT                   /db_xref="GOA:Q3YTT1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT1"
FT                   /protein_id="AAZ91058.1"
FT                   /translation="MPLLDKLREQYGVGPLCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKKEIQRVYDENHKVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGD
FT                   SYDNAMAESINGLYKAKVIHRKSWKNRAEVELATLTWVDWYNNRRLLERLGHTPPAEAE
FT                   KAYYASIGNDDLAA"
FT   gene            complement(34777..35052)
FT                   /locus_tag="SSON_P039"
FT                   /old_locus_tag="SSO_P039"
FT                   /note="SSOP039"
FT   CDS_pept        complement(34777..35052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P039"
FT                   /old_locus_tag="SSO_P039"
FT                   /product="IS629 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P039"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91059"
FT                   /db_xref="GOA:Q3YTB0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB0"
FT                   /protein_id="AAZ91059.1"
FT                   /translation="MVLESQGEYDSQWATICSIAPKIGCTPETLRVRVRQHERDTGGGD
FT                   GGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDRLWKK"
FT   mobile_element  complement(35157..35456)
FT                   /mobile_element_type="insertion sequence:IS150"
FT                   /note="partial"
FT   mobile_element  35453..37142
FT                   /mobile_element_type="insertion sequence:IS1294"
FT   gene            35770..36969
FT                   /locus_tag="SSON_P040"
FT                   /old_locus_tag="SSO_P040"
FT                   /note="SSOP040"
FT   CDS_pept        35770..36969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P040"
FT                   /old_locus_tag="SSO_P040"
FT                   /product="IS1294 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P040"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91060"
FT                   /db_xref="GOA:Q3YTD5"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD5"
FT                   /protein_id="AAZ91060.1"
FT                   /translation="MLSAFTPRPLKRLFTANQCWTSFLDAGGLRDIEVEAVTKMLACGT
FT                   RILGVKEYNCDKPECPHVRYVTNSCGSRACPSCGKKATDLWIATQLNRLPDCDWVHLVF
FT                   TLPDTLWPVFESNRWLLNDVCRLAVENLLYAARKRGQEPGIFCAIHTYGRRLNWHPHVH
FT                   VSVTCGCLNKHGQWKKLSFLKDAMRSRWMWNMRQRLLKAWSEGLAMPESLSHITTESQW
FT                   RSLVLKAGGKYWHVYMSKKTAGGRNTARYLGRYLKKPPIAASRLAHYNGGASLSFRYLD
FT                   HKTGETATETLTQRELVARLKQHIPEKFFKMVRYFGFLANRVCGEKLPQVYRALGMDKP
FT                   EPVAKVCYAQMVKQFLSRDPFECVLCGGRMVYRRAIAGLNVEGLKKNARDISLLRYMPA
FT                   "
FT   gene            complement(37224..38012)
FT                   /gene="virF"
FT                   /locus_tag="SSON_P041"
FT                   /old_locus_tag="SSO_P041"
FT                   /note="SSOP041"
FT   CDS_pept        complement(37224..38012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virF"
FT                   /locus_tag="SSON_P041"
FT                   /old_locus_tag="SSO_P041"
FT                   /product="VirF"
FT                   /note="member of the AraC family of transcriptional
FT                   activators; required for transcription of virB and icsA"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P041"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91061"
FT                   /db_xref="GOA:Q3YTV1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTV1"
FT                   /protein_id="AAZ91061.1"
FT                   /translation="MMDMGHKNKIDIKVRLHNYIILYAKRCSMTVSSGNETLTIDEGQI
FT                   AFIERNIQINVSIKKSDSINPFEIISLDRNLLLSIIRIMEPIYSFQHSYSEEKRGLNKK
FT                   IFLLSEEEVSIDLFKSIKEMPFGKRKIYSLACLLSAVSDEEALYTSISIASSLSFSDQI
FT                   RKIVEKNIEKRWRLSDISNNLNLSEIAVRKRLESEKLTFQQILLDIRMHHAAKLLLNSQ
FT                   SYINDVSRLIGISSPSYFIRKFNEYYGITPKKFYLYHKKF"
FT   gene            38511..39638
FT                   /locus_tag="SSON_P042"
FT                   /old_locus_tag="SSO_P042"
FT                   /note="SSOP042"
FT   CDS_pept        38511..39638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P042"
FT                   /old_locus_tag="SSO_P042"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P042"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91062"
FT                   /db_xref="GOA:Q3YXF2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YXF2"
FT                   /protein_id="AAZ91062.1"
FT                   /translation="MNNNNTLYVGLDVHKESITVAYAINSEPVELMGKIGTSPTDIQNL
FT                   CKRLRSKSSQVSIVYEAGPCGYGLYRRLVKSGFDCMVCAPSLIPKKPGERVKTDRRDAI
FT                   RLVRSLRAGDLSAVYVPGIEDEAFRDLARAWASARDDLRHARQRLKSFLLVHGVHYVGR
FT                   ADWGPAHRRWLSKYSFESPWRQLAFDEHRRTIEDRQAQCERLESALKEAVTEWRLYPVV
FT                   EALQAMRGIQFITAVGLISELGDLTRFEHPRQLMSWFGITPSEYSSGGSRHQGSITKAG
FT                   NSYARKLLVEAAWSYRHPARISPAIQKRQENLPRPVIDRAWDAQLRLCKRYRKLQAKGK
FT                   NVNITIVAVARELAGFIWDMGRIAMSVAQQPQCHK"
FT   gene            40072..40359
FT                   /locus_tag="SSON_P043"
FT                   /old_locus_tag="SSO_P043"
FT                   /note="SSOP043"
FT   CDS_pept        40072..40359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P043"
FT                   /old_locus_tag="SSO_P043"
FT                   /product="IS2 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P043"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91063"
FT                   /db_xref="GOA:Q3YTU9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTU9"
FT                   /protein_id="AAZ91063.1"
FT                   /translation="MADNGSAYTAHETRQFARELNLEPCTTAVSSPQSNGIAERFVKTM
FT                   KEDCIAFMPKPRTALHNLAVAIEHYNENHPHSALGYLSPREYRRQRVMST"
FT   mobile_element  40169..40345
FT                   /mobile_element_type="insertion sequence:IS2"
FT                   /note="partial"
FT   gene            40541..40807
FT                   /gene="ospE2"
FT                   /locus_tag="SSON_P044"
FT                   /old_locus_tag="SSO_P044"
FT                   /note="SSOP044"
FT   CDS_pept        40541..40807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospE2"
FT                   /locus_tag="SSON_P044"
FT                   /old_locus_tag="SSO_P044"
FT                   /product="OspE2"
FT                   /note="secreted by the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P044"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTU8"
FT                   /protein_id="AAZ91064.1"
FT                   /translation="MLTQTIFPCLPQKQENIILEVSNPVLLSSTVTTDGYTVFNKKAAI
FT                   YELQIPAANRTKTLKFTATEMQWLTKINEVGIVEKQSQRHSNI"
FT   mobile_element  41147..42296
FT                   /mobile_element_type="insertion sequence:ISSfl2"
FT                   /note="partial"
FT   gene            complement(41178..41594)
FT                   /locus_tag="SSON_P045"
FT                   /old_locus_tag="SSO_P045"
FT                   /note="SSOP045"
FT   CDS_pept        complement(41178..41594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P045"
FT                   /old_locus_tag="SSO_P045"
FT                   /product="ISSfl2 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P045"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91065"
FT                   /db_xref="GOA:Q3YTU7"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTU7"
FT                   /protein_id="AAZ91065.1"
FT                   /translation="MALEVEQRVLAHPLYPVLTSMPGVGVRTAARLLTEVACRAFASAA
FT                   HLAAYSGLAPVTRRSGSSIRGEHPSRRGNKALKRALFLSAFAALRDPLSRAYYTRKMSQ
FT                   GKRHNQALIALARRRCDVLFAMMRDGTFYTPQGS"
FT   gene            complement(41773..42318)
FT                   /locus_tag="SSON_P046"
FT                   /old_locus_tag="SSO_P046"
FT                   /note="SSOP046"
FT   CDS_pept        complement(41773..42318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P046"
FT                   /old_locus_tag="SSO_P046"
FT                   /product="ISSfl2 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P046"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91066"
FT                   /db_xref="GOA:Q3YTU6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTU6"
FT                   /protein_id="AAZ91066.1"
FT                   /translation="MQPPGCRGSGKRLFDKALPNDENKLRSLISDLKQHGQILLVVDQP
FT                   ATIGALPVAVARSEGVLVGYLPGLAMRRIADLHAGEAKTDARDAAIIAEAARTLPHALR
FT                   TLKLADEQIAELSMLCGFDDDLAAQTTQASNRIRGLLTQIHPALERVLGPRLEHPAVLD
FT                   LLQRYPSPEKLASLGFAG"
FT   gene            42373..42645
FT                   /locus_tag="SSON_P047"
FT                   /old_locus_tag="SSO_P047"
FT                   /note="SSOP047"
FT   CDS_pept        42373..42645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P047"
FT                   /old_locus_tag="SSO_P047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P047"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91067"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC4"
FT                   /protein_id="AAZ91067.1"
FT                   /translation="MSHNLEHQKVHTRMVKEVLKAVARANNHPYQSVFADFITGHPSCT
FT                   VCFWETFHKMYPDSPYEYVTFCHTCRRFDLYETEAEMKADDPKWW"
FT   gene            42626..43834
FT                   /locus_tag="SSON_P048"
FT                   /old_locus_tag="SSO_P048"
FT                   /note="SSOP048"
FT   CDS_pept        42626..43834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P048"
FT                   /old_locus_tag="SSO_P048"
FT                   /product="IS1294 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P048"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91068"
FT                   /db_xref="GOA:Q3YTC5"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC5"
FT                   /protein_id="AAZ91068.1"
FT                   /translation="MTRSGGDFQPRPLKRLFTANQCWTSFLDAGGLRDIEVEAVTKMLA
FT                   CGTRILGVKEYNCDKPECPHVRYVTNSCGSRACPSCGKKATDLWIATQLNRLPDCDWVH
FT                   LVFTLPDTLWPVFESNRWLLNDVCRLAVENLLYAARKRGQEPGIFCAIHTYGRRLNWHP
FT                   HVHVSVTCGCLNKHGQWKKLSFLKDAMRSRWMWNMRQRLLKAWSEGLAMPESLSHITTE
FT                   SQWRSLVLKAGGKYWHVYMSKKTAGGRNTARYLGRYLKKPPIAASRLAHYNGGASLSFR
FT                   YLDHKTGETATETLTQRELVARLKQHIPEKFFKMVRYFGFLANRVCGEKLPQVYRALGM
FT                   DKPEPVAKVCYVQMVKQFLSRDPFECVLCGGRMVYRRAIAGLNVEGLKKNARDISLLRY
FT                   MPA"
FT   mobile_element  42653..44007
FT                   /mobile_element_type="insertion sequence:IS1294"
FT                   /note="partial"
FT   gene            44739..46151
FT                   /gene="ospC1"
FT                   /locus_tag="SSON_P049"
FT                   /old_locus_tag="SSO_P049"
FT                   /note="SSOP049"
FT   CDS_pept        44739..46151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospC1"
FT                   /locus_tag="SSON_P049"
FT                   /old_locus_tag="SSO_P049"
FT                   /product="OspC1"
FT                   /note="secreted by the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P049"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91069"
FT                   /db_xref="InterPro:IPR010366"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTU3"
FT                   /protein_id="AAZ91069.1"
FT                   /translation="MNISETLNSANTQCNIDSMDNRLHTLFPKVTSVRNAAQQTMPDEK
FT                   NLKDSANIIKDFFRKTIAAQSYSRMFSQGSNFKSLNIAIDAPSDAKASFKAIEHLDRLS
FT                   KHYISEIREKLHPLSAEELNLLSLIINSDLIFRHQSNSDLSDKILNIKSFNKIQSEGIC
FT                   TKRNTYADDIKKIANHDFVFFGVEISSHQKKHPLNTKHHTVDFGANAYIIDHDSPYGYM
FT                   TLTDHFDNAIPPVFYHEHQSFLDKFSEVNKEVSRYVHGSKGIIDVPIFNTKDMKLGLGL
FT                   YLIDFIRKSEDQSFKEFCYGKNLAPVDLDRIINFVFQPEYHIPRMVSTENFKKVKIREI
FT                   SLEEAVTASNYEEINKQVTNKKIALQALFLSIANQKEDVALYILSNFEITRQDVISIKH
FT                   ELYDIEYLLSAHNSSCKVLEYFINKGLVDVNTKFKKTNSGDCMLDNAIKYENAEMIKLL
FT                   LKYGATSDNKYI"
FT   gene            46480..48177
FT                   /gene="ospD3"
FT                   /locus_tag="SSON_P050"
FT                   /old_locus_tag="SSO_P050"
FT                   /note="SSOP050"
FT   CDS_pept        46480..48177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospD3"
FT                   /locus_tag="SSON_P050"
FT                   /old_locus_tag="SSO_P050"
FT                   /product="OspD3"
FT                   /note="SenA; probably secreted by the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P050"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91070"
FT                   /db_xref="InterPro:IPR012927"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTU2"
FT                   /protein_id="AAZ91070.1"
FT                   /translation="MPSVNLIPSRKICLQNMINKDNVSVETIQSLLHSKQLPYFSDKRS
FT                   FLLNLNCQVTDHSGRLIVCRHLASYWIAQFNKSSGHVDYHHFAFPDEIKNYVSVSEEEK
FT                   AINVPAIIYFVENGSWGDIIFYIFNEMIFHSEKSRALEISTSNHNMALGLKIKETKNGG
FT                   DFVIQLYDPNHTATHLRAEFNKFNLAKIKKLTVDNFLDEKHQKCYGLISDGMSIFVDRH
FT                   TPTSMSSIIRWPNNLLHPKVIYHAMRMGLTELIQKVTRVVQLSDLSDNTLELLLAAKND
FT                   DGLSGLLLALQNGHSDTILAYGELLETSGLNLDKTVELLTAEGMGGRISGLSQALQNGH
FT                   AETIKTYGRLLKKRAINIEYNKLKNLLTAYYYDEVHRQIPGLMFALQNGHADAIRAYGE
FT                   LILSPPLLNSEDIVNLLASRRYDNVPGLLLALNNGQADAILAYGDILNEAKLNLDKKAE
FT                   LLEAKDSNGLSGLFVALHNGCVETIIAYGKILHTADLTPHQASKLLAAEGPNGVSGLII
FT                   AFQNRNFEAIKTYMEIIKNENITPEEIAEHLDKKNGSDFLEIMKNIKS"
FT   gene            complement(48324..48854)
FT                   /locus_tag="SSON_P051"
FT                   /old_locus_tag="SSO_P051"
FT                   /note="SSOP051"
FT   CDS_pept        complement(48324..48854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P051"
FT                   /old_locus_tag="SSO_P051"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P051"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91071"
FT                   /db_xref="GOA:Q3YTU1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTU1"
FT                   /protein_id="AAZ91071.1"
FT                   /translation="MAHIRTRETYGTRRLQTELAENGIIVGRDRLARLRKELRLRCKQK
FT                   RKFRATTNSNHNLPVAPNLLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNLFFEMKA"
FT   mobile_element  complement(48347..49361)
FT                   /mobile_element_type="insertion sequence:IS600"
FT                   /note="partial"
FT   gene            complement(48995..49297)
FT                   /locus_tag="SSON_P052"
FT                   /old_locus_tag="SSO_P052"
FT                   /note="SSOP052"
FT   CDS_pept        complement(48995..49297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P052"
FT                   /old_locus_tag="SSO_P052"
FT                   /product="IS600 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P052"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91072"
FT                   /db_xref="GOA:Q3Z588"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z588"
FT                   /protein_id="AAZ91072.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVPENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   gene            49336..49803
FT                   /locus_tag="SSON_P053"
FT                   /old_locus_tag="SSO_P053"
FT                   /note="SSOP053"
FT   CDS_pept        49336..49803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P053"
FT                   /old_locus_tag="SSO_P053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P053"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91073"
FT                   /db_xref="GOA:Q3YTT9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT9"
FT                   /protein_id="AAZ91073.1"
FT                   /translation="MSVKLRLPQCTDNKKTETDAIYDKVRSSYLLSCILKKNKNVGLIL
FT                   HAPSFVSVSEKIARIVMANYSRNWSNSELASAVLMSESSLKRRMYKEVGSISTFVHKIK
FT                   LTEAIRKLRRTNTPISVISSELGYSSPSYFSKVFFKYLKTYPQNIRKKNGR"
FT   gene            50243..50713
FT                   /locus_tag="SSON_P054"
FT                   /old_locus_tag="SSO_P054"
FT                   /note="SSOP054"
FT   CDS_pept        50243..50713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P054"
FT                   /old_locus_tag="SSO_P054"
FT                   /product="ISSfl1 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P054"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91074"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT8"
FT                   /protein_id="AAZ91074.1"
FT                   /translation="MVHKSDSDELSALRAENARIIKPLLLPEPATPRAGRPWAEHRKII
FT                   NGMFWVLCSGAPWRDLPERYGSWKTVYNRFNRWSKSGVINIIFNRLLSLLDANGFIDWS
FT                   ATALDGSNIRALKCAAGAQKNIPISTEIMGRVALAAVLAPKSIWQQTEVASR"
FT   mobile_element  complement(50300..51121)
FT                   /mobile_element_type="insertion sequence:ISSfl1"
FT                   /note="partial"
FT   gene            50719..51108
FT                   /locus_tag="SSON_P055"
FT                   /old_locus_tag="SSO_P055"
FT                   /note="SSOP055"
FT   CDS_pept        50719..51108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P055"
FT                   /old_locus_tag="SSO_P055"
FT                   /product="ISSfl1 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P055"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91075"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS8"
FT                   /protein_id="AAZ91075.1"
FT                   /translation="MLSPGQAHESQFAQRLLDGIGVQRQNGSMKRRGHAVLADKAYSGR
FT                   ALRNELKNNGIKAVIPRKSNEKMASDGRAQLDRDAYCNRNVVERCFGRLKEYRRIATRY
FT                   DKTARNYLAMVKLGCIRLFYQRLRN"
FT   mobile_element  51119..52278
FT                   /mobile_element_type="insertion sequence:IS630"
FT   gene            51223..52254
FT                   /locus_tag="SSON_P056"
FT                   /old_locus_tag="SSO_P056"
FT                   /note="SSOP056"
FT   CDS_pept        51223..52254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P056"
FT                   /old_locus_tag="SSO_P056"
FT                   /product="IS630 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P056"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91076"
FT                   /db_xref="GOA:Q3Z2U4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z2U4"
FT                   /protein_id="AAZ91076.1"
FT                   /translation="MPIIAPISRDERRLMQKAIHKTHDKNYARRLTAMLMLHRGDRVSD
FT                   VARTLCCARSSVGRWINWFTQSGVEGLKSLPAGRARRWPFEHICTLLRELVKHSPGDFG
FT                   YQRSRWSTELLAIKINEITGCQLNAGTVRRWLPSAGIVWRRAAPTLRIRDPHKDEKMAA
FT                   IHKALDECSAEHPVFYEDEVDIHLNPKIGADWQLRGQQKRVVTPGQNEKYYLAGALHSG
FT                   TGKVSCVGGNSKSSALFISLLKRLKATYRRAKTITLIVDNYIIHKSRETQSWLKENPKF
FT                   RVIYQPVYSPWVNHVERLWQALHDTITRNHQCSSMWQLLKKVRHFMETVSPFPGGKHGL
FT                   AKV"
FT   gene            complement(52274..52525)
FT                   /locus_tag="SSON_P057"
FT                   /old_locus_tag="SSO_P057"
FT                   /note="SSOP057"
FT   CDS_pept        complement(52274..52525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P057"
FT                   /old_locus_tag="SSO_P057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P057"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91077"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT5"
FT                   /protein_id="AAZ91077.1"
FT                   /translation="MPGTTTAMSINFIGMTARTMNSNGSHGKPQIPVDYQKLLSIEDIT
FT                   FCRNRWGNIGENALRRVAVGKKLSFFGSDRGGENAAII"
FT   mobile_element  52556..53156
FT                   /mobile_element_type="insertion sequence:iso-IS1"
FT                   /note="partial"
FT   mobile_element  53170..53282
FT                   /mobile_element_type="insertion sequence:ISSfl4"
FT                   /note="partial"
FT   gene            53671..55368
FT                   /gene="ipaH7.8"
FT                   /locus_tag="SSON_P058"
FT                   /old_locus_tag="SSO_P058"
FT                   /note="SSOP058"
FT   CDS_pept        53671..55368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipaH7.8"
FT                   /locus_tag="SSON_P058"
FT                   /old_locus_tag="SSO_P058"
FT                   /product="invasion plasmid antigen"
FT                   /note="probably secreted by the Mxi-Spa machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P058"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91078"
FT                   /db_xref="GOA:Q3YTT4"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR029487"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT4"
FT                   /protein_id="AAZ91078.1"
FT                   /translation="MFSVNNTHSSVSCSPSINSNSTSNEYYLRILTEWEKNSSPGEERG
FT                   IAFNRLSQCFQNQEAVLNLSDLNLTSLPELPKHISALIVENNKLTSLPKLPAFLKELNA
FT                   DNNRLSVIPELPESLTTLSVRSNQLENLPVLPNHLTSLFVENNRLYNLPALPEKLKFLH
FT                   VYYNRLTTLPDLPDKLEILCAQRNNLVTFPQFSDRNNIRQKEYYFHFNQITTLPESFSQ
FT                   LDSSYRINISGNPLSTRVLQSLQRLTSSPDYHGPQIYFSMSDGQQNTLHRPLADAVTAW
FT                   FPENKQSDVSQIWHAFEHEEHANTFSAFLDRLSDTVSARNTSGFREQVAAWLEKLSASA
FT                   ELRQQSFAVAADATESCEDRVALTWNNLRKTLLVHQASEGLFDNDTGALLSLGREMFRL
FT                   EILEDIARDKVRTLHFVDEIEVYLAFQTMLAEKLQLSTAVKEMRFYGVSGVTANDLRTA
FT                   EAMVRSREENEFTDWFSLWGPWHAVLKRTEADRWAQAEEQKYEMLENEYSQRVADRLKA
FT                   SGLSGDADAEREAGAQVMRETEQQIYRQLTDEVLALRLSENGSRLHHS"
FT   gene            55796..57520
FT                   /gene="ipaH4.5"
FT                   /locus_tag="SSON_P059"
FT                   /old_locus_tag="SSO_P059"
FT                   /note="SSOP059"
FT   CDS_pept        55796..57520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipaH4.5"
FT                   /locus_tag="SSON_P059"
FT                   /old_locus_tag="SSO_P059"
FT                   /product="invasion plasmid antigen"
FT                   /note="probably secreted by the Mxi-Spa machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P059"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91079"
FT                   /db_xref="GOA:Q3YTT3"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR029487"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT3"
FT                   /protein_id="AAZ91079.1"
FT                   /translation="MKPINNHSFFRSLCGLSCISRLSVEEQCTRDYHRIWDDWAREGTT
FT                   TENRIQAVRLLKICLDTREPVLNLSLLKLRSLPPLPLHIRELNISNNELISLPENSPLL
FT                   TELHVNGNNLNILPTLPSQLIKLNISFNRNLSCLPSLPPYLQSLSARFNSLETLPELPS
FT                   TLTILRIEGNRLTVLPELPHRLQELFVSGNRLQELPEFPQRLKYLKVGENQLRRLSRLP
FT                   QELLALDVSNNLLTSLPENIITLPICTNVNISGNPLSTRVLQSLQRLTSSPDYHGPQIY
FT                   FSMSDGQQNTLHRPLADAVTAWFPENKQSDVSQIWHAFEHEEHANTFSAFLDRLSDTVS
FT                   ARNTSGFREQVAAWLEKLSASAELRQQSFAVAADATESCEDRVALTWNNLRKTLLVHQA
FT                   SEGLFDNDTGALLSLGREMFRLEILEDIARDKVRTLHFVDEIEVYLAFQTMLAEKLQLS
FT                   TAVKEMRFYGVSGVTANDLRTAEAMVRSREENEFTDWFSLWGPWHAVLKRTEADRWAQA
FT                   EEQKYEMLENEYSQRVADRLKASGLSGDADAEREAGAQVMRETEQQIYRQLTDEVLA"
FT   mobile_element  57518..58827
FT                   /mobile_element_type="insertion sequence:IS629"
FT   gene            57572..57898
FT                   /locus_tag="SSON_P060"
FT                   /old_locus_tag="SSO_P060"
FT                   /note="SSOP060"
FT   CDS_pept        57572..57898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P060"
FT                   /old_locus_tag="SSO_P060"
FT                   /product="IS629 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P060"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91080"
FT                   /db_xref="GOA:Q3YTT2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT2"
FT                   /protein_id="AAZ91080.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWATICSIAPKIGCTPE
FT                   TLRVRVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            57898..58785
FT                   /locus_tag="SSON_P061"
FT                   /old_locus_tag="SSO_P061"
FT                   /note="SSOP061"
FT   CDS_pept        57898..58785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P061"
FT                   /old_locus_tag="SSO_P061"
FT                   /product="IS629 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P061"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91081"
FT                   /db_xref="GOA:Q3YTT1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT1"
FT                   /protein_id="AAZ91081.1"
FT                   /translation="MPLLDKLREQYGVGPLCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKKEIQRVYDENHKVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGD
FT                   SYDNAMAESINGLYKAKVIHRKSWKNRAEVELATLTWVDWYNNRRLLERLGHTPPAEAE
FT                   KAYYASIGNDDLAA"
FT   mobile_element  59021..60209
FT                   /mobile_element_type="insertion sequence:IS1294"
FT                   /note="partial"
FT   gene            59338..60243
FT                   /locus_tag="SSON_P062"
FT                   /old_locus_tag="SSO_P062"
FT                   /note="SSOP062"
FT   CDS_pept        59338..60243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P062"
FT                   /old_locus_tag="SSO_P062"
FT                   /product="IS1294 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P062"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91082"
FT                   /db_xref="GOA:Q3YTT0"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT0"
FT                   /protein_id="AAZ91082.1"
FT                   /translation="MLSAFTPRPLKRLFTANQCWTSFLDAGGLRDIEVEAVTKMLACGT
FT                   RILGVKEYNCDKPECPHVRYVTNSCGSRACPSCGKKATDLWIATQLNRLPDCDWVHLVF
FT                   TLPDTLWPVFESNRWLLNDVCRLAVENLLYAARKRGQEPGIFCAIHTYGRRLNWHPHVH
FT                   VSVTCGCLNKHGQWKKLSFLKDAMRSRWMWNMRQRLLKAWSEGLAMPESLSHITTESQW
FT                   RSLVLKAGGKYWHVYMSKKTAGGRNTARYLGRYLKKPPIAASRLAHYNGGASLSFRYLD
FT                   HKTGETATETCTNGETVPES"
FT   mobile_element  60210..60540
FT                   /mobile_element_type="insertion sequence:IS1294"
FT                   /note="partial"
FT   mobile_element  complement(60539..61404)
FT                   /mobile_element_type="insertion sequence:ISSfl1"
FT                   /note="partial"
FT   gene            60545..60994
FT                   /locus_tag="SSON_P063"
FT                   /old_locus_tag="SSO_P063"
FT                   /note="SSOP063"
FT   CDS_pept        60545..60994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P063"
FT                   /old_locus_tag="SSO_P063"
FT                   /product="ISSfl1 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P063"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91083"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS9"
FT                   /protein_id="AAZ91083.1"
FT                   /translation="MARYDLPDEAWTIIKPLLPPEPATPRAGRPWAEHRKIINGMFWVL
FT                   CSGAPWRDLPERYGSWKTVYNRFNRWSKSGVINIIFNRLLSLLDANGFIDWSATALDGS
FT                   NIRALKCAAGAQKNIPISTEIMGRVALAAVLAPKSIWQQTEVASR"
FT   gene            61000..61389
FT                   /locus_tag="SSON_P064"
FT                   /old_locus_tag="SSO_P064"
FT                   /note="SSOP064"
FT   CDS_pept        61000..61389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P064"
FT                   /old_locus_tag="SSO_P064"
FT                   /product="ISSfl1 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P064"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91084"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS8"
FT                   /protein_id="AAZ91084.1"
FT                   /translation="MLSPGQAHESQFAQRLLDGIGVQRQNGSMKRRGHAVLADKAYSGR
FT                   ALRNELKNNGIKAVIPRKSNEKMASDGRAQLDRDAYCNRNVVERCFGRLKEYRRIATRY
FT                   DKTARNYLAMVKLGCIRLFYQRLRN"
FT   gene            complement(61538..62992)
FT                   /gene="ospC2"
FT                   /locus_tag="SSON_P065"
FT                   /old_locus_tag="SSO_P065"
FT                   /note="SSOP065"
FT   CDS_pept        complement(61538..62992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospC2"
FT                   /locus_tag="SSON_P065"
FT                   /old_locus_tag="SSO_P065"
FT                   /product="OspC2"
FT                   /note="probably secreted by the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P065"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91085"
FT                   /db_xref="InterPro:IPR010366"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS7"
FT                   /protein_id="AAZ91085.1"
FT                   /translation="MKIPEAVNHINVQNNIDLVDGKINPNKDTKALQKNISCVTNSSSS
FT                   GISEKHLDHCADTVKSFLRKSIAAQSYSKMFSQGTSFKSLNLSIEAPSGARSSFRSLEH
FT                   LDKVSRHYLSEIIQKTHPLSSDERHLLSIIINSDFNFRHQSNANLSNNTLNIKSFDKIK
FT                   SENIQTYKNTFSEDIEEIANHDFVFFGVEISNHQETLPLNKTHHTVDFGANAYIIDHDS
FT                   PYGYMTLTDHFDNAIPPVFYHEHQSFFLDNFKEVVDEVSRYVHGNQGKTDVPIFNTKDM
FT                   RLGIGLHLIDFIRKSKDQRFREFCYNKNIDPVSLDRIINFVFQLEYHIPRMLSTDNFKK
FT                   IRLRDISLEDAIKASNYEEINNKVTDKKMAHQALAYSLGNAKSDMALYLLSKFNFTKQD
FT                   VAEMEKMNNNMYCELYDVEYLLSEDSANYKVLEYFINNGLVDVNKRFQKANSGDTMLDN
FT                   AMKSKDSKMIDFLLKNGAVSGKRFGR"
FT   mobile_element  complement(63355..63686)
FT                   /mobile_element_type="insertion sequence:ISSfl1"
FT                   /note="partial"
FT   gene            63417..63713
FT                   /locus_tag="SSON_P066"
FT                   /old_locus_tag="SSO_P066"
FT                   /note="SSOP066"
FT   CDS_pept        63417..63713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P066"
FT                   /old_locus_tag="SSO_P066"
FT                   /product="ISSfl1 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P066"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91086"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS6"
FT                   /protein_id="AAZ91086.1"
FT                   /translation="MACYDLPDEAWTIIKPLLPPEPATPRAGRPWAEHRKIINGMFWVL
FT                   CSGAPWRDLPERYGSWKTVYNRFNRWSKSGVINIIFNRLLSLLDAGDAANLLI"
FT   mobile_element  63687..64454
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            63936..64439
FT                   /gene="insB"
FT                   /locus_tag="SSON_P067"
FT                   /old_locus_tag="SSO_P067"
FT                   /note="SSOP067"
FT   CDS_pept        63936..64439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SSON_P067"
FT                   /old_locus_tag="SSO_P067"
FT                   /product="IS1 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P067"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91087"
FT                   /db_xref="GOA:Q3Z5Z0"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Z0"
FT                   /protein_id="AAZ91087.1"
FT                   /translation="MPGNCTHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   mobile_element  complement(64455..64878)
FT                   /mobile_element_type="insertion sequence:ISSfl1"
FT                   /note="partial"
FT   gene            64523..64885
FT                   /locus_tag="SSON_P068"
FT                   /old_locus_tag="SSO_P068"
FT                   /note="SSOP068"
FT   CDS_pept        64523..64885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P068"
FT                   /old_locus_tag="SSO_P068"
FT                   /product="ISSfl1 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P068"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91088"
FT                   /db_xref="GOA:Q3YTS4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS4"
FT                   /protein_id="AAZ91088.1"
FT                   /translation="MCRRCSKKHPDIDGDNGPGRSRGGFGTKIHLATDGSGLPLNIVLS
FT                   PGQAHESQFAQRLLDGIGVQRQNGSMKRRGHAVLADKAYSGRALRNELKNNGIKAVIPR
FT                   KSNEKMASDGRAQLDV"
FT   mobile_element  complement(64878..65206)
FT                   /mobile_element_type="insertion sequence:IS1294"
FT                   /note="partial"
FT   gene            complement(65173..66087)
FT                   /locus_tag="SSON_P069"
FT                   /old_locus_tag="SSO_P069"
FT                   /note="SSOP069"
FT   CDS_pept        complement(65173..66087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P069"
FT                   /old_locus_tag="SSO_P069"
FT                   /product="IS1294 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P069"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91089"
FT                   /db_xref="GOA:Q3YTS3"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS3"
FT                   /protein_id="AAZ91089.1"
FT                   /translation="MTRSGGDFQPRPLKRLFTANQCWTSFLDAGGLRDIEVEAVTKMLA
FT                   CGTRILGVKEYNCDKPECPHVRYVTNSCGSRACPSCGKKATDLWIATQLNRLPDCDWVH
FT                   LVFTLPDTLWPVFESNRWLLNDVCRLAVENLLYAARKRGQEPGIFCAIHTYGRRLNWHP
FT                   HVHVSVTCGCLNKHGQWKKLSFLKDAMRSRWMWNMRQRLLKAWSEGLAMPESLSHITTE
FT                   SQWRSLVLKAGGKYWHVYMSKKTAGGRNTARYLGRYLKKPPIAASRLAHYNGGASLSFR
FT                   YLDHKTGETATETCTNGETVPES"
FT   mobile_element  complement(65207..66060)
FT                   /mobile_element_type="insertion sequence:IS1294"
FT                   /note="partial"
FT   gene            complement(66068..66340)
FT                   /locus_tag="SSON_P070"
FT                   /old_locus_tag="SSO_P070"
FT                   /note="SSOP070"
FT   CDS_pept        complement(66068..66340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P070"
FT                   /old_locus_tag="SSO_P070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P070"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS2"
FT                   /protein_id="AAZ91090.1"
FT                   /translation="MSHNLEHQKVHTRMVKEVLKAVARANNHPYQSVFTDFIAGHPSCT
FT                   VCFWETFHKMYPDSPYEYVTFCHTCRRFDLYETEAEMKADDPKWW"
FT   gene            complement(66360..66947)
FT                   /locus_tag="SSON_P071"
FT                   /old_locus_tag="SSO_P071"
FT                   /note="SSOP071"
FT   CDS_pept        complement(66360..66947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P071"
FT                   /old_locus_tag="SSO_P071"
FT                   /product="ISSfl4 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P071"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91091"
FT                   /db_xref="GOA:Q3YTS1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS1"
FT                   /protein_id="AAZ91091.1"
FT                   /translation="MNSQTTKDIPCFRSYLPDALRLRFEDKLTIRAIAQRLGLSHSTIH
FT                   TLFQRFLASGIAWPLPDSVSFAQLDAILYANRKKELTEPQIREGSWRKERRTSYSREFK
FT                   VRLAKQALQPGAVVARIAREHDINDNLLFKWKSQYEDGLLSDDDIQECMPVPVALTDTP
FT                   EPTRPVTNPFWRKNHGSLAAANRGVAEYELSE"
FT   mobile_element  66421..67029
FT                   /mobile_element_type="insertion sequence:ISSfl4"
FT                   /note="partial"
FT   gene            67363..68817
FT                   /gene="ospC3"
FT                   /locus_tag="SSON_P072"
FT                   /old_locus_tag="SSO_P072"
FT                   /note="SSOP072"
FT   CDS_pept        67363..68817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospC3"
FT                   /locus_tag="SSON_P072"
FT                   /old_locus_tag="SSO_P072"
FT                   /product="OspC3"
FT                   /note="probably secreted by the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P072"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91092"
FT                   /db_xref="InterPro:IPR010366"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTS0"
FT                   /protein_id="AAZ91092.1"
FT                   /translation="MKIPEAVNHINVQNNIDLVDGKTNPNKATKALQKNILRVTNSSSS
FT                   GISEKHLDHCANTVKNFLRKSIAAQSYSKMFSQGTSFKSLNLSIEAPSGARSSFRSLEH
FT                   LDKVSRHYISEIIQKVHPLSSDERHLLSIIINSNFNFRHQSNSNLSNNILNIKSFDKIQ
FT                   SENIQTHKNTYSEDIKEISNHDFVFFGVEISNHQEKLPLNKTHHTVDFGANAYIIDHDS
FT                   PYGYMTLTDHFDNAIPPVFYHEHQSFFLDNFKEVVDEVSRYVHGNQGKTDVPIFNTKDM
FT                   RLGIGLHLIDFIRKSKDQGFREFCYNKNIDPVSLDRIINFVFQLEYHIPRMLSTDNFKK
FT                   IKLRDISLEDAIKASNYEEINNKVTDKKMAHQALAYSLGNKKADIALYLLSKFNFTKQD
FT                   VAEMEKMNNNRYCNLYDVEYLLSKDGANYKVLEYFINNGLVDVNKKFQKANSGDTMLDN
FT                   AMKSKDSKMIDFLLKNGAILGKRFEI"
FT   mobile_element  69091..70354
FT                   /mobile_element_type="insertion sequence:IS600"
FT   gene            69155..69457
FT                   /locus_tag="SSON_P073"
FT                   /old_locus_tag="SSO_P073"
FT                   /note="SSOP073"
FT   CDS_pept        69155..69457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P073"
FT                   /old_locus_tag="SSO_P073"
FT                   /product="IS600 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P073"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91093"
FT                   /db_xref="GOA:Q3YTM2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM2"
FT                   /protein_id="AAZ91093.1"
FT                   /translation="MSRKTQRYSTEFKAEAVKTVPENQLSISEGASRLSVPEGTLGQWV
FT                   TAARKGLNTPGSRTVAELESEVMQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   gene            69598..70311
FT                   /locus_tag="SSON_P074"
FT                   /old_locus_tag="SSO_P074"
FT                   /note="SSOP074"
FT   CDS_pept        69598..70311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P074"
FT                   /old_locus_tag="SSO_P074"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P074"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91094"
FT                   /db_xref="GOA:Q3YTR8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTR8"
FT                   /protein_id="AAZ91094.1"
FT                   /translation="MAHIRTRETYGTRRLQTELADNGIIVGRDRLARLRKELRLHCKQK
FT                   RKFRATTNSDHNLPVTPNLLNQNFTPTAPNQVWVADITYVATREGWLYLAGVKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHTDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNCYDNAPMESFWGTLKNESLSHYRFKSRDEAISVIREYIEIFYNRQRRHSRLGN
FT                   ISPAAFRIKYYQMTA"
FT   gene            70436..70678
FT                   /locus_tag="SSON_P075"
FT                   /old_locus_tag="SSO_P075"
FT                   /note="SSOP075"
FT   CDS_pept        70436..70678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P075"
FT                   /old_locus_tag="SSO_P075"
FT                   /product="putative IS orf"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P075"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91095"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTR7"
FT                   /protein_id="AAZ91095.1"
FT                   /translation="MLTDIFNSNYQCYGYRRLHAMLRHEGGRLSEKVVRRLMVEEQLVV
FT                   SRNRRRRYSSYCGEIGPAPDNLIARDFKAEQPNQK"
FT   gene            70733..71155
FT                   /locus_tag="SSON_P076"
FT                   /old_locus_tag="SSO_P076"
FT                   /note="SSOP076"
FT   CDS_pept        70733..71155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P076"
FT                   /old_locus_tag="SSO_P076"
FT                   /product="IS1353 putative transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P076"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91096"
FT                   /db_xref="GOA:Q3YTR6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTR6"
FT                   /protein_id="AAZ91096.1"
FT                   /translation="MVDCFDGKVVSWSLSTRPDAELVNTMLDSAVETLNAGERPVIHSD
FT                   RGGHYRWPGWLERVNAAGLIRSMSRKGCSPDNAACEGFFGRLKTEMYYGRKWSGITPEK
FT                   FMQQVDAYIRWYNERRIKLSLGAVSPKMYRQQCGLE"
FT   mobile_element  71269..71568
FT                   /mobile_element_type="insertion sequence:IS21"
FT                   /note="partial"
FT   gene            71276..71611
FT                   /locus_tag="SSON_P077"
FT                   /old_locus_tag="SSO_P077"
FT                   /note="SSOP077"
FT   CDS_pept        71276..71611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P077"
FT                   /old_locus_tag="SSO_P077"
FT                   /product="IS21 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P077"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91097"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTR5"
FT                   /protein_id="AAZ91097.1"
FT                   /translation="MADVADRRELRQFRQTPEQRFTQEQEHLQPLLGTDFDIRHVSWDG
FT                   YIEVGGNRYSVPESLCGQLVSIRISLDDELRIYSNEQQVASHRLCSAAYGWQTVRPGCS
FT                   SVTAKSA"
FT   gene            71581..71874
FT                   /locus_tag="SSON_P078"
FT                   /old_locus_tag="SSO_P078"
FT                   /note="SSOP078"
FT   CDS_pept        71581..71874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P078"
FT                   /old_locus_tag="SSO_P078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P078"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91098"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTR4"
FT                   /protein_id="AAZ91098.1"
FT                   /translation="MFISYSEVSIKNPDNSGQALPLTYVCCREQAEDGACWHLLTSGKA
FT                   ASAADARRIVSHYERRWLTEEYHKAWKSGGTWNRCECRPGITLSAWWLSRRL"
FT   mobile_element  complement(72054..73384)
FT                   /mobile_element_type="insertion sequence:IS2"
FT   gene            complement(72065..72904)
FT                   /locus_tag="SSON_P079"
FT                   /old_locus_tag="SSO_P079"
FT                   /note="SSOP079"
FT   CDS_pept        complement(72065..72904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P079"
FT                   /old_locus_tag="SSO_P079"
FT                   /product="IS2 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P079"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91099"
FT                   /db_xref="GOA:Q3Z5M1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5M1"
FT                   /protein_id="AAZ91099.1"
FT                   /translation="MSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYG
FT                   YRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRVAVKESN
FT                   QRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFG
FT                   NDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDY
FT                   ISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLEI"
FT   gene            complement(72928..73293)
FT                   /locus_tag="SSON_P080"
FT                   /old_locus_tag="SSO_P080"
FT                   /note="SSOP080"
FT   CDS_pept        complement(72928..73293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P080"
FT                   /old_locus_tag="SSO_P080"
FT                   /product="IS2 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P080"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91100"
FT                   /db_xref="GOA:Q3Z544"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z544"
FT                   /protein_id="AAZ91100.1"
FT                   /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQ
FT                   LFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYG
FT                   RAKKWIAHAPLLPGDGE"
FT   mobile_element  73511..74884
FT                   /mobile_element_type="insertion sequence:ISSfl2"
FT   gene            complement(73542..74738)
FT                   /locus_tag="SSON_P081"
FT                   /old_locus_tag="SSO_P081"
FT                   /note="SSOP081"
FT   CDS_pept        complement(73542..74738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P081"
FT                   /old_locus_tag="SSO_P081"
FT                   /product="ISSfl2 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P081"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91101"
FT                   /db_xref="GOA:Q3Z432"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z432"
FT                   /protein_id="AAZ91101.1"
FT                   /translation="MTESSDYESVQVFIGVDVGKDTHHAVAINRSGKRLFDKALPNDEN
FT                   KLRSLISDLKQHGQILLVVDQPATIGALPVAVARSEGVLVGYLPGLAMRRIADLHAGEA
FT                   KTDARDAAIIAEAARTLPHALRTLKLADEQIAELSMLCGFDDDLAAQTTQASNRIRGLL
FT                   TQIHPALERVLGPRLEHPAVLDLLQRYPSPEKLASLGEKKLAAQLCKLAPRLGKRLAAD
FT                   IAQALAEQTVVVPGTNAAAVVLPRLALQLITLRKQRDEVALEVEQRVLAHPLYPVLTSM
FT                   PGVGVRTAARLLTEVACRAFASAAHLAAYAGLAPVTRRSGSSIRGEHPSRRGNKALKRA
FT                   LFLSAFAALRDPLSRAYYTRKMSQGKRHNQALIALARRRCDVLFAMMRDGTFYTPQGS"
FT   gene            complement(74930..75934)
FT                   /locus_tag="SSON_P082"
FT                   /old_locus_tag="SSO_P082"
FT                   /note="SSOP082"
FT   CDS_pept        complement(74930..75934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P082"
FT                   /old_locus_tag="SSO_P082"
FT                   /product="IS100 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P082"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91102"
FT                   /db_xref="GOA:Q3YTR0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTR0"
FT                   /protein_id="AAZ91102.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGLSRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVPGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGSTVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHPGENLVSFDNPVTLFVPLIMGC"
FT   mobile_element  complement(74970..76021)
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="partial"
FT   gene            76173..76373
FT                   /locus_tag="SSON_P083"
FT                   /old_locus_tag="SSO_P083"
FT                   /note="SSOP083"
FT   CDS_pept        76173..76373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P083"
FT                   /old_locus_tag="SSO_P083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P083"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91103"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ9"
FT                   /protein_id="AAZ91103.1"
FT                   /translation="MVINKGKCRRCRVSQISDIIEPNIRCITLQIVESLQVKYTLVGVY
FT                   VAKHVIQVHLTNKDMSEVEDK"
FT   gene            77287..78066
FT                   /gene="ipaJ"
FT                   /locus_tag="SSON_P084"
FT                   /old_locus_tag="SSO_P084"
FT                   /note="SSOP084"
FT   CDS_pept        77287..78066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipaJ"
FT                   /locus_tag="SSON_P084"
FT                   /old_locus_tag="SSO_P084"
FT                   /product="IpaJ"
FT                   /note="invasion plasmid antigen"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P084"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ8"
FT                   /protein_id="AAZ91104.1"
FT                   /translation="MSEQRKPCKRGCIHTGVMLYGVLLQGAIPREYMISHQTDVRVNEN
FT                   RVNEQGCFLARKQMYDNSCGAASLLCAAKELGVDKIPQYKGSMSEMTRKSSLDLDNRCE
FT                   RDLYLITSGNYNPRIHKDNIADAGYSMPDKIVMATRLLGLNAYVVEESNIFSQVISFIY
FT                   PDARDLLIGMGCNIVHQRDVLSSNQRVLEAVAVSFIGVPVGLHWVLCRPDGSYMDPAVG
FT                   ENYSCFSTMELGARRSNSNFIGYTKIGISIVITNEAL"
FT   gene            complement(79012..79941)
FT                   /gene="virB"
FT                   /locus_tag="SSON_P085"
FT                   /old_locus_tag="SSO_P085"
FT                   /note="SSOP085"
FT   CDS_pept        complement(79012..79941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB"
FT                   /locus_tag="SSON_P085"
FT                   /old_locus_tag="SSO_P085"
FT                   /product="VirB"
FT                   /note="transcriptional activator required for tanscription
FT                   of the ipa, mxi, and spa operons"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P085"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91105"
FT                   /db_xref="GOA:Q3YTQ7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR014884"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ7"
FT                   /protein_id="AAZ91105.1"
FT                   /translation="MVDLCNDLLSIKEGQKKEFTLHSGNKVSFIKAKIPHKRIQDLTFV
FT                   NQKTNVRDQESLTEESLADIIKTIKLQQFFPVIGREIDGRIEILDGTRRRASAIYAGAD
FT                   LEVLYSKEYISTLDARKLANDIQTAKEHSIRELGIGLNFLKVSGMSYKDIAKKENLSRA
FT                   KVTRAFQAASVPQEIISLFPIASELNFNDYKILFNYYKGLEKANESLSSTLPILKEEIK
FT                   DLDTNLPPDIYKKEILNIIKKSKNRKQNPSLKVDSLFISKDKRTYIKRKENKTNRTLIF
FT                   TLSKINKTVQREIDEAIRDIISRHLSSS"
FT   gene            complement(80158..80394)
FT                   /gene="acp"
FT                   /locus_tag="SSON_P086"
FT                   /old_locus_tag="SSO_P086"
FT                   /note="SSOP086"
FT   CDS_pept        complement(80158..80394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acp"
FT                   /locus_tag="SSON_P086"
FT                   /old_locus_tag="SSO_P086"
FT                   /product="Acp"
FT                   /note="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P086"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91106"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ6"
FT                   /protein_id="AAZ91106.1"
FT                   /translation="MIKEKILSIVAFCYGIAYSKLSEETKFIEDLSADSLSLIEMLDMI
FT                   SFEFNLRIDESALEHIITIGDLISVVKNSTKSI"
FT   gene            complement(80398..82299)
FT                   /gene="ipaA"
FT                   /locus_tag="SSON_P087"
FT                   /old_locus_tag="SSO_P087"
FT                   /note="SSOP087"
FT   CDS_pept        complement(80398..82299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipaA"
FT                   /locus_tag="SSON_P087"
FT                   /old_locus_tag="SSO_P087"
FT                   /product="IpaA"
FT                   /note="secreted by the Mxi-Spa machinery; modulates entry
FT                   of bacteria into epithelial cells"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P087"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91107"
FT                   /db_xref="InterPro:IPR015138"
FT                   /db_xref="InterPro:IPR023225"
FT                   /db_xref="InterPro:IPR040658"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ5"
FT                   /protein_id="AAZ91107.1"
FT                   /translation="MHNVNNTQAPTFLYKATSPSSTEYSELKSKISDIHSSQTSLKTPA
FT                   SVSEKESFATSFNQKCLDFLFSSSGKEDVLRSIYSNSMNAYAKSEILEFSNVLYSLVHQ
FT                   NGLNFENEKGLQKIVAQYSELIIKDKLSQDSAFGPWSAKNKKLHQLRQNIEHRLALLAQ
FT                   QHTSGEALSLGQKLLNTEVSSFIKNNILAELKLSNETVSSLKLDDLVDAQAKLAFDSLR
FT                   NQRKNTIDSKGFGIGKLSRDLNTVAVFPELLRKVLNDILEDIKDSHPIQDGLPTPPEDM
FT                   PDGGPTPGANEKTSQPVIHYHINNDNRTYDNRVFDNRVYDNSYHENPENDAQSPTSQTN
FT                   DLLSRNGNSLLNPQRALVQKVTSVLPHSISDTVQTFANNSALEKVFNHTPDNSDGIGSD
FT                   LLTTSSQERSANNSLSRGHRPLNIQNSSTTPPLHPEGVTSSNDNSSDTTKSSASLSHRV
FT                   ASQINKFNSNTDSKVLQTDFFSRNGDTYLTRETIFEASKKVTNSLSNLISLIGTKSGTQ
FT                   ERELQEKSKDITKSTTEHRINNKLKVTDANTINYVTETNADTIDKNHAIYEKAKEVSSA
FT                   LSKVLSKIDDTSAELLTDDISDLKNNNDITAENNNIYKAAKDVTTSLSKVLKNINKD"
FT   gene            complement(82308..83306)
FT                   /gene="ipaD"
FT                   /locus_tag="SSON_P088"
FT                   /old_locus_tag="SSO_P088"
FT                   /note="SSOP088"
FT   CDS_pept        complement(82308..83306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipaD"
FT                   /locus_tag="SSON_P088"
FT                   /old_locus_tag="SSO_P088"
FT                   /product="IpaD"
FT                   /note="secreted by the Mxi-Spa machinery; required for
FT                   entry of bacteria into epithelial cells"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P088"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91108"
FT                   /db_xref="GOA:Q3YTQ4"
FT                   /db_xref="InterPro:IPR009483"
FT                   /db_xref="InterPro:IPR036708"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ4"
FT                   /protein_id="AAZ91108.1"
FT                   /translation="MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLT
FT                   MLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEY
FT                   PINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQM
FT                   YQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKKKYEDKPLYPATNTVSQKE
FT                   ADKWLTELGGTIGKVSKKNGGYVVNINMTPIDNMLKSLNNLGGNGEVVLDNAKYQAWNA
FT                   GFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF"
FT   gene            complement(83357..84448)
FT                   /gene="ipaC"
FT                   /locus_tag="SSON_P089"
FT                   /old_locus_tag="SSO_P089"
FT                   /note="SSOP089"
FT   CDS_pept        complement(83357..84448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipaC"
FT                   /locus_tag="SSON_P089"
FT                   /old_locus_tag="SSO_P089"
FT                   /product="IpaC"
FT                   /note="secreted by the Mxi-Spa secretion machinery;
FT                   required for entry into epithelial cells"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P089"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91109"
FT                   /db_xref="GOA:Q3YTQ3"
FT                   /db_xref="InterPro:IPR005427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ3"
FT                   /protein_id="AAZ91109.1"
FT                   /translation="MEIQNTKSTQILYTDISTKQTQSSSETQKSQNYQQIAAHIPLNVG
FT                   KNPVLTTTLNDDQLLKLSEQVQHDSEIIARLTDKKMKDLSEMSHTLTPENTLDISSLSS
FT                   NAVSLIISVAVLLSALRTAETKLGSQLSLIAFDATKSAAENIVRQGLAALSSSITGAVT
FT                   QVGITGIGAKKTHSGISDQKGALRKNLATAQSLEKELAGSKLGLNKQIDTNITSPQTNS
FT                   STKFLGKNKLAPDNISLSTEHKTSLSSPDISLQDKIDTQRRTYELNTLSAQQKQNIGRA
FT                   TMDTSAVAGNISTSGGRYASALEEEEQLISQASSKQAEEASQVSKEASQATNQLIQKLL
FT                   NIIDSITQSRNSTASQIAGNIRA"
FT   gene            complement(84468..86210)
FT                   /gene="ipaB"
FT                   /locus_tag="SSON_P090"
FT                   /old_locus_tag="SSO_P090"
FT                   /note="SSOP090"
FT   CDS_pept        complement(84468..86210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipaB"
FT                   /locus_tag="SSON_P090"
FT                   /old_locus_tag="SSO_P090"
FT                   /product="IpaB"
FT                   /note="secreted by the Mxi-Spa secretion machinery;
FT                   required for entry into epithelial cells"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P090"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91110"
FT                   /db_xref="GOA:Q3YTQ2"
FT                   /db_xref="InterPro:IPR003895"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="InterPro:IPR032391"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ2"
FT                   /protein_id="AAZ91110.1"
FT                   /translation="MHNVSTTTTGLSLAKILASTELGDNTIQAANDAANKLFSLTIADL
FT                   TANKNINTTNSHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITA
FT                   WKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQT
FT                   RLSELDPDSPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEID
FT                   SFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQES
FT                   RKTEMERKSDEYAAEVRKAEELNRVMGCVGKILGALLTIVSVVAAAFSGGASLALAAVG
FT                   LALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEGLGVDSKKAKMI
FT                   GSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLD
FT                   DLITNAVARLNKFLGAAGDEVISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNS
FT                   ASTNLADLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQANRTDVAKAILQ
FT                   QTTA"
FT   gene            complement(86216..86683)
FT                   /gene="ipgC"
FT                   /locus_tag="SSON_P091"
FT                   /old_locus_tag="SSO_P091"
FT                   /note="SSOP091"
FT   CDS_pept        complement(86216..86683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipgC"
FT                   /locus_tag="SSON_P091"
FT                   /old_locus_tag="SSO_P091"
FT                   /product="IpgC"
FT                   /note="cytoplasmic chaperone for IpaB and IpaC"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P091"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91111"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016379"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ1"
FT                   /protein_id="AAZ91111.1"
FT                   /translation="MSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYD
FT                   FYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDY
FT                   TPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE"
FT   gene            complement(86741..87367)
FT                   /gene="ipgB1"
FT                   /locus_tag="SSON_P092"
FT                   /old_locus_tag="SSO_P092"
FT                   /note="SSOP092"
FT   CDS_pept        complement(86741..87367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipgB1"
FT                   /locus_tag="SSON_P092"
FT                   /old_locus_tag="SSO_P092"
FT                   /product="IpgB1"
FT                   /note="secreted by the Mxi-Spa machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P092"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91112"
FT                   /db_xref="GOA:Q3YTQ0"
FT                   /db_xref="InterPro:IPR004959"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTQ0"
FT                   /protein_id="AAZ91112.1"
FT                   /translation="MQILNKILPQVEFAIPRPSFNSLSYNKLVKKILSVFNLKQRFPQK
FT                   NFGCPVNINKIRDNVIDKIKDSNSGNQLFCWMSQERTSYVSSMINRSIDEMAIHNGVVL
FT                   TSDNKKNIFAAIEKKFPDIKLDEKSAQTSISHTALNEIASSGLRAKILKRYSSNMDLFN
FT                   TQMKDLTNLVSSSVYDKIFNESTKVLQIEISAEVLKAVYRQSNTN"
FT   gene            complement(87383..87772)
FT                   /gene="ipgA"
FT                   /locus_tag="SSON_P093"
FT                   /old_locus_tag="SSO_P093"
FT                   /note="SSOP093"
FT   CDS_pept        complement(87383..87772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipgA"
FT                   /locus_tag="SSON_P093"
FT                   /old_locus_tag="SSO_P093"
FT                   /product="IpgA"
FT                   /note="similar to IpgE; putative chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P093"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91113"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP9"
FT                   /protein_id="AAZ91113.1"
FT                   /translation="MCRKLYDKLYEITGAKLDFNDKNQAFILLEEQIPVCITDNDEYIF
FT                   LTGLLNEHELFTENIINPEHILILNYSLSRDYGSSICLLPDTHQCVLTKKHYKKYLSPD
FT                   ELIESLYEFLFCIKLTIANITSEVN"
FT   gene            complement(87785..89269)
FT                   /gene="icsB"
FT                   /locus_tag="SSON_P094"
FT                   /old_locus_tag="SSO_P094"
FT                   /note="SSOP094"
FT   CDS_pept        complement(87785..89269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icsB"
FT                   /locus_tag="SSON_P094"
FT                   /old_locus_tag="SSO_P094"
FT                   /product="IcsB"
FT                   /note="invasion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P094"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91114"
FT                   /db_xref="InterPro:IPR011070"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP8"
FT                   /protein_id="AAZ91114.1"
FT                   /translation="MILKISNFIDASNTKGPIRVEDTEHGPILVAQKFNLKDLFFRTLS
FT                   TINAKINSQILNEQLKNYRLANQKSLLLFLKTLASEKSAESAFAAYEAVKNSIQHSFTG
FT                   KDIKLMLNTAERFHGIGTAKNLERHLVFRCWGNRGITHLGHTSISIKNNLLQEPTHTYL
FT                   SWYPGGNVTKDTEINYLFEKRSGYSVDTYKQDKLNMISDQTAERLDAGQEVRNLLNSKQ
FT                   DQNNNKKIFFPRANQKKDPYGYWGVSADKVYIPLSGDNKTKDGKISYNLFGLDETNMSK
FT                   FICQKKADAFRQLANYKLISKSENCAGMALNVLKAGNSEIYFPLPDVKLVATPNNVYAY
FT                   ANKVRQRIESLNQSYNEIMKYIESDFDLSRLTQLRRSYLKSFNKINLIHTPKTFKPLSI
FT                   SLYKHPTENVSSEDFDAVINACHSYLVKSAPSNMSRVLNELKTGATDKKEEIIEKSIKT
FT                   IDYYNSLKSPDLGTKLYIHDLLQVNKLLLNNSHSNI"
FT   gene            89583..91199
FT                   /gene="ipgD"
FT                   /locus_tag="SSON_P095"
FT                   /old_locus_tag="SSO_P095"
FT                   /note="SSOP095"
FT   CDS_pept        89583..91199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipgD"
FT                   /locus_tag="SSON_P095"
FT                   /old_locus_tag="SSO_P095"
FT                   /product="IpgD"
FT                   /note="secreted by the Mxi-Spa machinery; modulates entry
FT                   of bacteria into epithelial cells"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P095"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91115"
FT                   /db_xref="GOA:Q3YTP7"
FT                   /db_xref="InterPro:IPR008108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP7"
FT                   /protein_id="AAZ91115.1"
FT                   /translation="MHITNLGLHQVSFQSGDSYKGAEETGKHKGVSVISYQRVKNGERN
FT                   KGIEALNRLYLQNQTSLTGKSLLFARDRAEVFYEAIKLAGGDTSKIKAMMERLDTYKLG
FT                   EVNKRHINELNKVISEEIRAQLGIKNKKELQTKIKQIFTDYLNNKNWGPVNKNISHHGK
FT                   NYGFQLTPASHMKIGNKNIFVKEYNGKGICCASTRESDHIANMWLSKVVDDEGKEIFSG
FT                   IRHGVISAYGLKKNSSERAVAARNKAEELVSAALYSRPELLSQALSGKTVDLKIVSTSL
FT                   LTPTSLTGGEESMLKDQVNALKGLNSKRGEPTKLLIRNSDGLLKEVSVNLKVVTFNFGV
FT                   NELALKMGLGWRNVDKLNDESICSLLGDNFLKNGVIGGWAAEAIEKNPPCKNDVIYLAN
FT                   QIKEIINKKLQKNDNGEPYKLSQRMTLLAYTIGAVPCWNCKSGKDRTGMQDAEIKREII
FT                   RKHETGQFSQLNSKLSSEEKRLFSTILMNSGNMEIQEMNTGVPGNKVMKKLPLSSLELS
FT                   YSERIGDSKIWNMVKGYSSFV"
FT   gene            91209..91571
FT                   /gene="ipgE"
FT                   /locus_tag="SSON_P096"
FT                   /old_locus_tag="SSO_P096"
FT                   /note="SSOP096"
FT   CDS_pept        91209..91571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipgE"
FT                   /locus_tag="SSON_P096"
FT                   /old_locus_tag="SSO_P096"
FT                   /product="IpgE"
FT                   /note="cytoplasmic chaperone for IpgD"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P096"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91116"
FT                   /db_xref="GOA:Q3YTP6"
FT                   /db_xref="InterPro:IPR013095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP6"
FT                   /protein_id="AAZ91116.1"
FT                   /translation="MEDLADVICRALGIPLIDIDDQAIMLDDDVLIYIEKEGDSINLLC
FT                   PFCALPENINDLIYALSLNYSEKICLATDDEGGNLIARLDLTGINEFEDVYVNTEYYIS
FT                   RVRWLKDEFARRMKGY"
FT   gene            91571..92029
FT                   /gene="ipgF"
FT                   /locus_tag="SSON_P097"
FT                   /old_locus_tag="SSO_P097"
FT                   /note="SSOP097"
FT   CDS_pept        91571..92029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipgF"
FT                   /locus_tag="SSON_P097"
FT                   /old_locus_tag="SSO_P097"
FT                   /product="IpgF"
FT                   /note="periplasmic protein; similar to the catalytic site
FT                   of lyzozymes"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P097"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91117"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP5"
FT                   /protein_id="AAZ91117.1"
FT                   /translation="MSRFVFILLCFIPYLGRADCWDKAGERYNIPSSLLKAIAEKESGF
FT                   NKFAVNVNNNGSKDYGIMQINDFHSKRLREMGYSEEMLISHPCLSVHYAAKLLNEFMMM
FT                   YGRGWEAVGAYNAGTSPKKKKERLKYAEDIYRRYLRIAAESKQNNRRI"
FT   gene            92038..93153
FT                   /gene="mxiG"
FT                   /locus_tag="SSON_P098"
FT                   /old_locus_tag="SSO_P098"
FT                   /note="SSOP098"
FT   CDS_pept        92038..93153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiG"
FT                   /locus_tag="SSON_P098"
FT                   /old_locus_tag="SSO_P098"
FT                   /product="MxiG"
FT                   /note="component of the Mxi-Spa secretion machinery,
FT                   contains one transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P098"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91118"
FT                   /db_xref="GOA:Q3YTP4"
FT                   /db_xref="InterPro:IPR019029"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP4"
FT                   /protein_id="AAZ91118.1"
FT                   /translation="MSEAKNSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLE
FT                   FGNDNFPENIIPVTDSKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFH
FT                   LKNMREDKSRGHILNGMYKNHSVFFFFAVIVVLIIIFSLSLKKDEVKEIAEIIDDKRYG
FT                   IVNTGQCNYILAETQNDAVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRFPFINL
FT                   YVLNLVSDKAELLVFLSKERNSSKDTELDKLKNALIVEFPYIKNIKFNYLSDHNARGDA
FT                   KGIFTKVNVQYKEICENNKVTYSVREELTDEKLELINRLISEHKNIYGDQYIEFSVLLI
FT                   DDDFKGKSYLNSKDSYVMLNDKHWFFLDKNK"
FT   gene            93161..93412
FT                   /gene="mxiH"
FT                   /locus_tag="SSON_P099"
FT                   /old_locus_tag="SSO_P099"
FT                   /note="SSOP099"
FT   CDS_pept        93161..93412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiH"
FT                   /locus_tag="SSON_P099"
FT                   /old_locus_tag="SSO_P099"
FT                   /product="MxiH"
FT                   /note="component of the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P099"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91119"
FT                   /db_xref="GOA:Q3YTP3"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP3"
FT                   /protein_id="AAZ91119.1"
FT                   /translation="MSVTVPNDDWTLSSLSETFDDGTQTLQGELTLALDKLAKNPSNPQ
FT                   LLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAIIQNFR"
FT   gene            93425..93718
FT                   /gene="mxiI"
FT                   /locus_tag="SSON_P100"
FT                   /old_locus_tag="SSO_P100"
FT                   /note="SSOP100"
FT   CDS_pept        93425..93718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiI"
FT                   /locus_tag="SSON_P100"
FT                   /old_locus_tag="SSO_P100"
FT                   /product="MxiI"
FT                   /note="component of the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P100"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91120"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP2"
FT                   /protein_id="AAZ91120.1"
FT                   /translation="MNYIYPVNQVDIIKASDFQSQEISSLEDVVSAKYSDIKMDTDIQV
FT                   SQIMEMVSNPESLNPESLAKLQTTLSNYSIGVSLAGTLARKTVSAVETLLKS"
FT   gene            93724..94449
FT                   /gene="mxiJ"
FT                   /locus_tag="SSON_P101"
FT                   /old_locus_tag="SSO_P101"
FT                   /note="SSOP101"
FT   CDS_pept        93724..94449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiJ"
FT                   /locus_tag="SSON_P101"
FT                   /old_locus_tag="SSO_P101"
FT                   /product="MxiJ"
FT                   /note="lipoprotein, component of the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P101"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91121"
FT                   /db_xref="GOA:Q3YTP1"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP1"
FT                   /protein_id="AAZ91121.1"
FT                   /translation="MIRYKGFILFLLLMLIGCEQREELISNLSQRQANEIISVLERHNI
FT                   TARKVDGGKQGISVQVEKGTFASAVDLMRMYDLPNPERVDISQMFPTDSLVSSPRAEKA
FT                   RLYSAIEQRLEQSLVSIGGVISAKIHVSYDLEEKNISSKPMHISVIAIYDSPKESELLV
FT                   SNIKRFLKNTFSDVKYENISVILTPKEEYVYTNVQPVKEIKSEFLTNEVIYLFLGMAVL
FT                   VVILLVWAFKTGWFKRNKI"
FT   gene            94446..94973
FT                   /gene="mxiK"
FT                   /locus_tag="SSON_P102"
FT                   /old_locus_tag="SSO_P102"
FT                   /note="SSOP102"
FT   CDS_pept        94446..94973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiK"
FT                   /locus_tag="SSON_P102"
FT                   /old_locus_tag="SSO_P102"
FT                   /product="MxiK"
FT                   /note="putative component of the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P102"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91122"
FT                   /db_xref="GOA:Q3YTP0"
FT                   /db_xref="InterPro:IPR013388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTP0"
FT                   /protein_id="AAZ91122.1"
FT                   /translation="MIRMDGIYKKYLSIIFDPAFYINRNRLNLPSELLENGVIRSEINN
FT                   LIINKYDLNCDIEPLSGVTAMFVANWNLLPAVAYFIGSQESRLINHSEMVISYYGGKIS
FT                   KQGEAAIRSGFWHLIAWKENISVGIYERINLLFNPIALEGNYTPVERNLSRLNEGMQYA
FT                   KRHFTGIQTSCL"
FT   gene            94915..95610
FT                   /gene="mxiN"
FT                   /locus_tag="SSON_P103"
FT                   /old_locus_tag="SSO_P103"
FT                   /note="SSOP103"
FT   CDS_pept        94915..95610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiN"
FT                   /locus_tag="SSON_P103"
FT                   /old_locus_tag="SSO_P103"
FT                   /product="MxiN"
FT                   /note="putative component of the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P103"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN9"
FT                   /protein_id="AAZ91123.1"
FT                   /translation="MKVCNMQKGTLPVSRHHAYDGVVIKRIEKELCKTIKDRDTESKKK
FT                   AICVIKDATKKAESLRIDAVCDGYQIGIQTAFEHIIDYICEWKLKQNENRRNIEDYITS
FT                   LLSENLHDERIISTLLEQWLSSLRNTVTELKVVLPKCNLALRKKLELDLHKYRSDVKII
FT                   LKYSEGNNYIFCSGNQVVEFSPQDVISGVKIELAEKLTKNDKKYFKELAHKKLRQIAED
FT                   LLKENPVND"
FT   gene            95603..96010
FT                   /gene="mxiL"
FT                   /locus_tag="SSON_P104"
FT                   /old_locus_tag="SSO_P104"
FT                   /note="SSOP104"
FT   CDS_pept        95603..96010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiL"
FT                   /locus_tag="SSON_P104"
FT                   /old_locus_tag="SSO_P104"
FT                   /product="MxiL"
FT                   /note="secreted by and putative component of the Mxi-Spa
FT                   secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P104"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91124"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN8"
FT                   /protein_id="AAZ91124.1"
FT                   /translation="MINQINASNALQQRLNSEEFVNLNERLSSSQSFDEDIIYEIMQYF
FT                   SQSELNSIDNDELHNKIEQLFNSRFPYLTAAQKSSLLNKLIDANQYVDLHEGFYASLSI
FT                   YNNIDFYIKTTTFDSLISVFEAGREADDSTW"
FT   gene            95994..96422
FT                   /gene="mxiM"
FT                   /locus_tag="SSON_P105"
FT                   /old_locus_tag="SSO_P105"
FT                   /note="SSOP105"
FT   CDS_pept        95994..96422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiM"
FT                   /locus_tag="SSON_P105"
FT                   /old_locus_tag="SSO_P105"
FT                   /product="MxiM"
FT                   /note="lipoprotein; component of the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P105"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91125"
FT                   /db_xref="InterPro:IPR021546"
FT                   /db_xref="InterPro:IPR038517"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN7"
FT                   /protein_id="AAZ91125.1"
FT                   /translation="MIRHGSNKLKIFILSILLLTLSGCALKSSSNSEKEWHIVPVSKDY
FT                   FSIPNDLLWSFNTTNKSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAI
FT                   DKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGI"
FT   gene            96552..97184
FT                   /gene="mxiE"
FT                   /locus_tag="SSON_P106"
FT                   /old_locus_tag="SSO_P106"
FT                   /note="SSOP106"
FT   CDS_pept        96552..97184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiE"
FT                   /locus_tag="SSON_P106"
FT                   /old_locus_tag="SSO_P106"
FT                   /product="MxiE"
FT                   /note="similar to transcriptional activators of the AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P106"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91126"
FT                   /db_xref="GOA:Q3YTN6"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN6"
FT                   /protein_id="AAZ91126.1"
FT                   /translation="MEGFFFVRNQNIKFSDNVNYHYRFNINSCAKFLAFWDYFSGALVE
FT                   HSHAEKCIHFYHENDLRDSCNTESMLDKLMLRFIFSSDQNVSNALAMIRMTESYHLVLY
FT                   LLRTIEKEKEVRIKSLTEHYGVSEAYFRSLCRKALGAKVKEQLNTWRLVNGLLDVFLHN
FT                   QTITSAAMNNGYASTSHFSNEIKTRLGFSARELSNITFLVKKINEKI"
FT   gene            97171..98871
FT                   /gene="mxiD"
FT                   /locus_tag="SSON_P107"
FT                   /old_locus_tag="SSO_P107"
FT                   /note="SSOP107"
FT   CDS_pept        97171..98871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiD"
FT                   /locus_tag="SSON_P107"
FT                   /old_locus_tag="SSO_P107"
FT                   /product="MxiD"
FT                   /note="outermembrane protein of the secretin family;
FT                   component of the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P107"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91127"
FT                   /db_xref="GOA:Q3YTN5"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN5"
FT                   /protein_id="AAZ91127.1"
FT                   /translation="MKKFNIKSLTLLIVLLPLIVNANNIDSHLLEQNDIAKYVAQSDTV
FT                   GSFFERFSALLNYPIVVSKQAAKKRISGEFDLSNPEEMLEKLTLLVGLIWYKDGNALYI
FT                   YDSGELISKVILLENISLNYLIQYLKDANLYDHRYPIRGNISDKTFYISGPPALVELVA
FT                   NTATLLDKQVSSIGTDKVNFGVIKLKNTFVSDRTYNMRGEDIVIPGVATVVERLLNNGK
FT                   ALSNRQAQNDPMPPFNITQKVSEDSNDFSFSSVTNSSILEDVSLIAYPETNSILVKGND
FT                   QQIQIIRDIITQLDVAKRHIELSLWIIDIDKSELNNLGVNWQGTASFGDSFGASFNMSS
FT                   SASISTLDGNKFIASVMALNQKKKANVVSRPVILTQENIPAIFDNNRTFYVSLVGERNS
FT                   SLEHVTYGTLINVIPRFSSRGQIEMSLTIEDGTGNSQSNYNYNNENTSVLPEVGRTKIS
FT                   TIARVPQGKSLLIGGYTHETNSNEIVSIPFLSSIPVIGNVFKYKTSNISNIVRVFLIQP
FT                   REIKESSYYNTAEYKSLISEREIQKTTQIIPSETTLLEDEKSLVSYLNY"
FT   gene            98890..99957
FT                   /gene="mxiC"
FT                   /locus_tag="SSON_P108"
FT                   /old_locus_tag="SSO_P108"
FT                   /note="SSOP108"
FT   CDS_pept        98890..99957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiC"
FT                   /locus_tag="SSON_P108"
FT                   /old_locus_tag="SSO_P108"
FT                   /product="MxiC"
FT                   /note="secreted by and putative component of the Mxi-Spa
FT                   secretion machinery; similar to YopN (secreted by the type
FT                   III secretion machinery of Yersinia enterocoltica)"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P108"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91128"
FT                   /db_xref="GOA:Q3YTN4"
FT                   /db_xref="InterPro:IPR003520"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN4"
FT                   /protein_id="AAZ91128.1"
FT                   /translation="MLDVKNTGVFSSAFIDKLNAMTNSDDGDETADAELDSGLANSKYI
FT                   DSSDEMASALSSFINRRDLEKLKGTNSDSQERILDGEEDEINHKIFDLKRTLKDNLPLD
FT                   RDFIDRLKRYFKDPSDQVLALRELLNEKDLTAEQVESLTKIINEIISGSEKSVNAGINS
FT                   AIQAKLFGNKMKLEPQLLRACYRGFIMGNISTTDQYIEWLGNFGFNHRHTIVNFVEQSL
FT                   IVDMDSEKPSCNAYEFGFVLSKLIAIKMIRTSDVIFMKKLESSSLLKDGSLSAEQLLLT
FT                   LLYIFQYPSESEQILTSVIEVSRASHEDSVVYQTYLSSVNESPHDIFKSESEREIAINI
FT                   LRELVTSAYKKELSR"
FT   gene            99964..102030
FT                   /gene="mxiA"
FT                   /locus_tag="SSON_P109"
FT                   /old_locus_tag="SSO_P109"
FT                   /note="SSOP109"
FT   CDS_pept        99964..102030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxiA"
FT                   /locus_tag="SSON_P109"
FT                   /old_locus_tag="SSO_P109"
FT                   /product="MxiA"
FT                   /note="innermembrane protein; component of the Mxi-Spa
FT                   secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P109"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91129"
FT                   /db_xref="GOA:Q3YTN3"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN3"
FT                   /protein_id="AAZ91129.1"
FT                   /translation="MKVIQSFLKQVSTKPELIILVLMVMIIAMLIIPLPTYLVDFLIGL
FT                   NIVLAILVFMGSFYIERILSFSTFPSVLLITTLFRLALSISTSRLILVDADAGKIITTF
FT                   GQFVIGDSLAVGFVIFSIVTVVQFIVITKGSERVAEVAARFSLDGMPGKQMSIDADLKA
FT                   GIIDAAGAKERRSILERESQLYGSFDGAMKFIKGDAIAGIIIIFVNLIGGISVGMSQHG
FT                   MSLSGALSTYTILTIGDGLVSQIPALLISISAGFIVTRVNGDSDNMGRNIMSQIFGNPF
FT                   VLIVTSALALAIGMLPGFPFFVFFLIAVTLTALFYYKKVVEKEKSLSESDSSGYTGTFD
FT                   IDNSHDSSLAMIENLDAISSETVPLILLFAENKINANDMEGLIERIRSQFFIDYGVRLP
FT                   TILYRTSNELKVDDIVLLINEVRADSFNIYFDKVCITDENGDIDALGIPVVSTSYNERV
FT                   ISWVDVSYTENLTNIDAKIKSAQDEFYHQLSQALLNNINEIFGIQETKNMLDQFENRYP
FT                   DLLKEVFRHVTIQRISEVLQRLLGENISVRNLKLIMESLALWAPREKDVITLVEHVRAS
FT                   LSRYICSKIAVSGEIKVVMLSGYIEDAIRKGIRQTSGGSFLNMDIEVSDEVMETLAHAL
FT                   RELRNAKKNFVLLVSVDIRRFVKRLIDNRFKSILVISYAEIDEAYTINVLKTI"
FT   gene            102043..102444
FT                   /gene="spa15"
FT                   /locus_tag="SSON_P110"
FT                   /old_locus_tag="SSO_P110"
FT                   /note="SSOP110"
FT   CDS_pept        102043..102444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spa15"
FT                   /locus_tag="SSON_P110"
FT                   /old_locus_tag="SSO_P110"
FT                   /product="Spa15"
FT                   /note="putative component of the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P110"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91130"
FT                   /db_xref="InterPro:IPR003065"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN2"
FT                   /protein_id="AAZ91130.1"
FT                   /translation="MSNINLVQLVRDSLFTIGCPPSIITDLDSHSAITISLDSMPAINI
FT                   ALVNEQVMLWANFDAPSDVKLQSSAYNILNLMLMNFSYSINELVELHRSDEYLQLRVVI
FT                   KDDYVHDGIVFAEILHEFYQRMEILNEVL"
FT   gene            102448..103740
FT                   /gene="spa47"
FT                   /locus_tag="SSON_P111"
FT                   /old_locus_tag="SSO_P111"
FT                   /note="SSOP111"
FT   CDS_pept        102448..103740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spa47"
FT                   /locus_tag="SSON_P111"
FT                   /old_locus_tag="SSO_P111"
FT                   /product="Spa47"
FT                   /note="component of the Mxi-Spa secretion machinery;
FT                   putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P111"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91131"
FT                   /db_xref="GOA:Q3YTN1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN1"
FT                   /protein_id="AAZ91131.1"
FT                   /translation="MSYTKLLTQLSFPNRISGPILETSLSDVSIGEICNIQAGIESNEI
FT                   VARAQVVGFHDEKTILSLIGNSRGLSRQTLIKPTAQFLHTQVGRGLLGAVVNPLGEVTD
FT                   KFAVTDNSEILYRPVDNAPPLYSERAAIEKPFLTGIKVIDSLLTCGEGQRMGIFASAGC
FT                   GKTFLMNMLIEHSGADIYVIGLIGERGREVTETVDYLKNSEKKNRCVLVYATSDYSSVD
FT                   RCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAGESPARRGYPVSVFDS
FT                   LPRLLERPGKLKAGGSITAFYTVLLEDDDFADPLAEEVRSILDGHIYLSRNLAQKGQFP
FT                   AIDSLKSISRVFTQVVDEKHRIMAAAFRELLSEIEELRTIIDFGEYKPGENASQDKIYN
FT                   KISVVESFLKQDYRLGFTYEQTMELIGETIR"
FT   gene            103833..104171
FT                   /gene="spa13"
FT                   /locus_tag="SSON_P112"
FT                   /old_locus_tag="SSO_P112"
FT                   /note="SSOP112"
FT   CDS_pept        103833..104171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spa13"
FT                   /locus_tag="SSON_P112"
FT                   /old_locus_tag="SSO_P112"
FT                   /product="Spa13"
FT                   /note="component of the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P112"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91132"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTN0"
FT                   /protein_id="AAZ91132.1"
FT                   /translation="MEALDKRIIYFLQLENDLEPVGAQSVSQLFNTRRKIAIVKKHIIQ
FT                   YQSERILLKGRIEEIQKDIDEANASKRKLLHKESKICKRIGLIKRNNFAKQLILDELSQ
FT                   EDMKYGIR"
FT   gene            104158..105036
FT                   /gene="spa32"
FT                   /locus_tag="SSON_P113"
FT                   /old_locus_tag="SSO_P113"
FT                   /note="SSOP113"
FT   CDS_pept        104158..105036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spa32"
FT                   /locus_tag="SSON_P113"
FT                   /old_locus_tag="SSO_P113"
FT                   /product="Spa32"
FT                   /note="secreted by and component of the Mxi-Spa machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P113"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91133"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM9"
FT                   /protein_id="AAZ91133.1"
FT                   /translation="MALDNINLNFSSDKQIEKCEKLSSIDNIDSLVLKKKRKVEIPEYS
FT                   LIASNYFTIDKHFEHKHDKGEIYSGIKNAFELRNERATYSDIPESMAIKENILIPDQDI
FT                   KAREKINIGDMRGIFSYNKSGNADKNFERSHTSSVNPDNLLESDNRNGQIGLKNHSLSI
FT                   DKNIADIISLLNGSVAKSFELPVMNKNTADITPSMSLQEKSIVENDKNVFQKNSEMTYH
FT                   FKQWGAGHSVSISVESGSFVLKPSDQFVGNKLDLILKQDAEGNYRFDSSQHNKGNKNNS
FT                   TGYNEQSEEEC"
FT   gene            105030..105911
FT                   /gene="spa33"
FT                   /locus_tag="SSON_P114"
FT                   /old_locus_tag="SSO_P114"
FT                   /note="SSOP114"
FT   CDS_pept        105030..105911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spa33"
FT                   /locus_tag="SSON_P114"
FT                   /old_locus_tag="SSO_P114"
FT                   /product="Spa33"
FT                   /note="component of the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P114"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91134"
FT                   /db_xref="GOA:Q3YTM8"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR003283"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM8"
FT                   /protein_id="AAZ91134.1"
FT                   /translation="MLRIKHFDANEKLQILYAKQLCERFSIQTFKNKFTGSESLVTLTS
FT                   VCGDWVIRIDTLSFLKKKYEVFSGFSTQESLLHLSKCVFIESSSVFSIPELSDKITFRI
FT                   TNEIQYATTGSHLCCFSSSLGIIYFDKMPVLRNQVSLDLLHHLLEFCLGSSNVRLATLK
FT                   RIRTGDIIIVQKLYNLLLCNQVIIGDYIVNDNNEAKINLSESNGESEHTEVSLALFNYD
FT                   DINVKVDFILLEKNMTINELKMYVENELFKFPDDIVKHVNIKVNGSLVGHGELVSIEDG
FT                   YGIEISSWMVKE"
FT   gene            105916..106566
FT                   /gene="spa24"
FT                   /locus_tag="SSON_P115"
FT                   /old_locus_tag="SSO_P115"
FT                   /note="SSOP115"
FT   CDS_pept        105916..106566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spa24"
FT                   /locus_tag="SSON_P115"
FT                   /old_locus_tag="SSO_P115"
FT                   /product="Spa24"
FT                   /note="component of the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P115"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91135"
FT                   /db_xref="GOA:Q3YTM7"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM7"
FT                   /protein_id="AAZ91135.1"
FT                   /translation="MLSDMSLIATLSFFTLLPFLVAAGTCYIKFSIVFVMVRNALGLQQ
FT                   VPSNMTLNGIALIMALFVMKPIIEAGYENYLNGPQKFDTISDIVRFSDSGLMEYKQYLK
FT                   KHTDLELARFFQRSEEENADLKSAENNDYSLFSLLPAYALSEIKDAFKIGFYLYLPFVV
FT                   VDLVISSILLALGMMMMSPITISVPIKLVLFVALDGWGILSKALIEQYINVPA"
FT   gene            106581..106841
FT                   /gene="spa9"
FT                   /locus_tag="SSON_P115a"
FT   CDS_pept        106581..106841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spa9"
FT                   /locus_tag="SSON_P115a"
FT                   /product="Spa9, component of the Mxi-Spa secretion
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P115a"
FT                   /db_xref="EnsemblGenomes-Tr:ABS59873"
FT                   /db_xref="GOA:A7FAB0"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:A7FAB0"
FT                   /protein_id="ABS59873.1"
FT                   /translation="MSDIVYMGNKALYLILIFSLWPVGIATVIGLSIGLLQTVTQLQEQ
FT                   TLPFGIKLIGVSISLLLLSGWYGEVLLSFCHEIMFLIKSGV"
FT   gene            106841..107611
FT                   /gene="spa29"
FT                   /locus_tag="SSON_P116"
FT                   /old_locus_tag="SSO_P116"
FT                   /note="SSOP116"
FT   CDS_pept        106841..107611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spa29"
FT                   /locus_tag="SSON_P116"
FT                   /old_locus_tag="SSO_P116"
FT                   /product="Spa29"
FT                   /note="component of the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P116"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91136"
FT                   /db_xref="GOA:Q3YTM6"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM6"
FT                   /protein_id="AAZ91136.1"
FT                   /translation="MDISSWFESIHVFLILLNGVFFRLAPLFFFLPFLNNGIISPSIRI
FT                   PVIFLVASGLITSGKVDIGSSVFEHVYFLMFKEIIVGLLLSFCLSLPFWIFHAVGSIID
FT                   NQRGATLSSSIDPANGVDTSELAKFFNLFSAVVFLYSGGMVFILESIQLSYNICPLFSQ
FT                   CSFRVSNILTFLTLLASQAVILASPVMIVLLLSEVLLGVLSRFAPQMNAFSVSLTIKSL
FT                   LAIFIIFICSSTIYFSKVQFFLGEHKFFTNLFVR"
FT   gene            107618..108646
FT                   /gene="spa40"
FT                   /locus_tag="SSON_P117"
FT                   /old_locus_tag="SSO_P117"
FT                   /note="SSOP117"
FT   CDS_pept        107618..108646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spa40"
FT                   /locus_tag="SSON_P117"
FT                   /old_locus_tag="SSO_P117"
FT                   /product="Spa40"
FT                   /note="component of the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P117"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91137"
FT                   /db_xref="GOA:Q3YTM5"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM5"
FT                   /protein_id="AAZ91137.1"
FT                   /translation="MANKTEKPTPKKLKDAAKKGQSFKFKDLTTVVIILVGTFTIISFF
FT                   SLSDVMLLYRYVIINDFEINEGKYFFAVVIVFFKIIGFPLFFCVLSAVLPTLVQTKFVL
FT                   ATKAIKIDFSVLNPVKGLKKIFSIKTIKEFFKSILLLIILALTTYFFWINDRKIIFSQV
FT                   FSSVDGLYLIWGGLFKDIILFFLAFSIFVIILDFVIEFILYMKDMMMDKQEIKREYIEQ
FT                   EGHFETKSRRRELHIEILSEQTKSDIRNSKLVVMNPTHIAIGIYFNPEIAPAPFISLIE
FT                   TNQCALAVRKYANEVGIPTVRDVKLARKLYKTHTKYSFVDFEHLDEVLRLIVWLEQVEN
FT                   TH"
FT   gene            108668..108901
FT                   /locus_tag="SSON_P118"
FT                   /old_locus_tag="SSO_P118"
FT                   /note="SSOP118"
FT   CDS_pept        108668..108901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P118"
FT                   /old_locus_tag="SSO_P118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P118"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91138"
FT                   /db_xref="GOA:Q3YTM4"
FT                   /db_xref="InterPro:IPR024753"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM4"
FT                   /protein_id="AAZ91138.1"
FT                   /translation="MGVNFCNKIGIDQSEFEIESSIINSIANEVLNPISFLSNKDIINV
FT                   LLRKISSECDLVRKDIYRCALELVVEKTPDDL"
FT   gene            complement(109478..110098)
FT                   /locus_tag="SSON_P119"
FT                   /old_locus_tag="SSO_P119"
FT                   /note="SSOP119"
FT   CDS_pept        complement(109478..110098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P119"
FT                   /old_locus_tag="SSO_P119"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P119"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91139"
FT                   /db_xref="GOA:Q3YTM3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM3"
FT                   /protein_id="AAZ91139.1"
FT                   /translation="MAHIRTRETYGTRRLQTELADNGIIVGRDRLARLRKELRLHCKQK
FT                   RKFRATTSSDHNLPVTPNLLNQNFTPTAPNQVWVADITYVATREGWLYLAGVKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQHPPAGLIHHSDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNCYDNAPMEIFWGTLKNESLSHYRFKSRDISSAYGKTD"
FT   mobile_element  complement(109508..110599)
FT                   /mobile_element_type="insertion sequence:IS600"
FT                   /note="partial"
FT   gene            complement(110239..110541)
FT                   /locus_tag="SSON_P120"
FT                   /old_locus_tag="SSO_P120"
FT                   /note="SSOP120"
FT   CDS_pept        complement(110239..110541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P120"
FT                   /old_locus_tag="SSO_P120"
FT                   /product="IS600 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P120"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91140"
FT                   /db_xref="GOA:Q3YTM2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM2"
FT                   /protein_id="AAZ91140.1"
FT                   /translation="MSRKTQRYSTEFKAEAVKTVPENQLSISEGASRLSVPEGTLGQWV
FT                   TAARKGLNTPGSRTVAELESEVMQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   mobile_element  complement(110665..113236)
FT                   /mobile_element_type="insertion sequence:ISSso4"
FT   gene            110830..112365
FT                   /locus_tag="SSON_P121"
FT                   /old_locus_tag="SSO_P121"
FT                   /note="SSOP121"
FT   CDS_pept        110830..112365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P121"
FT                   /old_locus_tag="SSO_P121"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P121"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91141"
FT                   /db_xref="GOA:Q3YTM1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM1"
FT                   /protein_id="AAZ91141.1"
FT                   /translation="METCFKILQLKFDKKLTNRCIGLTLHISASTVFEVLARFKASSLS
FT                   WPLPADISHDTLEKLIFPPKDTSASELVMPDMLYFDTEMRKPGVTRQLLWMEYKAQAGD
FT                   KAMGYSHFCRCYRKWKKTRRLSMRQEHRAGEKLFIDFCGPTVPVINPDTGEIRRVAIFV
FT                   AVMGASNYTYVEACEGQDMMSWLNAHSRCLTFLGGVPKLLIPDNLRSAVKKADRYEPVI
FT                   NDSYQALVEHYGTVIIPARPRKPKDKPKAENGVLIVERWLLARIRNETFHTLRALNARL
FT                   RELLTDMNNRPMKGYGNQTRAERFRMLDAPALSPLPLEPYEYTEYKAVKVGPDYHVEYA
FT                   RHWYSVPHELVGQRLSLKVGQSVVQLWHKGQCVAQHPRSTHEYKHTTNPLHMPERHRRH
FT                   GTWTPERLIEQGNRTGPSTGRVVESMLKAKPHPELAYRAVLGLLALQKKYGPERLEKAC
FT                   YVALHYNAPDRRFIDNLLRHHRDNVELPLSRLGEQHPAYASEHENLRGPGYYH"
FT   gene            112382..113137
FT                   /locus_tag="SSON_P122"
FT                   /old_locus_tag="SSO_P122"
FT                   /note="SSOP122"
FT   CDS_pept        112382..113137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P122"
FT                   /old_locus_tag="SSO_P122"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P122"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91142"
FT                   /db_xref="GOA:Q3YTM0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTM0"
FT                   /protein_id="AAZ91142.1"
FT                   /translation="MSDNLLNKLTQLKLPAMAGSLIRQRETPQTYDELSFEERLTLLVD
FT                   DELLSRENSRVARLRKNACLKYQATPEGLRYPASRGLRAEQMRELLNGYYIIHRKNLLI
FT                   TGPTGCGKSWIANALGEQACRQKYSVRYCRTGRLLEQLAQGRVDGSWLKYLKQLQKIQV
FT                   LILDDLGLEQLSNAQCNDLLEITEDRYGQSSTIVVSQFPVDKWHGLMENPTTADAILDR
FT                   LVHNSHRVVLQGESLRKNPPTVESSEKTS"
FT   mobile_element  113251..113503
FT                   /mobile_element_type="insertion sequence:IS600"
FT                   /note="partial"
FT   gene            113272..113460
FT                   /locus_tag="SSON_P123"
FT                   /old_locus_tag="SSO_P123"
FT                   /note="SSOP123"
FT   CDS_pept        113272..113460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P123"
FT                   /old_locus_tag="SSO_P123"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P123"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91143"
FT                   /db_xref="GOA:Q3YTL9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTL9"
FT                   /protein_id="AAZ91143.1"
FT                   /translation="MESFWGTLKNESLSHYRFKSRDEAISVIREYIEIFYNRQRRHSRL
FT                   GNISPAAFRIKYYQMTA"
FT   gene            complement(113457..113840)
FT                   /locus_tag="SSON_P124"
FT                   /old_locus_tag="SSO_P124"
FT                   /note="SSOP124"
FT   CDS_pept        complement(113457..113840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P124"
FT                   /old_locus_tag="SSO_P124"
FT                   /product="IS3 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P124"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91144"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTL8"
FT                   /protein_id="AAZ91144.1"
FT                   /translation="MKYVFIEKHQAEFSIKAMCRVLRVARSGWYTWCQRRTGISPRQQF
FT                   RQHCDSVVLAAAFTRSKQRYGAPRLTDELRAQGYHFNVKTVAASLRRQGLRAKASRKFS
FT                   PVSYRAHGLRCTGNSGHHHLFFF"
FT   mobile_element  complement(113502..114201)
FT                   /mobile_element_type="insertion sequence:IS3"
FT                   /note="partial"
FT   gene            complement(113837..114136)
FT                   /locus_tag="SSON_P125"
FT                   /old_locus_tag="SSO_P125"
FT                   /note="SSOP125"
FT   CDS_pept        complement(113837..114136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P125"
FT                   /old_locus_tag="SSO_P125"
FT                   /product="IS3 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P125"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91145"
FT                   /db_xref="GOA:Q3YTL7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTL7"
FT                   /protein_id="AAZ91145.1"
FT                   /translation="MTKTVSTSKKTRKQHSPEFCSEALKLAERIGVAAAARELSLYESQ
FT                   LYAWRSKLQQQMTSSERESELAAENARLKRQLAEQAEELAILQKAATYFAKRLK"
FT   mobile_element  complement(114799..115024)
FT                   /mobile_element_type="insertion sequence:IS630"
FT                   /note="partial"
FT   gene            complement(115155..115871)
FT                   /locus_tag="SSON_P126"
FT                   /old_locus_tag="SSO_P126"
FT                   /note="SSOP126"
FT   CDS_pept        complement(115155..115871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P126"
FT                   /old_locus_tag="SSO_P126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P126"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91146"
FT                   /db_xref="GOA:Q3YTL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTL6"
FT                   /protein_id="AAZ91146.1"
FT                   /translation="MNDNSLLRNSSLFIAYMGCVGWVSAYSYGWGTSFYYGFPWWVVGA
FT                   GLDDVARSLLYAIIVMGILFTGWGIGILFFLLIKKRSKIQDLSFFRLFFAITLLFFPVI
FT                   FELLILKQYFILPLSLSCIISSLVISIIIRIYGRIFSVSCFSDIPFVREHRIKLIMAGF
FT                   LVYFWLFSFLVGWYKPQLKKEYQMLCYNNSWYYILARYDSRLVLSSSFKDDSNRFLIFN
FT                   TEQSGFYEINDVYVRK"
FT   gene            complement(116456..116656)
FT                   /locus_tag="SSON_P127"
FT                   /old_locus_tag="SSO_P127"
FT                   /note="SSOP127"
FT   CDS_pept        complement(116456..116656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P127"
FT                   /old_locus_tag="SSO_P127"
FT                   /product="putative transposase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P127"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91147"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTL5"
FT                   /protein_id="AAZ91147.1"
FT                   /translation="MCWGRTALYMAALEAPRFNLVIKAFYMRLLAAGNAKKVALVACMR
FT                   KLLTIMNAMLRKNEEWNESYL"
FT   gene            complement(116887..117219)
FT                   /locus_tag="SSON_P128"
FT                   /old_locus_tag="SSO_P128"
FT                   /note="SSOP128"
FT   CDS_pept        complement(116887..117219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P128"
FT                   /old_locus_tag="SSO_P128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P128"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91148"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTL4"
FT                   /protein_id="AAZ91148.1"
FT                   /translation="MKLTSLCWALKELAKDIWSRPWSEERRNDWQRWLSLAANSDVPMM
FT                   KNVAKTIGKRLYGILNAMRHGVSNGNAEALNSKIRLLRIKAKGYRNRERFKLGVMFHYG
FT                   KLNMAF"
FT   mobile_element  117347..118151
FT                   /mobile_element_type="insertion sequence:IS629"
FT                   /note="partial"
FT   gene            117401..117727
FT                   /locus_tag="SSON_P129"
FT                   /old_locus_tag="SSO_P129"
FT                   /note="SSOP129"
FT   CDS_pept        117401..117727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P129"
FT                   /old_locus_tag="SSO_P129"
FT                   /product="IS629 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P129"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91149"
FT                   /db_xref="GOA:Q3YTT2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTT2"
FT                   /protein_id="AAZ91149.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWATICSIAPKIGCTPE
FT                   TLRVRVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            117727..118179
FT                   /locus_tag="SSON_P130"
FT                   /old_locus_tag="SSO_P130"
FT                   /note="SSOP130"
FT   CDS_pept        117727..118179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P130"
FT                   /old_locus_tag="SSO_P130"
FT                   /product="IS629 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P130"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91150"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTL2"
FT                   /protein_id="AAZ91150.1"
FT                   /translation="MPLLDKLREQYGVGPLCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKKEIQRVYDENHKVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTISRKAFAAGDRVNRQFVAERPDQLWVADFTYVSTCVSASDIRR"
FT   mobile_element  118152..120281
FT                   /mobile_element_type="insertion sequence:IS21"
FT   gene            118277..119425
FT                   /locus_tag="SSON_P131"
FT                   /old_locus_tag="SSO_P131"
FT                   /note="SSOP131"
FT   CDS_pept        118277..119425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P131"
FT                   /old_locus_tag="SSO_P131"
FT                   /product="IS21 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P131"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91151"
FT                   /db_xref="GOA:Q3YTL1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTL1"
FT                   /protein_id="AAZ91151.1"
FT                   /translation="MIKQMRQQGAYIVDIATQIGCSERTVRRYLKYPEPPARKTRHKMV
FT                   KLKPFMDYIDMRLAENVWNSEVIFAEIKAMGYTGGRSMLRYYIQPKRKMRPSKRTVRFE
FT                   TQPGYQLQHDWGEVEVEVAGQRCKVNFAVNTLGFSRSFHVFAAPKQDAEHTYESLVRAF
FT                   RYFGGCVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLADHYNFLPRACRPRRARTKGKVE
FT                   RMVKYLKENFFVRYRRFDSFTHVNQQLEQWIADVADKRELRQFKETPEQRFALEQEHLQ
FT                   PLPDTDFDTSYFDIRHVSWDSYIEVGGNRYSVPEALCGQPVSIRISLDDELRIYSNEKL
FT                   VASHRLCSASSGWQTVPEHHAPLWQQVSQVEHRPLSAYEELL"
FT   gene            119425..120222
FT                   /locus_tag="SSON_P132"
FT                   /old_locus_tag="SSO_P132"
FT                   /note="SSOP132"
FT   CDS_pept        119425..120222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P132"
FT                   /old_locus_tag="SSO_P132"
FT                   /product="IS21 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P132"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91152"
FT                   /db_xref="GOA:Q3Z4V9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4V9"
FT                   /protein_id="AAZ91152.1"
FT                   /translation="MHELEVLLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQE
FT                   WNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERSENVILLG
FT                   PPGVGKTHLAIALGVKAVDAGHRVLFMPLDRLIATLMKAKQENRLERQLQQLSYARVLI
FT                   LDEIGYLPMNREEASLFFRLLNRRYEKASIILTSNKGFADWGEMFGDHVLATAILDRLL
FT                   HHSTTLNIKGESYRLKEKRKAGVLTKNTTPISDDEMVESGQHQ"
FT   mobile_element  120280..120790
FT                   /mobile_element_type="insertion sequence:IS629"
FT                   /note="partial"
FT   gene            120320..120748
FT                   /locus_tag="SSON_P133"
FT                   /old_locus_tag="SSO_P133"
FT                   /note="SSOP133"
FT   CDS_pept        120320..120748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P133"
FT                   /old_locus_tag="SSO_P133"
FT                   /product="IS629 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P133"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91153"
FT                   /db_xref="GOA:Q3YTK9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTK9"
FT                   /protein_id="AAZ91153.1"
FT                   /translation="MFAGYIVGWRVSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQ
FT                   YVSLAYTQRLKEAGLLASTGSTGDSYDNAMAESINGLYKAEVIHRKSWKNRAEVELATL
FT                   TWVDWYNNRRLLERLGHTPPAEAEKAYYASIGNDDLAA"
FT   gene            complement(120751..120978)
FT                   /locus_tag="SSON_P134"
FT                   /old_locus_tag="SSO_P134"
FT                   /note="SSOP134"
FT   CDS_pept        complement(120751..120978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P134"
FT                   /old_locus_tag="SSO_P134"
FT                   /product="putative transposase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P134"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91154"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTK8"
FT                   /protein_id="AAZ91154.1"
FT                   /translation="MNKRAFFGAFLIFWGFKFLSMDMNAGYIRAARIHLPNAVEKIAFD
FT                   RFHVAKQPGEVVDKTRQNEPPRVSWRVFYL"
FT   mobile_element  complement(120917..121516)
FT                   /mobile_element_type="insertion sequence:IS91"
FT                   /note="partial"
FT   gene            complement(121226..121582)
FT                   /locus_tag="SSON_P135"
FT                   /old_locus_tag="SSO_P135"
FT                   /note="SSOP135"
FT   CDS_pept        complement(121226..121582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P135"
FT                   /old_locus_tag="SSO_P135"
FT                   /product="IS91 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P135"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91155"
FT                   /db_xref="GOA:Q3YTK7"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTK7"
FT                   /protein_id="AAZ91155.1"
FT                   /translation="MLPRFADIFQQGNRWLNWLEKQPVQMSRLEHYAGQDEIGLRYNSH
FT                   RTKREENLVMSGDEFMERFSWHVADKGFRMVIRGPESGEAAITGRCGVRHNGDSEKNGE
FT                   ANHKERDVSAVTEG"
FT   mobile_element  complement(121513..122035)
FT                   /mobile_element_type="insertion sequence:IS91"
FT                   /note="partial"
FT   gene            complement(121582..122004)
FT                   /locus_tag="SSON_P136"
FT                   /old_locus_tag="SSO_P136"
FT                   /note="SSOP136"
FT   CDS_pept        complement(121582..122004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P136"
FT                   /old_locus_tag="SSO_P136"
FT                   /product="putative IS91 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P136"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91156"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTK6"
FT                   /protein_id="AAZ91156.1"
FT                   /translation="MACDYRYKNRQYHCLSGSYMARSAKPRKRKPAPQRSKLLRYVVKL
FT                   HEDDFFDEEEAEVLRFDNFDDAVECCADLNIPFFVDAGNKKLVFWFVRVDDEGYPEIAR
FT                   CTEREFATIPAGISADGMYCPECGTVHWPDGVIPPF"
FT   gene            complement(122667..122906)
FT                   /locus_tag="SSON_P137"
FT                   /old_locus_tag="SSO_P137"
FT                   /note="SSOP137"
FT   CDS_pept        complement(122667..122906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P137"
FT                   /old_locus_tag="SSO_P137"
FT                   /product="putative reverse transcriptase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P137"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91157"
FT                   /db_xref="GOA:Q3YTK5"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTK5"
FT                   /protein_id="AAZ91157.1"
FT                   /translation="MPQGGVISPLLSNIILNEFDQYLNKRYLSGKARKDRWYWNHSIQR
FT                   GRSTAVKENWQWKPAVAYCCYADDCVPRRRVLGT"
FT   gene            complement(122938..123138)
FT                   /locus_tag="SSON_P138"
FT                   /old_locus_tag="SSO_P138"
FT                   /note="SSOP138"
FT   CDS_pept        complement(122938..123138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P138"
FT                   /old_locus_tag="SSO_P138"
FT                   /product="putative reverse transcriptase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P138"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91158"
FT                   /db_xref="GOA:Q3YTK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTK4"
FT                   /protein_id="AAZ91158.1"
FT                   /translation="MARTRSGRETSRTITAHRLRGNTGRRVIEGDLSSYFDTVHHRLLM
FT                   KAVCRRISDARFMRLLWKTPC"
FT   gene            complement(123053..123295)
FT                   /locus_tag="SSON_P139"
FT                   /old_locus_tag="SSO_P139"
FT                   /note="SSOP139"
FT   CDS_pept        complement(123053..123295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P139"
FT                   /old_locus_tag="SSO_P139"
FT                   /product="IS3 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P139"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91159"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTK3"
FT                   /protein_id="AAZ91159.1"
FT                   /translation="MCSGYHFNVKTVAASLRRQELSAKASQKFSPISYRAHGLPVSENL
FT                   LTQDFYASGPNQKWAGDITYYYSSPTAGKHGAPGY"
FT   mobile_element  complement(123100..123468)
FT                   /mobile_element_type="insertion sequence:IS3"
FT                   /note="partial"
FT   gene            complement(123268..123831)
FT                   /locus_tag="SSON_P140"
FT                   /old_locus_tag="SSO_P140"
FT                   /note="SSOP140"
FT   CDS_pept        complement(123268..123831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P140"
FT                   /old_locus_tag="SSO_P140"
FT                   /product="IS629 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P140"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91160"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTK2"
FT                   /protein_id="AAZ91160.1"
FT                   /translation="MPLLDKLREQYGVGSVCSELHIAPSTYYHCQQQRHHHDKRSARAQ
FT                   RDDWLKKEILRVYDENHQVYAVRKVWHQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   HTTVSRKAVAAGDRVNRHQGNMPRTPGGPQRLVYVVSAADKDKHTSAVPSALRQRCPQG
FT                   FYPVQRYGAPRLTDELCALVTTLT"
FT   mobile_element  complement(123467..124210)
FT                   /mobile_element_type="insertion sequence:IS629"
FT                   /note="partial"
FT   gene            complement(123938..124156)
FT                   /locus_tag="SSON_P141"
FT                   /old_locus_tag="SSO_P141"
FT                   /note="SSOP141"
FT   CDS_pept        complement(123938..124156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P141"
FT                   /old_locus_tag="SSO_P141"
FT                   /product="IS629 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P141"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91161"
FT                   /db_xref="GOA:Q3YTK1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTK1"
FT                   /protein_id="AAZ91161.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKIGCILE
FT                   TLRVWVRQHERDTGGGEVGSPPLNVSV"
FT   gene            complement(124335..125537)
FT                   /gene="virA"
FT                   /locus_tag="SSON_P142"
FT                   /old_locus_tag="SSO_P142"
FT                   /note="SSOP142"
FT   CDS_pept        complement(124335..125537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virA"
FT                   /locus_tag="SSON_P142"
FT                   /old_locus_tag="SSO_P142"
FT                   /product="VirA"
FT                   /note="secreted by the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P142"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91162"
FT                   /db_xref="GOA:Q3YTK0"
FT                   /db_xref="InterPro:IPR009669"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3YTK0"
FT                   /protein_id="AAZ91162.1"
FT                   /translation="MQTSNITNHERNDSSWMSTVKSTTEVSWNKLSFCDVLLKIITFGI
FT                   YSPHETLAEKYSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDG
FT                   DKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCT
FT                   SIIPNDDYFPVKDTDFNSVWHDIYRDIRASNSNSTKIYFNNIEIPLKLIADLINELGIN
FT                   EFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQS
FT                   LHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVVPKNDTAISASGGR
FT                   AYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPD
FT                   V"
FT   gene            126066..129374
FT                   /gene="icsA/virG"
FT                   /locus_tag="SSON_P143"
FT                   /old_locus_tag="SSO_P143"
FT                   /note="SSOP143"
FT   CDS_pept        126066..129374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icsA/virG"
FT                   /locus_tag="SSON_P143"
FT                   /old_locus_tag="SSO_P143"
FT                   /product="IcsA/VirG"
FT                   /note="outermembrane protein exposed to the bacterial
FT                   surface by a C-terminal autotransporter domain and involved
FT                   in the movement of intracellular bacteria by binding to
FT                   N-WASP"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P143"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91163"
FT                   /db_xref="GOA:Q3YTJ9"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ9"
FT                   /protein_id="AAZ91163.1"
FT                   /translation="MNQIHKFFCNMTQCSQGGAGELPTVKEKTCKLSFSPFVVGASLLL
FT                   GGPIAFAIPLSGTQELHFSEDNYEKLLTPVDGLSPLGAGEDGMDAWYITSSNPSHASRT
FT                   KLRINSDIMISAGHGGAGDNNDGNSCGGNGGDSITGSDLSIINQGMILGGNGGSGADHN
FT                   GDGGEAVTGDNLFIINGEIISGGHGGDSYSDSDGGNGGDAVTGVNLPIINKGTISGGNG
FT                   GNNYGEGDGGNGGDAITGSSLSVINKGTFAGGNGGAAYGYGYDGYGGNAITGDNLSIIN
FT                   NGAILGGNGGHWGDAINGSNMTIANSGYIISGKEDDGTQNVVGNAIHITGGNNSLILHE
FT                   GSVITGDVQVNNSSILKIINNDYTGTTPTIEGDLCAGDCTTVSLSGNKFTVSGDVSFGE
FT                   NSSLNLAGISSLEASGNMSFGNNVKVEAIINNWAQKDYKLLSADKGITGFSVSNISIIN
FT                   PLLTTGAIDYTKSYISDQNKLIYGLSWNDTDGDSHGEFNLKENAELTVSTILADNLSHH
FT                   NINSWDGKSLTKSGEGTLILAEKNTYSGFTNINAGILKMGTVEAMTRTAGVIVNKGATL
FT                   NFSGMNQTVNTLLNSGTVLINNINAPFLPDPVIVTGNMTLEKNGHVILNNSSSNVGQTY
FT                   VQKGNWHGKGGILSLGAVLGNDNSKTDRLEIAGHASGITYVAVTNEGGSGDKTLEGVQI
FT                   ISTDSSDKNAFIQKGRIVAGSYDYRLKQGTVSGLNTNKWYLTSQMDNQESKQMSNQEST
FT                   QMSSRRASSQLVSSLNLGEGSIHTWRPEAGSYIANLIAMNTMFSPSLYDRHGSTIVDPT
FT                   TGQLSETTMWIRTVGGHNEHNLADRQLKTTANRMVYQIGGDILKTNFTDHDGLHVGIMG
FT                   AYGYQDSKTHNKYTSYSSRGTVSGYTAGLYSSWFQNEKERTGLYMDAWLQYGWFNNTVK
FT                   GDGLTGEKYSSKGITGALEAGYIYPTIRWTAHNNIDNALYLNPQVQITRHGVKANDYIE
FT                   HNGTMVTSSGVNNIQAKLGLRTSLISQSCIDKETLRKFEPFLEVNWKWSSKQYGVIMNG
FT                   MSNHQIGNRNVIELKTGVGGRLADNLSIWGNVSQQLGNNSYRDTQGILGVKYTF"
FT   gene            129560..129817
FT                   /locus_tag="SSON_P144"
FT                   /old_locus_tag="SSO_P144"
FT                   /note="SSOP144"
FT   CDS_pept        129560..129817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P144"
FT                   /old_locus_tag="SSO_P144"
FT                   /product="adhesion protein, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P144"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91164"
FT                   /db_xref="GOA:Q3YTJ8"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ8"
FT                   /protein_id="AAZ91164.1"
FT                   /translation="MLPPNIRGYAPQITGIAETNARVVVSQQGRVIYDSTVPAGTFSIQ
FT                   DLSSSVRGILDVEIFEQNGKRKHFQVEMCRCAFLIQTWSE"
FT   mobile_element  129955..131254
FT                   /mobile_element_type="insertion sequence:IS629"
FT   gene            130009..130335
FT                   /locus_tag="SSON_P145"
FT                   /old_locus_tag="SSO_P145"
FT                   /note="SSOP145"
FT   CDS_pept        130009..130335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P145"
FT                   /old_locus_tag="SSO_P145"
FT                   /product="IS629 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P145"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91165"
FT                   /db_xref="GOA:Q3YTJ7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ7"
FT                   /protein_id="AAZ91165.1"
FT                   /translation="MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            130607..131212
FT                   /locus_tag="SSON_P146"
FT                   /old_locus_tag="SSO_P146"
FT                   /note="SSOP146"
FT   CDS_pept        130607..131212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P146"
FT                   /old_locus_tag="SSO_P146"
FT                   /product="IS629 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P146"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91166"
FT                   /db_xref="GOA:Q3YTJ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ6"
FT                   /protein_id="AAZ91166.1"
FT                   /translation="MGLAGVLRGKKVRTTISRKAVAAGDRVNRQFVAERPDQLWVADFT
FT                   YVSTWQGFVYVAFIIDVFAGYIVGWRVSSSMETTFVLDALEQALWARRPSGTVHHSDKG
FT                   SQYVSYTQRLKEAGLLASTGSTGDSYDNAMAESINGLYKAEVIHRKSWKNRAEVELATL
FT                   TWVDWYNNRRLLERLGHIPPAEAEKAYYASIGNDDLAA"
FT   gene            131553..133205
FT                   /gene="ushA"
FT                   /locus_tag="SSON_P147"
FT                   /old_locus_tag="SSO_P147"
FT                   /note="SSOP147"
FT   CDS_pept        131553..133205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="SSON_P147"
FT                   /old_locus_tag="SSO_P147"
FT                   /product="UshA"
FT                   /note="probable periplasmic UDP-sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P147"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91167"
FT                   /db_xref="GOA:Q3YTJ5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ5"
FT                   /protein_id="AAZ91167.1"
FT                   /translation="MIPLKKNITLIMFTLSLLTGNPAIAYETDKVYKITVLHTNDHHGH
FT                   FWRNNHGEYGLSSQKTLVDNIRQKVINNGGSVLLLSGGDINTGVPESDLQKAEPDIRGM
FT                   NLIGYDAMAVGNHEFDNPLNILRQQEKWATFPFLSANIYQKSTGRRLFSPWKIFIRQNL
FT                   KIAVIGLTTDDTAKTGNSEYFTDIEFRQPAAEARSVIDELNQQEKPDIIIAATHMGHYD
FT                   NGESGSNAPGDVEMARSLPTGSLAMIVGGHSQAPVCMASDNKKQWNYIPGTTCVPDKQN
FT                   GIWIVQAHEWGKYVGQADFEFCNGTMKLVNYQLHPVNLKMRITREDGKTEFSFYTPEIT
FT                   EDPQMLSLLTPFQNKGKAQLDVKVGVVNGRLEGDRSKVRFVQTSMGHLILSALTERIDA
FT                   DFAVVSGGEIRDSIESGNITYKDILKVQPFGNTVVSIDLTGKEVADYLATVAQMKPDSG
FT                   AYPQFLNTSFVVKKGKIEMLKIKGKSVDLNKKYRMTTFSFNATGGDGYPRIDNRPGYIN
FT                   TGFIDAEVLIEYIREHSPLDAASYEPKGEVSWQ"
FT   gene            133174..133359
FT                   /locus_tag="SSON_P148"
FT                   /old_locus_tag="SSO_P148"
FT                   /note="SSOP148"
FT   CDS_pept        133174..133359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P148"
FT                   /old_locus_tag="SSO_P148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P148"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91168"
FT                   /db_xref="GOA:Q3YTJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ4"
FT                   /protein_id="AAZ91168.1"
FT                   /translation="MNQKVKSVGSDNVIDDHHVFFADSRCDFVKVVSADVCDMGMQLLY
FT                   FVFLLLPVVAEFNLAA"
FT   gene            complement(133712..134239)
FT                   /locus_tag="SSON_P149"
FT                   /old_locus_tag="SSO_P149"
FT                   /note="SSOP149"
FT   CDS_pept        complement(133712..134239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P149"
FT                   /old_locus_tag="SSO_P149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P149"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91169"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ3"
FT                   /protein_id="AAZ91169.1"
FT                   /translation="MSDATRLKNRLSVRFSEVGLVLNAGKTNIAYIDTFKRRNVATSFS
FT                   FLGYDFKVRTLKNFKGELYRKCMPGASNAAMCKITETIKKWRIHRSTAESLLDFARRYN
FT                   AIVRGWIEYYGKFWSRNFSYRLWSAMQSRLLKWMQSKYRLSNRKAQRKLALVRKQYPKL
FT                   FAHWYLLRASNE"
FT   gene            complement(134323..134568)
FT                   /locus_tag="SSON_P150"
FT                   /old_locus_tag="SSO_P150"
FT                   /note="SSOP150"
FT   CDS_pept        complement(134323..134568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P150"
FT                   /old_locus_tag="SSO_P150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P150"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91170"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ2"
FT                   /protein_id="AAZ91170.1"
FT                   /translation="MFNAKIRGWIKYYGAFYKSALYLTLRQIDRKLVLWLPRKHKRLRG
FT                   HRRRASHWLARVARSETRLFAHWPLLWGQASMRRAG"
FT   gene            complement(134538..135665)
FT                   /locus_tag="SSON_P151"
FT                   /old_locus_tag="SSO_P151"
FT                   /note="SSOP151"
FT   CDS_pept        complement(134538..135665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P151"
FT                   /old_locus_tag="SSO_P151"
FT                   /product="putative reverse transcriptase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P151"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91171"
FT                   /db_xref="GOA:Q3YTJ1"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ1"
FT                   /protein_id="AAZ91171.1"
FT                   /translation="MKDRNGSGAKGLPHCADGAAATTGDNADGRTAVKSAKPFPVSKRQ
FT                   VWEAYKRVKANRGAAGIDGQTLAGFDENVTDNLYKLWNRMASGSYMPQAVRRVDIPKAD
FT                   GGVRPLGIPAVSDRIAQMVVKQILEPVLEPLFHADSYGYRPGKSAHQAIAQARKRCWKF
FT                   DWVVEVDIKGFFDDIDHDLLLKTVQHHTQARWVVMYIERRLKAPVQMPDGAMLARGRGT
FT                   PQGGVISPLLSNLFLHYAFDMWMQRQFPGVPFERYADDVVCHCHSQWQADALISGLRQR
FT                   LAQCGLQLHPQKTRIVYCKDADRRGDYPETSFDFLGYTFRPRLSMNRWGKTFVNFSPAM
FT                   SARAGKAIRQEVRRIAVTSPCTSWRICSMRKSEAG"
FT   gene            complement(135678..135878)
FT                   /locus_tag="SSON_P152"
FT                   /old_locus_tag="SSO_P152"
FT                   /note="SSOP152"
FT   CDS_pept        complement(135678..135878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P152"
FT                   /old_locus_tag="SSO_P152"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P152"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91172"
FT                   /db_xref="GOA:Q3YTJ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTJ0"
FT                   /protein_id="AAZ91172.1"
FT                   /translation="MVLRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQFGLKTSMSRKGN
FT                   CYDNAPMESFWGTLKNGTGTE"
FT   mobile_element  complement(135695..135898)
FT                   /mobile_element_type="insertion sequence:IS600"
FT                   /note="partial"
FT   mobile_element  complement(136009..137339)
FT                   /mobile_element_type="insertion sequence:IS2"
FT   gene            complement(136020..136859)
FT                   /locus_tag="SSON_P153"
FT                   /old_locus_tag="SSO_P153"
FT                   /note="SSOP153"
FT   CDS_pept        complement(136020..136859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P153"
FT                   /old_locus_tag="SSO_P153"
FT                   /product="IS2 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P153"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91173"
FT                   /db_xref="GOA:Q3Z5M1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5M1"
FT                   /protein_id="AAZ91173.1"
FT                   /translation="MSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYG
FT                   YRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRVAVKESN
FT                   QRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFG
FT                   NDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDY
FT                   ISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLEI"
FT   gene            complement(136883..137248)
FT                   /locus_tag="SSON_P154"
FT                   /old_locus_tag="SSO_P154"
FT                   /note="SSOP154"
FT   CDS_pept        complement(136883..137248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P154"
FT                   /old_locus_tag="SSO_P154"
FT                   /product="IS2 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P154"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91174"
FT                   /db_xref="GOA:Q3Z544"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z544"
FT                   /protein_id="AAZ91174.1"
FT                   /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQ
FT                   LFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYG
FT                   RAKKWIAHAPLLPGDGE"
FT   mobile_element  complement(137343..137557)
FT                   /mobile_element_type="insertion sequence:IS2"
FT                   /note="partial"
FT   gene            complement(137447..137665)
FT                   /locus_tag="SSON_P155"
FT                   /old_locus_tag="SSO_P155"
FT                   /note="SSOP155"
FT   CDS_pept        complement(137447..137665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P155"
FT                   /old_locus_tag="SSO_P155"
FT                   /product="putative IS orf, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P155"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91175"
FT                   /db_xref="GOA:Q3YTI7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTI7"
FT                   /protein_id="AAZ91175.1"
FT                   /translation="MYLKIRDRLGYMSNTSSNFEMTGTLLGLELRKRKTPQEKIAIIQQ
FT                   TMEPGMTVSHVARLHGIQPSLLLKWKK"
FT   gene            complement(137720..138358)
FT                   /locus_tag="SSON_P156"
FT                   /old_locus_tag="SSO_P156"
FT                   /note="SSOP156"
FT   CDS_pept        complement(137720..138358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P156"
FT                   /old_locus_tag="SSO_P156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P156"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91176"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTI6"
FT                   /protein_id="AAZ91176.1"
FT                   /translation="MINGVSLQGTAGYEAHTEEGNVNVKKLLESLNSKSLGDMDKDSEL
FT                   AATLQKMINPSGGDGNCSGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDS
FT                   EGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQT
FT                   GKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC"
FT   mobile_element  complement(138517..138879)
FT                   /mobile_element_type="insertion sequence:iso-IS1"
FT                   /note="partial"
FT   mobile_element  139309..139519
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="partial"
FT   gene            139323..139556
FT                   /locus_tag="SSON_P157"
FT                   /old_locus_tag="SSO_P157"
FT                   /note="SSOP157"
FT   CDS_pept        139323..139556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P157"
FT                   /old_locus_tag="SSO_P157"
FT                   /product="IS100 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P157"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91177"
FT                   /db_xref="GOA:Q3YTI5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTI5"
FT                   /protein_id="AAZ91177.1"
FT                   /translation="MLHEEKLARHQRKQAMYTRMVAFPAVKMFEEYDFTFATGAPQKQL
FT                   QSLRSLSFIERNENIVLQGTSDITNPRVGICV"
FT   gene            complement(139608..139898)
FT                   /locus_tag="SSON_P158"
FT                   /old_locus_tag="SSO_P158"
FT                   /note="SSOP158"
FT   CDS_pept        complement(139608..139898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P158"
FT                   /old_locus_tag="SSO_P158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P158"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91178"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTI4"
FT                   /protein_id="AAZ91178.1"
FT                   /translation="MNAHWSSKKSNFFRKKIKLLTKYLFFESQGIPDKVDIVSRLKTYG
FT                   YSISGVETDDGYKALVRAFQLHFRQKNYDGIMDAETAAILYALLEKYFPGK"
FT   gene            complement(139867..140118)
FT                   /locus_tag="SSON_P159"
FT                   /old_locus_tag="SSO_P159"
FT                   /note="SSOP159"
FT   CDS_pept        complement(139867..140118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P159"
FT                   /old_locus_tag="SSO_P159"
FT                   /product="sugar phosphate transport protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P159"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91179"
FT                   /db_xref="GOA:Q3YTI3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTI3"
FT                   /protein_id="AAZ91179.1"
FT                   /translation="MEPVYVILNALLDSGRFTRKLILLGLSGSFSYIFGSIVATLGMGL
FT                   VVDYLGWGATFIVLILSAVFAIIFTLMSRERSLEFEKE"
FT   mobile_element  140569..141336
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            140818..141321
FT                   /gene="insB"
FT                   /locus_tag="SSON_P160"
FT                   /old_locus_tag="SSO_P160"
FT                   /note="SSOP160"
FT   CDS_pept        140818..141321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SSON_P160"
FT                   /old_locus_tag="SSO_P160"
FT                   /product="IS1 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P160"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91180"
FT                   /db_xref="GOA:Q3Z5Z0"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Z0"
FT                   /protein_id="AAZ91180.1"
FT                   /translation="MPGNCTHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            141439..141912
FT                   /locus_tag="SSON_P161"
FT                   /old_locus_tag="SSO_P161"
FT                   /note="SSOP161"
FT   CDS_pept        141439..141912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P161"
FT                   /old_locus_tag="SSO_P161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P161"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91181"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTI1"
FT                   /protein_id="AAZ91181.1"
FT                   /translation="MVGVAGAALAPLVKLLRHELLTRDVIHADETSLRLLDTRKGGKSC
FT                   SGWLCAYVSGERSGPPVVCFDSQTGRALRYPETWLQCWCGGTLVSDGYSVYKSLADNHP
FT                   GITSACCWSHAGRGFANLYKASREPRAGVELRKIAGLYRIEKLIRERCQRHDV"
FT   mobile_element  complement(141892..143866)
FT                   /mobile_element_type="insertion sequence:IS21"
FT                   /note="partial"
FT   gene            complement(141951..142748)
FT                   /locus_tag="SSON_P162"
FT                   /old_locus_tag="SSO_P162"
FT                   /note="SSOP162"
FT   CDS_pept        complement(141951..142748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P162"
FT                   /old_locus_tag="SSO_P162"
FT                   /product="IS21 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P162"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91182"
FT                   /db_xref="GOA:Q3YTI0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTI0"
FT                   /protein_id="AAZ91182.1"
FT                   /translation="MHELEVLLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQE
FT                   WNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERSENVILLG
FT                   PPGVGKTHLAIALGVKAVDAGHRVLFMPLDRLIATLMKAKQENRLERQLQQLSYARVLI
FT                   LDEIGYLPMNREEASLFFRLLNRRYEKASIMLTSNKGFADWGEMFGDHVLATAILDRLL
FT                   HHSTTLNIKGESYRLKEKRKAGVLTKNTTPISDDEMVESGQHQ"
FT   gene            complement(142748..143674)
FT                   /locus_tag="SSON_P163"
FT                   /old_locus_tag="SSO_P163"
FT                   /note="SSOP163"
FT   CDS_pept        complement(142748..143674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P163"
FT                   /old_locus_tag="SSO_P163"
FT                   /product="IS21 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P163"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91183"
FT                   /db_xref="GOA:Q3YTH9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTH9"
FT                   /protein_id="AAZ91183.1"
FT                   /translation="MGYTGGRSMLRYYIQPKRKMRPSKRTVRFETQPGYQLQHDWGEVE
FT                   VEVAGQRCKVNFAVNTLGFSRSFHVFAAPKQDAEHTYESLVRAFRYFGGCVKTVLVDNQ
FT                   KAAVLKNNNGKVVFNSGFLLLADHYNFLPRACRPRRARTKGKVERMVKYLKENFFVRYR
FT                   RFDSFTHVNQQLEQWIADVADKRELRQFKETPEQRFALEQEHLQPLPDTDFDTSYFDIR
FT                   HVSWDSYIEVGGNRYSVPEALCGQPVSIRISLDDELRIYSNEKLVASHRLCSASSGWQT
FT                   VPEHHAPLWQQVSQVEHRPLSAYEELL"
FT   mobile_element  143867..145130
FT                   /mobile_element_type="insertion sequence:IS600"
FT   gene            143931..144233
FT                   /locus_tag="SSON_P164"
FT                   /old_locus_tag="SSO_P164"
FT                   /note="SSOP164"
FT   CDS_pept        143931..144233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P164"
FT                   /old_locus_tag="SSO_P164"
FT                   /product="IS600 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P164"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91184"
FT                   /db_xref="GOA:Q3Z5X1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5X1"
FT                   /protein_id="AAZ91184.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   gene            144374..145087
FT                   /locus_tag="SSON_P165"
FT                   /old_locus_tag="SSO_P165"
FT                   /note="SSOP165"
FT   CDS_pept        144374..145087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P165"
FT                   /old_locus_tag="SSO_P165"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P165"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91185"
FT                   /db_xref="GOA:Q3Z2H7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z2H7"
FT                   /protein_id="AAZ91185.1"
FT                   /translation="MAHIRTRETYGTRRLQTELAENGIIVGRDRLARLRKELRLRCKQK
FT                   RKFRATTNSNHNLPVAPNLLNQTFTPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGN
FT                   ISPAAFREKYHQMAA"
FT   mobile_element  complement(145131..145288)
FT                   /mobile_element_type="insertion sequence:IS21"
FT                   /note="partial"
FT   gene            145341..145595
FT                   /locus_tag="SSON_P166"
FT                   /old_locus_tag="SSO_P166"
FT                   /note="SSOP166"
FT   CDS_pept        145341..145595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P166"
FT                   /old_locus_tag="SSO_P166"
FT                   /product="putative IS orf, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P166"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91186"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTH6"
FT                   /protein_id="AAZ91186.1"
FT                   /translation="MNDLFAWLEEQEPCCPPDGPLNKAINYILNRRDELSCFLGDGAVP
FT                   LDNNICERAIRPVVMGRKAWLFAGSLMAGNRAAQIMSLL"
FT   gene            146464..148101
FT                   /gene="ipaH9.8"
FT                   /locus_tag="SSON_P167"
FT                   /old_locus_tag="SSO_P167"
FT                   /note="SSOP167"
FT   CDS_pept        146464..148101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipaH9.8"
FT                   /locus_tag="SSON_P167"
FT                   /old_locus_tag="SSO_P167"
FT                   /product="invasion plasmid antigen"
FT                   /note="secreted by the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P167"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91187"
FT                   /db_xref="GOA:Q3YTH5"
FT                   /db_xref="InterPro:IPR029487"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3YTH5"
FT                   /protein_id="AAZ91187.1"
FT                   /translation="MLPINNNFSLPQNSFYNTISGTYADYFSAWDKWEKQALPGEERDE
FT                   AVSRLKECLINNSDELRLDRLNLSSLPDNLPAQITLLNVSYNQLTNLPELPVTLKKLYS
FT                   ASNKLSELPVLPPALESLQVQHNELENLPALPDSLLTMNISYNEIVSLPSLPQALKNLR
FT                   ATRNFLTELPAFSEGNNPVVREYFFDRNQISHIPESILNLRNECSIHISDNPLSSHALQ
FT                   ALQRLTSSPDYHGPRIYFSMSDGQQNTLHRPLADAVTAWFPENKQSDVSQIWHAFEHEE
FT                   HANTFSAFLDRLSDTVSARNTSGFREQVAAWLEKLSASAELRQQSFAVAADATESCEDR
FT                   VALTWNNLRKTLLVHQASEGLFDNDTGALLSLGREMFRLEILEDIARDKVRTLHFVDEI
FT                   EVYLAFQTMLAEKLQLSTAVKEMRFYGVSGVTANDLRTAEAMVRSREENEFTDWFSLWG
FT                   PWHAVLKRTEADRWAQAEEQKYEMLENEYSQRVADRLKASGLSGDADAEREAGAQVMRE
FT                   TEQQIYRQLTDEVLALRLSENGSQLHHS"
FT   gene            148309..148578
FT                   /locus_tag="SSON_P168"
FT                   /old_locus_tag="SSO_P168"
FT                   /note="SSOP168"
FT   CDS_pept        148309..148578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P168"
FT                   /old_locus_tag="SSO_P168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P168"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91188"
FT                   /db_xref="GOA:Q3YTH4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTH4"
FT                   /protein_id="AAZ91188.1"
FT                   /translation="MAQVNMSVRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQH
FT                   NSWFRDQVAAGRQQLECGDVLPHDMVESSAAAWRDEMSRKIADK"
FT   gene            148652..148801
FT                   /gene="yacB"
FT                   /locus_tag="SSON_P169"
FT                   /old_locus_tag="SSO_P169"
FT                   /note="SSOP169"
FT   CDS_pept        148652..148801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacB"
FT                   /locus_tag="SSON_P169"
FT                   /old_locus_tag="SSO_P169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P169"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91189"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTH3"
FT                   /protein_id="AAZ91189.1"
FT                   /translation="MAAIEPDERIGYSASSLAGQPYKGRNGRVEGTSGPHKVACNVILC
FT                   ENLL"
FT   gene            148830..149420
FT                   /gene="ospG"
FT                   /locus_tag="SSON_P170"
FT                   /old_locus_tag="SSO_P170"
FT                   /note="SSOP170"
FT   CDS_pept        148830..149420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ospG"
FT                   /locus_tag="SSON_P170"
FT                   /old_locus_tag="SSO_P170"
FT                   /product="OspG"
FT                   /note="secreted by the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P170"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91190"
FT                   /db_xref="GOA:Q3YTH2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PDB:4Q5E"
FT                   /db_xref="PDB:4Q5H"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3YTH2"
FT                   /protein_id="AAZ91190.1"
FT                   /translation="MKITSTIIQTPFPFENNNSHAGIVTEPILGKLIGQGSTAEIFEDV
FT                   NDSSALYKKYDLIGNQYNEILEMAWQESELFNAFYGDEASVVIQYGGDVYLRMLRVPGT
FT                   PLSDIDTADIPDNIESLYLQLICKLNELSIIHYDLNTGNMLYDKESESLFPIDFRNIYA
FT                   EYYAATKKDKEIIDRRLQMRTNDFYSLLNRKYL"
FT   gene            complement(149488..149667)
FT                   /gene="mob9"
FT                   /locus_tag="SSON_P171"
FT                   /old_locus_tag="SSO_P171"
FT                   /note="SSOP171"
FT   CDS_pept        complement(149488..149667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mob9"
FT                   /locus_tag="SSON_P171"
FT                   /old_locus_tag="SSO_P171"
FT                   /product="plasmid mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P171"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91191"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTH1"
FT                   /protein_id="AAZ91191.1"
FT                   /translation="MSLAGNPCVIRLAAQVCMWLKFIIRDRGGFSGGLLLFLPVCCRDR
FT                   TERILAVHTIKILR"
FT   gene            149825..150067
FT                   /locus_tag="SSON_P172"
FT                   /old_locus_tag="SSO_P172"
FT                   /note="SSOP172"
FT   CDS_pept        149825..150067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P172"
FT                   /old_locus_tag="SSO_P172"
FT                   /product="putative IS orf"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P172"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91192"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTH0"
FT                   /protein_id="AAZ91192.1"
FT                   /translation="MAGRRLGVPKSTVCGMFVRFRNAGLSWPLPAGMSEQELDALLYGS
FT                   ASTVPVVLTESTVMPKLPVVKKRPRRPNADQLRIS"
FT   mobile_element  150040..151465
FT                   /mobile_element_type="insertion sequence:IS4"
FT   gene            150124..151452
FT                   /locus_tag="SSON_P173"
FT                   /old_locus_tag="SSO_P173"
FT                   /note="SSOP173"
FT   CDS_pept        150124..151452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P173"
FT                   /old_locus_tag="SSO_P173"
FT                   /product="IS4 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P173"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91193"
FT                   /db_xref="GOA:Q3YTG9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTG9"
FT                   /protein_id="AAZ91193.1"
FT                   /translation="MHIGQALDLVSRYDSLRNPLTSLGDYLDPELISRCLAESGTVTLR
FT                   KRRLPLEMMVWCIVGMALERKEPLHQIVNRLDIMLPGNRPFVAPSAVIQARQRLGSEAV
FT                   RRVFTKTAQLWHNATPHPHWCGLTLLAIDGVFWRTPDTPENDAAFPRQTHAGNPALYPQ
FT                   VKMVCQMELTSHLLTAAAFGTMKNSENELAEQLIEQTGDNTLTLMDKGYYSLGLLNAWS
FT                   LAGEHRHWMIPLRKGAQYEELRKLGKGDHLVKLKTSPQARKKWPGLGNEVTARLLTVTR
FT                   KGKVCHLLTSMTDAMRFPGGEMADLYSHRWEIELGYREIKQTMQLSRLTLRSKKPELVE
FT                   QELWGVLLAYNLVRYQMIKMAEHLKGYWPNQLSFSESCGMVMRMLMTLQGASPGRIPEL
FT                   MRDLASMGQLVKLPTRRERAFPRVVKERPWKYPTAPKKSQSVA"
FT   gene            complement(151463..151705)
FT                   /locus_tag="SSON_P174"
FT                   /old_locus_tag="SSO_P174"
FT                   /note="SSOP174"
FT   CDS_pept        complement(151463..151705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P174"
FT                   /old_locus_tag="SSO_P174"
FT                   /product="putative IS orf"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P174"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91194"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTG8"
FT                   /protein_id="AAZ91194.1"
FT                   /translation="MLTELLTRAYPCPPLTPRSTVCGLFARFRKSGLSWPLPAGMSEQE
FT                   LDALLYGSASTVPVVLTESTVMPKLPVVKKRPRRP"
FT   mobile_element  151652..151980
FT                   /mobile_element_type="insertion sequence:IS3"
FT                   /note="partial"
FT   gene            151803..152021
FT                   /locus_tag="SSON_P175"
FT                   /old_locus_tag="SSO_P175"
FT                   /note="SSOP175"
FT   CDS_pept        151803..152021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P175"
FT                   /old_locus_tag="SSO_P175"
FT                   /product="IS3 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P175"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91195"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTG7"
FT                   /protein_id="AAZ91195.1"
FT                   /translation="MAASLRRQGLRAKASRKFSPVSYRAHGLPVSENLLEQDFYASGPN
FT                   QKWAGDITYLRTDEVRLHPVSTEPHAF"
FT   gene            complement(152009..154921)
FT                   /locus_tag="SSON_P176"
FT                   /old_locus_tag="SSO_P176"
FT                   /note="SSOP176"
FT   CDS_pept        complement(152009..154921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P176"
FT                   /old_locus_tag="SSO_P176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P176"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91196"
FT                   /db_xref="GOA:Q3YTG6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR027351"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTG6"
FT                   /protein_id="AAZ91196.1"
FT                   /translation="MFSKAFLRKISMFFARRKPAAMKICLYHTLNPDTIPGYKKFAQAI
FT                   ATDNFVQADVRKIDTNLYRARLSIRDRLLFSLYRYHGETICLVLEYIRNHAYNTSRFLR
FT                   RNVVIDEGRLQQQPVPDPVDIATEALTYINPSHGRFHRLDKMLSFDDDQQALYEHPLPL
FT                   VIVGSAGSGKTALVLEKMKQAAGDILYLSLSSFLVEKARTLYDASGEGSEVQNIDFLSL
FT                   TEFLETLRIPKGREVTFSAFSDWLPRNRAIAALGAAHTLYEEFRGVIGAVASGNGPLSR
FT                   EAYLSLGIRQSLYGMEDRPTVYVLFERYIAWLKQSHQYDSNLLSHQYLSLATPRYDVIF
FT                   VDEVQDMTPVQLQLVLKTLRHPGQFLLCGDANQIVHPSFFSWSSLKSLFFRQQQGNDTT
FT                   VNILQANYRNGHHVTALANRLLRLKQVRFSAIDRESHHFVRSCGQAEGTIRLLDDREET
FT                   KQELNAKTSLSNRVAVIVMHPEQKAQARCWFSTPLVFSVQEVKGLEYETVILYNIVSAA
FT                   RQAFDDICEGLTPADLEGEARYSRPRDRQDRSAEIYKFFTNALYVALTRATHNVYLVEQ
FT                   QVEHPLWSLLALTHQEEPLNLQEEISSRDEWQKTAHLLEKQGKQEQADTIRSRILQTSE
FT                   MPWQIITAEDARQWKQHILAGTADKTIQLQALEYSLIYSLFPLYNALYREDFKPTRQPR
FT                   TKTLQLLELKYFRPYSMNNPVAVLRDIERYGVDHRSPFNLTPLMSAARAGNIALVQLLL
FT                   ERGADPLLTGNDGLAAYHQVLSAAVSTPRYAQQKSAQLYTLLKPESLSLQVEGRLIKLD
FT                   NRQMAMFLVILMQALFHTHLGSALFFSEAFSAARLAECVVHLPEALLPERRKRRSYISS
FT                   QLSQHEVNSKNPYGKKLFLRLNHGQYILNPGLKIRQGDVWRAVYELQSPEDLGHDLQTY
FT                   LQDMSPELVDMLGGKKGFYERSEKSVGYWVGGIRRAAQKA"
FT   mobile_element  155180..156443
FT                   /mobile_element_type="insertion sequence:IS600"
FT   gene            155244..155546
FT                   /locus_tag="SSON_P177"
FT                   /old_locus_tag="SSO_P177"
FT                   /note="SSOP177"
FT   CDS_pept        155244..155546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P177"
FT                   /old_locus_tag="SSO_P177"
FT                   /product="IS600 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P177"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91197"
FT                   /db_xref="GOA:Q3Z588"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z588"
FT                   /protein_id="AAZ91197.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVPENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   gene            155687..156400
FT                   /locus_tag="SSON_P178"
FT                   /old_locus_tag="SSO_P178"
FT                   /note="SSOP178"
FT   CDS_pept        155687..156400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P178"
FT                   /old_locus_tag="SSO_P178"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P178"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91198"
FT                   /db_xref="GOA:Q3Z2P9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z2P9"
FT                   /protein_id="AAZ91198.1"
FT                   /translation="MAHIRTRETYGTRRLQTELAENGIIVGRDRLARLRKELRLRCKQK
FT                   RKFRATTNSNHNLPVAPNLLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQFGLKTS
FT                   MSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGN
FT                   ISPAAFREKYHQMAA"
FT   gene            156722..157513
FT                   /locus_tag="SSON_P179"
FT                   /old_locus_tag="SSO_P179"
FT                   /note="SSOP179"
FT   CDS_pept        156722..157513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P179"
FT                   /old_locus_tag="SSO_P179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P179"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91199"
FT                   /db_xref="GOA:Q3YTG3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTG3"
FT                   /protein_id="AAZ91199.1"
FT                   /translation="MYHHVSHCPGLVTLSPVTFRKQMKWLAENNWKTLSSDELEFFYRG
FT                   GKLPRKSVMLTFDDGYLDNWFQVYPLLKEFNLKAHIFLITGFIGNGPVRHSPGKEYSHR
FT                   DCEHQIATGNADNVMLRWSEVNEMLQSGLVEFHVHTHTHTRWDKKFSSREEQCKHLRQD
FT                   LLSGREYLKEMTGKCSKHLCWPEGYYNKDYIQVAEELGFYYLYTTERRMNAPAKGTTRI
FT                   GRISTKERESCAWLKRRLFYYTTPFFSSLLAFHKGPRLPDD"
FT   gene            157516..158604
FT                   /locus_tag="SSON_P180"
FT                   /old_locus_tag="SSO_P180"
FT                   /note="SSOP180"
FT   CDS_pept        157516..158604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P180"
FT                   /old_locus_tag="SSO_P180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P180"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91200"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTG2"
FT                   /protein_id="AAZ91200.1"
FT                   /translation="MNILFTESSPNIGGQELQAVAQMKALKKMGHSVLLVCRENSKIAF
FT                   EASKLGIDITFALFRNSLHIPTAWRLLGIVHGFQPNAIVCHSGHDSNIVGLVRLFTWKH
FT                   PFRIIRQKTYLTRKTKVFSINHFCDEVIVPGTSMKTHLEQEGCRTRVTVVPPGFDFQKL
FT                   YVDSRNSLPPNVLSWLASRRGCPVIAQVGMLRPEKGHEFMLNLLFHLKMNGRQFCWLIV
FT                   GSGSPELREHLQYQIDSMGMHDDVFIADNVFPAAPVYRVASLVVLPSENESFGMVLAEA
FT                   SAFSVPVLASQIGGIPDVIQNNQTGTLLPAGNKHAWMCALNDFFNDPGRFYQMARQAKQ
FT                   DIEERFDINKTALKILTLAKHK"
FT   gene            158609..159559
FT                   /gene="virK"
FT                   /locus_tag="SSON_P181"
FT                   /old_locus_tag="SSO_P181"
FT                   /note="SSOP181"
FT   CDS_pept        158609..159559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virK"
FT                   /locus_tag="SSON_P181"
FT                   /old_locus_tag="SSO_P181"
FT                   /product="VirK"
FT                   /note="required for proper localization of IcsA (VirG) at
FT                   the surface of bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P181"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91201"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTG1"
FT                   /protein_id="AAZ91201.1"
FT                   /translation="MFSVSNLSFIGFLKRIVFSSDSLPGKWEHRKFRFMYILRCAINPV
FT                   ASIRYYYELRSLQCIEDILAIQPTLPARIHRPYLHKGGRAWSRGQYILEHYRFVQNLPE
FT                   KYSEFLFPQKSVSLVQFIGKDGEDFDIQCSPSGFDREGELMLSLFFNKIVIARLTFSVI
FT                   LTQNGHTAFIGGLQGAPKNTGPDVIRCATRACYGLFPKRIIFEAFCALMKACNVSECLA
FT                   VSEHSHVFRQLRYWYQKRKTFVAVYSDFWESVAGKTCGDWYKLPTQVVRKPLSNIASKK
FT                   RSEYRKRYALLDYIHETAIRSLDAYPVNSEHQDLN"
FT   gene            159624..160568
FT                   /gene="msbB2"
FT                   /locus_tag="SSON_P182"
FT                   /old_locus_tag="SSO_P182"
FT                   /note="SSOP182"
FT   CDS_pept        159624..160568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbB2"
FT                   /locus_tag="SSON_P182"
FT                   /old_locus_tag="SSO_P182"
FT                   /product="MsbB2"
FT                   /note="probable lipid A transacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P182"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91202"
FT                   /db_xref="GOA:Q3YTG0"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTG0"
FT                   /protein_id="AAZ91202.1"
FT                   /translation="MKKYKSEFIPEFKKNYLSPVYWFTWFVLGMIAGISMFPPSFRDPV
FT                   LAKIGRWVGRLSRKARRRATINLSLCFPEKSDTEREIIVDNMFATALQSIVMMAELAIR
FT                   GPEKFQKRVFWKGLEILEEIRHNNRNVIFLVPHGWSVDIPAMLLAAQGEKMAAMFHQQR
FT                   NPVIDYVWNSVRRKFGGRLHSREDGIKPFIQSVRQGYWGYYLPDQDHGPEYSEFADFFA
FT                   TYKATLPIIGRLMNISQAMIIPLFPVYDEKKHFLTIEVRPPMDACIASADNKMIARQMN
FT                   KTVEILVGSHPEQYIWVLKLLKTRKSNEADPYP"
FT   mobile_element  complement(160699..161857)
FT                   /mobile_element_type="insertion sequence:IS630"
FT   gene            complement(160722..161753)
FT                   /locus_tag="SSON_P183"
FT                   /old_locus_tag="SSO_P183"
FT                   /note="SSOP183"
FT   CDS_pept        complement(160722..161753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P183"
FT                   /old_locus_tag="SSO_P183"
FT                   /product="IS630 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P183"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91203"
FT                   /db_xref="GOA:Q3YTF9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTF9"
FT                   /protein_id="AAZ91203.1"
FT                   /translation="MPIIAPISRDERRLMQKAIHKTHDKNYARRLTAMLMLHRGDRVSD
FT                   VARTLCCARSSVGRWINWFTQSGVEGLKSLPAGRARRWPFEHICTLLRELVKHSPGDFG
FT                   YQRSRWSTELLAIKINEITGCQLNAGTVRRWLPSAGIVWRRAAPTLRIRDPHKDEKMAA
FT                   IHKALDECSAEHQVFYEDEVDIHLNPKIGADWQLRGQQKRVVTPGQNEKYYLAGALHSG
FT                   TGKVSCVGGNSKSSALFISLLKRLKATYRRAKTITLIVDNYIIHKSRETQSWLKENPKF
FT                   RVIYQPVYSPWVNHVERLWQALHDTITRNHQCSSMWQLLKKVRHFMETVSPFPGGKHGL
FT                   AKV"
FT   gene            161897..162565
FT                   /locus_tag="SSON_P184"
FT                   /old_locus_tag="SSO_P184"
FT                   /note="SSOP184"
FT   CDS_pept        161897..162565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P184"
FT                   /old_locus_tag="SSO_P184"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P184"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91204"
FT                   /db_xref="GOA:Q3YTF8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTF8"
FT                   /protein_id="AAZ91204.1"
FT                   /translation="MCRLAVEYLLYAARKRGLEIGIFCTIHTLRLHFEEHLPLVVAGRR
FT                   LGVPKSTVCSMFVRFRKAGLSWPLPAGMSERELDARLYGSASTVPVVLTESTVMPEVPG
FT                   VKKRPRRPNFPYEFKIALVEQSLQPGACVAQIARENGINDNLLFNWRHQYRKGGLLPSG
FT                   KNMPALLPVTLTPEPDNHGFDIIYMLSTHHQRFTFVRLFDPYLIGSRPTFSHLAHHHIS
FT                   "
FT   gene            162929..163357
FT                   /locus_tag="SSON_P185"
FT                   /old_locus_tag="SSO_P185"
FT                   /note="SSOP185"
FT   CDS_pept        162929..163357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P185"
FT                   /old_locus_tag="SSO_P185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P185"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91205"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTF7"
FT                   /protein_id="AAZ91205.1"
FT                   /translation="MIYPVEELLQIEVDHPVIPGPDIFLGLYHCLVGRTTGTEPVAVVA
FT                   ERAISQCLQYLHHSLLDEAIHHHLDAQQTFAAAGLQYGYSSHRGWAVSAGQQLRFQLWP
FT                   VVPQVVRQFTYAHAIDSRRTLIASCRWNSNQRARGRQR"
FT   mobile_element  163303..164261
FT                   /mobile_element_type="insertion sequence:IS186"
FT                   /note="partial"
FT   gene            163371..164087
FT                   /locus_tag="SSON_P186"
FT                   /old_locus_tag="SSO_P186"
FT                   /note="SSOP186"
FT   CDS_pept        163371..164087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P186"
FT                   /old_locus_tag="SSO_P186"
FT                   /product="IS186 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P186"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91206"
FT                   /db_xref="GOA:Q3YTF6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTF6"
FT                   /protein_id="AAZ91206.1"
FT                   /translation="MGYDPHTCQFTDFELTDSRDAERLDRFAQTADEIRIADRGFGSRP
FT                   ECIRSLAFGEADYIVRVYWRGLRWLTAEGMRFDMMDFLRGLDCGKNGETTVMIGNSGNK
FT                   KAGAPFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEAAGHVLLLTSLSEDE
FT                   YSAEQVADCYRLRWQIELAFKRLKSLLHLDALRAKELELAKAWIFANLLAAFLIDDIIQ
FT                   PSLDFPPRSAGSEKKN"
FT   gene            164665..165012
FT                   /locus_tag="SSON_P187"
FT                   /old_locus_tag="SSO_P187"
FT                   /note="SSOP187"
FT   CDS_pept        164665..165012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P187"
FT                   /old_locus_tag="SSO_P187"
FT                   /product="putative antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P187"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91207"
FT                   /db_xref="InterPro:IPR004914"
FT                   /db_xref="InterPro:IPR042297"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTF5"
FT                   /protein_id="AAZ91207.1"
FT                   /translation="MQYAKPVTLNVEECDRLSFLPYLFGNDFLYAEAYVYALAQKMMPE
FT                   YQGGFWHFIRLPDGGGYMMPDGDRFHMVNGANWFDRTVSADAAGIILTSLVINRQLWLY
FT                   HDSGDAGLTLR"
FT   mobile_element  165005..166268
FT                   /mobile_element_type="insertion sequence:IS600"
FT   gene            165069..165371
FT                   /locus_tag="SSON_P188"
FT                   /old_locus_tag="SSO_P188"
FT                   /note="SSOP188"
FT   CDS_pept        165069..165371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P188"
FT                   /old_locus_tag="SSO_P188"
FT                   /product="IS600 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P188"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91208"
FT                   /db_xref="GOA:Q3Z588"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z588"
FT                   /protein_id="AAZ91208.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVPENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   gene            165512..166225
FT                   /locus_tag="SSON_P189"
FT                   /old_locus_tag="SSO_P189"
FT                   /note="SSOP189"
FT   CDS_pept        165512..166225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P189"
FT                   /old_locus_tag="SSO_P189"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P189"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91209"
FT                   /db_xref="GOA:Q3Z587"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z587"
FT                   /protein_id="AAZ91209.1"
FT                   /translation="MAHIRTRETYGTRRLQTELAENGIIVGRDRLARLRKELRLRCKQK
FT                   RKFRATTNSNHNLPVAPNLLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGN
FT                   ISPAAFREKYHQMAA"
FT   mobile_element  166267..166414
FT                   /mobile_element_type="insertion sequence:IS1"
FT                   /note="partial"
FT   gene            166425..168626
FT                   /gene="traD"
FT                   /locus_tag="SSON_P190"
FT                   /old_locus_tag="SSO_P190"
FT                   /note="SSOP190"
FT   CDS_pept        166425..168626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="SSON_P190"
FT                   /old_locus_tag="SSO_P190"
FT                   /product="TraD protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P190"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91210"
FT                   /db_xref="GOA:Q3YTF2"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022585"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTF2"
FT                   /protein_id="AAZ91210.1"
FT                   /translation="MFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTT
FT                   LEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICL
FT                   ITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVARMLKKDGRDSDIRIGDLPIIRDS
FT                   EIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVIYDRSGEFVKSYYDPSIDKILNPLD
FT                   ARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQGSGRTIFAEAAYLMRNDPNRSY
FT                   SKLVDTLLSIKIEKLRTYLRNSPAANLVEEKIEKTAISIRAVLTNYVKAIRYLQGIEHN
FT                   GEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRR
FT                   VWFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNT
FT                   RAFFRSPSHKIAEFAVGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDI
FT                   QSLPDLTCYVTLPGPYPAVKLSLKYQERPKVAPEFIPRDINPEMENRLSAVLAAREAEG
FT                   RQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQP
FT                   QQPQQPVSPVINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAY
FT                   EAWQQENHPDTWQQMQRREEVNINVHRERGEDVEPGDDF"
FT   gene            168626..169345
FT                   /gene="trbH"
FT                   /locus_tag="SSON_P191"
FT                   /old_locus_tag="SSO_P191"
FT                   /note="SSOP191"
FT   CDS_pept        168626..169345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbH"
FT                   /locus_tag="SSON_P191"
FT                   /old_locus_tag="SSO_P191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P191"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91211"
FT                   /db_xref="GOA:Q3YTF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTF1"
FT                   /protein_id="AAZ91211.1"
FT                   /translation="MNRSAPVFSSQAAHTFKFPGVISHNNQPPTAGMTCDHLIKWPDRA
FT                   SLTGKFCSYLAGVCGCSSVVIQNINAGNKSLDHSEITFRHLAFFCTIYQLHQGDRTDTH
FT                   SPLVQVKTLPDAGGFVLYRKNADVGIEHKLQHQNDSLSCMPGCSLLSIKSALTLCPSNH
FT                   SSHVSPAGVMILVRPTAITSTRFTFSGNATAFGSLTAWLRLLRNTVVSIICLLMWICLV
FT                   YIYCGIDAGICQRDIRL"
FT   gene            169342..173625
FT                   /locus_tag="SSON_P192"
FT                   /old_locus_tag="SSO_P192"
FT                   /note="SSOP192"
FT   CDS_pept        169342..173625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P192"
FT                   /old_locus_tag="SSO_P192"
FT                   /product="oriT nicking and unwinding protein, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P192"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91212"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014129"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040668"
FT                   /db_xref="InterPro:IPR040987"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTF0"
FT                   /protein_id="AAZ91212.1"
FT                   /translation="MMSIAQVRSAGSADNYYTDKDNYYVLGSMGERWAGQGAEQLGLQG
FT                   SVDKDVFTRLLEGRLPDGADLSRMQDGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRLIE
FT                   AHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQEPQLHTHAVVT
FT                   NVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKRKEQVEALGYETEVVGKHG
FT                   MWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQTL
FT                   KETGFDIRAYRDAAEQRAYTRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFMYTDLL
FT                   ARTVGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHMLDELSVRALSRDI
FT                   MKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMARE
FT                   QGREVQIIAADRRSQMNLKQDERLSGELITGRRQLLEGMAFTPGSTVIVDQGEKLSLKE
FT                   TLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRWQGGEQRPATIISEPDR
FT                   NVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVTMTALS
FT                   PVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVTERVTAQSHSLTLRNAQGETQVVR
FT                   ISSLDSSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRA
FT                   EPATLPVSDSPFTALKLENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDV
FT                   RLYSSLDETRTAEKLARHPSFTVVSEQIKARAGETLLETAISLQKAGLHTPAQQAIHLA
FT                   LPVLESKNLAFSMVDLLTEAKSFAAEGTGFADLGGEINAQIKRGDLLYVDVAKGYGTGL
FT                   LVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMILETSDRFTV
FT                   VQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLH
FT                   DTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAVGGGRAVASGDTDQLQAIA
FT                   PGQPFRLQQTRSAADVVIMKEIVRQTPELREAVYSLINRDVERALSGLERVKPSQVPRL
FT                   EGAWAPEHSVTEFSHSQEAKLAEAQQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEARE
FT                   QTLIVTHLNEDRRVLNSMIHDAREKAGELGQVQVMVPVLNTANIRDGELRRLSTWENNP
FT                   DALALVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVTLYTPDTIRVGTGD
FT                   RIRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAITA
FT                   HGAQGASETFAIALEGTEGNRKLMR"
FT   mobile_element  173618..174881
FT                   /mobile_element_type="insertion sequence:IS600"
FT   gene            173682..173984
FT                   /locus_tag="SSON_P193"
FT                   /old_locus_tag="SSO_P193"
FT                   /note="SSOP193"
FT   CDS_pept        173682..173984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P193"
FT                   /old_locus_tag="SSO_P193"
FT                   /product="IS600 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P193"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91213"
FT                   /db_xref="GOA:Q3Z5X1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5X1"
FT                   /protein_id="AAZ91213.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   gene            174125..174838
FT                   /locus_tag="SSON_P194"
FT                   /old_locus_tag="SSO_P194"
FT                   /note="SSOP194"
FT   CDS_pept        174125..174838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P194"
FT                   /old_locus_tag="SSO_P194"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P194"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91214"
FT                   /db_xref="GOA:Q3Z587"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z587"
FT                   /protein_id="AAZ91214.1"
FT                   /translation="MAHIRTRETYGTRRLQTELAENGIIVGRDRLARLRKELRLRCKQK
FT                   RKFRATTNSNHNLPVAPNLLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGN
FT                   ISPAAFREKYHQMAA"
FT   gene            175043..175879
FT                   /locus_tag="SSON_P195"
FT                   /old_locus_tag="SSO_P195"
FT                   /note="SSOP195"
FT   CDS_pept        175043..175879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P195"
FT                   /old_locus_tag="SSO_P195"
FT                   /product="oriT nicking and unwinding protein, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P195"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91215"
FT                   /db_xref="GOA:Q3YTE7"
FT                   /db_xref="InterPro:IPR009767"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTE7"
FT                   /protein_id="AAZ91215.1"
FT                   /translation="MNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYP
FT                   QPYVALPAFDRNGKSAGIWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGES
FT                   LLADNMQDGVRIARDNPDSGVVVSIAGEGRPWNPGAITDGRVWGDIPDNSVQPGAGNGE
FT                   PVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLPDGKTELAVREIAGQERDRAA
FT                   ITEREAALPESVLRESQREREAVREVARENLLQERLQQMERDMVRDLQKEKTPGGD"
FT   gene            175899..176646
FT                   /pseudo
FT                   /gene="traX"
FT                   /locus_tag="SSON_P196"
FT                   /old_locus_tag="SSO_P196"
FT                   /note="SSOP196; frameshift; original product: F pilin
FT                   acetylation protein"
FT   gene            176701..177261
FT                   /gene="finO"
FT                   /locus_tag="SSON_P197"
FT                   /old_locus_tag="SSO_P197"
FT                   /note="SSOP197"
FT   CDS_pept        176701..177261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="finO"
FT                   /locus_tag="SSON_P197"
FT                   /old_locus_tag="SSO_P197"
FT                   /product="FinO"
FT                   /note="putative fertility inhibition protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P197"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91216"
FT                   /db_xref="GOA:Q3YTE6"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR021065"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTE6"
FT                   /protein_id="AAZ91216.1"
FT                   /translation="MTEQKRPVLTLKRKTEGETPVRSRKTIINVTTPPKWKVKKQKLAE
FT                   KAAREAELAAKKAQARQALSIYLNLPTLDEAVNTLKPWWPGLFDGDTPRLLACGIRDVL
FT                   LEDVAQRNIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEAYAA
FT                   ARLDKIRRQNRIKAELQAVLDEK"
FT   gene            177391..177603
FT                   /gene="yigA"
FT                   /locus_tag="SSON_P198"
FT                   /old_locus_tag="SSO_P198"
FT                   /note="SSOP198"
FT   CDS_pept        177391..177603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yigA"
FT                   /locus_tag="SSON_P198"
FT                   /old_locus_tag="SSO_P198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P198"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91217"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTE5"
FT                   /protein_id="AAZ91217.1"
FT                   /translation="MNGFRNSSRNGQVWRYQRAGGRAVILEVSGRWMEAAEAWRRAACV
FT                   APRTDWQQFARKRAEHCHRRCRGRV"
FT   gene            177395..177658
FT                   /locus_tag="SSON_P199"
FT                   /old_locus_tag="SSO_P199"
FT                   /note="SSOP199"
FT   CDS_pept        177395..177658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P199"
FT                   /old_locus_tag="SSO_P199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P199"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91218"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTE4"
FT                   /protein_id="AAZ91218.1"
FT                   /translation="MDSETVHGTARSGVTSVPAGGPLFWKSVDAGWKRQKHGDGLPVLR
FT                   PGQTGSSLPEKGLNTATGAAGEGCNEKSSLHYSRSQKAERSL"
FT   gene            177847..178308
FT                   /locus_tag="SSON_P200"
FT                   /old_locus_tag="SSO_P200"
FT                   /note="SSOP200"
FT   CDS_pept        177847..178308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P200"
FT                   /old_locus_tag="SSO_P200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P200"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91219"
FT                   /db_xref="GOA:Q3YTE3"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTE3"
FT                   /protein_id="AAZ91219.1"
FT                   /translation="MRKYIPLVLFIFSWPVLSADIHGRVVRVLDGDTIEVMDSLKAVRI
FT                   RLVNIDAPEKKQDYGRWSTDMMKSLVAGKTVTVTYFQRDRYGRILGQVYAPDGMNINQF
FT                   MVRAGAAWVYEQYNTDPVLPVLQNEARQQKRGLWSDADPVPPWIWMHRK"
FT   gene            178354..178563
FT                   /gene="hmo"
FT                   /locus_tag="SSON_P201"
FT                   /old_locus_tag="SSO_P201"
FT                   /note="SSOP201"
FT   CDS_pept        178354..178563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmo"
FT                   /locus_tag="SSON_P201"
FT                   /old_locus_tag="SSO_P201"
FT                   /product="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P201"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91220"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTE2"
FT                   /protein_id="AAZ91220.1"
FT                   /translation="MAKTKQEWLYQLRRCSSVNTLEKIIHKNRDSLSNSERESFNSAAD
FT                   HRLAELITGKLYDRIPKEIWKYVR"
FT   gene            178602..179969
FT                   /pseudo
FT                   /locus_tag="SSON_P202"
FT                   /old_locus_tag="SSO_P202"
FT                   /note="SSOP202; contains IS1 insertion; original product:
FT                   conserved hypothetical protein"
FT   mobile_element  complement(178847..179614)
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            complement(178862..179365)
FT                   /gene="insB"
FT                   /locus_tag="SSON_P203"
FT                   /old_locus_tag="SSO_P203"
FT                   /note="SSOP203"
FT   CDS_pept        complement(178862..179365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SSON_P203"
FT                   /old_locus_tag="SSO_P203"
FT                   /product="IS1 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P203"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91221"
FT                   /db_xref="GOA:Q3Z5Z0"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Z0"
FT                   /protein_id="AAZ91221.1"
FT                   /translation="MPGNCTHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            180209..180469
FT                   /gene="repB"
FT                   /locus_tag="SSON_P204"
FT                   /old_locus_tag="SSO_P204"
FT                   /note="SSOP204"
FT   CDS_pept        180209..180469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="SSON_P204"
FT                   /old_locus_tag="SSO_P204"
FT                   /product="RepB"
FT                   /note="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P204"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91222"
FT                   /db_xref="GOA:Q3YTE0"
FT                   /db_xref="InterPro:IPR019661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTE0"
FT                   /protein_id="AAZ91222.1"
FT                   /translation="MSQTENAVTSSLSQKRFVRRGKPMTDSEKQMAAVARKRLTHKEIK
FT                   VFVKNPLKDLMVEYCEREGITQAQFVEKIIKDELQRLDILK"
FT   gene            180760..181617
FT                   /gene="repA"
FT                   /locus_tag="SSON_P205"
FT                   /old_locus_tag="SSO_P205"
FT                   /note="SSOP205"
FT   CDS_pept        180760..181617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="SSON_P205"
FT                   /old_locus_tag="SSO_P205"
FT                   /product="RepA"
FT                   /note="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P205"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91223"
FT                   /db_xref="GOA:Q3YTD9"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="InterPro:IPR017837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD9"
FT                   /protein_id="AAZ91223.1"
FT                   /translation="MTDLQQTYYRQVKNPNPVFTPREGARTLPFCGKLMEKAVGFTSRF
FT                   DFAIHVAHARSLGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECGLA
FT                   TESDAGTLSITRATRALTFLAELGLITYQTEYDPLIGCNIPTDITFTPALFAALDVSEE
FT                   AVASARRSRVEWENRQRKKQGLDTLGMDELMAKAWRFVRERFRSYQTELKSRGMKRARA
FT                   RRDADRQRQDIVTLVKRQLTREISEGRFTASREAVKREVERRVKERMILSRNRNYSRLA
FT                   TASP"
FT   gene            182317..182508
FT                   /locus_tag="SSON_P206"
FT                   /old_locus_tag="SSO_P206"
FT                   /note="SSOP206"
FT   CDS_pept        182317..182508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P206"
FT                   /old_locus_tag="SSO_P206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P206"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91224"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD8"
FT                   /protein_id="AAZ91224.1"
FT                   /translation="MAENGYGLAGLGMGKVKSVNQYRLTPGFGGFTPVSHVTAACRLTC
FT                   RWRGIRIIQAAFNAFAKV"
FT   gene            182527..182832
FT                   /locus_tag="SSON_P207"
FT                   /old_locus_tag="SSO_P207"
FT                   /note="SSOP207"
FT   CDS_pept        182527..182832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P207"
FT                   /old_locus_tag="SSO_P207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P207"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91225"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD7"
FT                   /protein_id="AAZ91225.1"
FT                   /translation="MVVSGISLRLVKQSQRCVMPNIILSETSASVSELKKNPMATVSAG
FT                   DGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLDSYL"
FT   gene            182829..183116
FT                   /locus_tag="SSON_P208"
FT                   /old_locus_tag="SSO_P208"
FT                   /note="SSOP208"
FT   CDS_pept        182829..183116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P208"
FT                   /old_locus_tag="SSO_P208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P208"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91226"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD6"
FT                   /protein_id="AAZ91226.1"
FT                   /translation="MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLR
FT                   GLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGKRERSNVYNLASERMR"
FT   mobile_element  complement(183177..184865)
FT                   /mobile_element_type="insertion sequence:IS1294"
FT   gene            complement(183349..184548)
FT                   /locus_tag="SSON_P209"
FT                   /old_locus_tag="SSO_P209"
FT                   /note="SSOP209"
FT   CDS_pept        complement(183349..184548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P209"
FT                   /old_locus_tag="SSO_P209"
FT                   /product="IS1294 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P209"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91227"
FT                   /db_xref="GOA:Q3YTD5"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD5"
FT                   /protein_id="AAZ91227.1"
FT                   /translation="MLSAFTPRPLKRLFTANQCWTSFLDAGGLRDIEVEAVTKMLACGT
FT                   RILGVKEYNCDKPECPHVRYVTNSCGSRACPSCGKKATDLWIATQLNRLPDCDWVHLVF
FT                   TLPDTLWPVFESNRWLLNDVCRLAVENLLYAARKRGQEPGIFCAIHTYGRRLNWHPHVH
FT                   VSVTCGCLNKHGQWKKLSFLKDAMRSRWMWNMRQRLLKAWSEGLAMPESLSHITTESQW
FT                   RSLVLKAGGKYWHVYMSKKTAGGRNTARYLGRYLKKPPIAASRLAHYNGGASLSFRYLD
FT                   HKTGETATETLTQRELVARLKQHIPEKFFKMVRYFGFLANRVCGEKLPQVYRALGMDKP
FT                   EPVAKVCYAQMVKQFLSRDPFECVLCGGRMVYRRAIAGLNVEGLKKNARDISLLRYMPA
FT                   "
FT   gene            184802..185026
FT                   /locus_tag="SSON_P210"
FT                   /old_locus_tag="SSO_P210"
FT                   /note="SSOP210"
FT   CDS_pept        184802..185026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P210"
FT                   /old_locus_tag="SSO_P210"
FT                   /product="ISSfl1 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P210"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91228"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD4"
FT                   /protein_id="AAZ91228.1"
FT                   /translation="MRQQQDEQGRFSICSRQAAVVHRDAYCNRNVVERCFGRLKEYRRI
FT                   ATRYDKTARNYLAMVKLGCIRLFYQRLRN"
FT   mobile_element  complement(184866..185038)
FT                   /mobile_element_type="insertion sequence:ISSfl1"
FT                   /note="partial"
FT   gene            185165..185332
FT                   /locus_tag="SSON_P211"
FT                   /old_locus_tag="SSO_P211"
FT                   /note="SSOP211"
FT   CDS_pept        185165..185332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P211"
FT                   /old_locus_tag="SSO_P211"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P211"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91229"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD3"
FT                   /protein_id="AAZ91229.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNQFSRMQTKLTVETVLNAELTD
FT                   HLGHEKSYIR"
FT   gene            complement(185350..187077)
FT                   /gene="ipaH1.4"
FT                   /locus_tag="SSON_P212"
FT                   /old_locus_tag="SSO_P212"
FT                   /note="SSOP212"
FT   CDS_pept        complement(185350..187077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipaH1.4"
FT                   /locus_tag="SSON_P212"
FT                   /old_locus_tag="SSO_P212"
FT                   /product="invasion plasmid antigen"
FT                   /note="secreted by the Mxi-Spa secretion machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P212"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91230"
FT                   /db_xref="GOA:Q3YTD2"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR029487"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD2"
FT                   /protein_id="AAZ91230.1"
FT                   /translation="MIKSTNIQAIGSSIMHQINNIYSLTPFSLPMELTPSCNEFYLKAW
FT                   SEWEKNGTPGEQRNIAFNRLKICLQNQEAELNLSELDLKTLPDLPPQITTLEIRKNLLT
FT                   HLPDLPPMLKVIHAQFNQLESLPALPETLEELNAGDNKIKELPFLPENLTHLRVHNNRL
FT                   HILPLLPPELKLLVVSGNRLDSIPPFPDKLEGLALANNFIEQLPELPFSMNRAVLMNNN
FT                   LTTLPESVLRLAQNAFVNVAGNPLSGHTMRTLQQITTGPDYSGPRIFFSMGNSATISAP
FT                   EHSLADAVTAWFPENKQSDVSQIWHAFEHEEHANTFSAFLDRLSDTVSARNTSGFREQV
FT                   AAWLEKLSASAELRQQSFAVAADATESCEDRVALTWNNLRKTLLVHQASEGLFDNDTGA
FT                   LLSLGREMFRLEILEDIARDKVRTLHFVDEIEVYLAFQTMLAEKLQLSTAVKEMRFYGV
FT                   SGVTANDLRTAEAMVRSREENEFTDWFSLWGPWHAVLKRTEADRWAQAEEQKYEMLENE
FT                   YSQRVADRLKASGLSGDADAEREAGAQVMRETEQQIYRQLTDEVLALRLSENGSNHIA"
FT   gene            complement(187467..187734)
FT                   /pseudo
FT                   /gene="ospE1"
FT                   /locus_tag="SSON_P213"
FT                   /old_locus_tag="SSO_P213"
FT                   /note="SSOP213; frameshift; original product: OspE1,
FT                   secreted by the Mxi-Spa secretion machinery"
FT   mobile_element  complement(187835..187937)
FT                   /mobile_element_type="insertion sequence:iso-IS1"
FT                   /note="partial"
FT   mobile_element  complement(187939..189505)
FT                   /mobile_element_type="insertion sequence:IS91"
FT                   /note="partial"
FT   gene            complement(188127..189200)
FT                   /locus_tag="SSON_P214"
FT                   /old_locus_tag="SSO_P214"
FT                   /note="SSOP214"
FT   CDS_pept        complement(188127..189200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P214"
FT                   /old_locus_tag="SSO_P214"
FT                   /product="IS91 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P214"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91232"
FT                   /db_xref="GOA:Q3YTD1"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD1"
FT                   /protein_id="AAZ91232.1"
FT                   /translation="MACGTTLMGYTQWCCSSPDCCHTKKVCFRCKSRSCPHCGVKAGAQ
FT                   WIQYLLSLVPDCPWQHIVFTLPCQYWSLVFHNRWLLTEMSRIAADVILEICHQADVESG
FT                   IFTVIHTWGRDQQWHPHIHLSTTAGGVTSGHTWKNLHFYARKVMSMWRYRITRLLSRKY
FT                   PDLVMPDALAAEGSSKREWNRFLDTHYRRGWNVNVSRVMDNATHVAVYFGSYLKKPPVP
FT                   MSRLEHYAGQDEIGLRYNSHRTKREEYLLMSGDEFMERFSWHVADKGFRMVRYYGFLSP
FT                   AKRRLLEEVVYIITETVRKTAMQITWRGMYQRLLKVDPLKCVLCGSQMRFTGLKRGYRL
FT                   AEQVLMHELLARMRWCG"
FT   gene            complement(189314..189499)
FT                   /locus_tag="SSON_P215"
FT                   /old_locus_tag="SSO_P215"
FT                   /note="SSOP215"
FT   CDS_pept        complement(189314..189499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P215"
FT                   /old_locus_tag="SSO_P215"
FT                   /product="putative IS91 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P215"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91233"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTD0"
FT                   /protein_id="AAZ91233.1"
FT                   /translation="MDAGNKKLVFWFVRVDDEGYPEIARCTEREFATILSGISAGGMYC
FT                   PECGTVHWPDGVAPPF"
FT   mobile_element  complement(189509..190772)
FT                   /mobile_element_type="insertion sequence:IS600"
FT   gene            complement(189552..190265)
FT                   /locus_tag="SSON_P216"
FT                   /old_locus_tag="SSO_P216"
FT                   /note="SSOP216"
FT   CDS_pept        complement(189552..190265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P216"
FT                   /old_locus_tag="SSO_P216"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P216"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91234"
FT                   /db_xref="GOA:Q3Z2H7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z2H7"
FT                   /protein_id="AAZ91234.1"
FT                   /translation="MAHIRTRETYGTRRLQTELAENGIIVGRDRLARLRKELRLRCKQK
FT                   RKFRATTNSNHNLPVAPNLLNQTFTPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGN
FT                   ISPAAFREKYHQMAA"
FT   gene            complement(190406..190708)
FT                   /locus_tag="SSON_P217"
FT                   /old_locus_tag="SSO_P217"
FT                   /note="SSOP217"
FT   CDS_pept        complement(190406..190708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P217"
FT                   /old_locus_tag="SSO_P217"
FT                   /product="IS600 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P217"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91235"
FT                   /db_xref="GOA:Q3Z5X1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5X1"
FT                   /protein_id="AAZ91235.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   gene            complement(190770..191003)
FT                   /locus_tag="SSON_P219"
FT                   /old_locus_tag="SSO_P219"
FT                   /note="SSOP219"
FT   CDS_pept        complement(190770..191003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P219"
FT                   /old_locus_tag="SSO_P219"
FT                   /product="putative IS91 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P219"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91237"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC7"
FT                   /protein_id="AAZ91237.1"
FT                   /translation="MVCNYRYKNRQCHCLSGGYMARSAKPRKRKPASQRSKLPRYVVKL
FT                   HEDDFFDEEDAEVLRFDSFDDAVECCADLNIP"
FT   mobile_element  complement(190774..191034)
FT                   /mobile_element_type="insertion sequence:IS91"
FT                   /note="partial"
FT   gene            190993..191184
FT                   /locus_tag="SSON_P218"
FT                   /old_locus_tag="SSO_P218"
FT                   /note="SSOP218"
FT   CDS_pept        190993..191184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P218"
FT                   /old_locus_tag="SSO_P218"
FT                   /product="IS630 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P218"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91236"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC6"
FT                   /protein_id="AAZ91236.1"
FT                   /translation="MQTMTSRSRQAAYSISLLKRLKATYRRAKTITLIVDNYIIHKSRE
FT                   TQSWLKENPKFTYRKLKN"
FT   mobile_element  191035..191161
FT                   /mobile_element_type="insertion sequence:IS630"
FT                   /note="partial"
FT   mobile_element  complement(191160..192514)
FT                   /mobile_element_type="insertion sequence:IS1294"
FT                   /note="partial"
FT   gene            complement(191333..192541)
FT                   /locus_tag="SSON_P220"
FT                   /old_locus_tag="SSO_P220"
FT                   /note="SSOP220"
FT   CDS_pept        complement(191333..192541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P220"
FT                   /old_locus_tag="SSO_P220"
FT                   /product="IS1294 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P220"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91238"
FT                   /db_xref="GOA:Q3YTC5"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC5"
FT                   /protein_id="AAZ91238.1"
FT                   /translation="MTRSGGDFQPRPLKRLFTANQCWTSFLDAGGLRDIEVEAVTKMLA
FT                   CGTRILGVKEYNCDKPECPHVRYVTNSCGSRACPSCGKKATDLWIATQLNRLPDCDWVH
FT                   LVFTLPDTLWPVFESNRWLLNDVCRLAVENLLYAARKRGQEPGIFCAIHTYGRRLNWHP
FT                   HVHVSVTCGCLNKHGQWKKLSFLKDAMRSRWMWNMRQRLLKAWSEGLAMPESLSHITTE
FT                   SQWRSLVLKAGGKYWHVYMSKKTAGGRNTARYLGRYLKKPPIAASRLAHYNGGASLSFR
FT                   YLDHKTGETATETLTQRELVARLKQHIPEKFFKMVRYFGFLANRVCGEKLPQVYRALGM
FT                   DKPEPVAKVCYVQMVKQFLSRDPFECVLCGGRMVYRRAIAGLNVEGLKKNARDISLLRY
FT                   MPA"
FT   gene            complement(192522..192794)
FT                   /locus_tag="SSON_P222"
FT                   /old_locus_tag="SSO_P222"
FT                   /note="SSOP222"
FT   CDS_pept        complement(192522..192794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P222"
FT                   /old_locus_tag="SSO_P222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P222"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91240"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC4"
FT                   /protein_id="AAZ91240.1"
FT                   /translation="MSHNLEHQKVHTRMVKEVLKAVARANNHPYQSVFADFITGHPSCT
FT                   VCFWETFHKMYPDSPYEYVTFCHTCRRFDLYETEAEMKADDPKWW"
FT   gene            192788..193063
FT                   /locus_tag="SSON_P221"
FT                   /old_locus_tag="SSO_P221"
FT                   /note="SSOP221"
FT   CDS_pept        192788..193063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P221"
FT                   /old_locus_tag="SSO_P221"
FT                   /product="IS630 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P221"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91239"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC3"
FT                   /protein_id="AAZ91239.1"
FT                   /translation="MTWELILDGYSESSYSATPRFAAARLPWFRVIYQPVYSPWVNHVE
FT                   RLWQALHDTITRNHQCSSMWQLLKKVRHFMETVSPFPGGKHGLAKV"
FT   mobile_element  192871..193086
FT                   /mobile_element_type="insertion sequence:IS630"
FT                   /note="partial"
FT   gene            193478..194518
FT                   /gene="wzz"
FT                   /locus_tag="SSON_P223"
FT                   /old_locus_tag="SSO_P223"
FT                   /note="SSOP223"
FT   CDS_pept        193478..194518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzz"
FT                   /locus_tag="SSON_P223"
FT                   /old_locus_tag="SSO_P223"
FT                   /product="O antigen chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P223"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91241"
FT                   /db_xref="GOA:Q3YTC2"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC2"
FT                   /protein_id="AAZ91241.1"
FT                   /translation="MPKAEDEIDLFELLGTLWKKKWVILCVTLLTTGLAAVYAFTAKEQ
FT                   WTAKTYIQAPRIAELGSYLKFHQAYARILNQPLDTNALANGLFSDLILIAESPDTKVKF
FT                   LESTEYYKKETNNLSTEQDKKIWLAEQANKGLVITPPKEKGNTSYYIIQASADSAQEAY
FT                   KLLQGYLKNVNNQAVTLSLDEFGQNVNTLLVNLNKEIIDIDFQRKSEKLDQIAHIQRDL
FT                   TTAEQAGIIDYRSSKGGFDNAQSSYKFLLGEKLLSAELKATKDAPIIYPFRYYEVKRQI
FT                   DELEGMLRDNIQAQAYRYQMKPSEPVIKDKPNKALILILGALPGAMFAIVGTLVYATLK
FT                   DKTKLD"
FT   gene            194554..195867
FT                   /gene="wbgT"
FT                   /locus_tag="SSON_P224"
FT                   /old_locus_tag="SSO_P224"
FT                   /note="SSOP224"
FT   CDS_pept        194554..195867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbgT"
FT                   /locus_tag="SSON_P224"
FT                   /old_locus_tag="SSO_P224"
FT                   /product="putative UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P224"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91242"
FT                   /db_xref="GOA:Q3YTC1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC1"
FT                   /protein_id="AAZ91242.1"
FT                   /translation="MFYVHFMMDKKMKFDTLNAKIGIIGLGYVGLPLAVEFGKKVTTIG
FT                   FDINKSRIDELRNGHDSTLECSNLELLEATKLTYACSLDALKECNVFIVTVPTPIDKHK
FT                   QPDLTPLIKASETLGKIIKKGDVIIYESTVYPGATEEDCIPVVEKVSGLKFNIDFFAGY
FT                   SPERINPGDKEHRVTNILKVTSGSTPDVAEYVDQLYKLIITVGTHKASSIKVAEAAKVI
FT                   ENTQRDVNIALINELSIIFNKLGIDTLEVLEAAGTKWNFLPFRPGLVGGHCIGVDPYYL
FT                   THKAQSVGYHPEMILAGRRLNDSMGQYVVSQLVKKMLKQRIQVEGANVLVMGLTFKENC
FT                   PDLRNTKVIDIISELKEYNINIDIIDPWCSTDEAQHEYGLTLCEDPKVNHYDAIIIAVA
FT                   HNEFREMGESAIRALGKDEHVLFDLKYVLDKKSIDMRL"
FT   gene            195948..196985
FT                   /gene="wbgU"
FT                   /locus_tag="SSON_P225"
FT                   /old_locus_tag="SSO_P225"
FT                   /note="SSOP225"
FT   CDS_pept        195948..196985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbgU"
FT                   /locus_tag="SSON_P225"
FT                   /old_locus_tag="SSO_P225"
FT                   /product="putative UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P225"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91243"
FT                   /db_xref="GOA:Q3YTC0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTC0"
FT                   /protein_id="AAZ91243.1"
FT                   /translation="MDIYMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQV
FT                   VIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAAL
FT                   GSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIG
FT                   NPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAML
FT                   KGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYI
FT                   YDELNLIHHIDKLSIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYV
FT                   RFLKG"
FT   gene            197086..198354
FT                   /gene="wzx"
FT                   /locus_tag="SSON_P226"
FT                   /old_locus_tag="SSO_P226"
FT                   /note="SSOP226"
FT   CDS_pept        197086..198354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzx"
FT                   /locus_tag="SSON_P226"
FT                   /old_locus_tag="SSO_P226"
FT                   /product="putative repeat unit transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P226"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91244"
FT                   /db_xref="GOA:Q3YTB9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB9"
FT                   /protein_id="AAZ91244.1"
FT                   /translation="MIDAGGTFLLKAIFQIGVFVYFTHVSDITTFGIISYVFTVYWFVL
FT                   NFSDYGFRTKLVKDISDNSYSASELLSRSDGVKTYVFFFIFIIFMFYSYVSDSISLTLL
FT                   VYISSAYFVCISSGRFSLLQAVGRFRCELYINIYSTIIYIGCNLFLSLFIEPLYYSAIS
FT                   IFIYSISLLVFSSHKCNVPCFHIKRPSILVYKDFLDATPFAILVLLNVVLSSIDLFILK
FT                   EYFSYNSVAIYQVVTRVNTGLIIVFNVIYTVLLPSFSYYLKNSEWGNIRKLQRYISLLV
FT                   LLLCLCYYFFGIYFVGILFGDEYKVISSATFLIMFMALIKYNFWLINELYLVCSGNQSE
FT                   RVKSYCIGVVISMAVFFYFIPRYGWSGAVFGSAIATLVIGIFYIISVKKDCGKILHDKY
FT                   SLMMIFVPIFFYFIINGQQRLLY"
FT   gene            198423..199595
FT                   /gene="wzy"
FT                   /locus_tag="SSON_P227"
FT                   /old_locus_tag="SSO_P227"
FT                   /note="SSOP227"
FT   CDS_pept        198423..199595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzy"
FT                   /locus_tag="SSON_P227"
FT                   /old_locus_tag="SSO_P227"
FT                   /product="putative polysaccharide polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P227"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91245"
FT                   /db_xref="GOA:Q3YTB8"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB8"
FT                   /protein_id="AAZ91245.1"
FT                   /translation="MLIYLYPVLLLFNILPVFFYGQMNSDLERFFGVPIGYIPDLIFYF
FT                   FVVLTSIITLRFHVSLWTKKLLFLGIIFLIYISIQMLLLSADISGVVILLSFFSNFIAL
FT                   VLLVSFCIGKDELYLTHSVRNINVVMCFGIICGVVKLFIGYSEDSNFIVYLNRNATAII
FT                   VVCFYCVYSYFYRGRKSWYVSSVLYSLFFLFLDSRAGIISFAISLFFVFLQLTKKEKLL
FT                   ISLFFVPLLTLGISFTDIGTRLERMLSSSQVIFSGGNTLTKSQNDYRRVELVFIGVDVL
FT                   KENYLIGTGLGVANYVKAIDKKFLGSTNFGLAHNFYLSYSAQLGIIGFILLISVFYIML
FT                   SPIFKCGGYIGKGCVFALAFYVFFNEYILTPAIYIYISIFLSVVFIRNSK"
FT   mobile_element  199588..200746
FT                   /mobile_element_type="insertion sequence:IS630"
FT   gene            199692..200723
FT                   /locus_tag="SSON_P228"
FT                   /old_locus_tag="SSO_P228"
FT                   /note="SSOP228"
FT   CDS_pept        199692..200723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P228"
FT                   /old_locus_tag="SSO_P228"
FT                   /product="IS630 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P228"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91246"
FT                   /db_xref="GOA:Q3YTB7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB7"
FT                   /protein_id="AAZ91246.1"
FT                   /translation="MPIIAPISRDERRLMQKAIHKTHDKNYARRLTAMLMLHRGDRVSD
FT                   VARTLCCARSSVGRWINWFTQSGVEGLKSLPAGRARRWPFEHICTLLRELVKHSPGDFG
FT                   YQRSRWSTELLAIKINEITGCQLNAGTVRRWLPSAGIVWRRAAPTLRIRDPHKDEKMAA
FT                   IHKALDECSAEHPVFYEDEVDIHLNPKIGADWQLRGQQKRVVTPGQNEKYYLAGALHSG
FT                   TGKVSCVGGNSKSSALFISLLKRLKATYRRAKTITLIVDNYIIHKSRETQSWLKENPKF
FT                   RVIYQPVYSPWMNHVERLWQALHDTITRNHQCSSMWQLLKKVRHFMETVSPFPGGKHGL
FT                   AKV"
FT   gene            200756..202000
FT                   /gene="wbgV"
FT                   /locus_tag="SSON_P229"
FT                   /old_locus_tag="SSO_P229"
FT                   /note="SSOP229"
FT   CDS_pept        200756..202000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbgV"
FT                   /locus_tag="SSON_P229"
FT                   /old_locus_tag="SSO_P229"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P229"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91247"
FT                   /db_xref="GOA:Q3YTB6"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB6"
FT                   /protein_id="AAZ91247.1"
FT                   /translation="MLLEYVERKISLALSKYPKVRDVIKFFYLYIASLFGIILNKNKTV
FT                   IQSKIYEISIDDSEESFFGYYDHSPMSSNGRYVLFHSSAFSTKRHPKKVKYISICVKDL
FT                   LNNKVYKLYDTRAFNWQQGSRLMWIDDDNIIFNDYENNGYISVVYSLSLMKVIKKINYP
FT                   IYDVNNYKAVTLDFSWLAKYDSDYGYYNKKSFSTDISIINLNTGGIELFLSLDEMLKRT
FT                   NFKCNIDVEHVVNHFMFAPDGRSVMFIHRYYTPKGKRERLIHWNLINDNVRVLINESII
FT                   SHCCWNGNDEIIGFFGAEIDSLNYYRLSIESCNTEKLFFDARKYSDGHPTIVHNRYIIS
FT                   DTYPDKNRIKKLFVYDLVKNDYRELGLFYESMSFFSYSRCDLHPRISVDNRFLFVDSVH
FT                   SGKRKLYFMRSGICE"
FT   gene            201993..202979
FT                   /gene="wbgW"
FT                   /locus_tag="SSON_P230"
FT                   /old_locus_tag="SSO_P230"
FT                   /note="SSOP230"
FT   CDS_pept        201993..202979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbgW"
FT                   /locus_tag="SSON_P230"
FT                   /old_locus_tag="SSO_P230"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P230"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91248"
FT                   /db_xref="GOA:Q3YTB5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB5"
FT                   /protein_id="AAZ91248.1"
FT                   /translation="MSDVLVSLIIVCFNAEKYIEKSLLAFINQDVGLDKFELIIVDGDS
FT                   SDNTISIVQDVFSKHSNIKHKIINNKKRTLATGWNIGVLEANGKFVCRVDAHSDIPNNY
FT                   ISKLLDDYFNIMQFDDSVVGVGGVLTNSYKTKFGSIVADFYASKFGVGNSPFRCVDKNN
FT                   RLKKTDTAVFALYNKDVFFDVGLFNEVLDRNQDIDFHKRVLSNNLSLYTDNSLFVEYYV
FT                   RDNFKDFIKKGFLDGFWVVMSGAYYFRHIVPLFFVLYLIVSFSLFFATGDYIYLSFLFF
FT                   YFLISILFSIRDGRSFIGRVFLPFIFLSYHISYGCGSLLSFLKRYFK"
FT   gene            202976..204130
FT                   /gene="wbgX"
FT                   /locus_tag="SSON_P231"
FT                   /old_locus_tag="SSO_P231"
FT                   /note="SSOP231"
FT   CDS_pept        202976..204130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbgX"
FT                   /locus_tag="SSON_P231"
FT                   /old_locus_tag="SSO_P231"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P231"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91249"
FT                   /db_xref="GOA:Q3YTB4"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB4"
FT                   /protein_id="AAZ91249.1"
FT                   /translation="MKNFIPFALPEIGEEEIAEVIDSLRSGWITTGPKAKQFEQEFSNY
FT                   LGANVQSLAVNSATSGLHLALEAVGVKPGDQVIVPSYTFTATAEIVRYLGADPVIVDVD
FT                   RKTFNISVDAIEKAITNETKAIIPVHFAGLACDMDSILSIAKKYDLKVVEDAAHAFPTT
FT                   YKGSKIGTLDSDATVFSFYANKTMTTGEGGMVVSKNKDIIERCKVMRLHGISRDAFDRY
FT                   QSKTPSWFYEVVAPGFKYNMPDICAAIGIHQLRKIDDFQKKRQRMAKIYDDALKELPLE
FT                   LPEWPTNASDIHAWHLYPIRLKTDSAINRDDFIKKLSDLGIGCSVHFIPLHKQPVWRDT
FT                   YNLNASDFPVSEECYLNEISIPLYTKMTDQDQLFVIKSIRQLFM"
FT   gene            204147..204737
FT                   /gene="wbgY"
FT                   /locus_tag="SSON_P232"
FT                   /old_locus_tag="SSO_P232"
FT                   /note="SSOP232"
FT   CDS_pept        204147..204737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbgY"
FT                   /locus_tag="SSON_P232"
FT                   /old_locus_tag="SSO_P232"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P232"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91250"
FT                   /db_xref="GOA:Q3YTB3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB3"
FT                   /protein_id="AAZ91250.1"
FT                   /translation="MKRIFDVIVAGLGLLFLFPVFIIVSMLIVADSKGGVFFRQYRVGR
FT                   FGKDFRIHKFRTMFIDSEKKGRITVGQDARVTRVGWYLRKYKIDELPQLIDVLSGTMSL
FT                   VGPRPEVREFIDEYPDDIREKVLSVRPGITDLASIEMVDENEILSSYDDPRRAYIDIIL
FT                   PIKQRYYLDYVANNSVKYDCVIIWKTIIKILSR"
FT   gene            204752..206671
FT                   /gene="wbgZ"
FT                   /locus_tag="SSON_P233"
FT                   /old_locus_tag="SSO_P233"
FT                   /note="SSOP233"
FT   CDS_pept        204752..206671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbgZ"
FT                   /locus_tag="SSON_P233"
FT                   /old_locus_tag="SSO_P233"
FT                   /product="putative epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P233"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91251"
FT                   /db_xref="GOA:Q3YTB2"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB2"
FT                   /protein_id="AAZ91251.1"
FT                   /translation="MIDRILELPRIVKRGIIICIDVVMVIFSFWLSYWLRLDEQTAFLS
FT                   APMWFAAAILTIFTVFIFIRIGLYRAVLRYVSAKIMLLIPVGILASTLSLVVISYSLSI
FT                   MLPRTVVGIYFLVLLLLTSGSRLLFRMILNYGVKGSAPVLIYGAGESGRQLLPALMQAK
FT                   EYFPVAFVDDNPRLHKAVIHGVTVYPSDKLSYLVDRYGIKKILLAMPSVSKSQRQKVIT
FT                   RLEHLPCEVLSIPGMVDLVEGRAQISNLKKVSIDDLLGRDPVAPDAKLMAENITGKAVM
FT                   VTGAGGSIGSELCRQIVRYKPAKLVLFELSEYALYAIEKELSALCDKEVLNVPVIPLLG
FT                   SVQRQNRLQMVMKSFGIQTVYHAAAYKHVPLVEHNVVEGVRNNVFGTLYCAESAIESGV
FT                   ETFVLISTDKAVRPTNTMGTTKRLAELVLQALSARQSQTRFCMVRFGNVLGSSGSVVPL
FT                   FEKQIAQGGPVTLTHRDIIRYFMTIPEASQLVIQAGAMGHGGDVFVLDMGDPVKIYDLA
FT                   KRMIRLSGLSVRDDKNPDGDIAIEVTGLRPGEKLYEELLIGDSVQGTSHPRIMTANEVM
FT                   LPWQDLSLLLKELDQACHDFDHERIRSLLLQAPAAFNPTDDICDLVWQQKKSLLSQASN
FT                   VIRL"
FT   gene            206790..207302
FT                   /locus_tag="SSON_P234"
FT                   /old_locus_tag="SSO_P234"
FT                   /note="SSOP234"
FT   CDS_pept        206790..207302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P234"
FT                   /old_locus_tag="SSO_P234"
FT                   /product="putative aquaporin"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P234"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91252"
FT                   /db_xref="GOA:Q3YTB1"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB1"
FT                   /protein_id="AAZ91252.1"
FT                   /translation="MFKPFSAEFFGTFWLVLGGCGSALISAAFPQLGIGFLGVALAFGL
FT                   TVVTMAYAVGHISGAHFNPAVTLGLWAGGRFPAARVLPYIIAQVIGGIAAAAVLYGIAS
FT                   GKAGFDATTSGFAANGYGLHSPGGYALSACMLSEFVLSAFFVRSDRKTRSCGLCATGDW
FT                   SGNHPVN"
FT   mobile_element  207401..207863
FT                   /mobile_element_type="insertion sequence:IS629"
FT                   /note="partial"
FT   gene            207506..207781
FT                   /locus_tag="SSON_P235"
FT                   /old_locus_tag="SSO_P235"
FT                   /note="SSOP235"
FT   CDS_pept        207506..207781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P235"
FT                   /old_locus_tag="SSO_P235"
FT                   /product="IS629 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P235"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91253"
FT                   /db_xref="GOA:Q3YTB0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTB0"
FT                   /protein_id="AAZ91253.1"
FT                   /translation="MVLESQGEYDSQWATICSIAPKIGCTPETLRVRVRQHERDTGGGD
FT                   GGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDRLWKK"
FT   gene            complement(207903..208172)
FT                   /locus_tag="SSON_P236"
FT                   /old_locus_tag="SSO_P236"
FT                   /note="SSOP236"
FT   CDS_pept        complement(207903..208172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P236"
FT                   /old_locus_tag="SSO_P236"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P236"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91254"
FT                   /db_xref="GOA:Q3YTA9"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTA9"
FT                   /protein_id="AAZ91254.1"
FT                   /translation="MWCFFNLFGVLIPIDERNLTRERTQVGLQAARARGRKGGRPKTLS
FT                   KDKQALAVQLYNEKKHTVAQICVLMGISRPTLYKYIESARLFKK"
FT   mobile_element  complement(208128..209956)
FT                   /mobile_element_type="insertion sequence:IS91"
FT   gene            complement(208316..209389)
FT                   /locus_tag="SSON_P237"
FT                   /old_locus_tag="SSO_P237"
FT                   /note="SSOP237"
FT   CDS_pept        complement(208316..209389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P237"
FT                   /old_locus_tag="SSO_P237"
FT                   /product="IS91 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P237"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91255"
FT                   /db_xref="GOA:Q3YTA8"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTA8"
FT                   /protein_id="AAZ91255.1"
FT                   /translation="MACGTTLMGYTQWCCSSPDCCHTKKVCFRCKSRSCPHCGVKAGAQ
FT                   WIQYLLSLVPDCPWQHIVFTLPCQYWSLVFHNRWLLTEMSRIAADVILEICHQADVEPG
FT                   IFTVIHTWGRDQQWHPHIHLSTTAGGVTSGHTWKNLHFYARKVMSMWRYRITRLLSRKY
FT                   PDLVMPDALAAEGSSKREWNRFLDTHYRRGWNVNVSRVMDNATHVAVYFGSYLKKPPVP
FT                   MSRLEHYAGQDEIGLRYNSHRTKREEYLLMSGDEFMERFSWHVADKGFRMVRYYGFLSP
FT                   AKRRLLEEVVYIITETVRKTAMQITWRGMYQRLLKVDPLKCVLCGSQMRFTGLKRGYRL
FT                   AEQVLMHELLARMRWCG"
FT   gene            complement(209503..209868)
FT                   /locus_tag="SSON_P238"
FT                   /old_locus_tag="SSO_P238"
FT                   /note="SSOP238"
FT   CDS_pept        complement(209503..209868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P238"
FT                   /old_locus_tag="SSO_P238"
FT                   /product="putative IS91 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P238"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91256"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTA7"
FT                   /protein_id="AAZ91256.1"
FT                   /translation="MARSAKPRKRKPASQRSKLPRYVVKLHEDDFFDEEDAEVLRFDSF
FT                   DDAVECCADLNIPFFVDAGNKKLVFWFVRVDDEGYPEIARCTEREFATILSGISAGGMY
FT                   CPECGTVHWPDGVAPPF"
FT   gene            209915..210772
FT                   /locus_tag="SSON_P239"
FT                   /old_locus_tag="SSO_P239"
FT                   /note="SSOP239"
FT   CDS_pept        209915..210772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P239"
FT                   /old_locus_tag="SSO_P239"
FT                   /product="IS911 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P239"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91257"
FT                   /db_xref="GOA:Q3YTA6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTA6"
FT                   /protein_id="AAZ91257.1"
FT                   /translation="MQTMTSRSRQAAYSGVHRSSYRYWKNRPEKPDGRRAVLRSQVLEL
FT                   HGISHGSAGARSIATMATRRGYQMGRWLAGRLMKELGLVSCQQPTHRYKRGGHEHVAIP
FT                   NYLERQFAVTEPNQVWCGDVTYIWTGKRWAYLAVVLDLFARKPVGWAMSFSPDSRLTMK
FT                   ALEMAWETRGKPGGVMFHSDQGSHYTSRQFRQLLWRYQIRQSMSRRGNCWDNSPMERFF
FT                   RSLKNEWMPMVGYVSFREAAHAITDYIVGYYSALRPHEYNGGLPPNESENRYWKNSNSV
FT                   ASFC"
FT   mobile_element  209957..210780
FT                   /mobile_element_type="insertion sequence:IS911"
FT                   /note="partial"
FT   gene            complement(210796..211488)
FT                   /locus_tag="SSON_P240"
FT                   /old_locus_tag="SSO_P240"
FT                   /note="SSOP240"
FT   CDS_pept        complement(210796..211488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_P240"
FT                   /old_locus_tag="SSO_P240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P240"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91258"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTA5"
FT                   /protein_id="AAZ91258.1"
FT                   /translation="MISPIKNIKNVFPINTANTEYIVRNIYPRVEHGYFNESPNIYGKK
FT                   YISGITRSMAQLKIEEFINEKSRRLNYMKTMYSPCPEDFQPISRDEASTPEGSWLTVIS
FT                   GKRPMGQFSVDSLYHPDLHALCELPEISCKIFPKENSDFLYIIVVFRNDSPQGELRANR
FT                   FIELYDIKREIMQVLRDESPELKSIKSEIIIAREMGELFSYASEEIDSYIKQMNDRLSQ
FT                   IKARMPVT"
FT   mobile_element  211542..211726
FT                   /mobile_element_type="insertion sequence:IS3"
FT                   /note="partial"
FT   gene            213078..214025
FT                   /gene="icsP/sopA"
FT                   /locus_tag="SSON_P241"
FT                   /old_locus_tag="SSO_P241"
FT                   /note="SSOP241"
FT   CDS_pept        213078..214025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icsP/sopA"
FT                   /locus_tag="SSON_P241"
FT                   /old_locus_tag="SSO_P241"
FT                   /product="IcsP/SopA"
FT                   /note="outermembrane protease of the OmpP family; involved
FT                   in cleavage of surface exposed IcsA"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_P241"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ91259"
FT                   /db_xref="GOA:Q3YTA4"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR020079"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YTA4"
FT                   /protein_id="AAZ91259.1"
FT                   /translation="MKLKFLVLALCVPAIFTTHATTNYPLFIPDNISTDISLGSLSGKT
FT                   KERVYHPKEGGRKISQLDWKYSNATIVRGGIDWKLIPKVSFGVSGWTTLGNQKASMVDK
FT                   DWNNSNTPQVWTDQSWHPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYSFNA
FT                   MGGSYIYSENGGNRNKKGAHPSGERTIDYKQLFKIPYIGLTANYRHENFEFGAELKYSG
FT                   WVRSSDTDKHYQTETIFKDEIKNQNYCSVAANIGYYVTPSAKFYIEGSRNYISNKKGDT
FT                   SLYEQSTNISGTIKNSASIEYIGFLTSAGIKYIF"
FT   mobile_element  complement(214062..214215)
FT                   /mobile_element_type="insertion sequence:IS629"
FT                   /note="partial"
XX
SQ   Sequence 214396 BP; 58597 A; 46949 C; 50100 G; 58750 T; 0 other;
     atgctgatga aaatacctaa ataatcagcc agcactctat ctttccaaat ccacagcata        60
     gcaaagagag caaaagagcc tgtaaattca gaaattaagg aaacgcctct tggtgcacat       120
     aatctatctt atgttaaatg aaatctaatt tcttgattat atgctggatc gttcgtgggt       180
     ggctttgccc ctatatttcc agacacctgt tatcattggc ccgctgccgc agatattccc       240
     gtggcgagcg ataatccagc gcactatgcg gatgctattc gttataatgc tcgaatgcct       300
     ctgcaaggtt ctttgctgcc gttaacccgt caggtttggg catgatactg atgtagtcac       360
     actttattgt tttcacgaag ctctttgcta ttctgttact ctccggactc cgcaccgccg       420
     tgttcttcgg ttcaacaaag tcccaacatc cgggtgaact ggcgtgtttc attagcccgg       480
     tagcatgaac cattatccgt cagtcacttc actggagacg ccggaagctc gttgccgaag       540
     cggtgttcca ccgctcccag catgtcgcca acgggagagc atctacggtc tgattgaact       600
     gtttattcaa attgtccacc gtctgtcagt acgctctgaa cgtcggctgg ttaaaacact       660
     gctcgctgat tttcagaggg ttcacggtaa aacagcactt ttattccgga ttgcggaagc       720
     ggctctgaat aatccggatg ggctggttaa agaggttgtg taccatctgc atattgttga       780
     accagatcgc agcggtaaga gaagttcatc atacttggcg cagttacgcg atgtttctgc       840
     tagaggtgat gccgtaaaga acggcagaac attaccggaa caagatagcg gtctacctgc       900
     actggtatca gacccggggc ttccccggat gatctccacg gtactttagg tactgtgtct       960
     atattatgta ggtaggatca attaactttg tagttgaaat tctttcattg aaataatgaa      1020
     taaaaaagac aaacagcatt aaacaatgcc agaatataat tgcatttttg ttccgttttt      1080
     ttaaatcata gtatacaaag aagcttgcat actatatgaa aatataacac cctttactat      1140
     gatgtttata aaacaatata tggagtcatg taggtatgaa tttagatggt gttagaccat      1200
     actgtagaat agtcaataaa aagaatgaaa gcatatcaga tattgcattt gcacatataa      1260
     taaaaagggt aaaaaattca tcatgtactc acccaaaagc agcattggtt tttttaggag      1320
     agaaaggttt ttgtgatagc aatgatgttc tatctattat gggacaacaa ataccaagag      1380
     tatttaagaa caagatgtta tatgattatg tttttaaaaa tgaaaaaagt aaaaatgatt      1440
     ttctaaaaat ggctgaatca tggctaccac agagtgaacc aatagtaata aataatgatg      1500
     atgacgcatt gaatgctgct gcttattttt ctgtaaaaaa agcgaaaata aaaacagtaa      1560
     acgatactga ttttaaagag tataataagg tttatattct tgggcacggt agtcctggtt      1620
     ctcatcaatt aggccttggt tcggaactta ttgatgtaca aacaatcatt tcaagaatga      1680
     aagactgtgg tattctaaat gtgaaagata tccgttttac ttcatgcggc tccgctgata      1740
     aagtggctcc taaaaatttt aacaatgccc ctgctgaaag tctttcttgt atccttaact      1800
     ctctgccttt ttttaaggaa aaagaatctt tgctagagca gataaaaaaa caccttgaaa      1860
     acgatgagtc attgagtgat ggtctaaaaa tatccggcta tcatggatat ggagttcact      1920
     atggtcaaga gctttttccc tactcacatt atcgttcaac ttcaattcct gctgatccgg      1980
     agcatacagt aaaaagaagc tctcagaaaa agacttttat tattaataaa gaactggatt      2040
     agtataaaat ttttaaccta tagttaattg tttgcattta agatgaagtt attttatctt      2100
     tagtagaaaa gtgcttccct atgagggaaa atcacaaatc atcataatac agagacaaaa      2160
     cgatacgaac aaatagataa aaaacatcat tcttttacca cattattttt cgtgaatatg      2220
     aaaaataatg ttattacttt aatataagac tattttttgt ttttccatca ctctgttcaa      2280
     atttttccgc atgacttgtg ttttttgtaa cacagctcgt tttttacagc tgaccaaaat      2340
     catcaattaa ttatgctaag gaaataaatt atgaaaacca aaaactttct tcttttttgt      2400
     attgctacaa atatgatttt tatcccctca gcaaatgctc tgaaggcaga aggttttctc      2460
     actcaacaaa cttcaccaga cagtttgtca atacttccgc cgcctccggc agaggattca      2520
     gtagtatttc aggctgacaa agctcattat gaattcggcc gctcgctccg ggatgctaat      2580
     cgtgtacgtc tcgctagcga agatgcatac tacgagaatt ttggtcttgc attttcagat      2640
     gcttatggca tggatatttc aagggaaaat accccaatct tatatcagtt gttaacacaa      2700
     gtactacagg atagccatga ttacgccgtg cgtaacgcca aagaatatta taaaagagtt      2760
     cgtccattcg ttatttataa agacgcaacc tgtacacctg ataaagatga gaacatggct      2820
     atcactggct cttatccctc tggtcatgca tcctttggtt gggcagtagc actgatactt      2880
     gcggagatta atcctcaacg taaagcggaa atacttcgac gtggatatga gtttggagaa      2940
     agtcgggtca tctgcggtgc gcattggcaa agcgatgtag aggctgggcg tttaatggga      3000
     gcatcggttg ttgcagtact tcataataca cctgaattta ccaaaagcct tagcgaagcc      3060
     aaaaaagagt ttgaagaatt aaatactcct accaatgaac tgaccccata aagctggaca      3120
     gcctgtatca ggctatggag ggcccataga caaatctacc ctatatgagc ataggaggag      3180
     tctatgggca caccacgttt tacccctgaa tttaagggat tactggaaag gctgggacat      3240
     atccctccgg cagaagcaga aaaagcttat tatgctgcca tcggaaacga tgatctggca      3300
     acctgagttc acagataaaa cattctctag gaaactcggg gcggttccgt tcaccacatg      3360
     caatgtggtg ttgcagggga acggtctgca ccatccccta tgtcgatcaa tataacagaa      3420
     atgacaactt cagattcagg gcacaaccta aatatatttt aggtcacctc tcaaatcgtt      3480
     tgcctgatac cgctccattt tttaataaaa aatcaatcat ttttgaatct ttgcttttca      3540
     ttgcattgtc aagcatagtg tccccactat ttgctttttg aaattttttg tttacatcaa      3600
     ccaatccatt attgataaaa tattctaaat agctgcgcgg aatagtagat cactttgagg      3660
     gaacttagcc cggattgtgc gatctgatca atcgccaaat caaaacaaat caccaaccgg      3720
     actgagcaat gccgatcata gcaccaattt cccgtgacga acgacgcctg atgcagaaag      3780
     ccatccataa aacacacgat aaaaattatg cccgcagact gactgccatg ctgatgctgc      3840
     accggggcga ccgtgtcagc gacgttgcca gaacgctctg ctgcgcccgt tcctctgttg      3900
     gacgctggat taactggttc acgcagtcgg gtgttgaggg actgaaatca ttacctgccg      3960
     ggcgtgcccg tcgctggccg tttgagcata tctgcacact gttacgtgag ctggtaaaac      4020
     attctcccgg cgactttggc taccagcgtt cacgctggag tacagaactg ctggcaataa      4080
     aaatcaatga gataaccggt tgccagttaa atgccggaac cgttcgccgc tggttgccgt      4140
     ctgcggggat tgtgtggcga agggctgcgc caactctgcg tatccgtgac ccgcataaag      4200
     atgaaaagat ggcagcaatc cataaagcac tggacgaatg cagcgcagag catccggtct      4260
     tttatgaaga tgaagtggat atccatctta atcccaaaat cggtgcggac tggcaactgc      4320
     gcggacagca aaaacgggtg gtcacgccgg gacagaatga aaaatattat ctggccggag      4380
     cgctgcacag cgggacaggt aaagtcagct gtgtgggcgg caacagcaaa agttcggcgc      4440
     tgttcatcag cctgctgaag cggcttaaag cgacataccg tcgggcgaaa accatcacgc      4500
     tgatcgtgga caactacatt atccacaaaa gccgggaaac acagagctgg ctgaaggaga      4560
     acccgaagtt cagggtcatt tatcagccgg tttactcgcc atggatgaat catgttgaac      4620
     ggctatggca ggcacttcac gacacaataa cgcgtaatca tcagtgcagc tcaatgtggc      4680
     aactgttgaa aaaagttcgc cattttatgg aaaccgtcag cccattcccc ggaggcaaac      4740
     atgggctggc aaaagtgtag cggtattaag cgcagctatt tagcacttta tagttggcac      4800
     catctttact aagtaagtat tcaacatcat acagattaca atatctattg ttgttcattt      4860
     tctccatctc tgcgacatct tgttttgtaa aattaaattt agatagtaaa taaagtgcta      4920
     tatcagcttt tttattgcct aaagaataag caagggcctg atgagccatt tttttatcag      4980
     tcactttatt gttaatctct tcataattag atgctttaat cgcatcctcc aaagatatgt      5040
     ctctgagttt tatttttttg aagttatctg tacttagcat tcttggtata tgatactcaa      5100
     gctgaaacac aaagtttata attctatcca gactaacagg atcaatgttt ttgttataac      5160
     aaaactctcg gaatccttga tctttactct ttcttataaa atcaataaga tgcaacccaa      5220
     ttccaagcct catatcttta gtattaaata ttggaacata ctcaccctct ggatgtgacc      5280
     tttatccatg aagaagattt ggccacacca tggaaacctg aacaatcatc agtttacgcc      5340
     catgtaaacc cctacgggat atttgaactc gatatggaaa taaggttgct aatcgaggtg      5400
     gttgcctgaa agttggcagt tacccggtca ctacaccttg ttggagtgaa catatcaaaa      5460
     acaggtaatt acacaattta aattacagtc tcataaaaaa tgattaaatc tatttattat      5520
     ttcaataaac gtttttttca tcttctttga aaattgttct gctatagtat ccggttccag      5580
     attgttctct tttattattc tacaatactc taatattgtt tctttgtctc tatttactac      5640
     agatacaaat acaccaggaa taccatcttt attagttgcg gacagcattt cgaccaatcg      5700
     tcttgtggta aaactatagt tttttagaat attacaaaag gcacgtattg tttcggtatg      5760
     gccattataa aatgccataa aaagtcctga tgtaccgttg ggatttttta tccataataa      5820
     ttcatctata tattcctggt gaggggggag tatttttagt atatctccat acgccataat      5880
     ggcctttgtg tgcccatttt gaagtgccat aaacaaccca tgctttactt tcaataattc      5940
     tttaatttgt tcactactaa gcattttctt attaagcaga cttccgaaca tacgaatact      6000
     atctgcatgt ccattctgca atgcaaaaaa taacccaggt aaatcatggc tgtctttcgc      6060
     agctaataga tataatctct tatcggaagt taacggggtt ttaaagacta tttccccata      6120
     ggcttttatt gtgtctacat gtccgttcat aaaagacatg cataaacccg gcacattgtt      6180
     tgcccctacc gcagcaagca atgtaagtat tgtttcttga ctaagattgc acatatttaa      6240
     tatcttacca tatacttgaa taatgtctga acatccgttt tgaagtgcta tataaaatgc      6300
     aggagtacca tcagagcttc tcgtggccag aaggttcacc agtttagatt gagaaatttc      6360
     accatttttg tatttttcca tcagtataaa taatacttct gtcagattct ttgttatcgc      6420
     atgatatata actctggaat tgatcaattc atctggtaaa agtttcactg tgtttgttag      6480
     aggggaatta tgcctatctt caaatattac ctgcccgggt tgctccagac cataaatttt      6540
     ccaataaaaa tcatcaaaaa aatccttagc ggataattga ctcagttcga aatggctatc      6600
     acaagtaaat acagtacgtt tatgagtaac agttcgatta ggatcgaaaa actgaacaac      6660
     ccatttttca ctttcttgta cgcgctttat tttcaaccct aacgccattt ggtggtttaa      6720
     tgtgcatgct gataatgttc tgacaaagtc tccatttttt ttcatgttat aaaaaaaatt      6780
     agtaataact gttccccact ttttattttc cacaaaataa atataagctg gtgattttga      6840
     aaaatcttcc gttttttcca aacatacatt ttttgcaata gcatcagggg tgctaagaag      6900
     ctgatagttt accttcccat ttgtttccat aaaattcatt tcccaatagg aagctaggtg      6960
     acggcaaact atttgtcttc catatatatc ttttgccact ccatttatat ttaccttcac      7020
     atttctcttt tctgaaaaat aaggtgctgt tttattctta aactgaatta gttcactgga      7080
     gtttgagacc ctcataatag aacttgttat tgttctatta tctctgttaa cagacatatc      7140
     tgttgataac gaattttttg ttgaaaatat actagatgaa aatgttttat ttaacggcat      7200
     agaagacaac catagagatg ttataatact attagattgc agttactaat agtaaaagcc      7260
     tccttacaag gaggtagctt attcagaatg ctcctataag atagcgagct cgtcaacgat      7320
     acagatgatc tgattatatt gtgcaaaagg agaacaggaa aataggcact ggaaaagatg      7380
     aaggcctgat gggagcatta actaatgcaa aatccgacag gttaatatcc cgaaaagcaa      7440
     tcaaacgact caaacaggag atgcacgctg aagtggtgga caactgttcg gatttcagat      7500
     gagtagctca gcagtttatg agccgaatgc tctgtcacgg gcaggaatca ggctgcatac      7560
     gcagtgccaa atctaatcgt agttattcta accagttttc aagctacaag gtggtgtagc      7620
     tggcatcttc tctactctat catcaaacga taaaatggtt cctctcgtaa catttgctct      7680
     tgcctttcac ttccatctcg atcgcttcgt agttcattac gatagctgac atatttccag      7740
     tcttcaggtc taacatctga cgccggatac tccccgggag cgattttgct tcttaataga      7800
     ttagactcga gacacattat aaattgtcgt attttatgaa gtaataaagc actatattgc      7860
     gagcattcct gatctgattt tacatatagc gtaaactgag ctcctatccc cacacgagat      7920
     tgctgagaaa ctcgattcat atcagttatc ttccatttat ctataggact gtcctctgaa      7980
     aataataaac cagacaaaat ttggaatgcc agaggaactt gctccctagc tatactaata      8040
     tgaaacttgt ccccaacaaa atccccctta ctctgaggat tttcacgaca tgcatgaata      8100
     aacacatctc cactatggtt cacaatctgg aatccttggt acatgacaga aaaaaattga      8160
     catatatcag agtaatttgg cacgttcgat gctactttga aatagtacgc tgggtattgc      8220
     cgtatttggt tgtacaatat attgaagtta tttttcaatc tttcattcgc agaaagcatc      8280
     tgcggtattt cagacctcac aacattcaaa gaatctaaat ttagttttag acagggcttt      8340
     tttatgggca tagaaaacgt cctctataaa atagatatat tatcttatat tgattgtcta      8400
     tcatctttta taaaacgata cattatatgt aatgtatgta agcgtaaggg tcttctccga      8460
     tcatggtggg aaggcttaga acgccatatt cagtttccca tagtggaaca tcactcccag      8520
     cttaaagcgc tcccggttgc ggtagccctt ggcttttatt ctcagcagcc tgatcttgct      8580
     gttcagtgct tccgcatttc cgtttgatac gccatggcgc atggcgttca ggataccgta      8640
     caaccttttc cctatcgttt tagccacatt cttcatcatg gggacgtcac tgttggccgc      8700
     cagcgacagc catctctgcc agtcgttgcg tctttcctcg ctccatggtc tgctccagat      8760
     atcctttgcc agttctttca gcgcccagca caggctcgtc agcttcatct gcgcacgcag      8820
     ccatatcagc ttttcctgcc tggattcggt catccattta ttgctgtgct gccacaggaa      8880
     gcgagttccc tttgcctgac gacgactttc aacaggaaga tgcggatgtt cattctggcg      8940
     ggttttatcc accacctcac ccggttgttt cgccacatga aagcgatcga aggctatttt      9000
     ctcaaccgca ttgggtaagt ggatgcgcgc tgctcttagt ttgctgagcc agtttagcat      9060
     tgccttctac atgaccgatg cctgagccgg tataccgaac tttattgtcc tcaaccagtc      9120
     atgttataag caagaaatgc actcagcgga tagagcgaca taatctgaac ctgcggacac      9180
     atcttaagcg gcttacccgc aaaaccatat gcttctcaaa gtctgatgat atgcactaca      9240
     agatcatcgg ctggtatctg acaatcaacc accaccacta aatctgcgtc acgacctgca      9300
     actgagtctg gttgaacagg ctgaggccct gctgaagcaa cgcgaacctc tcgactcttg      9360
     ttggatttta ccaaatagtt tttctaaaat taaacacatt tatataagtt ctttgctgaa      9420
     caaaacgcag cccgccatcc tttttcattc ataaattcag caatggcaga taaaactttt      9480
     tcatcaagca tataaaaaat aatgccagta gactcaatat gcctcataca aataaggccg      9540
     cacatatccg taatatattt gtcaatgctg ctataatttg catggtaata tgccatgcta      9600
     ttatctgatg attttacata tgcagtatga catatttttc cttcacgatt aacaaaactg      9660
     acaaaaccac tttcaccagg agtaatatat aaagatgaat ttaacgtgcg ctcactaata      9720
     ttcattaatt gttgaaattc aatggaatag ttttcagtta atgtatctat tatcttggct      9780
     ttgtctttct ttgttatctc attgtctttt tcggcaagaa aaattgccac tttatgacat      9840
     gcattcagct cgttaatttt acctgataaa actgcttttc ttaccacatc gttgaactca      9900
     tcgatagtgt gttttttatt atatatatca tgaaaaatat agcctaaaga cttaaacgag      9960
     actttcattt tattttatat tctccttaaa tattaacagg atatatatat cacattttcc     10020
     tctatatttt cagaaaccag ctatcatttt ccccattact ggtacgtcgc ttcagatatt     10080
     tccgcagcaa gcgataaccc tgcgcactat gaggatgcca ttcattataa tgtttgaaca     10140
     ccttcgcgag actactttac tgctgttaac acgtcaggtt cgaacataac actgatttaa     10200
     tcatatttca tcgttttgac gaagttttct gccattccat tttgcaccgc cgtgtgtttg     10260
     ggggcaaggc cgaccatctg tgtttcattc gccagatata agtgatgaga tggcattctc     10320
     cctccttcac ggcagaagca ttttgaccgt ttaggggatg cggacgattt tcatgcctgc     10380
     taagatactt tcgttactga tgctgtccgt tttccaccat ttcatcatca ctgattggcg     10440
     ttgtgttttt ggtcagcact ccagctttac gtttctcttt taaccggtaa ctctctcctt     10500
     tgatattcag cgtgtagcag ccgatctaaa tagctgcgcg gaatagtaga tcactttgag     10560
     ggaacttagc ccggattgtg cgatctgatc aatcgccaaa tcaaaacaaa tcaccaaccg     10620
     gactgagcaa tgccgatcat agcaccaatt tcccgtgacg aacgacgcct gatgcagaaa     10680
     gccatccata aaacacacga taaaaattat gcccgcagac tgactgccat gctgatgctg     10740
     caccggggcg accgtgtcag cgacgctgcc agaacgctct gctgcgcccg ttcctctgtt     10800
     ggacgctgga ttaactggtt cacgcagtcg ggtgttgagg gactgaaatc attacctgcc     10860
     gggcgtgccc gtcgctggcc gtttgagcat atctgcacac tgttacgtga gctggtaaaa     10920
     cattctcccg gcgactttgg ctaccagcgt tcacgctgga gtacagaact gctggcaata     10980
     aaaatcaatg agataaccgg ttgccagtta aatgccggaa ccgttcgccg ctggttgccg     11040
     tctgcgggga ttgtgtggcg aagggctgcg ccaactctgc gtatccgtga cccgcataaa     11100
     gatgaaaaga tggcagcaat ccataaagca ctggacgaat gcagcgcaga gcatccggtc     11160
     ttttatgaag atgaagtgga tatccatctt aatcccaaaa tcggtgcgga ctggcaactg     11220
     cgcggacagc aaaaacgggt ggtcacgccg ggacagaatg aaaaatatta tctggccgga     11280
     gcgctgcaca gcgggacagg taaagtcagc tgtgtgggcg gcaacagcaa aagttcggcg     11340
     ctgttcatca gcctgctgaa gcggcttaaa gcgacatacc gtcgggcgaa aaccatcacg     11400
     ctgatcgtgg acaactacat tatccacaaa agccgggaaa cacagagctg gctgaaggag     11460
     aacccgaagt tcagggtcat ttatcagccg gtttactcgc catgggtgaa tcatgttgaa     11520
     cggctatggc aggcacttca cgacacaata acgcgtaatc atcagtgcag ctcaatgtgg     11580
     caactgttga aaaaagttcg ccattttatg gaaaccgtca gcccattccc cggaggcaaa     11640
     catgggctgg caaaagtgta gcggtattaa gcgcagctat ttaggatcgc tgttgccagc     11700
     acgtgatctc cgaacatttc tccccagtct gcgacccctt tgtttgacgt cagtatgatg     11760
     ctcgcttttt catatcgaca gttcatcgat aggaatttaa atccccaaaa gattaaaaaa     11820
     gcaccgaaga atgcgcgttt attcaacaca acctgatcat caagtaatcg gtatagacac     11880
     ttaatattgc ttacattgat tgattcaatg tatctctgat ggttttttgc tctgttcccc     11940
     tcaacatgga cgcaacttcc cctctgcgac tctcagccgc accaccgtat tcgagccagc     12000
     ggctcatgca tcataacctg ctctgccaga cggtaacccc tcttcagccc cgtaaaccgc     12060
     atctgacctc cgcacagctc gcacttcagc gggtcaacct tcagtcactg ctgatacatc     12120
     cctctccttg tgatttgcct cgccgttttt ctcactgtct ccgttatggc gtacaccaca     12180
     tcttccagta atcgccgctt caccggactc aggaccccgt atcaccatcc ggaacccctt     12240
     atccgccaca tgccaggaga acctttccat aaactcgtcg ccactcatca caaggttttc     12300
     ttctcgtttt gtccggtggc tgttgtaacg caggccaatt tcatcctgac cggcataatg     12360
     ttccaggcgg ctcatctgca ccgactgctt ctccagccag ttaagccatc ggtttccctg     12420
     ctgaaaaata tcggcaaaac ggggaagcat cagaaaggcg gaataacgcc atccggccag     12480
     tgaaccgtac cgcattcagg gcaatacatg ccgtcggcgc tgataccggc aggaattgtc     12540
     gcaaattccc gctccatgca gcgggcaatt tccggatacc cttcgtcatc aacacgtaca     12600
     aaccagaaga ccagtttttt gtttccggca tccacaaaga acggaatatt caggtctgcg     12660
     caacactcaa cggcatcgtc aaaattatca aagcgcagaa cctcagcttc ttcgtaaccg     12720
     gctcatttaa accgtctggt ctgtttcctc cggctccaca aaaataatgt ccatcatttt     12780
     gaagtggaca ctatcgtatg gaataccgga cctggatcac tgaagcttta cgccttcatt     12840
     tcgaagaaca tttaccacgg gttgtggccg gacgtcgcct gggcgtacca aaatcaactg     12900
     tctgtggtat gttcgtgcgc ttccgcaacg ctggcctttc atggcctctg cccgcaggta     12960
     tgtcggagca ggaacttgat gcccttcttt acggaagtgc ctccacagta cctgtcgtac     13020
     ttactgaaag caccgttatg cccaaactcc cggtggtaaa aaaacgtccc cggcggcctt     13080
     aatgccagtc agttaagcaa ctgactggct ctttttcggg gctgtggggt atttccaggg     13140
     cctctccttt accactctcg ggaaggccct ttcccttctc gtcggtaatt tcacaagttg     13200
     tcccatactt gcaagatcgc gcatcagctc cggtatacgt cccggtgaag cgccctgcaa     13260
     tgtcatcagc attctcatca ccattccgca tgattctgag aaactcagtt gattcggcca     13320
     gtaacctttc agatgttccg ccattttaat catctgatat ctcaccagat tataagccag     13380
     taagacaccc cacagctctt gctccacaag ctccggcttt ttacttctca gcgtcagcct     13440
     gctcagttgc atcgtctgtt ttatctccct gtatcccagt tcgatttccc agcgatgact     13500
     gtacagatcc gccatttctc ctccggggaa gcgcatggcg tccgtcatcg acgtcagcag     13560
     atggcagact tttcctttgc gcgtcacggt cagcaggcgg gctgtcactt catttcccag     13620
     tcccggccac ttttttcgtg cctgcgggct ggttttcagc ttcaccagat gatcgccttt     13680
     acccagtttt ctgagctctt catattgcgc tccctttcct caggcttaaa ggtaaactga     13740
     ctccggcgtt attacagata cttatccgcg aaataaaagg gagcagccac tgatgatatc     13800
     tttccctgca ggttcgcgta tctggctggt tgcaggtatc accgatatgc gaaatggctt     13860
     taacggcctg gcctcaaaag ttcagaacgt cctgaaggat gacccgttct ccgggcatct     13920
     gttcatcttc cgcggacgcc ggggtgacca gataaaagtg ttgtgggctg acagtgacgg     13980
     actgtgcctc tttaccagac gcctggagcg gggccgcttc gtctggccgg tcacccgtga     14040
     cggcaaggtg caccttactc cggcccagtt atccatgctt cttgagggca tcgactggaa     14100
     acacccgaaa cgaacggaac gcgctggcat ccgcatataa cccgttgtaa agtgaggata     14160
     tggacacctc acttgctcat gagaatgccc gcctgcgggc actgttgcag acgcaacagg     14220
     acaccatccg ccagatggcg aaatacaacc gcctgctctc acagcgggtg gcggcttatg     14280
     cttccgaaat caaccggctg aaggcgctgg ttgcgaaact gcagcgcatg cagttcggta     14340
     aaagctcaga aaaacttcgc gcaaaaaccg aacggcagat acaggaagca caggagcgaa     14400
     tcagcgcact tcaggaagaa atggcggaaa cgctgggtga gcaatatgac ccggtactgc     14460
     catctcccct gcgccagtct tcagcccata aaccgttacc tgcctcactt ccccgtgaaa     14520
     cccgggtcat ccgtccggaa gaggaatgct gcccggcctg tggtggcgaa ctcagttctc     14580
     tgggatgtga tgtgttagag cagctggagc ttatcagcag cgcctttaag gttatcgaaa     14640
     cacaacgtcc gaaactggcc tgttgccggt gtgaccatat cgtgcaggca ccggtgcctt     14700
     caaaacccat tgcacgcagt tatgccggag cggggcttct ggcccatgtt gtcgctggaa     14760
     aatatgcaga ctatctgccg ttataccgcc agtcagaaat ataccgtcgt cagggcgtgg     14820
     agctgagccg tgccacactg gggcgctgga caggtgctgt tgctgaactg ctggaaccgc     14880
     tgtatgacat cctgcgccag tatgtgctga tgcccggtaa agtccatgcc gatgatatcc     14940
     ccgttccggt ccaggagccg ggcagcggta aaacaaggac tgcccggctg tgggtctacg     15000
     ttcgtgatga ccgtaacgcc ggttcggaaa tgcctccggc ggtctggttc gcgtactcac     15060
     cggaccggaa aggtatccat ccacagaatc atctggccgg ttacagcgga gtgcttcagg     15120
     ccgatgctta cggtagttac cgggcgttgt acgaatccgg cagaataacg gaagcccagc     15180
     agcgtatcgg tgaactgtat gccatcgagg cagaagtccg gggatgttca gcagaacagc     15240
     gtctggcggc aagaaaagcc agagccgcgc cactgatgca gtcactgtat gactggatac     15300
     agcaacagat gaaaattcat tcgctgaaaa tggaatgtct ccacggagaa cactattatc     15360
     catcgggaaa tagtgcgggc aacagtgttt agttatatcg agtgcgatta caatcgctgg     15420
     cgacggcacc gttggtgtgg tggtctcagt ccggaacaat ttgaaaacca gagcctcact     15480
     tacgactgtg tccatattat gtgggtagga tcaataaaga cgttttatat gtgtctgctt     15540
     gcagccagaa aatttatacc ctgcaggtat cataaacatg cttgacaact taattagggc     15600
     cccctcttcc ttttatggtg taattgtttg attgaatact tccggggatt tcagtatgaa     15660
     atgaagtata tttaatatac tttacaaaaa gtttgtatta gtggaataag aacaatagtt     15720
     tatccaaact gccaagcccc tttattataa gtaagatctg gcactggaat attctcaaaa     15780
     ggactaacat catcaccacg accttcaacc aaccataaaa aacaatacta ttttaggtga     15840
     tgtattaaat tagtagaata tttattcttc tataaaagca ctaccccaag aggttaatca     15900
     ggtcatccat gattatttat catatactaa ctatgtggga tttcaacgtg aaaacttatt     15960
     ttcactataa tcttcaggat tcgaagatca taggagcctg tacataagtt tgtataattc     16020
     tctgatgttg aactatttaa tttgatatca aatgaaggtg aatttatgaa tgaaaaacag     16080
     ttgacatcta ataagttgcg ggctttagct aatgaactag ccaaaagtct caaaaatcct     16140
     gaagatctca gtcagtttga ttggatgctg aaaatgaaac cgtactcaat gctaatatga     16200
     ctcatcatct tgggtgcgag aaaaatcagc ttagatctgg cagcaattcc cgcaatggtt     16260
     gcttaacgaa gattatcact actggagatg aacctctgga aatccgtact ctgcgtgatc     16320
     gtaatggcac tttcgaaccg caacagctga agaaaaacca gccctagatt actaaatctg     16380
     tcgggcgatg gattaactgg ttcaggctgt ctgatgctga aggcctgaag tcactgctgt     16440
     cagtgatgtg gccggctctt catgagacaa taacccgtaa tcatcagtgc cgttcaatat     16500
     ggccactgtt gaaaaaagtt cgtcacttta tggagacggt tagcccactt cccggagaaa     16560
     aacatagtct ggccaaagtg tagcggtatt aggctcacat atttagatgt agataagccg     16620
     gagctggcag ttaaatctag gcagcatcac agaaatggac aacgcccctt aaggactggc     16680
     gtatggcaat gagctgcttt attatcaagt ttggtgatcg ccttgacggt cacttctgag     16740
     tgaaggcgct tgcacagaat ggtaaacgga ctcgattatt gaatcttagg gataagatat     16800
     atctacgata tgtcaatata cgaaatcgaa agaatttatt ggtgaatata gccattcaat     16860
     gtggcaatgg tttttttaga ttggcaatag actaatatct attacattac aaaaataggt     16920
     tattgttttt tttagcaaaa aggatgaaca aaaatgtcaa taaataacta tggattacat     16980
     ccagcaaaca acaaaaatat gcacctaata ataggcagca atactgctaa tgaaaataaa     17040
     ggaatgaaaa gtaatatcat taacgtgaca aattccgcta tatcccacgc catcaatgaa     17100
     gaaaaatcag gggggggata tagtggtgtt tctttcagaa aattggccaa aatacagagc     17160
     atatccattc cgacaaagaa taataaggag tataaccgcc ataatttgtt ttcattgatt     17220
     tggcatggaa atgccgatgc agcgcgtaaa tacggtgaat cgctgttggc agccgaaata     17280
     cccaaagagg aaaaactaga agttcttgca gcacgaaata atgctgggga atctgctttg     17340
     ttcatagctc ttcaagaagg tcattccgct gcgattcaag cttatggaga ttttattaaa     17400
     acttttgatt tatcaccaaa agaaacgatt aaactattgg atgtaagaga taatgagggt     17460
     ttaccaggat tatttctggc cgcagggaaa gggaatatcg aggctatgat ggcatatata     17520
     aatatatgcc atcatagtgg gataaaactt acagaaatag cagacagact taacaataat     17580
     gaacaagaca tgtttaatat tatttctgac aaaatacaag agttgtttta agtgtgctaa     17640
     atagctgcaa agaattgcac ttagaaggat ctctccccga attgtgtgat ctgcttaatt     17700
     tctaaaaaga aacaaacagt taactagact gagcgatact acccatagaa ccagtttccc     17760
     atgacgaacg acactggacg caaaaacaat cataaaaaac acaataaatg taatgaacac     17820
     atcccaccct attaagtaaa gtgcactgtg atagaggaag ggaaatacag gaaggtgtgg     17880
     agcctcgcag atttctggca tcatagtgcc caatacggaa tgcataaagc cccctcagac     17940
     tggagactcc acaaatgaaa tatacagtgt ttaattatat caagtgcgat tacaatcgct     18000
     gacgacggca cagttggtgt ggaggtctca gtcctgaaca atttgaaaac cagaacctca     18060
     cttaagcctg tgttcatatt acgtgggtag gatcatactt ttatagaagc tgtcagcggc     18120
     tacgtcccag ccaaatcact tcatgctcca gcgccagaga ggcaaggttg ggtttgctca     18180
     gctgccggtt gattttgttg cgattgaacc ggacagcgtc cagggcgtcg gcaaaagagc     18240
     gaatctcacc aatcgttgtt tcattatccg cattaacgat agcttcaaga aacgccaagg     18300
     ttttatcgaa ttcatcagca acagtggctc cgggcatacc gtgaccgttt atacaaaacg     18360
     gcgttttcag cgtggagttt tcatgaatag cctcaacacg aatgtcgtga agccagtgat     18420
     gtatcggcta cgatcctcag ctgatgccag accataggac tgacactacg aacagcaatt     18480
     ttaatgacgt aaatcttcat aactacaact aacagggcat cattatgaat gatgccggtt     18540
     attttaccgc tgttggtccc ttcatttagg gactgcccca agttttttca tactctcttt     18600
     ctcagagagt ttagtctctg ggattccaga cggtccatca ttgagccaag ggagtaaaga     18660
     actcaaagca tttacagaat tgtttgaatc agctaaaata atgacaatgt tactattttt     18720
     acatgacaaa gtgattataa tgcttggaac atcttttaat aattttggaa tcagtttatc     18780
     tcacaaaaga tatttttcag gaaaggtgga tgagattatc cgctgtacaa tggggaaaag     18840
     gatagtaaaa atatcatcaa ccaaaataaa tactagtatt ttgagctctg tttcagaaca     18900
     aatcggtgaa aatattacag attggaaaaa tgatgaaaaa aaagtctacg tatcccgggt     18960
     ggtaaaccaa tgtattgata agttttgtgc agaacacagc cgagaaatcg gcgataacct     19020
     ccgtaaacag atatttaaac aggttgagaa agattatcgc atttctctag acatcaatgc     19080
     tgcacaaagt tccataaatc atcttgtatc aggaagcagt tatttcaaaa agaaaatgga     19140
     cgaactttgt gaagggatga atagaagcgt taaaaatgat acaacaagca atgttgcaaa     19200
     tcttatttcc gatcagtttt ttgagaaaaa tgtgcaatat attgatctaa agaaattacg     19260
     tgggaatatg agtgactata ttacaaattt agaatcgcct ttctgatgac agaacatccc     19320
     gagtaaagaa actaagaaaa gtaaataccc aggaattgcc tgagcggtgc tatatttctc     19380
     ctcgcaagta agtcctaata tattgaattg ttgtatagcc agtttttgta ttttcctagc     19440
     tcatggatgt gggatccctc tcccctttct ctgctcaaag gtaagcggct cgtcagaatc     19500
     atattgatat ttactgagaa gtcagatcaa ctttccaagg caacagatcg cgtacccggt     19560
     ttgccggtca gtcctggata tgttcaataa cgtaacgcag ccatttttct ggctccacat     19620
     tgttcagacg gcgtgtgccg atcagcgaga acaacaccgc tgcatgttcg tcaccgctgt     19680
     cggaacctgc gagtcgagtc agccggagag agtttcactc tccagctgct cacggaaccg     19740
     tacgtgacac tctcgcgtca tacggctctt gatcactcat tcgatgcacg tagtaaatac     19800
     cagtgagcaa attgatctta cccagcaata gtggacacgc ggctaagtga gtaaactctc     19860
     agtcagaggt gactcacatg acaaaaacag tatcaaccag caaaaaaaca cgtaaacagc     19920
     attcgcctga atttcgcagt gaagccctga agcttgctga acgcatcggt gttgctgccg     19980
     cagcccgtga actcagcctg tatgaatctc agctctatgc gtggcgcagc aaactgcagc     20040
     aacagatgac ctcgtctgag cgtgaaagtg aactggccgc tgaaaatgcc cgcctgaagc     20100
     ggcaactggc ggagcaggca gaggaactgg ctatcctcca aaaggccgcg acatactttg     20160
     cgaagcgcct gaaatgaagt atgtctttat tgaaaaacat caggctgagt tcagcatcaa     20220
     ggcaatgtgc cgcgtgctcc gggtggcccg cagcggctgg tatacgtggt gtcagcggcg     20280
     gacagggata agccctcgtc agcagttccg tcagcactgc gacagcgttg tcctcgcggc     20340
     ggcctttacc cggtcaaaac agcgttacgg tgcaccacgc ctgacggatg aactgcgtgc     20400
     tcagggttac cactttaacg taaaaaccgt ggcggcaagc ctgcgccgtc aggggctgag     20460
     ggcaaaggcc tcccggaagt tcagcccggt cagttaccgc gcacatggcc tgcctgtgtc     20520
     agaaaatctg ctggagcagg atttttacgc cagtggtccg aaccagaagt gggcgggaga     20580
     catcacgtac ttacgtacag atgaaggctg gctgtatctg gctgtggtca ttgacctgtg     20640
     gtcacgtgcc gttattggct ggtccatgtc accacgcctg acggcgcaac tggcctgcga     20700
     tgccctgcag atggcgctgt ggcggcgtaa gagaccccgg aacgttatcg ttcactcgga     20760
     ccgaggaagt cagtactgtt cagcagatta tcaggcgctg ctgaagtggc ataatctgcg     20820
     tggcagtatg agcgcaaagg gctgctgcta cgataatgcc tgcgtggaaa gcttctttca     20880
     ttcgctgaaa gtggaatgtc tccacggaga acactttatc agccgggaaa taatgcgggc     20940
     aacagtgttt aattatatcg aatgtgatta caatcgctgg cgacggcaca gttggtgtgg     21000
     cggcctcagt ccggaacaat ttgaaaacca gaacctcgct taggcctgtg tccatattac     21060
     gtgggtagga tcacttacgc cctgtggttg aaacgtgagc atattgtttt cagatgctgt     21120
     tgtcttgctt cagagtgatc tgtcctccgg atttacgcaa agttatccac aggcactgtg     21180
     catttaaaaa acttatcttt tcttcttgat tttaaaaact cagatcgtca tatcattatg     21240
     ataaacataa taaaaaactc taaacatgag aaggttttta acgtaaggtg agaggatttt     21300
     taagtgtatc catagattaa aaatgacaat gcctccaatt agttgaatta ggggttataa     21360
     tacccgcttt taaggttctt tcatggtcac agttaacctt cattgccccc gttgccagtc     21420
     cgttcaggtt taccgtcacg ggcagaaccc aaaaggacat gatcgattcc gttgccgtga     21480
     ctgtcaccgg gtgtttcagc tcacttactg ttacgaggcc cgtaaaccgg gagttaaaaa     21540
     ccaaatcact gaaatggctt tcaacggtgc cggagttcgc gatactgccc gtacgctgaa     21600
     aatcggcatc aataccgtca tacggacatt aaaaagctcc cgccccggcg gataacatct     21660
     gcgccagtcg ctcacgctga tgttgccctt atctgtgaac ttgatgggca gtggagcttc     21720
     gttggcagca aggcgcaaca acactgtcac gaacggtgca atagtgatcc acacccaacg     21780
     cctgaaatca gatccagggg gtaatctgct ctcctgattc aggagagctt atggtcactt     21840
     ttgagacagt tatggaaatt aaaatcctgc acaagcaggg aatgagtagc cgggcgattg     21900
     ccagagaact ggggctctcc cgcaataccg ttaaacgtta tttgcaggca aaatctgagc     21960
     cgccaaaata tacgccgcga cctgctgttg cttcactcct ggatgaatac cgggattata     22020
     ttcgtcaacg catcgccgat gctcatcctt acaaaatccc ggcaacggta atcgctcgcg     22080
     agatcagaga ccagggatat cgtggcggaa tgaccattct cagggcattc attcgttctc     22140
     tctcggttcc tcaggagcag gagcctgccg ttcggttcga aactgaaccc ggacgacaga     22200
     tgcaggttga ctggggcact atgcgtaatg gtcgctcacc gcttcacgtg ttcgttgctg     22260
     ttcccggata cagccgaatg ttgtacatcg aattcactga caatatgcgt tatgacacgc     22320
     tggagacctg ccatcgtaat gcgttccgct tctttggtgg tgtgccgcgc gaagtgttgt     22380
     atgacaatat gaaaactgtg gttctgcaac gtgacgcata tcagaccggt cagcaccggt     22440
     tccatccttc gctgtggcag ttcggcaagg agatgggctt ctctccccga ctgtgtcgcc     22500
     ccttcagggc acagactaaa ggtaaggtgg aacggatggt gcagtacacc cgtaacagtt     22560
     tttacatccc actaatgact cgcctgcgcc cgatggggag cactgtcgat gttgaaacag     22620
     ccaaccgcca cggtctgcgc tggctgcacg atgtcgctaa ccaacgaaag catgaaacaa     22680
     tccaggcccg tccctgtgat cgctggctcg aagagcagca gtccatgctg gcactgcctc     22740
     cggagaaaaa agagtatgac gtgcatcctg gtgaaaatct ggtgagcttc gacaaccccg     22800
     ttactttatt cgtacccctt ataatggggt gttagccagc cagacccggc atgattactg     22860
     cccccagtcg tccatgatcc ggggggtgat gtcaccgggt ctggtggggc gctggtaacc     22920
     gctaataggg gtcaggtcag gcacttttgc cgggaccgtc tgtaacgtgg atgccggtac     22980
     ctgctccccg tggttatctg gttaacccat atacaaggga gacagaatga ccgaatccag     23040
     cgattacgaa tccgtccagg tctttatcgg cgttgatgtc ggtaaagata cgcatcacgc     23100
     tgttgccatt aatcgttcag gtaaacgcct gttcgataaa gcattaccca acgacgaaaa     23160
     caaactcagg tcgctaatat ctgacctgaa acaacatggt cagatactgc tggttgttga     23220
     tcagccagct accatcggtg cgttacctgt cgccgttgcc cgctcagaag gagtccttgt     23280
     cggatacctc cctggactgg ccatgcgccg catagccgac ttacacgccg gtgaagctaa     23340
     aactgatgct cgtgacgctg ccatcattgc cgaagctgcc cgtaccctgc ctcacgcgct     23400
     acgcacgctg aaactggctg acgagcaaat cgccgaactc tccatgctct gcggcttcga     23460
     tgatgatctt gccgcacaga caacgcaggc cagcaaccgt atccgcggcc ttctgaccca     23520
     gatacatccg gcactggagc gcgttctcgg tccgagactt gagcacccgg cggtactcga     23580
     tcttctccag cgatatccct caccagaaaa actcgcttcg ctgggtgaga agaagctggc     23640
     agcccagctc tgcaaacttg cgcctcgtct gggtaaacgc cttgcagcag acatagctca     23700
     ggcactggcc gaacaaaccg tcgtcgttcc cggcacgaat gccgctgccg tagtactgcc     23760
     acgtctggca ctccagctca tcacgctgcg taagcaaaga gacgaggtgg cgcttgaggt     23820
     agaacagcga gttcttgctc accctcttta cccggtcctg accagtatgc ccggagtcgg     23880
     tgtcaggacc gcagccagac tcctcaccga ggtcgcctgc cgcgccttcg cctctgccgc     23940
     acatctcgct gcttatgctg gccttgcgcc ggtaactcgg cgatccggct cgtcaatacg     24000
     cggtgagcat ccctcgcgac ggggtaataa agctctcaaa cgggcgttgt tcctgtcggc     24060
     cttcgccgcg ctcagggatc cgctctccag ggcttactac acccgcaaaa tgagtcaggg     24120
     aaaacgacac aatcaggcgc ttatcgccct ggcgagacga cgctgcgacg ttctgttcgc     24180
     catgatgcgc gacgggactt tttatacccc gcaggggtca taacatgctt gacaacttaa     24240
     taggggcacc ccccagcatc atccactctc catctacgac tcattctgca gaggagtggc     24300
     gtgatgatgg aactgcaaca tcaacgactg atggcgctcg ccgggcagtt gcaactggaa     24360
     agccttataa ggcagtatga ctttccgtga gacagatgct ggccaacgtg ggatatttaa     24420
     cgcgggttaa catcgttgtc agagccgcat gggtgagctg ttgctacacc ccggtatttc     24480
     caccacggag gccagcatga acaacaataa cacattgtac gtcgggttag atgttcacaa     24540
     agaatcgatt actgtcgctt atgctatcaa ttcagaacct gttgaactga tgggtaaaat     24600
     tggcacatca cctactgata ttcagaatct ttgtaaacgt ctcaggtcaa agtcatcgca     24660
     ggtcagtatc gtttatgaag cggggccctg tggttatgga ctttatcgtc ggctggtgaa     24720
     atccggtttt gactgcatgg tctgcgcccc ctcacttatc ccgaaaaaac cgggggagcg     24780
     ggttaaaacc gatcgccgtg atgccatcag acttgtgcgt tcactgcgtg caggagatct     24840
     ttctgctgtc tacgtacccg gcattgaaga tgaggcattc cgggatttgg cccgggcatg     24900
     ggcatctgcc cgcgatgatt tacggcatgc aaggcaacgt ctgaaatcgt ttcttctggt     24960
     tcatggggtc cattatgtcg ggcgagcaga ttggggccct gcacaccgac gctggctcag     25020
     caaatactca ttcgaaagtc cctggcgaca attagctttt gacgaacacc gtcgtacaat     25080
     agaagatcgg caggcacaat gtgaacggct ggaatccgcc ctgaaggagg ccgttaccga     25140
     atggaggctg tatccggtag tagaggcgct gcaagccatg cgagggattc agtttattac     25200
     tgcggttgga ttaatttctg aactgggtga tctgacccgt tttgaacatc cacgacaact     25260
     gatgtcatgg tttggtatca cgccatcaga atattcatcg ggtggaagca gacatcaggg     25320
     cagcattacc aaagccggaa acagctatgc cagaaagcta ttggtcgagg cagcgtggag     25380
     ttaccgtcat ccggcacgca tcagtccggc aatacaaaaa aggcaggaaa atttaccccg     25440
     ccccgtcatt gacagagcat gggatgctca actcaggctt tgtaagaggt atcgaaaact     25500
     tcaggccaaa ggaaagaatg tcaatattac aattgttgct gttgcacgtg agctggcggg     25560
     ttttatctgg gatatgggcc gaatagcaat gtctgtcgca caacaaccac aatgtcacaa     25620
     ataaaaaatg agaataacca gttccctgaa ggcgacgtag cccggtacaa gagtaacgca     25680
     cgttagcgct tggcgacggc ggaacaaagc tgattcgcga cgtaagaaag tggcaggctc     25740
     atatgacgga cctctgtaat gcggtatcca acccgcgaat atcagcgtga ttcaccgtcg     25800
     gattatttcg ttcaaatcaa aggagaaagc tatcgactca gacagaaacg aaaggccggg     25860
     gttatagcag aagctaatcc tgagtaaaac ggtggatcaa tattgggccg ttggtggaga     25920
     tataagtgga tcacttttca tccgtcgttg acacaacact ggctctggta tgcgtacaac     25980
     actaaaactg gcggtgtgtt ggcttacact ttcgactttc gggccacgga atgatgagac     26040
     ctgtcgggaa ctgttagccc tgttgactcc gttctgtatc ggcatggtgg catggtgacc     26100
     agcgatgact ggggcagcta cgccagagaa gtgccgaagg agaaacacct gaccggcaaa     26160
     atcttcacgc aacgcattga acgtaacaac cggaccctcc gcacccgcat caagcggctg     26220
     gcacgtaaaa caatctgctt ctcgcgttcc gtggaaatcc acgaaaaagt catcggctcc     26280
     ttcattgaaa agcacatgtt ctactgattg gaagcactac ccccgcctgt tgcgacagtc     26340
     acgtcatcgc cgtccgttac cggaacatgt ttcccgcgaa atacaccatc tggagcctga     26400
     agaaagctgt tgtccggagt gtggtggtga actggattat tcgggggaaa tcagcgtctt     26460
     tctcccggaa aggcatacta tcttacagta atattcattc cgatgattaa taaatcagca     26520
     atgcgcgcat ttttaatata agcatgtaca atatgtactt gcatgcatta ccctgctaat     26580
     gcagtttttt ttgtaataag ttaaaatcct acatagcacg gagggggaat gactagtttt     26640
     gagcagttaa gtaaggttgc gcagcgtgca gataaaatgt tgctcgccct aacaaaacag     26700
     attcaggagc aaaagcagga gtttcaggct gatgtttttt atcaagtcta ttcaaagtct     26760
     gctgtagcta agcttccaaa attaacgcgc gcaagcgtgg atggtgcagt cggtgagatg     26820
     gaggctcagg gctatcagtt tgaaaaacgc ccagcaggaa ccgcgacaaa atatgcatta     26880
     accatccaga acattatcga tatctatgca catcgtggca ttcctaaata tcgcgatcgt     26940
     tatagtgagg catattccat attcatcggt agtctaaaag gcggtgtgtc taaaaccgtg     27000
     agtagtgttt ccgtagctca cgccctgcgt gctcatcctc acctgctgtc agaagattta     27060
     cgtattctgc tccttgattt agatccccag tcatcagcca ctatgtttct gaactacttg     27120
     catgcggtgg ggctggttga tacaaccgca ccgcaggcta tgttgcagaa cgtgagtcgt     27180
     gaggaactac tggaagattt tatcgttccg tcagttatcc ctggcgttta tgttatgccg     27240
     gcttctattg acgacgcctt tattgcatca aactgggata ctctgtgcga ggagcatcta     27300
     ttaggacaaa acaaacacgc gatattgcgt gagaatatta ttgataagct gaagcatgat     27360
     ttcgacttca tccttattga tacaggcccg catctggacg catttttgaa aaatgccatt     27420
     gctgccgcag atatcatgtt tacaccggtg ccgccagcac aagttgattt ccattccacg     27480
     cttaaatatt tggctcgttt acctgaactt gtacagatta ttgaacagga tggatgttca     27540
     tgccgtttgc aggcaaatat tggcttcatg tcgaaactgg cgaataagtc agatcataaa     27600
     tactgccata gcctgacaaa agagattttc ggtggtgaca tgcttgatgt ttcaatgcca     27660
     cgtcttgatg gttttgagag aagcggcgag tcgtttgata ccgtgatatc tgcgaatcct     27720
     gttacttatg ttggcagtgg tgaagctttg aaaaatgcac gtatggcagc agaagatttc     27780
     gctaaagcag tttttgatcg tattgaattt ataagggcca actactgatg gaaaacagaa     27840
     agcaccgacc gactattggc cgtacgctga atacaaatat cctgaataat actgaagaaa     27900
     tatcggctcc agttcatgta tttaccctca atactggccg aaaggcaaaa tttactgaga     27960
     tcaaggttga tcatgacaaa gtggacactc aaacttttgt ggttgaagag gtgaatggcc     28020
     gcgaacagac agccctgacg ccggactcac taaaagacat caccagaact atacatttac     28080
     aacaattcta tccatgtatt gggattcgga ctggcgatct tattgagatt ttggatggtt     28140
     cccgtcgtcg ggcagcagct ttgctatgca aggttggatt acgtgtactt gtaacggatg     28200
     atgagcttac tgtttctgaa gctcagcatc tggcgaaaga tttgcagacg tcacttgaac     28260
     ataatattcg tgaaattggg ttgcgtttag tacgtctcaa agaggccggt atgaaccaga     28320
     agcaaattgc ggaaagagag ggattgtcgg cagctaaggt gactcgtgcc ctccaagcag     28380
     cgtccgtacc taaagatttt gtgtctcttt ttcctgttca gtctgagctg acatacgccg     28440
     attacaggca actggctgaa ttaagtgaac gactgaggct gggtgatata tctattgatg     28500
     aagttgtgaa gaatatctcg ccgagtattg agcttattac tgctgatgac aatctttctg     28560
     aagacgaggt taaaaacagt attatgcggc ttataaccaa ggaaatgtct tcattgcttg     28620
     attcaggagt aaaggataaa gcggttgtaa ctttgttatg gaaatttgat agtaaagata     28680
     aatttgctcg aaaacgagta aagggacgta cgttctcata tgaattcggc agattaccgt     28740
     tggaagttca ggataagtta gatcgtatga ttgctcttgt actaaaagat aatctgaatt     28800
     cgctgtgaaa attcaagttt ttcgccagca actcaccagt ttttaattgg ctgttttaaa     28860
     agaaattttg cttttattag cgtttttttt gaacagtatt tcacggtgaa atcgcctgtt     28920
     tcaccgtatc ttctttgctt gaaaaagata gtttctctta gccgtttaac agtaaccgat     28980
     gagatagtct tccccctctt tcacggcagc cttcaattgc gccatgatgg ataaacttta     29040
     accacaaaag taagcggaat accatgtctg aacagaaaat caccggcatt gatctggcta     29100
     aaacgaactt ttatcttttc agtatcaatg ctcatggcaa acccgcagga aagaccaaac     29160
     tttctcgcaa tcaactgctt aactggctgg tgcaacagcc taaaatgact gttgcgatgg     29220
     aggctggcgg ggcatctcat tactgggccc gggaaatcag gaaactcgac catgatgtaa     29280
     tattgcttcc ggcacaacat gttaaagctt atcagcggtg ccagaaaaat gattataacg     29340
     acgcacaggc aatagctgag gcctgccaac atggaactat acgacccgta ccaataaaaa     29400
     ctctggagca acaggacgtc cagacttttt tgaatatgcg tcggttggtt tcaatggaaa     29460
     ggacacaact gataaatcac attcgtggac ttcttgctga atacggcatt gtgttcagta     29520
     aaggcgcagc agatttacgc caaaagtaag cggctcgtca gaaccgtatt gatatttact     29580
     gagagctcag atcaactttc cagggcaaca gatcacgtac ccggtttgcc agccagtcct     29640
     ggatatgctc aatgacgtaa cgcagccatt tttctggttc cacattgttc agacggcatg     29700
     tgccgatcag cgagtacaac accgccgcat gttcgtcatc gctgtcggaa cccgcgagtc     29760
     gagtcagccg gagagaattt cactccccgg ctgctcacgg aaccgtacgt gacactctcg     29820
     cgtcatacgg ctcttgatca ctcatttgat gcacgtagta aataccagtg aacaaatagc     29880
     ttcggatact ccttccttac cagcgtcagc tttcgctgag ccttccggtt cgaaagtctg     29940
     tatttagact gcatccactt gagcagacgt gactgcattg cactccacag tcgatagttg     30000
     aaatttctgg accagaactt tccgtagtac tcgatccagc ctctcactat cgcattgtag     30060
     cgcctcgcaa aatccagcaa actctcagct gttgagcgat gtatacgcca cttcttgatt     30120
     gtttctgtta ttttgcgcat tgctgcattt gacgcacccg gcatgcattt tcggtaccgt     30180
     tcgcctttga aattcttcag cgtacgcact ttgaagtcat atccgagaaa ggtgaaactc     30240
     gttgcgacgt ttctcctttt aaacgtgtca atgtaggcga tattcgtttt ccctgcattc     30300
     aggaccagcc cgacttccga gaagcgctcc gataacctgt tcttcagcct tgttgcatca     30360
     ctcattcgtg aacaatgtac tacaatatcg tcagcgtacc tctcaaacgg tacccccgat     30420
     attctctttc catccacaaa tcaaatgcat agtgatggaa caagttagca agtagcggac     30480
     taatgacccc gccctgcgga gtgcctcgtg ttcgggttat taattctcca ttttcacaac     30540
     tctgcattgg cgcttccatc cagcgtcgac agtacaggat gacccattta ggcatcccgt     30600
     ggtgttccag agctttgagc accagatcat gtctcacatg gtcgaaaaac gcactgatgt     30660
     ccacttccag tatccagcta taacgccagc accggatggc acattgtttc agagcgtcat     30720
     gagctgattt gcctggtcgg taaccatatg aatcagcatg gaaaatcggg tcaagctttt     30780
     cttccatgaa aagttttatc gctccctgag caattcgatc ggatactgtt gggatcccca     30840
     gaatgcgttc cttgccattc gacttcggga tccgtttttc cagcactggt ggcggaaacc     30900
     atgttcccga acatagccgg ttccagatct tgtatagatt gccatcacgt tgctggtcga     30960
     acattttcaa agtctgcccg tcgcatccgg gggctccctt gttgcgacgc acatccagat     31020
     atgatgccca gaccagtgct tttggtattt caaatgattt tcgttgcatc agttacgtca     31080
     tccccttttg ggttgtgtct tctgcaatga atgtgatccc catcccttcg ctccagaccc     31140
     attacagatc tttcatcact actacgaatg ggtccgcccc tgtttcccga tacgtgccgg     31200
     aaacaggttc tcacgttccc tgagatggtc tggcccggga tcctgctgcc ttcacaccgg     31260
     atgccgcgca gtcagtaagc aggtgtcttc tgcgcttatc agggggcggc tgtacggccc     31320
     cattttgaca tcatctaaga tttcgatgct tcatcggaca gtttactttc gttcagcttc     31380
     ccgaacccca cgtgacagta gatctctgcc ttttcccgag tcgctcacca cctcattcct     31440
     tagaatgaag cagcaccggg tcgtttggtc agtgctcctg taaaccctga ctgtcagcgc     31500
     cagtgatata agacggtaat tcgccatttg gattgtccgc tccacccaac atgttgtttc     31560
     cttaaggttc tcacaccaga aaggacatca acatgctgag cagagaggac ttttacatga     31620
     taaagcaaat gcgccagcag ggcgcgtaca tcgtcgatat tgcgactcag attggttgct     31680
     ctgaacggac ggtcagacgc tacctcaaat accctgaacc gccagccaga aagacccgcc     31740
     acaaaatggt taagctgaaa ccgtttatgg attacatcga catgcgcctg gcagagaatg     31800
     tctggaatag cgaggttatc ttcgcggaga ttaaggcaat gggttatacg ggcggacgtt     31860
     ccatgctgcg ttactacatc cagcccaaac gtaaaatgcg tccgtcaaaa agaacagttc     31920
     gcttcgaaac tcagcctgga taccagctcc agcatgactg gggcgaagtt gaggtggagg     31980
     ttgccgggca acggtgcaaa gttaactttg cggttaatac gctggggttc tcccgcagct     32040
     tccatgtctt cgccgcacca aaacaggatg ctgagcatac ctacgaatca ctggttcgcg     32100
     ccttccgcta cttcggtggt tgtgtgaaaa cggtgctggt tgataaccag aaggctgcgg     32160
     tgctgaagaa taacaacggg aaagtcgtgt tcaactccgg attcctgttg ctggctgacc     32220
     actataactt cctgccacgg gcatgccgtc cacgcagggc cagaacaaaa ggtaaggttg     32280
     agcggatggt gaaatacctc aaggagaact tcttcgtccg gtaccgcagg ttcgacagct     32340
     tcactcatgt caatcaacaa ctggagcaat ggatagccga tgtggctgac aaacgggagc     32400
     ttcgccagtt caaagaaacg ccggaacagc gcttcgcgct ggagcaggaa catctgcagc     32460
     cgttaccgga tacagacttc gataccagtt acttcgatat ccgccatgtg tcctgggaca     32520
     gctatatcga ggttggtggt aatcgttaca gcgttcccga agcgctgtgt ggtcagccgg     32580
     tatcgatacg aatatcgctg gatgacgagt tgcggatcta cagtaatgag aaactggtgg     32640
     cctcacatcg cctctgttca gcatcgtctg gctggcagac agtgccggag catcacgccc     32700
     cgctctggca gcaggtcagt caggtggaac atcgaccact gagtgcctat gaggagctgt     32760
     tgtgatgcat gaactggaag tcctgctgag tcgcctgaaa atggagcatc tgagttatca     32820
     cgttgaaagc ctgctggaac aggcagctaa aaaagagctg aactaccggg agttcctgtg     32880
     catggcgcta cagcaggaat ggaacggcag gcatcagcgc ggtatggagt ccaggctgaa     32940
     gcaggctcgt ctgccgtggg tcaaaacgct ggagcagttc gactttacct tccagccggg     33000
     catcgaccgt aaggttgtcc gggaactggc tggtctggcg ttcgtggagc gcagcgaaaa     33060
     cgtgatcctg ctgggccctc ctggtgtcgg aaaaactcat ctggccatag ctcttggcgt     33120
     gaaagcggtg gatgcgggac atcgggtact gtttatgcca ctggacagac tgatcgcgac     33180
     actgatgaaa gcgaaacagg aaaaccggct ggagcgtcag ctacagcaac tgagttatgc     33240
     ccgggtgttg atcctggatg aaataggcta tctgccgatg aacagagagg aagccagtct     33300
     gttcttccgg ctactgaacc gtcgatatga aaaagcgagc atcatactga cgtcaaacaa     33360
     agggttcgca gactggggag aaatgttcgg agatcacgta ctggcaacag cgatcctgga     33420
     tcggctgcta catcactcaa ccacgctgaa tatcaaagga gagagttacc ggttaaaaga     33480
     gaaacgtaaa gctggagtgc tgaccaaaaa cacaacgcca atcagtgatg atgaaatggt     33540
     ggaaagcgga cagcatcagt aacgaaagta tttagcgggc atgaaaatgg caaataacgg     33600
     tcaaacatcg tggcgttgac atgaccggag ggcccacctc cacccacctc agagcatgga     33660
     taacttatgc tgcaatttcc gaaccggcgt tacggtcatc acgaacgtag acccacagcc     33720
     gggcagtcct tgttttaccg ctgcccggct cctggaccgg aacggggata tcatcggcat     33780
     ggactttacc gggcatctgc acatactggc gcaggatgtc atacagcggt tccagcagtt     33840
     cagcaactga accgccccgg gtttcctgga gagtgtttta tctgtgaact caggctgcca     33900
     gatcatcgtt tccgatggaa gcataataag ctttttctgc ttctgccgga ggagtatggc     33960
     ccagcctttc cagcaatcgt cgattgttat accagtccac ccacgtgagt gtggccagtt     34020
     ccacttctgc acggtttttc cagctcttac ggtgtattac cttcgctttg taaagaccat     34080
     tgatgctctc cgccatcgcg ttgtcatacg agtcgcctgt acttcctgtt gatgccagta     34140
     atccggcttc cttaagccgc tgtgtgtagg ccagcgatac atactgagaa cctttatcac     34200
     tgtgatggac cgtgccggac ggtcgacggg cccataacgc ctgctccagt gcatccagca     34260
     cgaatgtcgt ttccatggac gatgagaccc gccaccccac gatgtatccg gcaaacacat     34320
     caatgatgaa cgccacatag acgaagccct gccatgtgct gacgtaagta aaatcagcca     34380
     cccacagctg gtcaggtcgt tctgccacga actgacggtt tacgcggtcg cctgcggcaa     34440
     cggctttccg gctgatggtc gtacggacct ttttaccccg gagaacaccg gcaagtccca     34500
     taaccgccat gagacgtgcc acagtgcatc tggccactct gataccttcc cgtaacaact     34560
     gacgccagac tttacgcaca ccgtatacct tgtgattttc atcgtatacg cgctgtatct     34620
     ctttcttcag ccagtcatcg cgctgcgcac gggcactgcg tttatccgga tgatgtcgct     34680
     gttgctgaca gtggtaatac gttgacgggg caatatgcag ttcgctgcat agcggtccga     34740
     ccccgtactg ctcacgcagc ttatccagca gtggcatcat tttttccaga ggcggtcaaa     34800
     ctccgccttc gcaaaataag cggaagcctg gcgaaggata tcgttactgc ggcgcagttc     34860
     acgattttca cgctccagct ctttcagacg ctgacgttca gcggtggtga gccctccatc     34920
     accgcccccg gtatcccgct catgctggcg aacccggaca cgcagagtct ccggcgtaca     34980
     gccaatcttt ggagcaatgg aacaaattgt cgcccattgt gagtcatatt cgccctgact     35040
     ttccagaacc atacggactg cccgttgacg gacttcgggg gaaaaacgag tatttttagt     35100
     catcctgttt acctctttct caggaagttt agtctccagg attcccgggg cggttcatta     35160
     agctttttga atgcctgatc gagcatattc tcgaccatgt tcatcactgg tctttccgaa     35220
     aggctgtaag aaataacttc gttgttgaag agatctatta ctggagacaa atacagcttg     35280
     cgcccattga ctgcaaattc agtaacatcg gtaacccact tctcgtttgg ccgcgtagcc     35340
     ttgaaatctc tttggagaac attgggggcg gtttgcccta cctctcctct gtaagagcgg     35400
     tatcgcttga ccttaatcgc tgccttaagt gagaggattc ccatcaggcg ctgaaccacg     35460
     gcagcctgac ggctgcaaat tgaaaaccgc ccctgttcgt cctgttgttg ccgcacgctc     35520
     cgcagaatat gtatgctctg aggacctgtt ttattaagga ctcatcctct tatgttgacc     35580
     cgcaaaagta tagataccgt tctgctctct gttggtgctg agaagctctc acaacgtgaa     35640
     tgggactgga tgaagatgct caaacccatg gacccaccac ctgcgatggt cgcggcctcc     35700
     atcctggagc gccgtggcga cacagcagcc cttacccggc tacaggatac cgggggttaa     35760
     tccgtcctca tgttgtccgc ttttactccc cgcccgctga aacgcctgtt cacagccaac     35820
     cagtgctgga cgtccttcct ggatgcgggc ggtctgcgcg atatcgaggt tgaggctgtc     35880
     acaaaaatgc tggcctgcgg cacgcggata ctgggagtga aggaatacaa ctgcgataaa     35940
     cctgagtgcc cccacgtcag atacgtcact aactcatgcg gcagccgtgc ctgcccgtcc     36000
     tgcggaaaaa aggccacaga cctgtggata gcgacacagc tgaatcgtct tcctgactgc     36060
     gactgggtac atctggtctt caccctgccg gacacgctgt ggccggtgtt cgaaagcaac     36120
     cggtggctgc tgaatgacgt gtgccgtctg gcggtggaga atctgctgta tgccgcccgg     36180
     aaacgggggc aggaacccgg tatcttctgc gccatccaca cgtatggccg tcgtctcaac     36240
     tggcatccgc atgtacatgt gtctgtaacc tgtggatgtc tgaataagca tggtcagtgg     36300
     aaaaagctga gcttcctgaa agacgcgatg cgttcgcggt ggatgtggaa tatgcggcaa     36360
     cggcttctga aagcgtggtc agaggggctg gcgatgccgg agtcgttgtc acatatcacg     36420
     acggaatcac agtggagaag cctggtgctg aaagccggag gaaaatactg gcatgtgtac     36480
     atgtcgaaaa aaacggccgg cgggaggaat acggcgcgct acctgggtcg ttatctgaag     36540
     aagccgccga tagcggcctc ccggctggca cattacaacg gaggggcgag cctgagcttc     36600
     cgttacctgg accacaaaac gggagaaacg gcgacggaaa cgctgacaca gcgtgagctg     36660
     gtcgcgaggc tgaaacagca catcccggag aagtttttta agatggtgag gtacttcggg     36720
     ttccttgcca accgggtgtg tggagagaag ctgccgcagg tgtaccgtgc tctggggatg     36780
     gataaaccgg aaccagtggc gaaagtgtgc tatgcacaaa tggtgaaaca gttcctgagt     36840
     cgtgacccgt tcgaatgcgt gctgtgtggc ggccggatgg tataccgccg ggccattgcg     36900
     gggctgaatg tggaggggct gaagaaaaac gcgcgggata tcagtctgct gaggtatatg     36960
     ccggcctgac acaggctaag tgtgcccggg aatcggtgca agtataaaaa acagcctgtt     37020
     gcggtataag aatcgaccat gcagagagag aaaacaccgg agtggtgggg aaaaacagaa     37080
     aggctcacgt ggcataaggc gcggacaggg gtatcgctta gtttttcaat ttcctatacg     37140
     tgaacgtaat gaaaatatcg tattactggg gccatcaggt gtggggaaaa cccatctggc     37200
     aatagcgatg ggctatgaag catttaaaat tttttatgat ataagtaaaa tttctttgga     37260
     gttataccat aatattcatt aaatttcctt ataaaataag atgggcttga tattccgata     37320
     agtcttgata catcattaat atagctttga ctattcaata aaagctttgc tgcatgatgc     37380
     atgcgaatat caagaaggat ttgttgaaat gttaattttt cactctccaa tcgttttcta     37440
     acagctattt ctgataaatt caagttattt gaaatatcag aaagacgcca tctcttctcg     37500
     atgttttttt caacaatctt ccttatctga tcagaaaaac taagagaaga agctatcgat     37560
     atcgaagtat ataaagcttc ctcatcagaa acagctgata aaaggcaagc taaactatag     37620
     atctttcttt tgccgaaagg catctctttt atagatttga acaaatcgat agaaacctcc     37680
     tcctcagaga ggaggaatat ttttttgttt aacccccttt tctcctcaga ataggagtgt     37740
     tgaaatgaat aaattggttc cattattcta ataatgctta ataataaatt tctgtcaagg     37800
     cttataatct caaatggatt aatgctatca gattttttta tggagacgtt tatttgtata     37860
     tttcgctcta taaaagcaat ttgcccttca tcgatagtca aagtttcatt gcctgagcta     37920
     accgtcattg aacacctttt tgcatataaa ataatatagt tatgcaagcg aacctttata     37980
     tctattttgt ttttatgtcc catatccatc ataaattcaa cagaatatac caaactatat     38040
     ttagtgttta cagagtaact aagaaatttc tgtaacagtg attgtataca aaatctttcc     38100
     gttattaaga tagattaagt aatttttcct atatttaact ttatttacat tttttgaaga     38160
     aagagcttat gcagcttcta tttctctgtg caacaagcta agtatttgca ctgaaaggga     38220
     ctataaccat attatggttt cacttttctt aggcaatatc tgtgtaaatg ttcggaaagg     38280
     agtggagctt cgcaaaactc cagcatcata atatcctata cggaacgcat aaagcccctt     38340
     cagactggag gctccacaaa tccggttggt gttgatattg gtaaggcagt atgactttcc     38400
     gtgagacaga tgctggccaa cgtgggatat ttaacgcggg ttaacatcgt tgtcagagcc     38460
     gcatgggtga gctgttgcta caccccggta tttccaccac ggaggccagc atgaacaaca     38520
     ataacacatt gtacgtcggg ttagatgttc acaaagaatc gattactgtc gcttatgcta     38580
     tcaattcaga acctgttgaa ctgatgggta aaattggcac atcacctact gatattcaga     38640
     atctttgtaa acgtctcagg tcaaagtcat cgcaggtcag tatcgtttat gaagcggggc     38700
     cctgtggtta tggactttat cgtcggctgg tgaaatccgg ttttgactgc atggtctgcg     38760
     ccccctcact tatcccgaaa aaaccggggg agcgggttaa aaccgatcgc cgtgatgcca     38820
     tcagacttgt gcgttcactg cgtgcaggag atctttctgc tgtctacgta cccggcattg     38880
     aagatgaggc attccgggat ttggcccggg catgggcatc tgcccgcgat gatttacggc     38940
     atgcaaggca acgtctgaaa tcgtttcttc tggttcatgg ggtccattat gtcgggcgag     39000
     cagattgggg ccctgcacac cgacgctggc tcagcaaata ctcattcgaa agtccctggc     39060
     gacaattagc ttttgacgaa caccgtcgta caatagaaga tcggcaggca caatgtgaac     39120
     ggctggaatc cgccctgaag gaggccgtta ccgaatggag gctgtatccg gtagtagagg     39180
     cgctgcaagc catgcgaggg attcagttta ttactgcggt tggattaatt tctgaactgg     39240
     gtgatctgac ccgttttgaa catccacgac aactgatgtc atggtttggt atcacgccat     39300
     cagaatattc atcgggtgga agcagacatc agggcagcat taccaaagcc ggaaacagct     39360
     atgccagaaa gctattggtc gaggcagcgt ggagttaccg tcatccggca cgcatcagtc     39420
     cggcaataca aaaaaggcag gaaaatttac cccgccccgt cattgacaga gcatgggatg     39480
     ctcaactcag gctttgtaag aggtatcgaa aacttcaggc caaaggaaag aatgtcaata     39540
     ttacaattgt tgctgttgca cgtgagctgg cgggttttat ctgggatatg ggccgaatag     39600
     caatgtctgt cgcacaacaa ccacaatgtc acaaataaaa aatgagaata accagttccc     39660
     tgaaggcgac gtagcccggt acaagagtaa cgcacgttag cgcttggcga cggcggaaca     39720
     aagctgattc gcgacgtaag aaagtggcag gctcatatga cggacctctg taatgcggta     39780
     tccaacccgc gaatatcagc gtgattcacc gtcggattta ctgctacgtc gccctcaggg     39840
     aattaaacct aaaaagaaaa tcgtcaaaat tagagattcc ggtttgacac ggaaagtcat     39900
     atcagcgtta accgaatgcc acattgacga ttctcccgat gacagcgtta cgttccatat     39960
     tgcgatcgtg aagccataga ctgggcagca ggcacgggag attatgacaa agcaacggtg     40020
     caggatgtca tgtcagcgat atggcgataa aggaccggaa cggccaatcc agtggccgat     40080
     aacggttcgg cttatacggc tcatgaaaca cggcagttcg ccagagagtt gaatctggag     40140
     ccctgcacga cggcagtcag tagccctcag agtaatggaa tagcagaacg gttcgtgaaa     40200
     acgatgaagg aagactgcat cgcgttcatg ccgaaaccaa gaacggcatt gcataacctt     40260
     gcagtggcga tcgagcatta caatgaaaac catccgcata gtgcgttggg ttatctctca     40320
     ccaagggaat atcgacgtca gcgggtaatg tcaacttaag atacaacgac tgtctgaata     40380
     tcgtgggtca aggacagttc aatgacgtaa cgcagccatt tttctggctc cacatctcat     40440
     cgcttacgaa aaaagtatcg tttttttaca gtaaacttca tttagccgac tataatgtaa     40500
     aaaataaatt ctttactaaa atataacata aggaagcaat atgcttacac aaactatatt     40560
     cccttgcctt ccacaaaaac aagaaaatat catccttgaa gtatcaaatc ctgtattatt     40620
     atcttctact gttactacag atggatatac tgttttcaat aaaaaagcag ctatatacga     40680
     attacaaata cctgctgcca accggacgaa aacgttgaaa ttcactgcta cagaaatgca     40740
     atggttgaca aagataaatg aagtaggaat tgttgaaaaa caaagccaac ggcattctaa     40800
     tatctgaagt taatttcaga ctcgtttaag ctccattttc aaaagaatat atcagggttt     40860
     gttactagta atttctggaa acagaaaaag tagagcagta attctatttc agagaggagt     40920
     aactccatct atcctcgata catactgaac gttatcgtga tatattcatc atgctttctt     40980
     caccattatt cgagtgcagg gacgcaatga tcttaaatac cttttagtag aatatattgc     41040
     tgacccacaa atatcaggat ggtattgaca agtcatagat ggagaaatat atgactgaat     41100
     taccattctc tggaataaca gcagactcct tcccatagac ggcttagggg ggggccccta     41160
     ttaagttgtc aagcatgtta tgacccctgc ggggtataaa aagtcccgtc gcgcatcatg     41220
     gcgaacagaa cgtcgcagcg tcgtctcgcc agggcgataa gcgcctgatt gtgtcgtttt     41280
     ccctgactca ttttgcgggt gtagtaagcc ctggagagcg gatccctgag cgcggcgaag     41340
     gccgacagga acaacgcccg tttgagagct ttattacccc gtcgcgaggg atgctcaccg     41400
     cgtattgacg agccggatcg ccgagttacc ggagcaaggc cagaataagc agcgagatgt     41460
     gcggcagagg cgaaggcgcg gcaggcgacc tcggtgagga gtctggctgc ggtcctgaca     41520
     ccgactccgg gcatactggt caggaccggg taaagagggt gagcaagaac tcgctgttct     41580
     acctcaagcg ccacctcgtc tctttgctta cgcagcgtga tgagctggag tgccagacgt     41640
     ggcagtacta cggcagcggc attcgtgccg ggaacgacga cggtttgttc ggccagtgcc     41700
     tgagctatgt ctgctgcaag gcgtttaccc agacgaggcg caagtttgca gagctgggct     41760
     gccagcttct tctcacccag cgaagcccag cgaagcgagt ttttctggtg agggatatcg     41820
     ctggagaaga tcgagtaccg ccgggtgctc aagtctcgga ccgagaacgc gctccagtgc     41880
     cggatgtatc tgggtcagaa ggccgcggat acggttgctg gcctgcgttg tctgtgcggc     41940
     aagatcatca tcgaagccgc agagcatgga gagttcggcg atttgctcgt cagccagttt     42000
     cagcgtgcgt agcgcgtgag gcagggtacg ggcagcttcg gcaatgatgg cagcgtcacg     42060
     agcatcagtt ttagcttcac cggcgtgtaa gtcggctatg cggcgcatgg ccagtccagg     42120
     gaggtatccg acaaggactc cttctgagcg ggcaacggcg acaggtaacg caccgatggt     42180
     agctggctga tcaacaacca gcagtatctg accatgttgt ttcaggtcag atattagcga     42240
     cctgagtttg ttttcgtcgt tgggtaatgc tttatcgaac aggcgtttac ctgaaccacg     42300
     gcagcctggc ggctgcaaat cggggtgtgg cagaatatga gctttcagag taaccatcca     42360
     gaatgagttc ccatgtcaca caacctggag caccagaaag tccacaccag aatggtgaaa     42420
     gaggttctga aagccgtcgc cagagccaat aatcaccctt atcagtccgt atttgcagac     42480
     tttatcaccg gtcatccctc ctgcacggtc tgtttctggg aaaccttcca caaaatgtac     42540
     ccggattcac cgtacgaata cgtcacgttc tgccatacct gccgtcgttt tgatttatac     42600
     gaaacagaag cggagatgaa ggcggatgac ccgaagtggt ggtgattttc agccccgacc     42660
     gctgaaacgc ctgttcacag ccaaccagtg ctggacgtcc ttcctggatg cgggcggtct     42720
     gcgcgatatc gaggttgagg ctgtcacaaa aatgctggcc tgcggcacgc ggatactggg     42780
     agtgaaggaa tacaactgcg ataaacctga gtgcccccac gtcagatacg tcactaactc     42840
     atgcggcagc cgtgcctgcc cgtcctgcgg aaaaaaggcc acagacctgt ggatagcgac     42900
     acagctgaat cgtcttcctg actgcgactg ggtacatctg gtcttcaccc tgccggacac     42960
     gctgtggccg gtgttcgaaa gcaaccggtg gctgctgaat gacgtgtgcc gtctggcggt     43020
     ggagaatctg ctgtatgccg cccggaaacg ggggcaggaa cccggtatct tctgcgccat     43080
     ccacacgtat ggccgtcgtc tcaactggca tccgcatgta catgtgtctg taacctgtgg     43140
     atgtctgaat aagcatggtc agtggaaaaa gctgagcttc ctgaaagacg cgatgcgttc     43200
     gcggtggatg tggaatatgc ggcaacggct tctgaaagcg tggtcagagg ggctggcgat     43260
     gccggagtcg ttgtcacata tcacgacgga atcacagtgg agaagcctgg tgctgaaagc     43320
     cggaggaaaa tactggcatg tgtacatgtc gaaaaaaacg gccggcggga ggaatacggc     43380
     gcgctacctg ggtcgttatc tgaagaagcc gccgatagcg gcctcccggc tggcacatta     43440
     caacggaggg gcgagcctga gcttccgtta cctggaccac aaaacgggag aaacggcgac     43500
     ggaaacgctg acacagcgtg agctggtcgc gaggctgaaa cagcacatcc cggagaagtt     43560
     ttttaagatg gtgaggtact tcgggttcct tgccaaccgg gtgtgtggag agaagctgcc     43620
     gcaggtgtac cgtgctctgg ggatggataa accggaacca gtggcgaaag tgtgctatgt     43680
     acaaatggtg aaacagttcc tgagtcgtga cccgttcgaa tgcgtgctgt gtggcggccg     43740
     gatggtatac cgccgggcca ttgcggggct gaatgtggag gggctgaaga aaaacgcgcg     43800
     ggatatcagt ctgctgaggt atatgccggc ctgacacagg ctaagtgtgc ccgggaatcg     43860
     gtgcaagtat aaaaaacagc ctgttgcggt ataagaatcg accatgcaga gagagaaaac     43920
     accggagtgg tggggaaaaa cagaaaggct cacgtggcat aaggcgcgga caggggtatc     43980
     gcttagtttt tcaatttcct atacgtgaac gcccgcctgc gggcactgtt gcagacgcaa     44040
     caggacacta tccaccagat ggctgaatac aaccgcctgc tctcacagcg gatggcggct     44100
     tatgcttccg aaatcaaccg actgaaggcg ctggttgcga aactgcagcg tatgtagttc     44160
     ggtaaaagct cagaaaaact tcgcgcaaaa accgaacggc agattccatt ttcacgggcg     44220
     atctacgcca cacaggctct gggttgcagt gactgctcca ttaaggcgat tttgaactca     44280
     taagggaagt aacaaaaaaa ctgcaaaagt acaataatta tatatggcca aactaacctc     44340
     tattaaaaaa acatcagttt ttcacactta gttgagcttc atgaaaaaat catcgaggat     44400
     ttcattgcag aatacacatt ccactaactg gaagcactcc ataagaggaa tcagagaaag     44460
     tatcgttttt ttatagtaaa attcattgct gttcaataaa attgatatag ttattaaatt     44520
     atgaaaataa tttcacaaaa aagattaact tgagttctta agcatcggat tttagatatt     44580
     ttgaaatatc tggcatcaca taacatcaaa agtatataac acccttatct aattacatgc     44640
     agtatattgt atatatactc aaaaattgta attcataccc tgctatatct tgtagggaaa     44700
     gatattaatt aaaactgttt tcatataagg ttcattttat gaatatatca gaaacactga     44760
     actcagcaaa tacccaatgc aatatagatt ctatggataa cagattacat acattgtttc     44820
     caaaagtgac atcagtgcga aacgctgcac aacaaactat gccagatgaa aaaaatttaa     44880
     aagatagtgc aaatattatt aaagatttct ttaggaaaac tatagcagca cagagttata     44940
     gtagaatgtt ctctcaaggc tctaacttta aatctttaaa tatagcaatt gatgcaccat     45000
     cagacgctaa agcctcattt aaggctattg agcaccttga cagattatcg aagcattata     45060
     tatctgaaat aagggaaaaa cttcatcctc tttctgcaga ggaactcaat ttgctttcgc     45120
     taattattaa ttctgattta atcttcagac atcaaagtaa ttctgatttg tctgataaaa     45180
     ttttaaacat taagtcattc aataaaattc agtctgaagg aatatgcaca aaacgaaaca     45240
     catacgctga tgatataaaa aaaatagcta atcatgactt tgtgtttttt ggcgttgaaa     45300
     tctctagcca tcagaaaaaa caccccctga atacaaaaca tcacactgtt gattttggtg     45360
     caaatgcgta tatcattgat catgactctc catatggata tatgacatta accgatcact     45420
     ttgataatgc tattccacct gttttttacc atgagcacca atcattttta gataaatttt     45480
     cagaggttaa taaagaagtt agtcgatacg tacatggaag taaaggaatt atagatgtac     45540
     caatattcaa tactaaagat atgaagttag ggctcggatt atacctgatt gactttatta     45600
     gaaaaagtga agaccaaagc ttcaaggagt tttgctatgg aaaaaatctt gcccctgtgg     45660
     atctggatag aatcataaac tttgtttttc agccagagta ccatatacct aggatggtaa     45720
     gtacagaaaa cttcaaaaaa gttaagatta gagaaatatc cttagaggag gctgttacag     45780
     catctaatta cgaagaaatt aacaagcagg tcactaacaa aaaaattgct ctccaggctc     45840
     tttttctttc gattgctaat caaaaagagg atgtcgcctt atatatatta tctaattttg     45900
     agataactag acaagatgtt atttccataa agcatgagtt gtatgatatt gagtatctac     45960
     ttagcgctca taattcaagc tgtaaagtac ttgagtattt tatcaataag ggattggttg     46020
     atgtaaacac aaagttcaaa aaaactaata gtggggattg tatgttggat aacgcaataa     46080
     aatatgagaa tgcagaaatg ataaaactat tattgaaata tggtgcaaca tctgacaata     46140
     aatatattta atcaaaattg aatatcgttt agcaaaaggc agtatttgca caaaatatcg     46200
     atatattgtt tattgtcagt atggctcaat gtgataatag ttggaaagtt tgatgggttt     46260
     cgccccgttg tagcggtagt cgagctggaa ggtcttcagg cactgcttac agcgatagag     46320
     cagcccccct gaactggaat ggccgttccg gatacccccc tgagtttcag agtaacgggg     46380
     acaaaccaca tcaatctttg ccatcaatca tccaaagggc aaagagtaca acaacactaa     46440
     gtctgcgtca caacccatca atgaaaggaa tatatacata tgccatcagt aaatttaatt     46500
     ccatcaagga aaatatgttt gcaaaatatg ataaataaag acaacgtctc tgttgagaca     46560
     atccagtctc tattgcactc aaaacaattg ccatattttt ctgacaagag gagtttttta     46620
     ttaaatctaa attgccaagt taccgatcac tctggaagac ttattgtctg tcgacattta     46680
     gcttcctact ggatagcaca gtttaacaaa agtagtggtc acgtggatta tcatcacttt     46740
     gcttttccgg atgaaattaa aaattatgtt tcagtgagtg aagaagaaaa ggctattaat     46800
     gtgcctgcta ttatttattt tgttgaaaac ggttcatggg gagatattat tttttatatt     46860
     ttcaatgaaa tgatttttca ttccgaaaaa agcagagcac tagaaataag tacatcaaat     46920
     cacaatatgg cattaggctt gaagattaaa gaaactaaaa atggggggga ttttgtcatt     46980
     cagctttatg atcccaacca tacagcaact catttacgag cagagtttaa caaatttaac     47040
     ttagctaaaa taaaaaaact gactgtagat aattttcttg atgaaaaaca tcagaaatgt     47100
     tatggtctta tatccgacgg tatgtctata tttgtggaca gacatactcc aacaagcatg     47160
     tcctccataa tcagatggcc taataattta cttcacccca aagttattta tcacgcgatg     47220
     cgtatgggat tgactgagct aatccaaaaa gtaacaagag tcgtacaact atctgacctt     47280
     tcagacaata cgttagaatt acttttggca gccaaaaatg acgatggttt gtcaggattg     47340
     cttttagctt tacaaaatgg gcattcagat acaatcttag catacggaga actcctggaa     47400
     acttctggac ttaaccttga taaaacggta gaactactaa ctgcggaagg aatgggagga     47460
     cgaatatcgg gtttatccca agcacttcaa aatgggcatg cagaaactat caaaacatac     47520
     ggaaggcttc tcaagaagag agcaataaat atcgaataca ataagctgaa aaatttgctg     47580
     accgcttatt attatgatga agtacacaga cagatacccg gactaatgtt tgctcttcaa     47640
     aatggacatg cagatgctat acgcgcatac ggtgagctca ttcttagccc ccctctcctc     47700
     aactcagagg atattgtaaa tttgctggcc tcaaggagat atgacaatgt tcccggactt     47760
     ctgttagcat tgaataatgg acaggctgat gcaatcttag cttatggtga tatcttgaat     47820
     gaggcaaaac ttaacttgga taaaaaagca gagctgttag aagcgaaaga ttctaatggt     47880
     ttatctggat tgtttgtagc cttgcataat ggatgtgtag aaacaattat tgcttatggg     47940
     aaaatacttc acactgcaga ccttactcca catcaggcat caaaattact ggcagcagaa     48000
     ggcccaaatg gggtatctgg attaattata gcttttcaaa ataggaattt tgaggcaata     48060
     aaaacttata tggaaataat aaaaaatgaa aatattacac ctgaagaaat agcagaacac     48120
     ttggacaaaa aaaatggaag tgattttctg gaaattatga agaatataaa aagctgaata     48180
     ttatctcgtg gtgatacact gaatttgagg taaccggctc atttaaaccg tctggtctgt     48240
     tacctccggt tccacaaaaa taatgtccat cattttgaag tggacactat cgtatggaat     48300
     accggacctg gatcactgaa gctttacgcc ttcatttcga agaacaagtt acctttacgc     48360
     gacattgatg ttttcagacc agactgctcc tgtatgaccc ggtaatcgta tgcgcagtac     48420
     tgtgaacctc gatcagagtg gtggattagc ccggcaggtg ggcgctggct cctgagcgcc     48480
     ataaacaggg ctttacctgt cagctctttt gtcatgcgct ctcccatggc gtagccgaca     48540
     atttcgcacg tataaacatc tttgatgcca gcgaggtaca accatccctc ctgtgtggca     48600
     acatacgtca ggtccgccac ccagacctga tttggtgctg taggagcgaa cgtctggttc     48660
     agcagatttg gcgcaactgg cagattgtgg ttcgagttcg tagtcgctct gaacttgcgt     48720
     ttctgcttac agcgtagcct tagctcctta cgaagacgtg ccagtcggtc acgaccaacg     48780
     atgatgccat tctctgccag ctccgtctgg agccgccggg ttccatatgt ttcgcgagtg     48840
     cggatatgtg ccaccttaat ctccagtttt agccgctcat cactttgttt tctgtctgag     48900
     ggttcatgct gtacccagtt gtaataaccg ctcctggata caccaaatac ctgacacatc     48960
     gcttcaatgg gaaattgttg tcgccattgt tcgattaacg cgtatttttc agcgactcct     49020
     gtgcaaaata cgctgttgct ttttttaata tatctcgctc aaggcgagct tcatttaacg     49080
     ccttacgcag ttgcagaatt tcagattcca gttcagccac cgtgcgggaa ccaggagtac     49140
     cgagcccttt tctggcggcg gtaacccatt gtcctaaagt gccttcagga agagataatc     49200
     gggaagcgcc ttcactgatc gaaagttgat tttcaggaac cgttctgaca gcttcggctt     49260
     tgaactcttt agagtaacgt tgggtttttc tgctcattat tagctccttc tgatgccatt     49320
     ctatttcagg aaggagtgtc cgttaaactc aggctacctc agtgcactga taataaaaag     49380
     acggagacag atgccattta cgataaagtt cggagttctt atttgctttc atgtattctg     49440
     aaaaaaaaca aaaatgttgg gcttattctt catgcaccat catttgtttc tgtgtctgaa     49500
     aaaatcgcca gaattgtgat ggcaaattac tcccgtaact ggagtaattc cgagttggcc     49560
     agtgcggttt taatgagtga atcttcttta aaaagaagaa tgtacaaaga ggtcggttct     49620
     ataagtacat ttgtacataa aataaagctt acagaagcta tcaggaaatt acgaaggaca     49680
     aatactccca tttctgtcat atcatctgag ttaggttaca gttcaccatc gtatttttct     49740
     aaagttttct ttaaatattt aaagacatac cctcaaaaca taaggaagaa aaatggtcgg     49800
     taatgtcacc aattaggagg acttgcagag ccgctttttt acgatactca ccccgtaagt     49860
     aagcgataat tggtaactta aacgcccatc tgacatagat ggacacctga gtatggaatt     49920
     acaggactgg cgaaaagaac ctcgtaaaaa gtatttggtg caaatcgttg gttcctttgc     49980
     tgaatttgaa cgcgccatgc ttcgtgaacg gacaaagagt ggacttgcag cggcacgcca     50040
     ggacgggttg gtggatggcg accaaagtta acaccccagc aacaaaaaga gattgtctcg     50100
     ctcgtcacat cggggcagaa aacaggtgct gatgccgccc gtctgtttcg ggttcaccct     50160
     tccaccgtgg tgcgtcttct cgccagacac cggatgactg agatcaaaca gacataatct     50220
     atgcggagat ttacagcagg gcatggttca caaatctgac agcgatgaat tatcggcact     50280
     gcgggcagaa aatgctcgaa tcatcaagcc cctgttactt cctgaacccg ccacaccacg     50340
     ggccggacgc ccatgggctg agcaccgtaa aatcatcaat ggcatgttct gggtgttatg     50400
     ttccggtgca ccatggcgcg atttacccga acgatatggg tcatggaaaa ctgtttataa     50460
     ccgctttaac cgatggtcaa agtcaggcgt gattaatatt attttcaaca ggttgctttc     50520
     gctacttgat gcaaacggct ttattgactg gtctgccacc gcgctggatg gcagtaatat     50580
     ccgggcgctg aaatgtgccg ccggtgctca aaaaaacatc ccgatatcga cggagataat     50640
     gggccgggtc gctctcgcgg cggttttggc accaaaatcc atctggcaac agacggaagt     50700
     ggcctcccgt taaatatcgt gctaagcccc ggacaagctc atgaaagcca gttcgcgcaa     50760
     cgacttctgg acgggattgg cgttcagcgt cagaacggca gcatgaaacg ccgtggacat     50820
     gcggtactgg ctgataaagc gtattcaggg cgcgcattgc gcaacgagct gaaaaataac     50880
     ggtataaagg cagtaatccc ccgaaagtca aatgagaaaa tggcatcgga tggacgtgca     50940
     cagcttgatc gtgatgcgta ctgcaatcgt aatgtcgttg aacggtgctt tgggcggctg     51000
     aaagaatatc gccgcatcgc cacgcgttac gacaaaacgg cgagaaatta cctggcgatg     51060
     gtgaaactgg gctgcatccg actcttttat caacgcttac gtaattaagg gacacagcct     51120
     aaatagctgc gcggaatagt agatcacttt gagggaactt agcccggatt gtgcgatctg     51180
     atcaatcgcc aaatcaaaac aaatcaccaa ccggactgag caatgccgat catagcacca     51240
     atttcccgtg acgaacgacg cctgatgcag aaagccatcc ataaaacaca cgataaaaat     51300
     tatgcccgca gactgactgc catgctgatg ctgcaccggg gcgaccgtgt cagcgacgtt     51360
     gccagaacgc tctgctgcgc ccgttcctct gttggacgct ggattaactg gttcacgcag     51420
     tcgggtgttg agggactgaa atcattacct gccgggcgtg cccgtcgctg gccgtttgag     51480
     catatctgca cactgttacg tgagctggta aaacattctc ccggcgactt tggctaccag     51540
     cgttcacgct ggagtacaga actgctggca ataaaaatca atgagataac cggttgccag     51600
     ttaaatgccg gaaccgttcg ccgctggttg ccgtctgcgg ggattgtgtg gcgaagggct     51660
     gcgccaactc tgcgtatccg tgacccgcat aaagatgaaa agatggcagc aatccataaa     51720
     gcactggacg aatgcagcgc agagcatccg gtcttttatg aagatgaagt ggatatccat     51780
     cttaatccca aaatcggtgc ggactggcaa ctgcgcggac agcaaaaacg ggtggtcacg     51840
     ccgggacaga atgaaaaata ttatctggcc ggagcgctgc acagcgggac aggtaaagtc     51900
     agctgtgtgg gcggcaacag caaaagttcg gcgctgttca tcagcctgct gaagcggctt     51960
     aaagcgacat accgtcgggc gaaaaccatc acgctgatcg tggacaacta cattatccac     52020
     aaaagccggg aaacacagag ctggctgaag gagaacccga agttcagggt catttatcag     52080
     ccggtttact cgccatgggt gaatcatgtt gaacggctat ggcaggcact tcacgacaca     52140
     ataacgcgta atcatcagtg cagctcaatg tggcaactgt tgaaaaaagt tcgccatttt     52200
     atggaaaccg tcagcccatt ccccggaggc aaacatgggc tggcaaaagt gtagcggtat     52260
     taagcgcagc tatttagatt attgccgcat tttctccacc acgatcagag ccgaaaaaag     52320
     ataatttttt tccaactgcc acccggcgta atgcgttttc accaatgtta ccccacctat     52380
     tgcggcaaaa ggtaatgtct tcaatcgata gaagtttctg gtaatctact ggtatttgag     52440
     gttttccatg actaccgtta ctgttcattg tccgcgctgt cattccgatg aagtttatcg     52500
     acatggccgt agttgttccc ggcatgagcg tttccgttgt cgctcatgta aacgtgtttt     52560
     ccagctcact tactcttatg aagccagaaa acccggcgtt aaggagcaga tcgttgaaat     52620
     ggcacataac ggcgcagggg gctgttatac cgccagaaca ctgaaaatcg gcatcaatac     52680
     cgtcatacgg acattaaaaa gctctcgccc cggcggataa catctgcgcc agtcgctcac     52740
     gctgatgttg cccttatctg tgaacttgat gagcagtggc gcttcgttgg cagcaaggcg     52800
     caacaacact ggccctggta tgcgtacaac actaaaactg gcggtgtgtt ggcttacact     52860
     tgcgggccac ggaatgatga gacctgtcgg gaactgttag ccctgttgac tccgttctgt     52920
     atcggcatgg tggcatggtg accagcgatg actggggcag ctacgccaga gaagtgccgg     52980
     aggagaaaca cctgaccggc aaaatcttca cgcaacgtat gaacgtaaca acctgaccct     53040
     ccgcccccgc atcaagcggc tggcacgtaa aacaatctgc ttctcgcgtt ccgtggaaat     53100
     ccacgaaaaa gtcatcggtt ccttcattga aaagcacata ttctaatgat tggaagtact     53160
     acccggcaaa actcattcag tgcattccag tgattcagga tatagttgaa cgcctttacc     53220
     atttcagcat ggtttgacaa agttttcctc tggagcttta tccagtcata caaggacttc     53280
     attcgcggca cacatttctc ctgccttacc gcaagccgtt tttctgccgg cctccctcgt     53340
     attaaatgtg tatcgttttt ttacagtaat tttaatttat cattctataa taggaataaa     53400
     tgagcttggc taaaatatga tgtaaaacaa atatacttac tcggattaca tttccttgct     53460
     cactggaatg ttgaattcag tgttattatt gactgcagtc acaataaaaa aagaattcca     53520
     tagaaaacct caataaataa attacaacta acttctgtta tgtgtaaaat ggaaactatt     53580
     aaaacttaat atcggaaatg gtaagtgaaa tttgtataaa tatacaattt taaatattta     53640
     ttctcacaaa tataaggttg acctagcatt atgttctctg taaataatac acactcatca     53700
     gtttcttgct ccccctctat taactcaaac tcaaccagta atgaatatta tctgagaatc     53760
     ctgactgaat gggaaaagaa ctcttctccc ggggaagagc gaggcattgc ttttaacaga     53820
     ctctcccagt gctttcagaa tcaagaagca gtattaaatt tatcagacct aaatttgacg     53880
     tctcttcccg aattaccaaa gcatatttct gctttgattg tagaaaataa taaattaaca     53940
     tcattgccaa agctgcctgc atttctcaaa gaacttaatg ctgataataa caggctttct     54000
     gtgataccag aacttcctga gtcattaaca actttaagtg ttcgttctaa tcaactggaa     54060
     aaccttcctg ttttgccaaa ccatttaaca tcattatttg ttgaaaataa caggctatat     54120
     aacttaccgg ctcttcccga aaaattgaaa tttttacatg tttattataa caggctgaca     54180
     acattacccg acttaccgga taaactggaa attctctgtg ctcagcgcaa taatctggtt     54240
     acttttcctc aattttctga tagaaacaat atcagacaaa aggaatatta ttttcatttt     54300
     aatcagataa ccactcttcc ggagagtttt tcacaattag attcaagtta caggattaat     54360
     atttcaggga atccattgtc gactcgcgtt ctgcaatccc tgcaaagatt aacctcttcg     54420
     ccggactacc acggcccgca gatttacttc tccatgagtg acggacaaca gaatacactc     54480
     catcgccccc tggctgatgc cgtgacagca tggttcccgg aaaacaaaca atctgatgta     54540
     tcacagatat ggcatgcttt tgaacatgaa gagcatgcca acaccttttc cgcgttcctt     54600
     gaccgccttt ccgataccgt ctctgcacgc aatacctccg gattccgtga acaggtcgct     54660
     gcatggctgg aaaaactcag tgcctctgcg gagcttcgac agcagtcttt cgctgttgct     54720
     gctgatgcca ctgagagctg tgaggaccgt gtcgcgctca catggaacaa tctccggaaa     54780
     accctcctgg tccatcaggc atcagaaggc cttttcgata atgataccgg cgctctgctc     54840
     tccctgggca gggaaatgtt ccgcctcgaa attctggagg acattgcccg ggataaagtc     54900
     agaactctcc attttgtgga tgagatagaa gtctacctgg ccttccagac catgctcgca     54960
     gagaaacttc agctctccac tgccgtgaag gaaatgcgtt tctatggcgt gtcgggagtg     55020
     acagcaaatg acctccgcac tgccgaagcc atggtcagaa gccgtgaaga gaatgaattt     55080
     acggactggt tctccctctg gggaccatgg catgctgtac tgaagcgtac ggaagctgac     55140
     cgctgggcgc aggcagaaga gcagaagtat gagatgctgg agaatgagta ctctcagagg     55200
     gtggctgacc ggctgaaagc atcaggtctg agcggtgatg cggatgcgga gagggaagcc     55260
     ggtgcacagg tgatgcgtga gactgaacag cagatttacc gtcagttgac tgacgaggta     55320
     ctggccctgc gattgtctga aaacggctca cgactgcacc attcataatc acgtcgcata     55380
     agcataaacc gcagaccgga ttgactccgg aaaaactgtg acccgattac ggaccttaac     55440
     aacaacccgt aaatcctcgc tcaataccgg cagggattta cggcgtgcaa ctgacttttt     55500
     tgaggggcta accaaccaga tcgtttgcta tgggaatatc gagacagtaa tgagttaaat     55560
     gataaaaatt gtttgaaaat ataggggata aagatcaatc caaactggat gaaagtagaa     55620
     ctggtcacat taacatgggt agactgatat aacaatcgac ggttactgga aagacaggaa     55680
     catattcctc cagctggaat gaaaacgccg ataaagctct aggattgttt ttttaaagac     55740
     tttctcgttt tatttgcatt aatagaccaa gatatgaata gtgaggggtt aataaatgaa     55800
     accgatcaac aatcattctt tttttcgttc cctttgtggc ttatcatgta tatctcgttt     55860
     atcggtagaa gaacagtgta ccagagatta ccaccgcatc tgggatgact gggctaggga     55920
     aggaacaaca acagaaaatc gcatccaggc ggttcgatta ttgaaaatat gtctggatac     55980
     ccgggagcct gttctcaatt taagcttact gaaactacgt tctttaccac cactcccttt     56040
     gcatatacgt gaacttaata tttccaacaa tgagttaatc tccctacctg aaaattctcc     56100
     gcttttgaca gaacttcatg taaatggtaa caacttgaat atactcccga cacttccatc     56160
     tcaactgatt aagcttaata tttcattcaa tcgaaatttg tcatgtctgc catcattacc     56220
     accatattta caatcactct cggcacgttt taatagtctg gagacgttac cagagcttcc     56280
     atcaacgcta acaatattac gtattgaagg taatcgcctt actgtcttgc ctgaattgcc     56340
     tcatagacta caagaactct ttgtttccgg caacagacta caggaactac cagaatttcc     56400
     tcagcgctta aaatatttga aggtaggtga aaatcaacta cgcagattat ccagattacc     56460
     gcaagaacta ttggcactgg atgtttccaa taacctacta acttcattac ccgaaaatat     56520
     aatcacattg cccatttgta cgaatgttaa catttcaggg aatccattgt cgactcgcgt     56580
     tctgcaatcc ctgcaaagat taacctcttc gccggactac cacggcccgc agatttactt     56640
     ctccatgagt gacggacaac agaatacact ccatcgcccc ctggctgatg ccgtgacagc     56700
     atggttcccg gaaaacaaac aatctgatgt atcacagata tggcatgctt ttgaacatga     56760
     agagcatgcc aacacctttt ccgcgttcct tgaccgcctt tccgataccg tctctgcacg     56820
     caatacctcc ggattccgtg aacaggtcgc tgcatggctg gaaaaactca gtgcctctgc     56880
     ggagcttcga cagcagtctt tcgctgttgc tgctgatgcc actgagagct gtgaggaccg     56940
     tgtcgcgctc acatggaaca atctccggaa aaccctcctg gtccatcagg catcagaagg     57000
     ccttttcgat aatgataccg gcgctctgct ctccctgggc agggaaatgt tccgcctcga     57060
     aattctggag gacattgccc gggataaagt cagaactctc cattttgtgg atgagataga     57120
     agtctacctg gccttccaga ccatgctcgc agagaaactt cagctctcca ctgccgtgaa     57180
     ggaaatgcgt ttctatggcg tgtcgggagt gacagcaaat gacctccgca ctgccgaagc     57240
     catggtcaga agccgtgaag agaatgaatt tacggactgg ttctccctct ggggaccatg     57300
     gcatgctgta ctgaagcgta cggaagctga ccgctgggcg caggcagaag agcagaagta     57360
     tgagatgctg gagaatgagt actctcagag ggtggctgac cggctgaaag catcaggtct     57420
     gagcggtgat gcggatgcgg agagggaagc cggtgcacag gtgatgcgtg agactgaaca     57480
     gcagatttac cgtcagttga ctgacgaggt actggcctga accgccccgg gaatcctgga     57540
     gactaaactc cctgagaaag aggtaaacag gatgactaaa aatactcgtt tttcccccga     57600
     agtccgtcaa cgggcagtcc gtatggttct ggaaagtcag ggcgaatatg actcacaatg     57660
     ggcgacaatt tgttccattg ctccaaagat tggctgtacg ccggagactc tgcgtgtccg     57720
     ggttcgccag catgagcggg ataccggggg cggtgatgga gggctcacca ccgctgaacg     57780
     tcagcgtctg aaagagctgg agcgtgaaaa tcgtgaactg cgccgcagta acgatatcct     57840
     tcgccaggct tccgcttatt ttgcgaaggc ggagtttgac cgcctctgga aaaaatgatg     57900
     ccactgctgg ataagctgcg tgagcagtac ggggtcggac cgctatgcag cgaactgcat     57960
     attgccccgt caacgtatta ccactgtcag caacagcgac atcatccgga taaacgcagt     58020
     gcccgtgcgc agcgcgatga ctggctgaag aaagagatac agcgcgtata cgatgaaaat     58080
     cacaaggtat acggtgtgcg taaagtctgg cgtcagttgt tacgggaagg tatcagagtg     58140
     gccagatgca ctgtggcacg tctcatggcg gttatgggac ttgccggtgt tctccggggt     58200
     aaaaaggtcc gtacgaccat cagccggaaa gccgttgccg caggcgaccg cgtaaaccgt     58260
     cagttcgtgg cagaacgacc tgaccagctg tgggtggctg attttactta cgtcagcaca     58320
     tggcagggct tcgtctatgt ggcgttcatc attgatgtgt ttgccggata catcgtgggg     58380
     tggcgggtct catcgtccat ggaaacgaca ttcgtgctgg atgcactgga gcaggcgtta     58440
     tgggcccgtc gaccgtccgg cacggtccat cacagtgata aaggttctca gtatgtatcg     58500
     ctggcctaca cacagcggct taaggaagcc ggattactgg catcaacagg aagtacaggc     58560
     gactcgtatg acaacgcgat ggcggagagc atcaatggtc tttacaaagc gaaggtaata     58620
     caccgtaaga gctggaaaaa ccgtgcagaa gtggaactgg ccacactcac gtgggtggac     58680
     tggtataaca atcgacgatt gctggaaagg ctgggccata ctcctccggc agaagcagaa     58740
     aaagcttatt atgcttccat cggaaacgat gatctggcag cctgagttca cagataaaac     58800
     actctccagg aaacccgggg cggttcacct cggtgaatat caatatgcct tttaggtgtt     58860
     accacgctga tgttatccat atcatagaca ccaccatttt ggctgatcgg cttctcatga     58920
     tgaagcttga atgaagttct cttccctgca acatcctggg ttccaggctg tgtcccttaa     58980
     tcatctgagt tatagtaact gtctgtttac acaacatatt gaaccacggc agcctgacgg     59040
     ctgcaaattg aaaaccgccc ctgttcgtcc tgttgttgcc gcacgctccg cagaatatgt     59100
     atgctctgag gacctgtttt attaaggact catcctctta tgttgacccg caaaagtata     59160
     gataccgttc tgctctctgt tggtgctgag aagctctcac aacgtgaatg ggactggatg     59220
     aagatgctca aacccatgga cccaccacct gcgatggtcg cggcctccat cctggagcgc     59280
     cgtggcgaca cagcagccct tacccggcta caggataccg ggggttaatc cgtcctcatg     59340
     ttgtccgctt ttactccccg cccgctgaaa cgtctgttca cggccaacca gtgctggacg     59400
     tccttcctgg atgcgggcgg tctgcgcgat atcgaggttg aggctgtcac aaaaatgctg     59460
     gcctgcggca cgcggatact gggagtgaag gaatacaact gcgataaacc tgagtgcccc     59520
     cacgtcagat acgtcactaa ctcatgcggc agccgtgcct gcccgtcctg cggaaaaaag     59580
     gccacagacc tgtggatagc gacacagctg aatcgtcttc ctgactgcga ctgggtacat     59640
     ctggtcttca ccctgccgga cacgctgtgg ccggtgttcg aaagcaaccg gtggctgctg     59700
     aatgacgtgt gccgtctggc ggtggagaat ctgctgtatg ccgcccggaa acgggggcag     59760
     gaacccggta tcttctgcgc catccacacg tatggccgtc gtctcaactg gcatccgcat     59820
     gtacatgtgt ctgtaacctg tggatgtctg aataagcatg gtcagtggaa aaagctgagc     59880
     ttcctgaaag acgcgatgcg ttcgcggtgg atgtggaata tgcggcaacg gcttctgaaa     59940
     gcgtggtcag aggggctggc gatgccggag tcgttgtcac atatcacgac ggaatcacag     60000
     tggagaagcc tggtgctgaa agccggagga aaatactggc atgtgtacat gtcgaaaaaa     60060
     acggccggcg ggaggaatac ggcgcgctac ctgggtcgtt atctgaagaa gccgccgata     60120
     gcggcctccc ggctggcaca ttacaacgga ggggcgagcc tgagcttccg ttacctggac     60180
     cacaaaacgg gagaaacggc gacggaaaca tgcacaaatg gtgaaacagt tcctgagtcg     60240
     tgacccgttc gaatgcgtgc tgtgtggcgg ccggatggta taccgccggg ccattgcggg     60300
     gctgaatgtg gaggggctga agaaaaacgc gcgggatatc agtctgctga ggtatatgcc     60360
     ggcctgacac aggctaagtg tgcccgggaa tcggtgcaag tataaaaaac agcctgttgc     60420
     ggtataagaa tcgaccatgc agagagagaa aacaccggag tggtggggaa aaacagaaag     60480
     gctcacgtgg cataaggcgc ggacaggggt atcgcttagt ttttcaattt cctatacgtg     60540
     aactatggct cgctacgacc ttcccgatga ggcatggacc atcatcaagc ctctgttacc     60600
     tcctgaaccc gccacaccac gggccggacg cccatgggct gagcaccgta aaatcatcaa     60660
     tggcatgttc tgggtgttat gttccggtgc accatggcgc gatttacccg aacgatatgg     60720
     gtcatggaaa actgtttata accgctttaa ccgatggtca aagtcaggcg tgattaatat     60780
     tattttcaac aggttgcttt cgctacttga tgcaaacggc tttattgact ggtctgccac     60840
     cgcgctggat ggcagtaata tccgggcgct gaaatgtgcc gccggtgctc aaaaaaacat     60900
     cccgatatcg acggagataa tgggccgggt cgctctcgcg gcggttttgg caccaaaatc     60960
     catctggcaa cagacggaag tggcctcccg ttaaatatcg tgctaagccc cggacaagct     61020
     catgaaagcc agttcgcgca acgacttctg gacgggattg gcgttcagcg tcagaacggc     61080
     agcatgaaac gccgtggaca tgcggtactg gctgataaag cgtattcagg gcgcgcattg     61140
     cgcaacgagc tgaaaaataa cggtataaag gcagtaatcc cccgaaagtc aaatgagaaa     61200
     atggcatcgg atggacgtgc acagcttgat cgtgatgcgt actgcaatcg taatgtcgtt     61260
     gaacggtgct ttgggcggct gaaagaatat cgccgcatcg ccacgcgtta cgacaaaacg     61320
     gcgagaaatt acctggcgat ggtgaaactg ggctgcatcc gactctttta tcaacgctta     61380
     cgtaattaag ggacacagcc tagtctccag gattcccggg gcgttcacca catgcaatgt     61440
     gttgttgcag gggaacggtc tgcaccatcc cctatatcga tcaatataac aaaaatgaca     61500
     acgtcagatt cagggcacaa cctaaatata ttttaggtca cctcccaaat cgtttgcctg     61560
     ataccgctcc attttttaat aaaaaatcaa tcatttttga atctttgctt ttcattgcat     61620
     tgtcaagcat agtgtcccca ctatttgctt tttgaaatct tttgtttaca tcaaccaatc     61680
     cattattaat aaaatattct agcactttat agttggcact atcttcacta agtaaatact     61740
     caacatcata cagctcacaa tacatattgt tgttcatttt ctccatctct gcgacatctt     61800
     gttttgtaaa attaaattta gatagtaaat aaagtgccat atcagatttt gcattaccta     61860
     gagaataagc aagagcttga tgagccattt ttttatcagt caccttattg ttaatttctt     61920
     cataattgga tgctttaatg gcatcctcca aagatatatc tctgagtctt atctttttga     61980
     agttatctgt gcttagcatt cttggtatat gatactcaag ctgaaacaca aagtttataa     62040
     ttctatccag actaacagga tcaatgtttt tattataaca aaactctcgg aatctttgat     62100
     ctttactctt tcttataaaa tcaataagat gcaacccaat tccaagcctc atatctttag     62160
     tattaaatat tggcacatca gtttttccct gattaccatg cacatacctg ctaacttcat     62220
     ccacaacctc tttaaagtta tctaagaaaa atgattggtg ctcatggtaa aaaacaggtg     62280
     gaatagcatt atcaaagtgg tcggttaatg tcatatatcc atatggagag tcatgatcaa     62340
     tgatatacgc attagcacca aaatctacag tatgatgtgt tttatttagt gggagtgttt     62400
     cttgatgatt ggaaatttca accccaaaaa aaacaaaatc gtggttagct atttcttcaa     62460
     tatcctcaga gaatgtgttt ttatatgttt gtatattctc agacttaatt ttatcaaagg     62520
     acttaatatt aagagtatta tttgacaggt tagcgttact ttgatgtctg aagttaaaat     62580
     cagaattaat aataatagag agcaagtgac gttcatccga agaaagagga tgagtttttt     62640
     gtattatttc agaaagatag tgtctggaca ccttatcgag gtgctcaagt gaccgaaatg     62700
     atgaccgtgc tccagatggc gcttcaatag aaagatttaa tgatttgaaa ctggtccctt     62760
     gagagaacat tttactataa ctttgcgctg ctatagactt ccttaaaaag cttttcacag     62820
     tatcagcaca gtgatctaaa tgtttttcac ttatgccaga agaggatgag tttgttacgc     62880
     atgatatgtt tttttgtaat gcttttgtat ctttgttcgg atttattttt ccatcaacaa     62940
     gatcaatatt gttctgaaca ttaatatgat ttactgcttc aggtattttc ataaaacatc     63000
     ccccattatg tgcgttttta tctgcagtta tttagaataa tattatctaa cttaatattt     63060
     tcttgtatgt attataacga acatatttta atatgttgta cgattttcac tctgaaatcc     63120
     cctgagttta atcacacttc ctttactgaa aggaattatt gcaacagtat tatttgtttt     63180
     tggatatata tcttgcgcct tgttatgtag ttaatgctca gaatatgata gataaaatag     63240
     agacgcagaa cagggcatgc tcataacatg atgataacat aaaaaattag taacaataaa     63300
     tgaaagaatc atgggcgctc aacaaaaaga gagctaaata gctgcgcgga atagtaggct     63360
     gtgtccctta atcatctgag ttatagtaac tgtctgttta cacaacatat tgaactatgg     63420
     cttgctacga ccttcccgat gaggcatgga ccatcatcaa gcccctgtta cctcctgaac     63480
     ccgccacacc acgggccgga cgcccatggg ctgagcaccg taaaatcatc aatggcatgt     63540
     tctgggtgtt atgttccggt gcaccatggc gcgatttacc cgaacgatat gggtcatgga     63600
     aaactgttta taaccgcttt aaccgatggt caaagtcagg cgtgattaat attattttca     63660
     acaggttgct ttcgctactt gatgcaggtg atgctgccaa cttactgatt tagtgtatga     63720
     tggtgttttt gaggtgctcc agtggcttct gtttctatca gctgtccctc ctgttcagct     63780
     actgacgggg tggtgcgtaa cggcaaaagc actgccggac atcagcgcta tctctgctct     63840
     cactgccgta aaacatggca actgcagttc acttacaccg cttctcaacc cggtacgcac     63900
     cagaaaatca ttgatatggc catgaatggc gttggatgcc gggcaactgc acgcattatg     63960
     ggcgttggcc tcaacacgat tttacgtcac ttaaaaaact caggccgcag tcggtaacct     64020
     cgcgcataca gccgggcagt gacgtcatcg tctgcgcgga aatggacgaa cagtggggct     64080
     atgtcggggc taaatcgcgc cagcgctggc tgttttacgc gtatgacagt ctccggaaga     64140
     cggttgttgc gcacgtattc ggtgaacgca ctatggcgac gctggggcgt cttatgagcc     64200
     tgctgtcacc ctttgacgtg gtgatatgga tgacggatgg ctggccgctg tatgaatccc     64260
     gcctgaaggg aaagctgcac gtaatcagca agcgatatac gcagcgaatt gagcggcata     64320
     acctgaatct gaggcagcac ctggcacggc tgggacggaa gtcgctgtcg ttctcaaaat     64380
     cggtggagct gcatgacaaa gtcatcgggc attatctgaa cataaaacac tatcaataag     64440
     ttggagtcat tacccttgat gcaaacggct ttattgactg gtctgccacc gcgctggatg     64500
     gcagtaatat ccgggcgctg aaatgtgccg ccggtgctca aaaaaacatc ccgatatcga     64560
     cggagataat gggccgggtc gctctcgcgg cggttttggc accaaaatcc atctggcaac     64620
     agacggaagt ggcctcccgt taaatatcgt gctaagcccc ggacaagctc atgaaagcca     64680
     gttcgcgcaa cgacttctgg acgggattgg cgttcagcgt cagaacggca gcatgaaacg     64740
     ccgtggacat gcggtactgg ctgataaagc gtattcaggg cgcgcattgc gcaatgagct     64800
     gaaaaataac ggtataaagg cagtaatccc ccgaaagtca aatgagaaaa tggcatcgga     64860
     tggacgtgca cagcttgacg tataggaaat tgaaaaacta agcgataccc ctgtccgcgc     64920
     cttatgccac gtgagatttt ctgcttttcc ctccactccg gtgttttctc tctctgcatg     64980
     gtcagttttt atgcagtaac aggctatttt ttatacttgc accgattccc gggcacactt     65040
     agcctgtgtc aggccggcat atacctcagc agactgatat cccgcgcgtt tttcttcagc     65100
     ccctccacat tcagccccgc aatggcccgg cggtatacca tccggccgcc acacagcacg     65160
     cattcgaacg ggtcacgact caggaactgt ttcaccattt gtgcatgttt ccgtcgccgt     65220
     ttctcccgtt ttgtggtcca ggtaacggaa gctcaggctc gcccctccgt tgtaatgtgc     65280
     cagccgggag gccgctatcg gcggcttctt cagataacga cccaggtagc gcgccgtatt     65340
     cctcccgccg gccgtttttt tcgacatgta cacatgccag tattttcctc cggctttcag     65400
     caccaggctt ctccactgtg attccgtcgt gatatgtgac aacgactccg gcatcgccag     65460
     cccctctgac cacgctttca gaagccgttg ccgcatattc cacatccacc gcgaacgcat     65520
     cgcgtctttc aggaagctca gctttttcca ctgaccatgc ttattcagac atccacaggt     65580
     tacagacaca tgtacatgcg gatgccagtt gagacgacgg ccatacgtgt ggatggcgca     65640
     gaagataccg ggttcctgcc cccgtttccg ggcggcatac agcagattct ccaccgccag     65700
     acggcacacg tcattcagca gccaccggtt gctttcgaac accggccaca gcgtgtccgg     65760
     cagggtgaag accagatgta cccagtcgca gtcaggaaga cgattcagct gtgtcgctat     65820
     ccacaggtct gtggcctttt ttccgcagga cgggcaggca cggctgccgc atgagttagt     65880
     gacgtatctg acgtgggggc actcaggttt atcgcagttg tattccttca cgcccagtat     65940
     ccgcgtgccg caggccagca tttttgtgac agcctcaacc tcgatatcgc gcagaccgcc     66000
     cgcatccagg aaggatgtcc agcactggtt ggccgtgaac agacgtttca gcggtcgggg     66060
     ctgaaaatca ccaccacttc gggtcatccg ccttcatctc cgcttctgtt tcgtataaat     66120
     caaaacgacg gcaggtatgg cagaacgtga cgtattcgta cggtgaatcc gggtacattt     66180
     tgtggaaggt ttcccagaaa cagaccgtgc aggagggatg accggcgata aagtctgtaa     66240
     atacggactg ataagggtga ttattggctc tggcgacggc tttcagaacc tctttcacca     66300
     ttctggtgtg gactttctgg tgctccaggt tgtgtgacat gggaactcat tctggatggt     66360
     tactctgaaa gctcatattc tgccacaccc cgatttgcag ccgccaggct gccgtggttc     66420
     ttacgccaga agggatttgt aactggtctg gtcggctccg gcgtatcagt cagtgccacc     66480
     gggacaggca tgcattcctg tatgtcatca tcgctcagta agccgtcctc gtactggctt     66540
     ttccatttaa acagcaggtt atcattgata tcgtgttctc tggcgatccg ggcaacaaca     66600
     gcaccaggct gtaatgcctg cttagccaga cggaccttaa attcacggct atagctggtt     66660
     cgccgttctt ttcgccatga gccttctctg atttgaggct ctgttaattc cttctttctg     66720
     ttggcataaa ggatggcgtc aagttgagcg aatgaaactg aatcgggcaa tggccatgcg     66780
     ataccggatg caagaaatcg ctgaaaaagc gtatgtattg tggaatgact gagacccaga     66840
     cgctgagcga tggcccggat ggtcagttta tcttcaaatc ttaaacgcag ggcatcaggc     66900
     aaataagaac ggaagcaggg aatatctttt gttgtctggg aattcatcgt tcgtgtccat     66960
     caatatagat gggcgcgatt gttgccagac aggacaattt tcacaagacg tcgctgatgg     67020
     ggcgcttact tataagagga ctctatcatc gccaatcatc agacattgaa atagacgaca     67080
     ctgagatgac gcttacaatt cttttggttt ctgtaataag taatctgaca tcccccgtgc     67140
     ccagaagagg agagggatat caagcccaag ggttaataat tgatactacg gttaaaattg     67200
     ccttcagtaa aggaaacgtg attaaattca ggggatttca gagtgaaaac catacaacat     67260
     attaaaatct gttcatttag ctataataca tacaagaaag tgtccagtta gataatgtta     67320
     tctaaataac cacagataaa aacgcacata attggggggg ggatgaaaat acctgaagca     67380
     gtaaatcata ttaatgttca gaataatatt gatcttgttg atggaaaaac gaatccgaat     67440
     aaagcaacaa aagcattaca aaaaaatata ttacgcgtaa caaactcatc ttcttctggc     67500
     ataagtgaaa aacatttaga tcactgtgct aatactgtga aaaacttttt aaggaagtct     67560
     atagcagcgc aaagttatag caaaatgttt tctcaaggga ccagtttcaa atcactaaat     67620
     ctttctattg aagcgccatc tggagcacgg tcatcatttc ggtcacttga gcatctcgat     67680
     aaggtgtcca gacactatat ctctgagata atacaaaaag ttcatcctct ttcttcagac     67740
     gaacgtcact tactttctat tattattaat tctaatttta acttcagaca tcaaagtaac     67800
     tctaatctgt caaataatat tcttaatatt aaatcctttg ataaaattca gtctgaaaat     67860
     atacaaacac ataagaatac atactctgag gatattaaag aaatctctaa ccacgatttt     67920
     gttttttttg gggttgaaat ttccaatcat caagaaaaac tcccactaaa taaaacacat     67980
     catactgtag attttggcgc caatgcgtat atcattgatc atgactctcc atatggatat     68040
     atgacattaa ccgatcactt tgataatgct attccacctg ttttttacca tgagcaccaa     68100
     tcatttttct tagataactt taaagaggtt gtggatgaag ttagcaggta tgtgcatggt     68160
     aatcagggga aaactgatgt tccaatattt aacactaaag atatgaggct tggaattggg     68220
     ttgcatctta ttgattttat aagaaagagt aaagatcaag gattcagaga gttttgttat     68280
     aacaaaaata ttgatcctgt tagtctggat agaattataa actttgtgtt tcagcttgag     68340
     tatcatatac caagaatgct aagtacagat aacttcaaaa aaataaaact cagagacata     68400
     tctttggagg atgcgattaa agcatctaat tatgaagaga ttaacaataa agtgactgat     68460
     aaaaaaatgg ctcatcaggc ccttgcttat tctttaggca ataaaaaagc tgatatagca     68520
     ctttatttac tatctaaatt taattttaca aaacaagatg tcgcagagat ggagaaaatg     68580
     aacaacaata gatattgtaa tctgtatgat gttgaatact tacttagtaa agatggtgcc     68640
     aactataaag tgctagaata ttttatcaat aatggattgg ttgatgtaaa caaaaaattt     68700
     caaaaagcaa atagtgggga cactatgctt gacaatgcaa tgaaaagcaa agattcaaaa     68760
     atgattgatt ttttattaaa aaatggagca atattaggca aacgatttga gatatgacct     68820
     aaaagctcgg ccaaataata atgtcgtcga ttatcgaagt catcatgagt gattctgtcc     68880
     ccacagtgca gcatcagcat gacagtgaat tgtctggcgt ggtccattta atgagatgga     68940
     gatggtccct ctttcctaaa tagctgtgcc taataccgct acacttttgc cagcccatgt     69000
     ttgcctccgg ggaatgggct gacggttcct tcaaaatcca ttgcacgcag ttatgtcgga     69060
     gcgggaactt gactcccgtc tttacgggag tgaggtagcc tgagtttaac ggacactcct     69120
     tcctgaaata gaatggcatc agaaggagcc aataatgagc agaaaaaccc aacgttactc     69180
     tacggagttt aaagccgaag ccgtcaaaac ggttcctgaa aatcagcttt cgatcagtga     69240
     aggcgcttcc cgattatctg ttcctgaagg cactttagga caatgggtta ccgccgcaag     69300
     aaaagggctc aatacaccag gctcccgcac agtggctgag ctggaatctg aagttatgca     69360
     actgcgtaag gctttaaatg aagcacgact tgagcgagat atattaaaaa aagcaacagc     69420
     gtattttgcc caggagtcgc tgaaaaatac gcgttagtcg aacaatggcg acaacaattc     69480
     cctgttgaag cgatgtgtcg ggtacctggt gtatccagga gcggttatta cgaccgggta     69540
     cagcatgtcc cctcagacag aaaacaaagt gatgagcggc taaaactgga gattaaggtg     69600
     gcacatatcc gcactcgcga aacatatgga acccggcggc tccagacgga gctggcagat     69660
     aacggaatta tcgtcggtcg tgacagactg gcacgtcttc gtaaggagct gaggctgcac     69720
     tgtaagcaga aacgcaagtt cagggcgacc acaaactctg accacaatct gccggttacg     69780
     ccgaatctgc tgaatcagaa ctttacgccc acagcaccta atcaggtctg ggtcgcagat     69840
     ataacgtatg ttgccacccg ggaaggatgg ctgtatctcg ccggcgtcaa agatgtttat     69900
     acgtgcgaaa ttgtcggtta cgccatggga gagcgcatga cgaaagagtt gacgggtaaa     69960
     gccctgttta tggcgctcag gagccagcgc ccacctgccg ggctaatcca ccacaccgat     70020
     cgaggttcac agtactgcgc atacgattac cgggtcatac aggagcagtc tggtctgaaa     70080
     acatcaatgt cgcgtaaagg taactgttac gacaacgctc cgatggaaag cttctgggga     70140
     acgctgaaaa atgaaagcct gagccactat cgttttaaga gccgggatga ggccatctca     70200
     gtaatacggg aatacattga gattttctac aatcgtcagc gtcgtcactc tcgtctgggg     70260
     aatatctccc cggcagcctt caggataaaa tattatcaga tgactgctta gaaaaagaac     70320
     aaatggtggt gtccgctatt gccagtacac ctcagttctg ggccttgccc gtagcagtta     70380
     tttttatcac cgggctgcac tgaaagccgg tgataaatac gccacgatac gtaagatgct     70440
     gacagatatc tttaacagta attaccagtg ttatggctat cgtcgcctgc atgcgatgct     70500
     caggcatgag ggggggcggc tatcagaaaa ggttgtacgc agacttatgg tggaggaaca     70560
     gcttgtcgtc agtcgtaacc gtcgtcgtcg ctacagctca tattgcggag aaatcggacc     70620
     ggctccggat aaccttatcg ccagagattt taaggcggag caacctaatc agaaatagct     70680
     gacagatatc acggagttcc agctccctgc aggtaaagtc tggctgtcac cagtggtgga     70740
     ctgcttcgat ggaaaagttg tgagctggtc tctcagtaca cgccctgatg ctgaactggt     70800
     caacactatg ctggatagcg ctgtcgaaac gttaaatgct ggcgaacgac cggtgataca     70860
     cagtgacaga ggtgggcatt atcgctggcc aggctggctg gaaagagtga atgcagcagg     70920
     tcttattcgc tcaatgtccc gtaaaggatg ttcacctgat aatgctgcat gcgaaggctt     70980
     tttcggcaga ctgaaaacgg aaatgtatta tgggcgtaaa tggtcgggca tcacgccaga     71040
     aaagttcatg cagcaagtgg atgcttacat cagatggtat aacgagcggc gtataaaatt     71100
     atcgctgggt gccgtcagcc ccaaaatgta ccgccaacaa tgcgggctgg aatgataaag     71160
     cagtccagga aatcgtccgc atcccccctt caccatttgg attgtccgct ccacccaaca     71220
     tgttgtttcc ttaaggttcc tacaccacaa aggaaactct catgctgcgc agtggatggc     71280
     tgacgttgcc gacaggcggg aacttcgcca gttcaggcag acaccggaac agcgcttcac     71340
     gcaggaacag gagcatctgc agccgctgct gggtacggac ttcgatatcc gtcatgtctc     71400
     ctgggatggc tatatcgagg ttggcgggaa ccgttacagt gtgccggaaa gcctgtgtgg     71460
     ccagctggta tcaatacgga tctcgctgga tgatgaactg cggatctaca gtaatgagca     71520
     acaggtagca tcgcaccgtc tctgttcggc tgcatacggc tggcagaccg tcaggcccgg     71580
     atgttcatca gttacagcga agtcagcata aaaaatcccg acaacagcgg ccaggcgctc     71640
     ccgctcacgt atgtctgttg ccgggagcag gcagaggacg gtgcctgctg gcatctgctg     71700
     acgtcaggaa aagcggcgag tgccgccgat gcacgacgta ttgtcagcca ttacgagcga     71760
     cgctggctga cagaggaata ccacaaggcg tggaaaagtg gtggtacatg gaatcgctgc     71820
     gaatgcagac ccgggataac cttgagcgca tggtggttat ccaggcgttt atagcggtac     71880
     gggtgctggg cctgcggcag ggaggtgtca gtgaagaaac acaaaatgac agctgtgaga     71940
     aaatactgac gccgacagag tggaaactac tgtgggttaa gctggaagga aagccgcttc     72000
     cggtgcaggc accgaccctg aaatgggcct ggggcgatgg catgacagca aactggattt     72060
     gcccctatat ttccagacat ctgttatcac ttaacccatt acaagcccgc tgccgcagat     72120
     attcccgtgg cgagcgataa cccagcgcac tatgcggatg ccattcgtta taatgctcga     72180
     acgcctctgc aaggttcttt gctgccgtta acccgtctgg tttgggcatg atactgatgt     72240
     agtcacgctt tatcgttttc acgaagctct ctgctattcc gttactctcc ggactccgca     72300
     ccgccgtgtt cttcggttca agtcccaaca tccgggcgaa ctggcgtgtt tcattagccc     72360
     ggtagcatga accattatcc gtcagccact ccactggaga cgacggaaga tcgttgccga     72420
     agcggcgttc caccgctccc agcatgacgt cctgtactgt ttcactgttg aagccgccgg     72480
     tagtcaccgc ccagtgcagt gcctcacgat cacagcagtc cagcgcgaac gtgacacgca     72540
     gtctctctcc gttatcacag cagaactcga acccgtcaga gcaccatcgc tgattgcttt     72600
     ctttcacggc cactctgcct gtatgtgccc gtttcgatgg cggtacagca ggttttcgct     72660
     caagcaacag cgcattctgg cgcatgatcc ggtaaacacg tttggcattg atcgcaggca     72720
     taccatcaag ttctgcctgt ctgcgaagca gcgcccatac ccgacgataa ccatacgtgg     72780
     gcagctctcc gataacatgg tgtatacgga gaagcacatc cgtatcatca gtgtgacgac     72840
     tgcggcggcc atccatccag tcatcggttc gtctgagaat gacgtgcaac tgcgcacgcg     72900
     acacccggag acaacggctg actaagctta ctccccatcc ccgggcaata agggcgcgtg     72960
     cgctatccac ttttttgccc gtccatattc aacggcttct ttgaggagtt cattttccat     73020
     cgttttcttg ccgagcaggc gctggagttc tttaatctgc ttcatggcgg cagcaagttc     73080
     agaggcagga acaacctgtt ctccggcggc gacagcagta agacttcctt cctggtattg     73140
     cttacgccag agaaataact ggctggctgc tacaccatgt tgccgggcaa cgagggagac     73200
     cgtcatcccc ggttcaaagc tctgctgaac aattgcgatc ttttcctgtg tggtacgccg     73260
     tctgcgtttc tccggcccta agacatcaat catctgtact ccaatgacta gtctaaaaac     73320
     tagtattaag actatcactt atttaagtga tactggttgt ctggagattc agggggccag     73380
     tctacaaacg cacaggtcgt cccggttggg tcgtcatgtg ggatggctgg tcagacttca     73440
     ggatatggtt gagggttacc tggtgatgaa gtctcttgat caggagctct gatcaagaga     73500
     cagcagcttt ggggggtgcc cctattaagt tgtcaagcat gttatgaccc ctgcggggta     73560
     taaaaagtcc cgtcgcgcat catggcgaac agaacgtcgc agcgtcgtct cgccagggcg     73620
     ataagcgcct gattgtgtcg ttttccctga ctcattttgc gggtgtagta agccctggag     73680
     agcggatccc tgagcgcggc gaaggccgac aggaacaacg cccgtttgag agctttatta     73740
     ccccgtcgcg agggatgctc accgcgtatt gacgagccgg atcgccgagt taccggcgca     73800
     aggccagcat aagcagcgag atgtgcggca gaggcgaagg cgcggcaggc gacctcggtg     73860
     aggagtctgg ctgcggtcct gacaccgact ccgggcatac tggtcaggac cgggtaaaga     73920
     gggtgagcaa gaactcgctg ttctacctca agcgccacct cgtctctttg cttacgcagc     73980
     gtgatgagct ggagtgccag acgtggcagt actacggcag cggcattcgt gccgggaacg     74040
     acgacggttt gttcggccag tgcctgagct atgtctgctg caaggcgttt acccagacga     74100
     ggcgcaagtt tgcagagctg ggctgccagc ttcttctcac ccagcgaagc gagtttttct     74160
     ggtgagggat atcgctggag aagatcgagt accgccgggt gctcaagtct cggaccgaga     74220
     acgcgctcca gtgccggatg tatctgggtc agaaggccgc ggatacggtt gctggcctgc     74280
     gttgtctgtg cggcaagatc atcatcgaag ccgcagagca tggagagttc ggcgatttgc     74340
     tcgtcagcca gtttcagcgt gcgtagcgcg tgaggcaggg tacgggcagc ttcggcaatg     74400
     atggcagcgt cacgagcatc agttttagct tcaccggcgt gtaagtcggc tatgcggcgc     74460
     atggccagtc cagggaggta tccgacaagg actccttctg agcgggcaac ggcgacaggt     74520
     aacgcaccga tggtagctgg ctgatcaaca accagcagta tctgaccatg ttgtttcagg     74580
     tcagatatta gcgacctgag tttgttttcg tcgttgggta atgctttatc gaacaggcgt     74640
     ttacctgaac gattaatggc aacagcgtga tgcgtatctt taccgacatc aacgccgata     74700
     aagacctgga cggattcgta atcgctggat tcggtcattc tgtctccctt gtatatgggt     74760
     taaccagata accacgggga gcaggtaccg gcatccacgt tacagacggt cccggcaaaa     74820
     gtgcctgacc tgacccctat tagcggttac cagcgcccca ccagacccgg tgacatcacc     74880
     ccccggatca tggacgactg ggggcagtaa tcatgccggg tctggctggc taacacccca     74940
     ttataagggg tacgaataaa gtaacggggt tgtcgaagct caccagattt tcaccaggat     75000
     gcacgtcata ctcttttttc tccggaggca gtgccagcat ggactgctgc tcttcgagcc     75060
     agcgatcaca gggacgggcc tggattgttt catgctttcg ttggttagcg acatcgtgca     75120
     gccagcgcag accgtggcgg ttggctgttt caacatcgac agtgctcccc atcgggcgca     75180
     ggcgagtcat tagtgggatg taaaaactgt tacgggtgta ctgcaccatc cgttccacct     75240
     tacctttagt ctgtgccctg aaggggcgac acagtcgggg agagaagccc atctccttgc     75300
     cgaactgcca cagcgaagga tggaaccggt gctgaccggt ctgatatgcg tcacgttgca     75360
     gaaccacagt tttcatattg tcatacaaca cttcgcgcgg cacaccacca aagaagcgga     75420
     acgcattacg atggcaggtc tccagcgtgt cataacgcat attgtcagtg aattcgatgt     75480
     acaacattcg gctgtatccg ggaacagcaa cgaacacgtg aagcggtgag cgaccattac     75540
     gcatagtgcc ccagtcaacc tgcatctgtc gtccgggttc agtttcgaac cgaacggcag     75600
     gctcctgctc ctgaggaacc gagagagaac gaatgaatgc cctgagaatg gtcattccgc     75660
     cacgatatcc ctggtctctg atctcgcgag cgattaccgt tgccgggatt ttgtaaggat     75720
     gagcatcggc gatgcgttga cgaatataat cccggtattc atccaggagt gaagcaacag     75780
     caggtcgcgg cgtatatttt ggcggctcag attttgcctg caaataacgt ttaacggtat     75840
     tgcgggagag ccccagttct ctggcaatcg cccggctact cattccctgc ttgtgcagga     75900
     ttttaatttc cataactgtc tcaaaagtga ccataagctc tcctgaatca ggagagcaga     75960
     ttaccccctg gatctgattt caggcgttgg gtgtggatca ctattgcacc gttcgtgaca     76020
     cttgttgact gcctgtgcgg catctggtat caaggtggcg tgaagccggt tcaggttctc     76080
     atgcggaacg ttggaaccta tatccccccg gtaccaaagg cgaaatgtaa gtgacaaaat     76140
     gcaatgaaca cgttctccgt taactgagga gcatggtgat aaataaaggt aaatgcagaa     76200
     ggtgtagagt ctcgcagatt tctgacatca tagagcctaa cattagatgc ataacgctac     76260
     agattgtaga atctctacag gtgaaatata cactggttgg cgtttatgtc gcaaaacatg     76320
     tcattcaggt tcatctcacc aataaggata tgagtgaagt ggaggataag tgagtctgct     76380
     gtcagagttt tctggtgtat gtcagtaact gcgaaccatg tctgcttgat atgggagctt     76440
     atggaggctc tctgtacaag gttagggagc taacaaagca gggataaaaa gtccgcctga     76500
     tgcaggcacg gttcgttaaa tcttttgcca ttggtaacaa aatggtgcga tgaatgttca     76560
     ggctatcttt atcttgatgg tggttcagct gtttggtaaa gaaatcgctg taacaataga     76620
     agaactgcag gcagtactgg tcccacatcg tttgctcagt caactggtga agttccgtag     76680
     cgcgtaaatt aatgctttgc atgaaacgtt actggagtgg atgaaagaat acctgcatat     76740
     atcattactg cgttggatta ccagtacaac agattgaatg aactggacat gttgatagac     76800
     ggcattgaaa agcagcttat aagcatagtg cggcagagtt aattggagag cacttcgcct     76860
     tctgagtatt aagtaagcat ggtggtacct gcggatacta tctattcact gtgctcggtc     76920
     ggcagcctta ctgaccaagg agttggggga gtcgataaca aagttgaaaa aacagctctc     76980
     aaccaaggtg gttattgtaa caatagcaaa taagctggtg tgacctgaat cacaataacc     77040
     gattatggac gtaaatacga caaaaatatg tcagtatcag gcggtattaa ttgctgatgc     77100
     tgatggacat taactcttaa taaaagggtg gatgctgaaa ggttgttatg gtgacggacg     77160
     tgatgacgac ggaaaagagt atgaggtttt ggatttaaag ttcgttcggg gaataaggac     77220
     ccggtcagct aattctcata gtagttcgca ttgctggatg caatactgtg ctgcaattac     77280
     tcgtcgatgt cggaacaacg gaagccttgc aaacggggat gtattcatac aggtgttatg     77340
     ttatatgggg ttttattgca gggggctata ccaagagaat atatgatatc tcatcagact     77400
     gatgtgaggg taaatgagaa tagagtaaac gaacaaggtt gttttttggc gaggaagcag     77460
     atgtatgaca attcttgtgg agctgccagt ttactctgtg ctgcaaagga attaggggtt     77520
     gataaaatac cacaatacaa agggtctatg tccgaaatga caaggaagag ttctcttgat     77580
     ttggataatc gttgtgagcg ggatttatac ttaataacta gtggtaatta taatccgaga     77640
     atacacaaag ataatatcgc ggatgccggt tattctatgc ctgataagat agtcatggct     77700
     acgaggcttc ttggattgaa tgcttatgtc gttgaagaaa gtaacatttt ttcgcaagta     77760
     attagtttta tttatcccga tgcaagggac ttattaattg gcatgggatg taatatagta     77820
     catcaacgag atgtgttatc ttctaaccaa agagttttgg aagctgttgc tgtatccttt     77880
     attggagttc ctgtcggcct ccactgggtg ttgtgtagac ctgatggaag ctatatggat     77940
     ccagctgtag gagaaaatta ttcttgtttt tcaactatgg aattaggtgc aagaagaagt     78000
     aattctaact ttataggata tactaaaata ggtatttcca tagttataac taatgaggct     78060
     ttgtaaattg tcgtttttta tctgtgaagg agcttgaata ttttgggggc ggggggcata     78120
     acaaatgata ttactgagta caaatttagc tatattgggc ggattagttg tgtgggaaga     78180
     cgaaatgttt ctcttgaaat aagtgaactc cctcaaggaa tgattgtgtg cttaaatatt     78240
     taagtgctgg taagtttgag aaggctgaca tattttgcag agcaaacagt gattgacttg     78300
     gatgatattt ttattttagt cactcgttgt aattggagta tgctttattt tatttgaaaa     78360
     tagatgtatt ttatacccgc aatttaaact gtaagcccta tgaggggtat ggatattata     78420
     agttactctt tgactaagca taacttttgg ggttagaaaa ataaatctct tgttaataat     78480
     taatatgatt ttaaaatcaa acttgtttat aattataaaa taatgtaatt cggtcatttt     78540
     atgggaagat taggagaata aaacagtaat tatatttgag aaatctgcta atatattctt     78600
     aaagcttttt tgatactgtg aacgaagtct gttaatggtg gattttttgt ttatcaccat     78660
     gtaaaaaaat tgagtagtaa aagcgttgac tgctaatcct cgctgttttt attgaaacaa     78720
     ttaaaaatac gctgaatatt ttcggccagt cactcatctt cacataaaat tttgaccatc     78780
     atgccgcatc ccttagttga caattcattt tcaatgatat gaatattact aatttcacca     78840
     gataatgttc tcgtggtcag cagggtatga gttttcaccg taattttaag gaaacacagt     78900
     gcgtggggat tgaataacag atagccgacg gaattacccc accggctgaa agtcaagttc     78960
     aacgaagatt tttattatct gaattgggca gtttacatca gtgttcgatg tttatgaaga     79020
     cgatagatgg cgagaaatta tatcccgaat agcttcatct atttctctct gaactgtttt     79080
     gtttatttta gataatgtaa atattagagt tctgtttgtt ttattctctt ttctttttat     79140
     gtaagtccgt ttgtctttag aaataaataa cgagtcaact tttagcgaag ggttttgctt     79200
     tctgtttttg cttttcttta tgatgtttaa aatttctttt ttatatatgt ccgggggcaa     79260
     atttgtatca aggtctttta tttcttcctt taatattggt agtgtagaac taagagattc     79320
     attagccttt tcaagtcctt tataataatt gaataatatc ttgtagtcat taaagttaag     79380
     ttctgacgcg attggaaata gagatattat ttcctgtgga acgcttgctg cctgaaaggc     79440
     acgagtgact ttcgcgcgag acagattctc ttttttggct atgtctttat aggacatccc     79500
     tgatactttc agaaaattaa gaccgatacc aagttctcgg atgctatgct cttttgctgt     79560
     ttgtatatcg tttgctagtt ttctggcatc aagagtagat atatattctt ttgaatatag     79620
     aacttcaaga tctgctcctg catatattgc agatgctctt ctacgagtgc catccagaat     79680
     ttcaattcta ccatcaatct cccttcctat tacagggaag aattgttgta gctttatagt     79740
     ttttatgata tcggctaatg attcttctgt tagggattct tgatcgcgta cattcgtttt     79800
     ttggttgacg aaggttaaat cttggatcct tttatgagga atcttggctt tgataaagga     79860
     aactttatta ccagaatgga gtgtaaactc tttcttttgg ccttccttta tacttaacaa     79920
     gtcgttgcac aaatccacca tatcacaccc tgtttattca tattgattta tattgacaaa     79980
     agttaaatgc agtgtgagca agattgtatg taactgttga tgatagtcaa cggtagtctt     80040
     aaaaattact attttaatag ctggattgat gcaatttatc tttattggat aaaagaataa     80100
     tattcttgtg gagctctgat gtgagagctc catagatgaa aaaatgctta tcaattacta     80160
     tattgatttt gtactatttt tgactacaga aataagatct ccaatagtaa taatgtgttc     80220
     taatgcagat tcatctatac gtagattgaa ctcaaaacta atcatatcca gcatttcaat     80280
     cagagaaaga gaatcggcag aaagatcttc aataaattta gtttcttcag atagtttgct     80340
     gtacgctata ccatagcaaa aggccactat tgataatatt ttttctttta tcatatttta     80400
     atccttattg atattcttta atacttttga tagggaagtg gttacatctt ttgctgcttt     80460
     atatatatta ttgttttcag ctgtaatatc attgttattt tttaaatcag atatatcatc     80520
     tgtaagtaat tctgcagagg tatcgtcaat ttttgacaat accttgctga gggcgctaga     80580
     tacttctttt gccttttcat agatcgcatg atttttatca attgtatctg cgttggtttc     80640
     tgttacgtag tttattgtat ttgcatctgt aacttttaat ttgttgttta ttctgtgttc     80700
     tgttgtggat tttgtaatgt cctttgattt ttcctgtaac tctcgttctt gtgttcctga     80760
     tttagttcca atgagagata taagattact tagggagttt gttacttttt ttgacgcttc     80820
     aaatatcgtt tcccgtgtta aatatgtgtc tccatttctt gagaaaaaat cagtctgaag     80880
     tacttttgaa tcagtgtttg agttgaattt attgatttgc gaagctactc tatgagaaag     80940
     agaagcgcta cttttagttg tatctgatga gttatcatta ctgcttgtca ctccttccgg     81000
     gtggagaggg ggggtggttg aagagttctg tatgttcaga ggcctgtgtc cccgagaaag     81060
     agagttattt gcagatcttt cttgactact cgtagttaac aggtctgaac ctattccatc     81120
     cgaattatct ggagtatggt tgaaaacctt ttctaaagct gaattatttg caaatgtctg     81180
     gacagtatct gatatagagt gtggtagaac ggaagttact ttttgaacta gtgctctttg     81240
     tggatttagt aatgagtttc cgttacggga taatagatcg tttgtctgag aagtaggaga     81300
     ctgtgcatca ttttctgggt tctcgtgata gctattgtca tatactctgt tgtcaaaaac     81360
     tctattatcg taagttctat tatcattatt tatatgatag tgaattacag gttgggatgt     81420
     tttctcattg gctccggggg ttggtccgcc atctggcata tcttcgggag gtgtagggag     81480
     gccatcttgg ataggatgcg aatcttttat atcttctaaa atatcattaa ggacttttct     81540
     caacagctca ggaaacacgg ctactgtatt taagtctctt gacagtttac ctataccaaa     81600
     tcctttacta tcaatagtat ttttacgttg attgcgcaaa ctatcaaagg caagttttgc     81660
     ctgtgcgtca actaaatcat ctagtttgag agatgaaaca gtttcattac ttaactttaa     81720
     ttcagcaaga atattattct tgataaatga tgatacttca gtattgagga gtttttgtcc     81780
     caatgataaa gcttcaccag atgtgtgttg ttgtgctaat agtgcaagtc tgtgctcaat     81840
     gttttgtcgt aattgatgga gtttcttatt ctttgccgac catggtccaa aggcagaatc     81900
     ttgggataat ttatctttta taattagttc cgaatactgt gcgacaattt tttgaagtcc     81960
     cttttcgttt tcaaaattaa gaccattttg atgtactaag gagtacaaaa catttgaaaa     82020
     ttcgagaatc tcgcttttgg catacgcatt cattgagttg gaataaatgc ttcttaacac     82080
     atcttctttc cctgaggaag aaaataaaaa atcaagacat ttctgattaa aagacgttgc     82140
     aaagctttct ttttcagaca ctgatgctgg tgtttttaga gaagtttgcg aactatggat     82200
     atcggatatt ttgcttttta actcgctgta ttctgttgat gatggtgaag ttgccttata     82260
     taagaatgtt ggcgcttgag tattatttac attatgcatg gcgcacctca gaaatggaga     82320
     aaaagtttat ctgtatctgt acatgagctt attgtactac tcaaaacctt tactaaatta     82380
     tcaaaaatac tattggcatt actgtatttt tgaactaaag tttgaagatt atttttcatt     82440
     gtttcatctt cggcagagaa tccggcattc catgcctgat attttgcatt atctagcaca     82500
     acctcgccat ttccacctag attatttaag ctttttaaca tattgtctat tggggtcatg     82560
     tttatattga caacatatcc cccgtttttt ttagatacct tgccgattgt tccacctaat     82620
     tctgtaagcc atttatctgc ttctttctga ctaacagtat tagttgctgg atatagcggt     82680
     ttatcttcat attttttctt gagttcttcc aatgcttttt taagcgagtt gacttgtaat     82740
     ttcacggagt ttccgtcgtt acctccggga gagatccagc cggcaagact ggaaagaaca     82800
     gcgctaaaat cttgatacat ttgagtatat gaactaacgg catgttcata tactttcaga     82860
     tactgttcat taatatcatt gatggagttt gcaattttag cccacagttc tctatgagat     82920
     atcatttgat ctccatcaag ctcggcttct ttcggggctg aatgtaataa ttctcttgcg     82980
     tctttattaa ttggatattc gttcctggaa agaatatcca atagttgagc ggatttattt     83040
     acatccatgc taatctgaga tgaatgtaat gctatttctt ctagcgatgt tttagtcaac     83100
     gttttttgtg aaagctcttt ctttaatgcc tgatttgttg ttctgatatt atgaagggtg     83160
     tcgttgagca tagtaaggga acttacagga tgagaactgg tcgttgtttt tatatcagaa     83220
     ttaactgttt cggttgatga accgttggta ttgtttggac tgaatgatga ggtggaaata     83280
     ctattagtca gagttgttat attcatggtt atttccttac aggaagagcc atatattatt     83340
     atggctcttg gatatattaa gctcgaatgt taccagcaat ctgactggct gtcgaattcc     83400
     ttgattgggt gatgctgtca attatattca ataatttttg tattaattga tttgtcgctt     83460
     gggatgcttc tttagatact tgggatgctt cctctgcttg tttactgctg gcctgactga     83520
     ttagttgttc ttcttcttca agagcagatg cataacgccc tcctgatgtg gatatattac     83580
     cagcaacggc tgatgtgtcc attgttgcac ggccaatatt ttgtttttgc tgcgcagaaa     83640
     gggtattgag ctcgtaagtt cttctctggg tgtcaatttt atcctgcaaa gaaatatcgg     83700
     gagaactaag agaagtttta tgttcagttg acagggatat attatctggc gccagtttat     83760
     ttttacctaa aaattttgtg ctagagttag tttgtggtga ggtgatattt gtatctattt     83820
     gtttatttaa ccctaattta gaacctgcaa gctctttttc aagagattga gcagtggcaa     83880
     ggttctttct taaggctcct ttttggtcgc taatccctga atgcgttttt ttggcaccga     83940
     tacccgttat acctacttgt gtgactgctc cagtaatgct tgatgatagg gctgccaggc     84000
     cttgccgaac aatgttctct gcagctgatt ttgtagcatc gaacgcaatc aatgacaatt     84060
     gagagcccaa tttagtttct gcagtgcgga gagcagaaag tagaacggct acactaataa     84120
     ttaaagaaac agcattagaa gaaagactgg aaatatccag agtgttctct ggagtaaggg     84180
     tgtgactcat ctctgaaaga tctttcatct ttttgtcagt aaggcgagca atgatttctg     84240
     aatcatgctg aacctgctct gataacttta aaagttgatc atcatttaat gtggttgtta     84300
     atacgggatt tttaccgaca ttaagtggaa tatgcgctgc aatctgctga taattttgtg     84360
     atttttgtgt ttcggaagaa ctttgagttt gttttgtgga tatatctgta tataaaatct     84420
     gggttgattt tgtgttttga atttccataa cattctcctt atttgtatca agcagtagtt     84480
     tgttgcaaaa ttgcttttgc aacatcagtt ctattagcct gagagttgga cattgaggct     84540
     aatagatctg caattacttc ctgcaattgg ccgaattttt ctattgcttc actgatatat     84600
     tttgacagtt gttcaacttg atatttcgat aatgtcaggt ctgctagatt tgtagacgcg     84660
     ctgttctgga aaacagcaga agcgacactt cctcccgctt gtgtggcaga gttaacactt     84720
     tctcctaata aaactgcttg gtttaaatgg gtggaaataa tttgtttgga tattacttca     84780
     tcacccgctg caccaagaaa tttatttaat ctggcaacag cattagtgat taaatcgtcc     84840
     agttgagaag aaaaattctt gagaaacttt ggtataaggt ctgtgagggt tttacctatt     84900
     attttgccaa tattctctgc aagttttgct gctgcctgtt taccaacagt ggctacgaga     84960
     actactgctg caaccaggac aagagcgcct gcgattgccc ccagaataga gccaatcatt     85020
     ttggcttttt tcgagtcgac gcccaagcct tcgagcattt ttgtaaatgc atctgaaagg     85080
     agtttgatta agggttcaat gactgctttc atgatcggat tcagggcttg ttccatgaag     85140
     gaattgccgg tcgctgcttg tactatagca tccgtaacca taagagctaa accaacagct     85200
     gccagtgcta gagaggctcc tccagaaaaa gctgctgcaa caacactaac gatagttaaa     85260
     agtgccccaa gtattttccc aacacaaccc attactctgt tgagttcttc tgctttacgt     85320
     acttcagcag catactcatc agattttctc tccatttcag tttttcttga ttcttggaga     85380
     gactggaata gagccagatc attttttaaa gattcttcat tattttttcc aactagttga     85440
     ataaaggttg ccatcaattg agtaacactg gcaagtccgg ttaatgattt ctgctgggtt     85500
     gatagctgtt cagcagatgc tgtgtttgaa aatgcagaaa aagagtctat ttctttttcg     85560
     agttgcattg atttatctgt aagtttgcta tgaattgaca gggttttctg ctcaatcaat     85620
     gtcctgtctt taactgctgc gtcttttttg atagtgagtt gtatttcttc ccggcttaat     85680
     tttttctttt ctggtgaatc tgggtcgagt tcggataatc ttgtttgaat ttggttaatt     85740
     ttattttcta ggtcttttat tttagaatct gcgtttttta gtttattaat ttgtttttca     85800
     tagtctctgg ttagtccttc agtttcagat agaagagtat taattttatc ggagaattct     85860
     aggttttttt gctgtcttgc ctgttgctga gacttccaag cagtaatttt atttgttaat     85920
     gcagttaaag atttttcacc gagtatttga ataaggtttc caattaaaag cgttagttgg     85980
     gaacttgcat ttaatgactt tggtgcttta agttcaggga ttaatatatt tgaagttgag     86040
     tgtgaattag ttgtattaat atttttgtta gcagtaagat cagcaattgt aagagaaaat     86100
     aatttgttag ctgcatcatt tgcagcctgg atagtattgt ctccaagctc agtggaagcc     86160
     aatattttgg caagagacaa accagtggtt gtggtactta cattatgcat aataattact     86220
     ccttgatatc ctgaattgcg tccaagtatg attgtgcttt tatttttaat ttttcatcat     86280
     tgctgtgttg aattacgagt tcgaagcact ctttggcttt caagggggct ttcaaccgaa     86340
     gctggcattg tccagtatgg aataccggtg tatagtcatt ttttcctaat gcaaaagcga     86400
     cagcataaag gtctgctgct tgttggaact gttcttttat ctgataaata gctgcgagtc     86460
     ccataatgta gtctacattg taaaagtcgt atatacataa aaatctgaag aaaacttcag     86520
     cttcctctat tcttcctttg ttgtaaaagt cataagcata tgaataaatg tcatccatca     86580
     tatcatcagg aattgcatta atatctttca gtgtagcgcc agagttaatt gcatcaatta     86640
     ctgcagtaga gatgctttca ttttcagtga tatttaaaga cataaggtct cctttttgtc     86700
     tgctttactt taataagtat aagatttaat ataaacagat ttaatttgta ttgctttgac     86760
     ggtatacggc ctttagaacc tctgcgctta tttctatttg taaaactttt gttgattcat     86820
     taaatatttt atcgtagacg gaactggata ctagatttgt aagatccttc atttgtgtgt     86880
     taaacaaatc catgttactg ctatagcgtt ttaaaatctt tgctctgagg ccagatgagg     86940
     caatctcgtt tagtgctgta tgactgatag atgtttgtgc tgatttttca tcaagtttta     87000
     tatccgggaa ttttttttca atagctgcaa atatgttttt tttgttatct gaggtcaaaa     87060
     caactccatt gtgtatggcc atttcatcta tacttctgtt tatcattgaa gagacataag     87120
     aggttcgctc ttggctcatc caacaaaata gttgattccc cgaattacta tcttttattt     87180
     tgtctatgac gttgtccctg attttattta tattcaccgg gcatccaaaa ttcttctgag     87240
     gaaagcgttg ttttaagtta aaaacagata atattttctt tacaagctta ttgtaactta     87300
     acgaattaaa tgatgggcga ggaatcgcga attcaacctg tggaagtatt ttgtttagaa     87360
     tttgcatgat accccctata tgttagttca cttctgaagt gatgtttgca atggttagtt     87420
     taatacaaaa taaaaattca tacaaagatt caatgagttc atcaggtgaa agatattttt     87480
     tgtagtgttt cttggtcaaa acacattgat gagtatcagg gagaagacag atagaagaac     87540
     cataatctct actcaaagag tagttaagga tgagtatgtg ttctggatta ataatatttt     87600
     ctgtaaaaag ttcatgttca ttaagaagtc cggtcaaaaa gatgtattca tcattatctg     87660
     ttatacaaac aggtatttgt tcttcgagca atataaaggc ttgattttta tcgttaaaat     87720
     caagctttgc acctgttatt tcataaagtt tatcatatag tttgcgacac atttctatgg     87780
     ccttctatat attagaatga gagttattca ataaaagctt attgacctgt aataagtcgt     87840
     gaatgtaaag tttggttcca agatctggcg atttaagaga attgtaataa tcaatagttt     87900
     ttattgactt ttcgataatt tcttcttttt tatctgttgc tccggttttt aattcgttta     87960
     atacacgaga catattgctg ggtgctgatt ttactaagta tgagtggcaa gcgttgatga     88020
     ccgcatcaaa gtcttctgaa gatacatttt cagtaggatg tttgtaaagt gaaattgata     88080
     aaggcttgaa tgtttttggg gtgtggataa ggttaatttt attgaaactt ttaagatagc     88140
     tacgtcgtaa ttgagtcaat ctggaaagat caaaatcaga ttcaatatac ttcattatct     88200
     cgttataaga ctgattgaga ctttcaatgc gttgcctaac tttatttgca tacgcgtata     88260
     cattgttagg tgtagcaacc aatttaacgt cagggagtgg aaagtatatt tcagaatttc     88320
     ctgctttaag aacattaagt gccataccag cacagttttc agatttactg attaatttat     88380
     aatttgccaa ttgtctgaaa gcatctgctt tcttttggca tataaatttt gacatgtttg     88440
     tttcatcaag gccaaaaagg ttatagctga ttttaccatc ctttgtttta ttatcacctg     88500
     ataatggaat gtatacttta tcagcactga ccccccaata accatagggg tctttttttt     88560
     gattagctct gggaaaaaat atttttttgt tgttattttg atcttgtttt gaatttaata     88620
     agtttctaac ctcttggcct gcatcaagtc tttcggctgt ttggtctgaa atcatattta     88680
     gtttgtcttg tttataggta tcgacactgt aacctgagcg tttttcaaaa aggtagttta     88740
     tttctgtatc ttttgtaaca ttcccgccgg gataccagct gagataggta tgagttggtt     88800
     cctgtagtaa attgtttttt atactgatac tggtatgccc taaatgggtt atgcctctat     88860
     ttccccagca acgaaaaact aaatgtcttt caagattttt ggctgtaccg atgccatgaa     88920
     aacgctctgc ggtattcaac attaatttga tgtctttacc tgtaaaagaa tgttgaattg     88980
     aatttttgac tgcttcatag gcggcaaacg cactttctgc agatttttcg ctagctaatg     89040
     tcttgaggaa aagcaataag gatttttgat tcgctagtcg ataatttttt agttgttcat     89100
     ttaatatctg tgaatttatc tttgcattaa tagtgcttaa tgttctgaaa aagagatcct     89160
     ttaggttgaa tttctgtgct accaatatag gtccatgctc tgtatcttca acgcgtatag     89220
     gcccttttgt attgcttgcg tcaatgaaat tgctaatttt gaggatcata ctttattaac     89280
     tctccattac gtggtgattg tggggatgta aaatgtattt gatatataat atattcaatt     89340
     aataaattta gaaacttgag cctgttaaca taatcaaatt ttcttttgtt gtacataata     89400
     tgtacctcgt gagcatatgt agtgctcgtt tcatcatgaa atcccacaag ttaaagtgtc     89460
     tgatatatca ggctcggagt gttatagaaa aagagagaac cctgttgaat aagtatcttt     89520
     tttgttgtaa aacgaggtac aaaactgcaa tcaatgcccc atttatgact gaggataatt     89580
     aaatgcacat aactaatttg ggattgcatc aggtttcatt tcaaagcgga gattcctata     89640
     aaggcgcaga agaaaccgga aagcacaaag gtgtaagcgt gatttcatat caaagagtta     89700
     aaaatggaga aagaaataag gggatcgaag cgcttaatcg attatattta cagaaccaaa     89760
     caagcttaac aggaaaaagc cttttgtttg cgcgtgacag agctgaagtt ttttacgagg     89820
     caataaagtt ggcaggtggt gatacgtcaa aaattaaagc catgatggaa cgattagata     89880
     cctataaact tggtgaagtt aataaaagac atattaatga gcttaataaa gtaataagtg     89940
     aagagataag agcacagcta ggcattaaaa ataaaaagga attgcaaacg aaaataaaac     90000
     aaatatttac tgattattta aataataaga attggggacc ggtcaacaag aatattagtc     90060
     atcatgggaa aaattatggt tttcaattaa cacctgcctc tcatatgaag atagggaata     90120
     aaaatatatt tgtcaaagag tataatggaa aaggaatttg ttgtgcttct acgagagaga     90180
     gtgatcatat cgcgaatatg tggctttcaa aagtggtgga tgacgagggg aaggaaattt     90240
     tttcgggtat cagacatgga gttatatcag cctatggatt gaaaaaaaac tcatctgaaa     90300
     gagctgttgc tgctcgtaat aaagctgagg agttagtaag cgcagcatta tatagcagac     90360
     cagagttatt atcacaggct ttgtctggta aaacagtaga tttaaagatt gtttcgactt     90420
     ctcttctgac gccgaccagt ttaaccgggg gagaggagag tatgttaaaa gatcaggtga     90480
     acgcattaaa agggttaaac tctaaaaggg gggagccaac gaaattatta attcggaata     90540
     gtgatggtct tctgaaagaa gtaagcgtta atctaaaagt ggtgacattt aactttggtg     90600
     taaatgaatt agcgctaaaa atgggcttag gctggaggaa tgttgacaag cttaatgatg     90660
     aatcaatatg ttctttgttg ggggataatt tcctcaaaaa tggtgtgatt ggaggttggg     90720
     ctgcagaagc aatagaaaaa aatccaccat gtaagaatga tgtgatatat ctggctaacc     90780
     agataaaaga gattataaac aagaagttac aaaaaaatga taatggagag ccgtataaat     90840
     tgtcacaaag aatgactcta ttggcttata ctataggtgc tgtaccttgc tggaattgta     90900
     agagtgggaa ggacagaaca ggtatgcagg atgctgaaat taaaagagaa ataataagaa     90960
     aacatgaaac aggtcagttt tctcaattaa atagtaaatt atcctcagaa gagaaaagat     91020
     tattttctac tattctaatg aatagtggta atatggaaat ccaagagatg aatactggtg     91080
     tgcccggaaa taaagtcatg aaaaaattgc cgctatcttc gttagagcta tcttattctg     91140
     aaagaatagg ggactcaaaa atatggaata tggtgaaagg gtattcgtca tttgtataag     91200
     aggaatatat ggaagattta gcagatgtta tttgccgagc cttgggtatc cctttaattg     91260
     atatcgatga tcaagcaatc atgcttgatg atgatgtgct aatatatatt gaaaaagaag     91320
     gagattcaat aaatttatta tgcccttttt gtgcattgcc tgaaaatata aatgatctta     91380
     tatatgcgtt gagcctaaat tactcagaaa agatatgctt agctactgat gatgaaggcg     91440
     gaaatctaat tgcgcgatta gatcttaccg ggataaatga attcgaggat gtatatgtta     91500
     atacagaata ttatatttcg cgtgtgcgtt ggctgaagga tgaatttgcg cgaagaatga     91560
     aggggtatta atgtcccgtt tcgtatttat tttgctgtgt tttatcccat atttagggag     91620
     agctgattgt tgggataagg ctggtgaaag gtacaatatt ccatcaagtt tgttaaaagc     91680
     gattgcggaa aaagaatccg gatttaataa atttgcagtc aatgttaata acaatggaag     91740
     taaagattat ggtataatgc aaataaatga ctttcattct aaaagactta gagaaatggg     91800
     atattctgag gaaatgctaa ttagtcatcc atgtctttct gtacattatg cagcaaagtt     91860
     attaaatgag tttatgatga tgtatggaag agggtgggag gctgttggag cctataatgc     91920
     aggaacgtct ccgaaaaaga aaaaagaaag attaaagtac gcagaggata tctatagacg     91980
     ctatttgcgg atagcagcag agagcaagca gaataatcga aggatataag aggatttatg     92040
     tctgaggcaa agaactcaaa tcttgcacca ttcaggttat tagtgaaact cacaaacggt     92100
     gtcggggatg agtttccgtt atattatggg aataacttaa ttgttctcgg acggacgata     92160
     gaaacacttg agtttggaaa cgacaatttc ccagaaaata ttattcctgt aacagatagt     92220
     aaatcggatg gtataattta tttgaccata agcaaagata atatctgtca atttagtgat     92280
     gaaaaaggtg agcaaattga tatcaattca caatttaatt catttgaata tgacgggatt     92340
     tcttttcacc ttaaaaatat gagggaggat aaatcgagag gccatatact aaacggaatg     92400
     tataagaacc actcggtgtt ttttttcttt gctgttattg ttgtgttaat tataattttt     92460
     tccctctctt taaagaaaga tgaagtaaaa gaaattgctg aaattataga tgataagaga     92520
     tatggaatag tcaacactgg acagtgcaat tatattcttg ccgaaacaca aaatgatgcg     92580
     gtatgggcat ctgtagcttt aaataaaacc ggatttacca aatgcagata tattctggtg     92640
     tcaaacaaag aaataaatag aattcaacaa tatatcaatc aacgattccc atttatcaat     92700
     ttgtatgtgt tgaatttagt gagtgataaa gcggaattac tggtgttttt aagtaaagaa     92760
     agaaatagtt caaaagatac cgaacttgat aaattgaaaa atgctctgat tgttgaattt     92820
     ccgtatatca aaaatattaa attcaactat cttagcgatc ataatgcaag gggggatgct     92880
     aaaggtattt tcacaaaggt aaatgtccag tataaagaga tttgtgaaaa taataaagtt     92940
     acatattctg tcagagaaga actgacagat gaaaagcttg agctcattaa tagactgatt     93000
     tctgaacata aaaatatata tggagatcag tatattgagt tttctgtact tttgatagat     93060
     gatgatttta aaggtaaatc atatcttaac agcaaagaca gttatgtaat gttgaatgat     93120
     aaacactggt tttttttaga taaaaataag tgaggataaa atgagtgtta cagtaccgaa     93180
     tgatgattgg acactgagtt cattatctga aacttttgat gatggaactc aaacattaca     93240
     aggtgaacta acattggcac tagataaatt agctaaaaat ccttcgaatc cacagttgct     93300
     ggctgaatac caaagtaaat tatctgaata tacattatat aggaacgcgc aatccaatac     93360
     agtgaaagtg attaaggatg ttgatgctgc aattattcaa aacttcagat aatagggagc     93420
     attcatgaat tacatttatc cagtcaatca ggttgatatt atcaaagcca gtgattttca     93480
     atctcaagag atatcaagtc tggaagacgt cgtgtcggct aaatatagtg atattaagat     93540
     ggatacagat attcaagtat cacaaataat ggagatggta agcaatccag aatcattaaa     93600
     cccagaatct ttggccaagt tacagacgac gctctcaaat tattcaatag gagtatcatt     93660
     agctggcacg ttagcaagaa aaacagtttc ggctgttgaa actttattaa agtcttaatt     93720
     tatatgatta ggtataaagg ttttatttta ttcttgttgc tgatgttgat tggatgtgag     93780
     caacgtgaag agttaatttc taatttatct caaagacagg caaatgaaat aatatctgtg     93840
     ctagaacgcc ataatattac tgctagaaaa gttgatggag gtaaacaggg gatctcggta     93900
     caagtcgaaa aggggacatt tgcatcggca gttgatttga tgcgcatgta cgatttgcca     93960
     aatccggaga gagttgatat ctcacaaatg tttcctacag attcattagt gtcttctcca     94020
     agagctgaaa aggcccgttt atatagtgct attgagcaac ggctggaaca gtctttagtt     94080
     tctattggtg gtgttatttc ggcaaaaata catgttagct atgatcttga agaaaaaaat     94140
     atatcttcaa aaccgatgca tatatcagta atcgctatat atgactcacc gaaagagtct     94200
     gaactattag ttagtaatat taagcgattt ttgaaaaaca ccttttctga tgttaagtat     94260
     gaaaatatat ctgtcatatt aactccgaaa gaagaatatg tttatacaaa tgtacaacct     94320
     gttaaggaaa ttaaatcgga atttttaaca aatgaagtaa tatatttatt tctcgggatg     94380
     gctgtactag ttgtcattct tttggtatgg gcattcaaaa cagggtggtt caagagaaac     94440
     aaaatatgat aagaatggat ggaatttata aaaaatatct ttcaataatt tttgatccag     94500
     cgttctatat aaatagaaat cggttgaatt tgccttctga actgttagaa aatggcgtaa     94560
     tcagaagtga gattaataat ctcataatta ataaatatga tctaaattgc gatattgaac     94620
     ctttaagcgg ggtaaccgct atgtttgttg ccaactggaa tttacttcca gctgttgctt     94680
     attttatcgg tagtcaagag tctcggttaa ttaatcatag tgagatggtt attagttatt     94740
     atgggggcaa aatcagtaag caaggggagg ccgctattcg aagtggtttt tggcatctta     94800
     ttgcgtggaa ggaaaatata tctgttggta tatatgaaag aataaactta ttatttaatc     94860
     caattgcttt ggagggaaat tatacgcctg tagaaagaaa tttgtcccga ttaaatgaag     94920
     gtatgcaata tgcaaaaagg cactttaccg gtatccagac atcatgccta tgatggtgtt     94980
     gttataaaga gaattgaaaa ggaattatgt aaaaccataa aagatagaga cactgagagt     95040
     aagaagaaag caatttgtgt tataaaggat gctacgaaaa aagctgaatc actgcgtata     95100
     gatgctgtat gtgatggtta tcaaattggt atacagactg cttttgagca tattattgac     95160
     tatatttgtg aatggaagtt aaagcaaaat gaaaacagaa gaaatattga ggactatata     95220
     actagtttgc tttcagaaaa tttacatgat gagaggatca ttagcacttt attggagcag     95280
     tggcttagtt cgttgcgtaa tacagtaaca gaattaaaag tggttttgcc caagtgtaat     95340
     ttagcactga ggaaaaagtt agaacttgat ctccataaat atcgctcaga tgtcaagatt     95400
     attttaaaat attctgaagg gaataattat atattctgta gtggtaatca agtagtggag     95460
     tttagtcctc aggatgtaat atcaggtgtt aaaatagaac ttgcggaaaa attaacaaaa     95520
     aatgataaaa aatatttcaa agagttagca cataagaaac tgagacaaat tgcagaagac     95580
     ttgttaaaag agaatcctgt taatgattaa tcaaataaat gcaagcaatg ctctgcagca     95640
     aagattaaat agtgaagaat ttgttaattt aaatgagaga ttatcatctt cgcaatcatt     95700
     tgatgaggat ataatctatg aaataatgca atatttctca cagagtgaat taaattccat     95760
     agataatgat gaactgcaca ataagattga acaattattc aattcacgtt ttccttatct     95820
     tacagctgca caaaaaagtt cacttcttaa taaactcata gatgcaaatc aatatgtcga     95880
     tttgcatgag ggattttatg catcattgtc catatataac aatattgatt tctatattaa     95940
     gactacaacc ttcgattcat taattagtgt ctttgaagca gggagagagg cagatgattc     96000
     gacatggtag taataagttg aaaatattta ttttaagtat attgctatta acactgagtg     96060
     ggtgtgcttt aaagtcatca tctaattctg aaaaagaatg gcatattgtt cctgtaagta     96120
     aggattattt ttctattcca aatgatttat tatggtcgtt taatacaacc aataaaagta     96180
     taaatgttta ctctaaatgt attagtggta aggcagttta tagttttaat gcaggtaaat     96240
     tcatgggcaa ctttaatgtt aaggaagtag atgggtgctt catggatgca caaaagatag     96300
     ctatagataa actattttct atgctgaaag acggggttgt tttaaaaggt aataagataa     96360
     atgataccat ccttatagag aaggatgggg aagttaaatt aaaattaatt cgagggatat     96420
     aattgtattg tgagtaaata taaaggtcta aatacaagta atatgtttta catttactct     96480
     agtggacatg aaccagttaa cgttgagctt gtaaaagata aagaacgtaa cataatcgag     96540
     ctggctccag catggaaggg tttttttttg tccgaaatca aaatataaaa ttcagtgata     96600
     atgtgaacta tcattatcgc tttaacatta atagttgtgc aaaatttctt gctttttggg     96660
     actatttcag tggtgctcta gtagagcata gccatgctga aaaatgtatt catttctatc     96720
     atgagaatga tcttcgggat agttgtaata ccgaatcgat gcttgataag ttaatgttaa     96780
     gattcatctt ttcatctgac cagaatgtaa gtaatgcact ggctatgata cgaatgactg     96840
     agtcatatca tttggttctt tatcttctga gaactattga gaaagaaaag gaggtaagaa     96900
     taaagagtct gacagagcat tatggtgtgt cggaggctta ttttagatct ttatgtagaa     96960
     aagctttagg ggcaaaagtc aaagaacaac tgaacacttg gcggttagta aatggtttat     97020
     tagatgtatt tttgcacaat caaacaatca cttctgctgc catgaataat gggtatgcat     97080
     caacatccca tttttcaaat gagataaaaa cacgactagg cttttctgca agagaattat     97140
     cgaatattac ttttttagtg aaaaaaataa atgaaaaaat ttaatattaa atctttgact     97200
     ctcttgattg tattgttacc attgatagtt aatgctaata atattgactc tcatttatta     97260
     gaacaaaatg acatagcgaa atatgttgct caaagtgata cggtaggatc tttttttgaa     97320
     cgtttttctg cgttattaaa ttatcctatt gttgttagca aacaagctgc aaaaaagaga     97380
     atatctgggg agtttgattt atctaatcca gaagaaatgc ttgaaaaact gacattactt     97440
     gtgggactca tatggtataa agatggaaat gcattataca tatatgactc tggagaatta     97500
     ataagcaaag ttattttgct ggagaatata tcacttaatt atcttattca gtatctgaag     97560
     gatgctaacc tttatgatca cagatatcct ataagaggaa atattagtga taaaacattc     97620
     tatatatctg gtcctccggc attggttgaa ctggtagcta atacagcaac tttgcttgat     97680
     aagcaggttt cttctattgg gacagataaa gttaattttg gggttataaa attaaaaaat     97740
     acatttgtta gtgacagaac ttataatatg agaggggagg atattgtcat cccaggggtg     97800
     gctactgttg tagaacgttt attaaataat ggtaaggctc tgagtaacag acaagcccaa     97860
     aatgatccga tgccaccctt taatattaca cagaaagtat ctgaggatag taatgacttt     97920
     tcatttagtt cagttaccaa tagttctata ttagaggatg tatcacttat tgcatatcca     97980
     gaaaccaatt ctatattagt caaaggtaat gatcagcaaa tacagattat tcgcgatatt     98040
     atcactcagt tagatgtagc caaacgacat atagaattat cattatggat aatcgatatt     98100
     gataaatctg aattaaataa ccttggtgtt aattggcaag gaacggcttc atttggtgat     98160
     tcgtttggtg cgtcatttaa tatgagctca tcagcatcga taagcacttt ggacggcaat     98220
     aagtttattg cttcagttat ggcattaaat cagaaaaaga aagcaaatgt agtttcaagg     98280
     ccggtgattt tgacacaaga gaatattccg gctatatttg ataataacag gactttttat     98340
     gtgtcattag ttggtgagcg caattcttcg ttggagcatg ttacgtatgg aacattgata     98400
     aatgttatac ctcgcttttc atctcgggga caaattgaga tgtctttaac gatagaggat     98460
     ggaacaggaa atagtcagtc aaattacaat tataataatg aaaatacatc tgtccttcca     98520
     gaagttggaa ggaccaaaat cagtacaata gcgagagttc cacaaggcaa aagtttgttg     98580
     ataggtggtt atacgcatga aacgaactct aacgaaatag tatctattcc ttttctctcc     98640
     tctattcctg taatcggtaa tgtgttcaag tataaaacaa gtaatatcag taatattgta     98700
     agggtttttc tgattcaacc ccgtgagata aaggagtcaa gttattataa tactgcagaa     98760
     tataaaagcc tcatatctga aagagaaata caaaagacta cacaaataat cccatctgaa     98820
     actactttgc tggaagacga aaaatcattg gtttcatact taaattacta actataaagt     98880
     aggtgatgta tgcttgatgt taaaaataca ggagttttta gctctgcatt cattgataag     98940
     ttgaatgcaa tgacaaattc agatgatgga gatgagactg ctgatgcaga gcttgattct     99000
     ggcttggcta atagcaagta tattgactca tctgatgaga tggcttccgc tctttcgtca     99060
     tttataaaca gaagagacct tgagaaactg aaaggaacaa atagtgatag tcaggaacgt     99120
     attttagatg gggaagaaga tgaaattaat cacaagattt ttgatttaaa gagaacgtta     99180
     aaagataacc ttcctctaga tcgggatttt atagacagac taaagagata ttttaaagat     99240
     ccaagtgatc aagtcttagc attaagggaa cttttgaatg aaaaagatct tactgctgaa     99300
     caagtcgaat cattaactaa aattattaat gagataatat caggtagtga aaaaagtgtt     99360
     aatgctggaa taaattcagc tatacaggct aaattatttg gcaacaaaat gaaacttgaa     99420
     ccacagcttt tgcgtgcatg ttatcgtggt tttatcatgg ggaacatatc aacaacagat     99480
     cagtatatag aatggcttgg taattttggt tttaatcaca gacatacaat tgtgaatttt     99540
     gtagagcagt cactgattgt agacatggat tctgagaaac cgagctgtaa tgcttatgag     99600
     tttggttttg tgttatctaa attaattgca attaagatga ttagaacttc agacgtaatt     99660
     tttatgaaga aactggaatc ctcaagcttg ctaaaagatg gcagtttaag tgcagagcag     99720
     ctattgctaa ctttattata tatttttcaa tatccaagtg aaagtgagca aattcttact     99780
     tctgttatag aagtatcacg agccagtcat gaggattctg tagtgtatca aacatatcta     99840
     tcttctgtta atgaaagtcc tcatgatata tttaaaagtg aaagtgaaag agaaattgcg     99900
     atcaatattc tacgagagct tgtcacaagt gcatacaaga aagagctttc tagataacag     99960
     gagatgaaag tgatccagtc ttttcttaag caagtaagta ctaagcctga attaattata    100020
     ttagtgctta tggttatgat cattgctatg ttgatcatac cattacctac ataccttgtt    100080
     gattttttaa tagggcttaa tattgtactt gctattctcg tttttatggg atcattttat    100140
     attgaaagaa tattgagttt ttctacattc ccttcggttt tgttgataac gacattattt    100200
     cgtctcgctt tatcaataag tactagtcga ctaattttag ttgatgcgga tgcgggtaaa    100260
     attattacta catttggcca gtttgtcatt ggtgatagtc tggctgtagg ttttgttatt    100320
     ttttcaatag taactgttgt gcagttcatt gttataacaa aaggatctga aagggttgcg    100380
     gaggtagctg ctcgcttttc tcttgacggt atgccgggga aacaaatgag cattgatgcg    100440
     gatttaaagg ctggaattat tgatgccgca ggagctaaag aaagacgcag tattctggaa    100500
     cgtgagagtc aattgtatgg ttcatttgat ggagcaatga agttcattaa aggtgatgca    100560
     attgctggca tcattattat ttttgtcaat ttaataggag gtatttctgt tggtatgagt    100620
     caacatggaa tgtccctatc tggtgcatta tctacttata ccatactaac tattggtgac    100680
     ggattggtct ctcagattcc tgctctgtta atttctataa gtgcaggatt tatcgttaca    100740
     agagttaatg gtgatagcga taatatggga cgtaacataa tgtcccagat atttgggaat    100800
     ccttttgttc tcattgttac atcagctctt gccttggcga tagggatgtt gccaggtttt    100860
     ccgttttttg tttttttcct gatagcagtt actttgacgg ctttattcta ttataaaaag    100920
     gtcgtagaaa aagaaaaaag tctgtctgag tctgattcta gtggctatac tggtacattt    100980
     gatattgata atagccatga ctcatctttg gcaatgatag aaaatctgga tgctattagt    101040
     tcagaaaccg ttcctttaat tttattattt gccgaaaata agataaatgc aaatgatatg    101100
     gaaggtctta ttgaaaggat aagaagtcag ttctttattg attatggtgt caggcttcca    101160
     actattttat atagaacaag caatgagctt aaggtcgatg atattgtttt gttaataaat    101220
     gaggtgcgtg ccgatagttt taatatatat tttgacaaag tgtgtattac agatgaaaat    101280
     ggagatatag atgctctagg tattcctgtt gtttcaactt catataatga acgtgttatt    101340
     tcttgggtag acgtttcata tacagaaaat ctaactaata ttgatgctaa aattaaaagt    101400
     gctcaagatg aattttatca ccagttgtca caagctttat taaacaacat aaatgagatt    101460
     tttggtatac aagaaacaaa aaatatgtta gatcagtttg aaaatcggta tcctgatcta    101520
     ttaaaggaag tcttccgaca tgtgactata cagagaattt ctgaggtatt acaaagattg    101580
     cttggagaaa atatttctgt tcgcaattta aaacttatta tggagtcttt ggcgctttgg    101640
     gctcccagag aaaaagatgt cataacatta gttgaacatg tccgtgcatc actttctagg    101700
     tatatttgta gtaaaatagc tgtttctggt gagattaaag ttgtgatgct ttccggatat    101760
     attgaggatg caataagaaa agggataagg caaacctctg gtggctcttt cttgaatatg    101820
     gatatagagg tttcggatga ggtaatggaa actttagcac atgctttgag agaattgaga    101880
     aatgcaaaaa aaaatttcgt tcttttggta tcagtagata tacgtaggtt tgttaaaaga    101940
     cttatagata acagatttaa gagtatactc gttatatcgt atgctgagat tgatgaagca    102000
     tataccatta atgtattaaa gactatttag tgaggtttaa atatgagtaa cattaattta    102060
     gttcaattag ttagagatag tcttttcacg attggttgtc ctccatcaat tattacagat    102120
     ttagacagcc attcagcgat taccatttct ttggatagta tgcctgctat taatatagct    102180
     cttgtcaatg agcaggttat gttatgggct aattttgatg caccaagtga tgtaaaactt    102240
     cagtcatctg cttataacat attaaattta atgttaatga actttagtta tagcattaat    102300
     gagctggtag agcttcatcg ttctgatgag tacttacagt taagagttgt tattaaagat    102360
     gactacgttc acgatgggat tgtttttgca gagattctgc atgagtttta tcagaggatg    102420
     gaaatcttaa atgaggtctt ataatcaatg agctatacaa aattgctcac tcaattatct    102480
     tttcctaata gaatctcggg gccaatcttg gaaacaagtc ttagcgatgt ttcgattggt    102540
     gagatttgta acattcaggc tggaattgaa agtaatgaaa ttgttgcaag agctcaggtt    102600
     gtaggatttc atgatgaaaa aacaatatta agcttgattg gaaattctcg tggactttca    102660
     cggcaaacgt tgattaagcc cactgcccag tttcttcata cgcaagtcgg ccgtggatta    102720
     ttgggtgcag tagtcaatcc tttaggggag gttactgata agtttgctgt tacggataac    102780
     agtgaaattc tttatcgacc tgtagataat gctcctccgc tatatagtga aagggctgca    102840
     attgagaagc cttttttaac aggtattaag gttattgatt ctttactcac gtgtggtgaa    102900
     ggacagcgaa tggggatttt tgcgtcagct ggttgtggca aaacttttct catgaatatg    102960
     ctcattgaac atagtggtgc tgatatatat gttattgggt taattggtga gcgaggtcga    103020
     gaggttacag aaacggttga ttatttgaaa aactctgaga aaaaaaacag gtgtgtttta    103080
     gtatatgcaa cttcggatta ctcttcggtt gatcgttgta atgctgcata tatagccact    103140
     gctatagccg aattttttag gactgaagga cataaagtag cgctttttat tgattcatta    103200
     acaaggtatg ccagagcatt acgtgatgtg gccttagccg ctggagaatc acctgccaga    103260
     agaggctatc cggtttcggt ttttgatagc ttacccagac ttcttgaaag gccaggaaag    103320
     ttaaaggcag gtggctctat tactgcattt tacactgttc ttttggagga tgatgatttt    103380
     gctgatccat tagctgaaga ggtaagatcc attttagatg gacatatata tttgagcaga    103440
     aatctagccc aaaaaggaca atttcctgca attgattcct taaaaagtat aagcagggta    103500
     tttacacagg ttgttgatga aaaacatcgt attatggccg ctgcatttcg ggagctactt    103560
     tctgaaatag aagagctaag gacaattatt gactttggtg aatacaaacc gggggagaat    103620
     gcctctcagg ataaaatcta caacaaaata tctgttgttg agagttttct gaagcaagat    103680
     tatcgactcg gttttactta tgagcagaca atggagctta ttggtgaaac aattagataa    103740
     ggttttaaaa atcaaagata aatatcaacg gtctgttaaa ttaattgaag cacacatatt    103800
     aacactaaaa aaaaaactct ttgtatcgag atgtggaggc attagataaa aggattatat    103860
     acttcctgca actggagaat gacttagaac ctgtaggcgc tcagagtgtt agtcagcttt    103920
     tcaatacaag acgtaagatc gctatagtaa aaaagcatat tatccaatat cagtctgaac    103980
     gaattcttct aaagggaaga attgaagaaa ttcaaaaaga tattgatgag gcaaatgctt    104040
     ctaaaagaaa actgcttcat aaagagagta aaatatgtaa acggattggc ttgattaaaa    104100
     gaaataactt tgccaaacag ttgatacttg atgagttatc acaagaggat atgaagtatg    104160
     gcattagata atataaacct aaattttagt agtgacaaac agatagaaaa atgtgagaaa    104220
     ctatcttcaa tagataatat tgatagtctc gttttgaaga agaagaggaa ggttgaaatt    104280
     cctgagtact ctttaattgc atctaactat tttactattg ataagcactt tgaacataag    104340
     catgataaag gagaaattta tagtggcatt aaaaatgcgt tcgaacttag aaacgaacga    104400
     gcgacatatt ctgatattcc agaatcaatg gccattaaag aaaatatttt gataccagat    104460
     caagatataa aagcaaggga aaaaataaat atcggcgata tgagggggat cttttcatat    104520
     aataagagtg gaaatgcaga caagaacttc gaaagaagtc atacttcttc tgtaaaccct    104580
     gataatctgc tagaatctga taatagaaat ggtcaaattg gtttaaaaaa tcatagcttg    104640
     tctattgata agaatattgc tgacatcatt tctttactaa atggaagtgt tgctaaatca    104700
     tttgagctgc ctgtaatgaa taaaaatact gcagacataa ccccatccat gtcattgcaa    104760
     gaaaaatcaa tagttgaaaa tgataaaaat gtttttcaaa aaaatagtga aatgacttac    104820
     cactttaaac agtggggggc tggacattct gttagtattt cagtggagtc tggttctttt    104880
     gttctaaaac cgtcagatca atttgtagga aataaacttg acttaatttt gaaacaagat    104940
     gctgagggta attatagatt tgatagcagt caacataata aggggaataa aaataatagt    105000
     acaggatata atgaacagag tgaagaagaa tgctaagaat taaacatttt gacgctaacg    105060
     aaaaactaca gattttatat gcaaagcaac tctgcgagcg tttttcgatt cagacattca    105120
     aaaataaatt tacaggcagt gaaagtttag tcactcttac ttccgtgtgt ggggattggg    105180
     taattcgtat tgatacatta tcttttttga aaaaaaaata cgaggtattt tcaggatttt    105240
     ctacacaaga atctttactg catttatcaa aatgtgtctt tatagagtcg tcatctgtat    105300
     tttcgattcc agaactgtct gataagatta ctttccggat cacgaatgaa atccagtatg    105360
     caactactgg gagtcattta tgctgttttt cctcttcttt aggtattatt tattttgaca    105420
     agatgccggt attacgtaat caagtttctc ttgacttatt gcatcatctt ttagagtttt    105480
     gcttaggttc atctaatgta aggctggcta ctttaaaaag aattcgcact ggtgatataa    105540
     tcatagttca gaaactttat aatttattat tgtgtaatca agttattatt ggggattata    105600
     ttgtgaatga taataatgag gcaaaaatta atctgtcaga aagtaatggt gagtcagaac    105660
     acacagaagt ttctttggca ttattcaatt atgatgatat caatgtaaaa gtggacttta    105720
     ttcttttaga aaaaaatatg acaatcaatg aactaaaaat gtatgtagaa aacgaattat    105780
     tcaagtttcc cgatgacata gttaaacatg taaatattaa agtaaatggt tctttggttg    105840
     ggcatgggga acttgtttct attgaggatg gttatggtat cgagattagt tcttggatgg    105900
     taaaggagta atctcatgct gagtgacatg tccctcatcg ctacactttc tttttttacg    105960
     ctattaccat ttttagttgc tgctggtacc tgttatataa agttttctat tgtttttgta    106020
     atggtacgaa atgcacttgg tttgcagcag gttccatcaa atatgactct caatggtatt    106080
     gcattgatta tggctttgtt cgtgatgaaa cccattattg aagctggtta tgaaaattat    106140
     ctaaatggcc ctcaaaaatt tgatacaata tctgatattg tccgtttttc tgattctggc    106200
     ttgatggaat ataagcaata cttgaaaaag catacagatc ttgagttagc acgttttttc    106260
     caaaggtctg aagaagaaaa tgctgattta aagagtgcag agaataatga ttattcattg    106320
     ttttccctct tgcctgcata tgcgctaagt gaaatcaaag atgcgttcaa aataggtttt    106380
     tatttatatt tgccatttgt tgttgttgat cttgttattt caagcatttt acttgcactt    106440
     ggtatgatga tgatgagtcc aatcacaata tcagtaccaa taaaacttgt attatttgtt    106500
     gcgcttgatg ggtggggtat cctgtctaag gccttgattg aacaatatat caatgttcct    106560
     gcttagatga tggaggtaat gtgtctgata tagtttatat gggtaataag gctctttatt    106620
     taatccttat cttttcctta tggccagtag gtatagctac ggttattgga ttatctattg    106680
     gtttgttaca gacagtgact caactccaag agcagacact tccttttggt ataaagctta    106740
     taggtgtctc aatatctttg ctacttcttt ctggatggta tggtgaggtt ttattgtctt    106800
     tttgtcatga aataatgttt ttaattaaga gtggggtttg atggacattt caagctggtt    106860
     cgaaagtatt catgtgtttt taatactcct gaacggcgtt ttttttagat tggctccatt    106920
     atttttcttt cttccatttt taaataacgg tataatttct ccatctatta gaatacctgt    106980
     gatttttctt gttgcatcag gattaattac ttctggtaag gtagacatag gttcttctgt    107040
     ttttgaacat gtttatttcc ttatgttcaa ggaaataatt gttggcctcc ttctctcttt    107100
     ttgcttgtct cttccctttt ggatatttca tgctgttggt agcattattg acaaccagcg    107160
     tggggcaacg cttagtagtt caattgatcc tgccaatggt gttgatacgt ctgagttggc    107220
     aaaatttttc aatctttttt ctgcagttgt atttctatac agtggtggta tggtctttat    107280
     tttagaatcc atacaattgt cttataatat atgcccgtta ttttctcaat gttctttccg    107340
     tgtctcaaat atcttaacat ttctgacttt attggcaagt caggctgtta ttttagccag    107400
     tcctgttatg atagtattgt tactatcaga agtattactt ggtgtattat cgagatttgc    107460
     tccgcagatg aatgcttttt ccgtatcatt aactattaaa agtttacttg caatatttat    107520
     tattttcatc tgttcttcta ctatttactt ttctaaagtt caatttttcc tcggtgaaca    107580
     taaatttttc acaaatctat ttgttagata aaatattatg gcaaataaaa cagaaaagcc    107640
     gacacctaaa aaactaaagg atgccgcaaa aaaaggacag tcatttaaat ttaaggattt    107700
     aacgactgtt gttattattc tggtagggac atttactata atatcattct tttccttaag    107760
     tgatgtaatg ctcttataca gatatgtaat aattaatgac ttcgaaatta atgagggtaa    107820
     atactttttt gcagtggtta ttgtcttttt taagataatt ggcttcccac tttttttctg    107880
     tgttctttcg gctgtgttgc caacattggt tcaaacaaag tttgttcttg cgactaaagc    107940
     tatcaagatt gatttttcag tattaaaccc tgttaaaggg ttaaaaaaaa tatttagtat    108000
     aaagacaata aaagaatttt tcaaaagcat tctgcttctt attattctag cattaacaac    108060
     ctatttcttt tggattaatg accgaaaaat aattttttct caggtgtttt ctagtgttga    108120
     tggcttatat cttatttggg gggggctgtt taaggatata atattatttt tcttggcatt    108180
     ttctattttt gttattattc ttgactttgt gattgagttc attttataca tgaaagatat    108240
     gatgatggat aaacaggaga taaaaagaga atatatagag caagagggac actttgagac    108300
     aaagtcgaga aggcgtgagt tgcatatcga gattctttca gagcagacta aatctgatat    108360
     acgtaattca aaattagtgg taatgaaccc gactcatatt gcaattggta tttattttaa    108420
     tccagaaata gcgcctgcac cttttatttc tctcattgaa actaaccagt gtgccttggc    108480
     tgtcagaaaa tatgcaaatg aagttggtat accaactgtg cgtgatgtga aattagctag    108540
     aaaactatat aaaacacata caaaatatag ttttgttgat tttgaacact tggatgaagt    108600
     cctacgtctt attgtttggc ttgagcaggt tgaaaacact cattaataag taaaggagat    108660
     gtgttatatg ggagttaatt tctgtaataa aataggtatt gatcagtctg aatttgaaat    108720
     agaatcttcc atcattaact ccattgctaa tgaggtattg aacccaatat ctttccttag    108780
     caataaggat ataataaatg ttttactcag aaagatttca tctgaatgtg acctggttag    108840
     aaaagacatt tatcgttgtg ctctggagtt ggtcgttgaa aaaacacctg atgatttata    108900
     atcattcata ataactcttt tgctgatata aatatttttg ttgaagatat ttatgtagtc    108960
     acaggatcaa ttgtagaaaa ttgttatgtt tttgttagga actgcactaa ataatatatg    109020
     ataagacagc aaaaacgact gaccataatc cttcttttat taggagttga taagagagac    109080
     tattcatcct gtaatgttaa aactctgtta tatagtattc gcgattatgc aaagtctgta    109140
     aatgatcatg agatactaac cgagagtaat cgtttattat ctcattgcat ttcagatagt    109200
     aacggagctt tctttaaaag tagtaaatac gttcccctta agtacttacg taaaaggaga    109260
     atagcacgaa agataccaaa tgattagcac tttgctagta agcttgctgg taaactatat    109320
     tgaccgttgg gtttgttttg agactgtaat ttaaattgtg taattgcctg tttttgatat    109380
     gtttactcca acaacggaga caggtaaatt atggacgaaa agaagcttaa agcccttgcg    109440
     gctgaactgg ctaaaggcct caaaactgag gccgacctca atcagttttc ccgtatgctg    109500
     acgaaatatc ccggctctta aaacgatagt ggctcaggct ttcatttttc agcgttcccc    109560
     agaagatttc catcggagcg ttgtcgtaac agttaccttt acgcgacatt gatgttttca    109620
     gaccagactg ctcctgtatg acccggtaat cgtatgcgca gtactgtgaa cctcgatcgg    109680
     agtggtggat tagcccggca ggtgggtgct ggctcctgag cgccataaac agggctttac    109740
     ccgtcaactc tttcgtcatg cgttctccca tggcgtaacc gacaatttcg cacgtataaa    109800
     catctttgac gccagcgaga tacagccatc cttcccgggt ggcaacatac gttatatctg    109860
     cgacccagac ctgattaggt gctgtgggcg taaagttctg attcagcaga ttcggcgtaa    109920
     ccggcagatt gtggtcagag cttgtggtcg ccctgaactt gcgtttctgc ttacagtgca    109980
     gcctcagctc cttacgaaga cgtgccagtc tgtcacgacc gacgataatt ccgttatctg    110040
     ccagctccgt ctggagccgc cgggttccat atgtttcgcg agtgcggata tgtgccacct    110100
     taatctccag ttttagccgc tcatcacttt gttttctgtc tgagggggca tgctgtaccc    110160
     ggtcgtaata accgctcctg gatacaccaa atacctgaca catcgcttca atgggaaatt    110220
     gttgtcgcca ttgttcgatt aacgcgtatt tttcagcgac tcctgggcaa aatacgctgt    110280
     tgcttttttt aatatatctc gctcaagtcg tgcttcattt aaagccttac gcagttgcat    110340
     aacttcagat tccagctcag ccactgtgcg ggagcctggt gtattgagcc cttttcttgc    110400
     ggcggtaacc cattgtccta aagtgccttc aggaacagat aatcgggaag cgccttcact    110460
     gatcgaaagt tgattttcag gaaccgtttt gacggcttcg gctttaaact ccgtagagta    110520
     acgttgggtt tttctgctca ttattggctc cttctgatgc cattctattt caggaaggag    110580
     tgtccgttaa actcaggctg caaaatggca tctgaatcga tcgcagtttg gcattcgaat    110640
     cgatcatgat ttggcatcca tctccgatca cagtttggca tcacaatcga tcacgatttg    110700
     gcatacttcc gatcattgat tggaattcgc cagtcactcc gggaattaac tcttttcacc    110760
     acagtctcca ttgccgtgtt taaaccagtg gagacgtcaa tgtccaaaaa gagaaaatcc    110820
     aggagcacta tggaaacttg ttttaagatc cttcagctca agttcgataa gaagctgact    110880
     aaccgttgta tcggactgac gttacacatc agcgcctcaa ccgtttttga ggttcttgcc    110940
     cgcttcaaag cctcttctct gtcatggcca ttacctgcgg atatatccca tgacacgctg    111000
     gagaaactca ttttcccgcc caaagacacc tctgcgtcag agcttgttat gcctgacatg    111060
     ctgtacttcg atacggaaat gagaaaacct ggcgtgacgc gccaactgtt gtggatggaa    111120
     tacaaggcac aggcgggtga caaagcgatg ggatactcac acttctgccg ttgctaccgg    111180
     aagtggaaaa aaacgcgacg cctctccatg cgacaggagc atcgtgctgg cgaaaagctc    111240
     tttatcgact tctgtggtcc tacggtccct gttattaatc cggacaccgg agagatacgc    111300
     cgcgtggcaa tcttcgtggc tgtaatgggg gcgtccaact atacctatgt tgaagcgtgc    111360
     gaaggtcagg acatgatgtc atggttaaat gcccacagcc gttgcctgac cttcctgggc    111420
     ggcgtaccga agctgctcat ccccgataac ctcagaagcg cagtgaaaaa agccgatcgc    111480
     tatgagcctg tcatcaacga cagttatcag gcgctggttg agcactatgg cacggttatt    111540
     atcccggccc gcccgcgcaa acctaaagat aaaccaaaag cagaaaacgg cgtcctcatc    111600
     gtcgagcgat ggcttcttgc ccgcatccgt aatgaaacct tccacacgct cagggcgctg    111660
     aatgcacgcc ttcgggagtt gctgacggac atgaataacc gaccaatgaa gggatacggt    111720
     aatcaaaccc gcgcagaacg cttccgcatg ctggatgcac cagcactctc tccgctgcct    111780
     ctggagcctt atgaatacac ggaatacaaa gccgtgaagg ttggccctga ctaccacgtt    111840
     gaatatgccc gtcactggta ctccgttcca cacgaactgg tcggtcagcg tctgtcactg    111900
     aaggtggggc agtcggtggt acagctctgg cacaaggggc agtgtgtggc gcaacatccg    111960
     cgcagcacac atgaatataa acacacaacc aatccgcttc acatgccaga acgccaccgg    112020
     cggcatggga catggacacc ggaacgcctt atcgagcagg gaaaccgtac aggtccgtcc    112080
     acaggccggg tggttgaatc catgctgaaa gccaaacccc atccggagct ggcttaccgt    112140
     gcagtcctgg gtctgctggc acttcagaaa aaatacggcc cggaacggct ggaaaaggcc    112200
     tgttacgttg ccctgcacta taacgccccg gacagacgct ttatcgacaa tctgctgcgt    112260
     catcatcggg ataacgttga gcttccgtta tcccgcctgg gcgaacaaca tccggcatat    112320
     gcttcagagc atgaaaacct gcgtggtcct ggctactacc actgacagaa ggaacaaccg    112380
     tatgagtgat aatctgttaa acaaactgac ccaactgaaa ctcccggcga tggccgggag    112440
     cctgatacgg caacgggaaa cgcctcagac ttacgacgaa ctgtcgttcg aggaaaggct    112500
     gacactgctg gttgatgacg agcttctgag cagagaaaac agtcgtgtgg cacggttgag    112560
     aaaaaatgcc tgcctgaaat atcaggcaac accggaaggg ctgcgttatc cggcctcaag    112620
     aggtctgcgg gctgaacaga tgagggaact gctgaacggc tactacataa tccacaggaa    112680
     aaacctactg ataaccggtc cgacaggatg cggtaagagc tggatagcca atgcgctggg    112740
     cgaacaggca tgtcgacaga aatacagcgt ccggtactgt agaaccgggc gattactgga    112800
     acagttggct cagggacgtg ttgatggcag ttggctgaaa tatctgaaac agttgcaaaa    112860
     aatacaggtt ctaatcctgg acgatctggg gctggaacag ttaagtaacg cccagtgtaa    112920
     tgaccttctg gagatcacag aggatcgtta cggacaaagc agcacgatag tggtaagcca    112980
     gttcccggta gataaatggc atggtctgat ggagaaccca acaacagcag atgccatcct    113040
     ggacagactg gtacataact cacacagagt ggtccttcag ggagagtccc tgaggaaaaa    113100
     tcccccgaca gtggaaagca gcgaaaaaac gagttaaaaa gcggtagaaa aagttaagtt    113160
     cccggttgat cgaatggatg cgaatcgctg atcgaacttc gatgccaatc cgtgatcgaa    113220
     tagagcggaa tacgcactca ggctacctca aactgttacg acaacgctcc gatggaaagc    113280
     ttctggggaa cgctgaaaaa tgaaagcctg agccactatc gttttaagag ccgggatgag    113340
     gccatctcag taatacggga atacattgag attttctaca atcgtcagcg tcgtcactct    113400
     cgtctgggga atatctcccc ggcagccttc aggataaaat attatcagat gactgcttag    113460
     aaaaagaaca aatggtggtg tccgctattg ccagtacacc tcaggccatg tgcgcggtaa    113520
     ctgaccgggc tgaacttccg ggaggccttt gccctcagcc cctgacggcg caggcttgcc    113580
     gccacggttt ttacgttaaa gtggtaaccc tgagcacgca gttcatccgt caggcgtggt    113640
     gcaccgtaac gctgttttga ccgggtaaag gccgccgcga ggacaacgct gtcgcagtgc    113700
     tgacggaact gctgacgagg gcttatccct gtccgccgct gacaccacgt ataccagccg    113760
     ctgcgggcca cccggagcac gcggcacatt gccttgatgc tgaactcagc ctgatgtttt    113820
     tcaataaaga catacttcat ttcaggcgct tcgcaaagta tgtcgcggcc ttttggagga    113880
     tagccagttc ctctgcctgc tccgccagtt gccgcttcag gcgggcattt tcagcggcca    113940
     gttcactttc acgctcagac gaggtcatct gttgctgcag tttgctgcgc cacgcataga    114000
     gctgagattc atacaggctg agttcacggg ctgcggcagc aacaccgatg cgttcagcaa    114060
     gcttcagggc ttcactgcaa aattcaggcg aatgctgttt acgtgttttt ttgctggttg    114120
     atactgtttt tgtcatgtga gtcacctctg actgagagtt tactcactta gccgcgtgtc    114180
     cactattgct gggtaagatc acatctcatc gcttacagcc actacaggac gtttccgtat    114240
     cctgtgaatt atcatcccac gtggactgca tatattttta atacacacaa cccctcttcc    114300
     agccacatgc agtgtcgagg tggtcccgca gattccgtat acccgacacc ctgcacgggt    114360
     tccgagtatc tgtactcccg gtggtttatc agagtaatag tagtcactgt tacattcgac    114420
     ccagctcttt cccccggggg gatgcgggac cactcggaaa tacaccccat atggtccgtg    114480
     cacattaatc tccgcatagc aatgttctgt tgaattacgt ggcatagcca gtaaagtctc    114540
     ttttgcagca gcgggtaccg cataccacat acacattagt gcaactatca gcgcagtatt    114600
     cattttcatt gtcactttcc gttactggtg ctgtccgtca cagcacctca tgtcctgcgg    114660
     acagggcaag ctgaccggcc ataacaactt tcagttccat cagggaagtg gaagctagac    114720
     gccggacaat caaatcccgc cggcggtaca ccttcttcgc agcagagttg ttcagtcaac    114780
     atgaaagtga cagacagtgt caccacgatg cagcatcagt atgacggtga atcgccggtc    114840
     gtagtttttg ttctttgttt tatagggagc tttctgcatc aggcatcgtt catcacgggg    114900
     tattggtgca atgctcggca tcactcagtc cggctggtga tttgtgatgt ttggcaattt    114960
     atctgattac ataatccgga ctgagtcccc cctgagtgtt ttactgttcc gagcacttat    115020
     ttagtaactt tcttgcatag ttgtttctgg ctttaattgt gctgccctaa ggtttgtttc    115080
     tcagtatgac agctcaatac atatacttcg aacgcattat atattcattt aattcacttt    115140
     gtgggagagg attattactt tctgacataa acatcattga tttcataaaa tcccgactgt    115200
     tctgtattaa atattaagaa tctgttactg tcatctttaa atgaactaga caaaacgagc    115260
     cgtgaatcat aacgagcaag aatataatac caactattat tataacaaag catctgatat    115320
     tcttttttta attgaggttt ataccagcca acaagaaagg aaaaaagcca aaaataaacc    115380
     aaaaaaccag ccataattaa cttaatgcgg tgttctctaa caaaagggat atctgaaaaa    115440
     catgatacag aaaagatccg tccatatata cgaattatta ttgaaataac caatgaacta    115500
     ataatgcatg aaagtgataa tggaagtatg aaatattgtt tgagaattaa aagttcgaat    115560
     attacaggga aaaacagtag ggtaatagca aaaaatagtc taaaaaaact caagtcttgt    115620
     attttacttc ttttctttat aagaagaaaa aataaaatac caatccccca accggtaaaa    115680
     agtataccca ttactatgat agcatagagt aaacttctgg caacatcatc caaacctgca    115740
     ccaacaaccc accatggaaa tccatagtaa aaagaggttc cccagccata agaataagca    115800
     ctgacccacc ctacacatcc catataggcg atgaataatg aagaatttct aagcaatgaa    115860
     ttgtcattca taagaaacca actgataatg taaaaaatat tcgagataaa aagttgatct    115920
     tttaattttc atgctaggaa attaacaata atatcattgt taatgcatat ttatcatatc    115980
     aaaatactct gcagaatgct actatcaaaa ccagacaagt gaacaaaact tggtcaacat    116040
     ttagtaacgc tagttggtaa tgtcttcaat cgatagaagt ttctggtaat ctactggtat    116100
     tcaaacagtt agggctcata cagcttgctg gaccttcccc ataaccgccc gaacgtgaag    116160
     gtctgatgtg ttgcaagaga gccggatgcg ggaaatctgc aagtccggtt cgatgagagg    116220
     gacgttgttt ttacttgttg ttgatgaaga ctttcattat tgaacagaat gataatattg    116280
     tctaaacaaa acattaaatc tcataattct ttgtagaaaa cgcttttctt gaaattaaaa    116340
     ataagtagaa tcagcagtct cattataatt acagacaatg tcatgctctc gcccgttccg    116400
     gtaataaacg gagcgggcta tctttttgga atatttatgg cccacaatcc agttttcata    116460
     aatacgattc attccattct tcgttttttc tgagcattgc gttcataatg gtcagcaact    116520
     tacgcataca ggcaaccagt gccacttttt tggcgtttcc ggctgcaagt aggcgcatgt    116580
     aaaacgcctt tatcaccaga ttaaaccggg gtgcctcaag cgccgccatg tacagagctg    116640
     ttcttcccca gcacaatcac cgaaaatggt tcgtcgaccg cgcagagttc ccgagtcccg    116700
     gtttacctga gcaacaccga caagtgcgct gatttcacgt ctcgagaggc tgctcgattc    116760
     aggcatttcc gccagcaatg ctgcggcagt catggctcta acacctcaga cgttcagtaa    116820
     gctctttaaa gtaactctga atgtgcctgt tcatatctgg gtcttccccg atcatggtgg    116880
     gaaggcttag aacgccatat tcagtttccc atagtggaac atcactccca gcttaaagcg    116940
     ctcccggttg cggtagccct tggcttttat tctcagcagc ctgatcttgc tgttcagtgc    117000
     ttccgcattt ccgtttgata cgccatggcg catggcgttc aggataccgt acaacctttt    117060
     ccctatcgtt ttagccacat tcttcatcat ggggacgtca ctgttggccg ccagcgacag    117120
     ccatctctgc cagtcgttgc gtctttcctc gctccatggt ctgctccaga tatcctttgc    117180
     cagttctttc agcgcccagc acaggctcgt cagcttcatc tgcgcacgca gccatatcag    117240
     cttttcctgc ctggattcgg tcatccattt atcgctgtgc tgccacagga agcgagttcc    117300
     ctttgcctga cgacgacttt caacaggaag atgcggatgt tcattctgaa ccgccccggg    117360
     aatcctggag actaaacttc ctgagaaaga ggtaaacagg atgactaaaa atactcgttt    117420
     ttcccccgaa gtccgtcaac gggcagtccg tatggttctg gaaagtcagg gcgaatatga    117480
     ctcacaatgg gcgacaattt gttccattgc tccaaagatt ggctgtacgc cggagactct    117540
     gcgtgtccgg gttcgccagc atgagcggga taccgggggc ggtgatggag ggctcaccac    117600
     cgctgaacgt cagcgtctga aagagctgga gcgtgaaaat cgtgaactgc gccgcagtaa    117660
     cgatatcctt cgccaggctt ccgcttattt tgcgaaggcg gagttcgacc gcctctggaa    117720
     aaaatgatgc cactgctgga taagctgcgt gagcagtacg gggttggacc gctatgcagc    117780
     gaactgcata ttgccccgtc aacgtattac cactgtcagc aacagcgaca tcatccggat    117840
     aaacgcagtg cccgtgcgca gcgcgatgac tggctgaaga aagagataca gcgcgtatac    117900
     gatgaaaatc acaaggtata cggtgtgcgt aaagtctggc gtcagttgtt acgggaaggt    117960
     atcagagtgg ccagatgcac tgtggcacgt ctcatggcgg ttatgggact tgccggtgtt    118020
     ctccggggta aaaaggtccg tacgaccatc agccggaaag cctttgccgc aggcgaccgc    118080
     gtaaaccgtc agttcgtggc agaacgacct gaccagctgt gggtggctga ttttacttac    118140
     gtcagcacat gtgtcagcgc cagtgatata agacggtaat tcgccatttg gattgtccgc    118200
     tccacccaac atgttgtttc cttaaggttc tcacaccaga aaggacatca acatgctgag    118260
     cagagaggac ttttacatga taaagcaaat gcgccagcag ggcgcgtaca tcgtcgatat    118320
     tgcgactcag attggttgct ctgaacggac ggtcagacgc tacctcaaat accctgaacc    118380
     gccagccaga aagacccgcc acaaaatggt taagctgaaa ccgtttatgg attacatcga    118440
     catgcgcctg gcagagaatg tctggaatag cgaggttatc ttcgcggaga ttaaggcaat    118500
     gggttatacg ggcggacgtt ccatgctgcg ttactacatc cagcccaaac gtaaaatgcg    118560
     tccgtcaaaa agaacagttc gcttcgaaac tcagcctgga taccagctcc agcatgactg    118620
     gggcgaagtt gaggtggagg ttgccgggca acggtgcaaa gttaactttg cggttaatac    118680
     gctggggttc tcccgcagct tccatgtctt cgccgcacca aaacaggatg ctgagcatac    118740
     ctacgaatca ctggttcgcg ccttccgcta cttcggtggt tgtgtgaaaa cggtgctggt    118800
     tgataaccag aaggctgcgg tgctgaagaa taacaacggg aaagtcgtgt tcaactccgg    118860
     attcctgttg ctggctgacc actataactt cctgccacgg gcatgccgtc cacgcagggc    118920
     cagaacaaaa ggtaaggttg agcggatggt gaaatacctc aaggagaact tcttcgtccg    118980
     gtaccgcagg ttcgacagct tcactcatgt caatcaacaa ctggagcaat ggatagccga    119040
     tgtggctgac aaacgggagc ttcgccagtt caaagaaacg ccggaacagc gcttcgcgct    119100
     ggagcaggaa catctgcagc cgttaccgga tacagacttc gataccagtt acttcgatat    119160
     ccgccatgtg tcctgggaca gctatatcga ggttggtggt aatcgttaca gcgttcccga    119220
     agcgctgtgt ggtcagccgg tatcgatacg aatatcgctg gatgacgagt tgcggatcta    119280
     cagtaatgag aaactggtgg cctcacatcg cctctgttca gcatcgtctg gctggcagac    119340
     agtgccggag catcacgccc cgctctggca gcaggtcagt caggtggaac atcgaccact    119400
     gagtgcctat gaggagctgt tgtgatgcat gaactggaag tcctgctgag tcgcctgaaa    119460
     atggagcatc tgagttatca cgttgaaagc ctgctggaac aggcagctaa aaaagagctg    119520
     aactaccggg agttcctgtg catggcgcta cagcaggaat ggaacggcag gcatcagcgc    119580
     ggtatggagt ccaggctgaa gcaggctcgt ctgccgtggg tcaaaacgct ggagcagttc    119640
     gactttacct tccagccggg catcgaccgt aaggttgtcc gggaactggc tggtctggcg    119700
     ttcgtggagc gcagcgaaaa cgtgatcctg ctgggccctc ctggtgtcgg aaaaactcat    119760
     ctggccatag ctcttggcgt gaaagcggtg gatgcgggac atcgggtact gtttatgcca    119820
     ctggacagac tgatcgcgac actgatgaaa gcgaaacagg aaaatcggct ggagcgtcag    119880
     ctacagcaac tgagttatgc ccgggtgttg atcctggatg aaataggcta tctgccgatg    119940
     aacagagagg aagccagtct gttcttccgg ctactgaacc gtcgatatga aaaagcgagc    120000
     atcatactga cgtcaaacaa agggttcgca gactggggag aaatgttcgg agatcacgta    120060
     ctggcaacag cgatcctgga tcggctgcta catcactcaa ccacgctgaa tatcaaagga    120120
     gagagttacc ggttaaaaga gaaacgtaaa gctggagtgc tgaccaaaaa cacaacgcca    120180
     atcagtgatg atgaaatggt ggaaagcgga cagcatcagt aacgaaagta tttagcgggc    120240
     atgaaaatgg caaataacgg tcaaacatcg tggcgttgac acatggcagg gcttcgtcta    120300
     tgtggcgttc atcattgatg tgtttgccgg atacatcgtg gggtggcggg tctcatcgtc    120360
     catggaaacg acattcgtgc tggatgcact ggagcaggcg ttatgggccc gtcgaccgtc    120420
     cggcacggtc catcacagtg ataaaggttc tcagtatgta tcgctggcct acacacagcg    120480
     gcttaaggaa gccggattac tggcatcaac aggaagtaca ggcgactcgt atgacaacgc    120540
     gatggcggag agcatcaatg gtctttacaa agcggaggta atacaccgta agagctggaa    120600
     aaaccgtgca gaagtggaac tggccacact cacgtgggtg gactggtata acaatcgacg    120660
     attgctggaa aggctgggcc atactcctcc ggcagaagca gaaaaagctt attatgcttc    120720
     catcggaaac gatgatctgg cagcctgagt tcacagataa aacactctcc aggaaacccg    120780
     gggcggttca ttctggcggg ttttatccac cacctcaccc ggttgtttcg ccacatgaaa    120840
     gcgatcgaag gctattttct caaccgcatt gggtaagtgg atgcgcgctg ctcttatata    120900
     gcctgcattc atgtccatcg ataggaattt aaatccccaa aagattaaaa aagcaccgaa    120960
     gaatgcgcgt ttattcaaca caacctgatc atcaagtaat cggtatagac acttaatatt    121020
     gcttacattg attgattcaa tgtatctctg atggtttttt gctccgttcc cctcaacatg    121080
     gacgcaactt cccctctgcg actctcagcc gcaccaccgt attcgagcca gcggctcatg    121140
     catcataacc tgctctgcca gacggtaacc cctcttcagc cccgtaaacc gcatctgacc    121200
     tccgcacagc tcgcacttca gcgggtcaac cttcagtcac tgctgataca tccctctcct    121260
     tgtgatttgc ctcgccgttt ttctcactgt ctccgttatg gcgtacacca catcttccag    121320
     taatcgccgc ttcaccggac tcaggacccc gtatcaccat ccggaacccc ttatccgcca    121380
     catgccagga gaacctttcc ataaactcgt cgccactcat cacaaggttt tcttctcgtt    121440
     ttgtccggtg gctgttgtaa cgcaggccaa tttcatcctg accggcataa tgttccaggc    121500
     ggctcatctg caccggctgc ttctccagcc agttaagcca tcggtttccc tgctgaaaaa    121560
     tatcggcaaa acggggaagc atcagaaagg cggaataacg ccatccggcc agtgaaccgt    121620
     accgcattca gggcaataca tgccgtcggc gctgataccg gcaggaattg tcgcaaattc    121680
     ccgctccgtg cagcgggcaa tttccggata cccttcgtca tcaacacgta caaaccagaa    121740
     gaccagtttt ttgtttccgg catccacaaa gaacggaata ttcaggtctg cgcaacactc    121800
     aacggcatcg tcaaaattat caaagcgcag aacctcagct tcttcttcgt caaaaaaatc    121860
     atcttcgtga agttttacga catagcggag gagtttgctt ctttgaggtg caggttttcg    121920
     tttgcgtggt ttagctgaac gggccatata actacctgaa agacaatgat attgtctgtt    121980
     tttataacgg taatcacagg ccatgacaag ccgcagccgt caggccgcct actcggggcg    122040
     gtttagaacg cttatttagt accagatctt acttataata aaggggcttg gcagtttgga    122100
     taaactattg tccttattcc actaatacaa actttttgta aagtatatta aatatacttc    122160
     atttcatact gaaatccccg gaagtattca atcaaacaat tacaccataa aaggaagagg    122220
     gggccccaat taagttgtca agcatgttta ctgcgcaatc gcttggtgct ccgtccctgt    122280
     accccgcatt ggtactctgg cgctcatggg gcttccactt gcgcttctcc cttcacatcg    122340
     gggtgacagg tccacgttcc ccacaagagc ctgaatcgac ttcacgccgc ttttatgccg    122400
     gatgccgcgc aggcagtaaa catatcccac aggaacgact ccaccattgt tttgacatca    122460
     tctatatgct ttcgacacat catcagcggt tcactttcgt tcgtctcttc gaaccatacc    122520
     tgatcggctc acgtccgacc ttttcccatc tcgctcacca ccacatctct taaatgcagc    122580
     agcagtggat ggtttggtgc ctgcgcctgc acgccgacac cgaggggcct tccctcatct    122640
     cttgtgccgc atggctgcac agggactcac gtccccagga cgcgccttcg tggcacacag    122700
     tcatcggcat agcaacagta agcaacggca ggtttccatt gccagttttc tttgacagca    122760
     gtacttcggc ctcgctggat actgtgattc cagtaccagc gatcctttct ggcttttcca    122820
     ctcaggtagc gtttattcag atactggtcg aactcattca gtatgatgtt cgacagcaac    122880
     ggcgagatca caccgccctg tggcatactt tcactgaccg cccggaagag accaacatca    122940
     acacggcgtt ttccacagca gtctcataaa acgtgcatca ctgatcctgc ggcagacggc    123000
     tttcatcagc agccggtgat gtactgtgtc gaagtagctg gacaggtcac cttcaataac    123060
     ccggcgcccc gtgtttcccc gcagtcggtg agctgtaata gtacgtgatg tctcccgccc    123120
     acttctggtt cgggccactg gcgtaaaaat cctgcgtcag cagattttct gatacaggca    123180
     ggccgtgtgc acggtaactg atcgggctga acttctggga ggcttttgcg ctcagttcct    123240
     gacggcgcag actggctgcc acggttttta cgttaaagtg gtaaccagag cacacagttc    123300
     atccgtcagg cgtggggcac cgtaacgctg gactgggtaa aagccttgcg gacaacgctg    123360
     tcgcagtgct gacggaactg ctgacgtgtg tttatccttg tccgccgctg acaccacgta    123420
     taccagccgc tgcgggccac ccggagtacg cggcatattg ccttgatgac ggtttacgcg    123480
     gtcgcctgcg gcaacggctt tccggctgac ggtagtgtgg acctttttac cccggagaac    123540
     accggcaagc cccataaccg ccatgagacg tgccacagtg catctggcca ctctgatacc    123600
     ttcccgtaac aactgatgcc agactttacg cacagcgtat acctgatgat tctcatcgta    123660
     tacgcgcagt atctctttct tcagccagtc atcgcgctgc gcacgggcac tgcgtttatc    123720
     atgatgatgt cgctgttgct gacagtggta atacgttgac ggggcaatat gcagttcact    123780
     gcataccgat ccgaccccgt actgctcacg cagcttatcc agcagtggca ttattttttc    123840
     cagaggcggt cgaactccgc ctttgcaaaa taagcggaag ccaggcgaag gatattgtta    123900
     ctgcggcgca gttcacgatt ttcacgttcc ggctctttca gacgctgacg ttcagcggtg    123960
     gtgagcccac ctcaccgccc ccggtatccc gctcatgctg gcgtacccag acacgcagag    124020
     tctccagtat acagccaatc tttggggcaa tggaacaaat cgctgcccat tgtgagtcat    124080
     attcgccctg actttccaga accatacgaa ctgcccgttg acggacttca ggggaaaaac    124140
     gtgtattttt agtcatcctg tttacctctt tctcagggag tttagtctcc aggatttccg    124200
     gggcggttca taatgatata aaaaggatgg gctgagattc tattggtccc catcctttta    124260
     gctttggttt aatagtttat agagctgttc tgaagaacgt ttttttacag tctggcagcc    124320
     aatataatat tggcttaaac atcaggagat atgatggcaa atgatacttg acgactttct    124380
     ggagggatag cattgcgaag cccttcactg cttggaagtg ttccagcatg aacgagatag    124440
     cttgtttcta ttttattaat accaacacca ttacatgtta tgtgcgatgg taatattgat    124500
     gagctaactt cgtaagccct ccccccagag gcagagattg cagtgtcgtt tttagggaca    124560
     actgcgttga tttttataat atgtccacaa ttgttaataa ctcgttgttc aggcatgaaa    124620
     ttaagcctgt tttctatgtt ttcggacata atttgggcat atatgtgttc cacagaggaa    124680
     gacgtgatgt gaagagattg ccagaatgca gatgttagtg cagatataaa tgcagggtct    124740
     tgaaagagtg aagtaaacaa aagtttttct gtttgaaaac ataggtcttg ttgggggaag    124800
     tttgaattga ttattttatt tacttggttg taacttagca tttgaagctc ttttttgcta    124860
     tcaatgaatt cattaattcc taactcatta attagatctg caattaattt tagtggtatt    124920
     tcaatattgt tgaaatatat ttttgtacta ttgctgttag atgctctaat atctctgtaa    124980
     atatcatgcc aaacactatt aaaatcagtg tctttaacgg ggaagtaatc atcgtttggt    125040
     attatcgatg tacagcaatt aatggctgtt tcaataactt ctggtgcagg cttgtgagtt    125100
     ttaaaattcc ctgataccgg agctgtaata gtatgtactt ttcctaagtt gaattgtttg    125160
     ggggggagtg aacttaacaa gttattatat tcttttgatg aaagttgagt ggattgtatt    125220
     ttatctccat caagataaaa aaccgaacat atgcctttgt taaggcatag ccgtattgaa    125280
     atgccatcta tgtttgcgtg ggcaaactct ccgtccattt tatcttgtga tagtgatggt    125340
     gagaaactat ccattagttt tttttcgcta tatttttcgg ctagagtttc gtgtggagaa    125400
     tatatgccga aagttattat tttcagtaaa acgtcacaaa aactcaattt attccaactt    125460
     acttctgtag ttgatttgac agttgacatc catgatgagt catttctttc atggttagtt    125520
     atgtttgatg tctgcatttg atttctcctg atgtattttc ctattaatgc caatatatat    125580
     taatataatt aaattgggaa cataataaaa tggaatgtta ttcttctctt taagaaaacg    125640
     atacatttcc actaaaaaca attatgcagt tattgcattg gagagtctgg taggaaagtt    125700
     gtgatatgaa tacattcatg ttattggctt tggggattaa catcaagggg cagatagaac    125760
     cattgggtgt atagaaaaac aaagtggtta aactttgggc aagcgtacag aaagaactga    125820
     aaagttgcgg tctgaagcag actatcatag taaaattatt aatttattat cgaacatata    125880
     gctttccccc tctttttttc aaagcaagac acaggtaaat ttctcccgtt gcattgatat    125940
     ataacacagc tctcatgttt tggttgaggc tttgtttaat atatttttgc atatatcgtc    126000
     cctttattcc ggataaaacg gaatcttttt aggggtttat caaccactta ctgataatat    126060
     agtgcatgaa tcaaattcac aaattttttt gtaatatgac ccaatgttca cagggggggg    126120
     ccggagaatt acctacggta aaggaaaaaa catgcaaatt gtctttttct ccttttgttg    126180
     ttggtgcatc cctgttgctc ggggggccaa tagcttttgc tattcctctt tcgggtactc    126240
     aagaacttca tttttcagag gacaattatg aaaaattatt aacacctgtt gatggacttt    126300
     ctcccttggg agctggtgaa gatggaatgg atgcgtggta tataacttct tccaacccct    126360
     ctcatgcatc tagaactaag ctacggatta actctgatat tatgattagc gcaggtcatg    126420
     gtggtgctgg tgataataat gatggtaata gttgtggcgg taatggtggt gactctatta    126480
     ccggatctga cttgtctata atcaatcaag gcatgattct tggtggtaac ggcggtagcg    126540
     gtgctgacca taacggtgat ggtggtgagg ctgttacagg agacaatctg tttataataa    126600
     atggagaaat tatttcaggt ggacatggtg gcgatagtta tagtgatagt gatgggggga    126660
     atggaggtga tgccgtcaca ggagtcaatc tacccataat caacaaaggg actatttccg    126720
     gtggtaatgg aggtaacaat tatggtgagg gtgatggcgg taatggaggt gatgccatca    126780
     caggaagcag cctctctgta atcaataagg gcacgttcgc tggaggcaac ggaggtgctg    126840
     cttacggtta tggttatgat ggctacggtg gtaatgctat cacaggagat aacctgtcta    126900
     taatcaacaa tggagctatt ttaggcggta atggtggaca ttggggggat gctataaatg    126960
     gtagcaatat gaccattgct aatagcggat atataatttc aggtaaagaa gatgatggaa    127020
     cacaaaatgt agtaggtaat gctatccaca tcactggtgg aaacaattca ttaatactcc    127080
     atgaaggttc tgtcattact ggtgatgtac aggttaacaa ttcatccatt ctgaaaatta    127140
     tcaacaatga ttacactggg accacaccaa ctattgaagg tgatttatgt gctggtgatt    127200
     gtacaactgt ttcactatca ggtaacaaat tcactgtttc aggtgacgtt tcttttggtg    127260
     agaacagttc tttaaattta gctggaatca gtagtctgga agcttctgga aatatgtcat    127320
     ttggcaacaa tgtaaaagtg gaagctatta taaataactg ggcgcagaag gactataaac    127380
     tgctaagtgc agataaaggg ataacaggtt tcagtgtttc taatatatct atcatcaatc    127440
     cgttactcac tactggtgct attgactata caaaaagcta tatcagtgac cagaataaat    127500
     tgatctacgg tttgagctgg aatgatacag atggcgacag tcatggagag ttcaatctga    127560
     aagaaaacgc tgaacttact gttagtacta ttctggcaga taatctcagc catcataata    127620
     taaatagctg ggacggaaaa tccctaacaa aatcagggga gggaactctc attttggcgg    127680
     aaaaaaatac ctactctggt ttcaccaaca tcaatgcagg cattctaaaa atggggacag    127740
     ttgaagctat gacacgtacc gctggtgtta ttgttaataa aggtgctacc ttgaattttt    127800
     caggcatgaa ccaaactgtt aacactttat taaatagtgg gactgtgcta atcaataata    127860
     ttaatgcccc ttttttgcct gaccccgtca ttgtcacagg taacatgact ctggagaaaa    127920
     acggtcatgt tattctcaat aatagttcgt caaatgtcgg tcagacctat gttcagaaag    127980
     gtaattggca tggaaagggc ggaatattat ctttgggcgc ggttctcggc aatgacaaca    128040
     gtaaaactga ccggctggaa attgcaggcc atgcgtctgg tattacctat gttgcagtga    128100
     caaatgaggg aggctctgga gataaaactc ttgaaggtgt tcaaattatt tcgacagatt    128160
     cttctgataa gaatgctttt attcagaaag gccgtattgt tgctggtagt tatgactatc    128220
     gcctgaaaca gggcactgta tctggactga ataccaataa gtggtatcta actagtcaga    128280
     tggataatca agaatcaaaa cagatgagca atcaagagtc tactcaaatg agtagtcgcc    128340
     gagctagttc acagcttgta tcttcactta atttgggtga aggtagtatt cacacatggc    128400
     gccctgaagc tggcagttat attgctaacc tgatagcaat gaacacgatg tttagtcctt    128460
     ctctctatga ccgacacggt agcactattg ttgatcctac tacaggtcag ctcagcgaaa    128520
     ccaccatgtg gattcgtact gttggtggac ataatgagca taatttagct gatagacaat    128580
     taaaaaccac agctaacagg atggtttatc agattggtgg agatattttg aagacaaact    128640
     tcactgatca tgatggcttg catgtgggta ttatgggagc ttatggatat caggatagca    128700
     aaactcataa taagtatact agttatagtt cacgaggaac tgtgagcggt tatactgccg    128760
     gtttgtacag ttcttggttt cagaatgaaa aagaacgaac aggtctatat atggatgctt    128820
     ggttgcagta cggttggttt aataatacag tcaaaggaga tgggttaact ggtgagaaat    128880
     attccagcaa aggaataaca ggagctttgg aagctggcta tatctaccca accatacgct    128940
     ggactgctca taataatatt gacaacgcat tgtatctcaa tccacaagtc cagataacta    129000
     ggcatggggt aaaagcaaac gactatattg aacacaatgg cactatggtc acatcctctg    129060
     gggtcaataa tattcaagca aaattgggat tgcgtacatc cttaattagt cagagttgta    129120
     tcgataagga gactcttcgt aagttcgaac catttttgga agtgaattgg aaatggagct    129180
     caaagcaata tggtgtaatt atgaatggca tgtcaaatca ccagataggc aaccgtaatg    129240
     tgattgaact caaaactggt gtgggggggc gtcttgcaga taacctaagc atctggggaa    129300
     acgtatctca gcaattgggt aataacagtt acagagacac ccaaggtatt ttgggtgtga    129360
     aatatacctt ctgataataa aaatgcaggg cgtgttgatg tcctgcattt ctctgggacc    129420
     caccgtgtaa aagctcggtg ggtttttgtg cacatgatgg tatgcctgcg atcaatgcca    129480
     aacgtgttta ccagatcatg cgccagaatg cgctgttgct tggcgttaca caggaattgc    129540
     attagaaagc gatgaacgaa tgctaccgcc aaatattcgt ggttatgcgc ctcagattac    129600
     tggtattgca gaaactaatg cacgtgttgt tgtatctcaa caaggtcgag taatatatga    129660
     ctctactgta ccagctggaa ctttttctat tcaggacttg agtagttctg tacgaggaat    129720
     attggatgtt gaaatttttg agcaaaatgg taaaagaaaa catttccaag tagaaatgtg    129780
     caggtgtgcc tttcttatcc agacttggtc agagtaggta taaattagta acaggtctac    129840
     ctaaaacaaa taataaagca actggtgatg catttttttc ggtgaagatc ctacggggtc    129900
     ctgagcccgg tgaagtggcg aggcaaatta catggggaag cgtacagcct gaactgaact    129960
     gccccgggaa tcctggagac taaactccct gagaaagagg taaacaggat gactaaaaat    130020
     actcgttttt cccccgaagt ccgtcagcgg gcgattcgta tggttctgga aagtcaggat    130080
     gaatatgact cacagtgggc ggcaatttgt tccattgccc caaagattgg ctgtacgccg    130140
     gagactctgc gtgtctgggt tcgccagcat gagcgggata ccgggggcgg tgatggtggg    130200
     ctcaccaccg ctgaacgtca gcgtctgaaa gagctggagc gtgaaaatcg tgaactgcgc    130260
     cgcagtaacg atatccttcg ccaggcttcc gcttattttg cgaaggcgga gtttgaccgc    130320
     ctctggaaaa aatgatgcta ctgctggata agctgcgtga gcagtacggg gtcggaccgc    130380
     tatgcagcga actgcatatt gccccgtcaa cgtattacca ctgtcagcaa cagcgacatc    130440
     atccggataa acgcagtgcc cgtgcgcagc gcgatgactg gctgaagaaa gagatacagc    130500
     gcgtatacga tgaaaatcac aaggtatacg gtgtaaagtc tggcgtcagt tgttacggga    130560
     aggtatcaga gtggccagat gcactgtggc acgtctcatg gcggttatgg gacttgccgg    130620
     tgttctccgg ggtaaaaagg tccgtacgac catcagccgg aaagccgttg ccgcaggcga    130680
     ccgcgtaaac cgtcagttcg tggcagaacg acctgaccag ctgtgggtgg ctgattttac    130740
     ttacgtcagc acatggcagg gcttcgtcta tgtggcgttc atcattgatg tgtttgccgg    130800
     atacatcgtg gggtggcggg tctcatcgtc catggaaacg acattcgtgc tggatgcact    130860
     ggagcaggcg ttatgggccc gtcgaccgtc cggcacggtc catcacagtg ataaaggttc    130920
     tcagtatgta tcctacacac agcggcttaa ggaagccgga ttactggcat caacaggaag    130980
     tacaggcgac tcgtatgaca acgcgatggc ggagagcatc aatggtcttt acaaagcgga    131040
     ggtaatacac cgtaagagct ggaaaaaccg tgcagaagtg gaactggcca cactcacgtg    131100
     ggtggactgg tataataatc gacgattgct ggaaaggctg ggccacatcc ctccggcaga    131160
     agcagaaaaa gcttattatg cttctatcgg aaacgatgat ctggcagcct gagttcacag    131220
     ataaaacatt ctccaggaaa cttggggcgg ttcacgtcag tatcagacca tattaattgc    131280
     tgaaactgat aaacatcaaa ccttatagaa gggtgaatgc tgaaaggggg ctatggtgat    131340
     cgacgtgatg acaacgacag gtaagaccgt gacctgataa acctgaattg tgtcctagac    131400
     ataaagtccg tgaagggaat aaggctcagg tcagcgaatc ttatagtggc ccgcagctct    131460
     gactgcaata aggccggata cagagcagca actactcgtc gatgtcagaa caacggaagc    131520
     cttgcaaacg gggatgcgtt catacaggta caatgatacc gttaaaaaaa aacattacgc    131580
     taataatgtt caccctgtca ttactgacag gaaatcctgc tatagcgtat gaaacagata    131640
     aagtatataa aataaccgtt ctgcatacaa atgaccacca tggacacttt tggcgtaaca    131700
     atcatggtga gtacgggtta tcctcccaaa aaactctggt ggacaatatc cggcagaaag    131760
     taataaataa tggcggaagt gttctattat tatctggtgg tgatattaac accggtgtac    131820
     ctgaatcaga ccttcagaag gctgaacccg atattcgtgg aatgaatcta attggttatg    131880
     atgcaatggc cgtcggtaat catgaatttg ataatcctct aaatatatta cgtcagcagg    131940
     aaaaatgggc cacatttcct ttcctttctg ctaacatata tcaaaaaagt acagggaggc    132000
     gtttattcag tccatggaaa attttcatcc gtcagaattt gaaaattgca gtcattggct    132060
     tgacgacaga tgatactgcg aaaacaggaa attctgaata ttttactgat attgagttcc    132120
     gtcaacctgc tgctgaggcg aggagtgtca ttgatgaact taatcagcag gaaaagccag    132180
     atattattat tgcggcaaca catatgggtc actatgacaa tggcgagtca ggttcgaatg    132240
     ctcctggtga tgttgaaatg gctcgcagtt tgccgactgg ctcattagca atgattgtgg    132300
     gaggacattc acaagctcct gtctgcatgg ccagcgataa taaaaaacag tggaattata    132360
     ttccggggac aacctgtgta ccagataaac aaaatggcat ctggattgta caagcgcatg    132420
     agtggggaaa atatgtcggt caggctgatt ttgaattctg taacggtaca atgaaactgg    132480
     ttaattatca gttacaccca gttaatctca aaatgagaat taccagagaa gatggaaaaa    132540
     cggaattttc tttttacacc cccgaaatta ctgaagatcc acagatgtta tccttactga    132600
     caccattcca gaataaaggc aaagcacaac tggatgtgaa ggttggggtt gtgaacggac    132660
     gtctggaagg ggacagaagt aaagttcgtt ttgttcagac cagtatgggc catctgattc    132720
     tgagcgctct gacagaacgt attgacgcag attttgctgt tgtcagtggt ggggaaattc    132780
     gagattccat agagagtggt aacatcacat acaaagatat actgaaagtt cagccatttg    132840
     gtaatacggt agtaagtatt gatttgacgg ggaaagaagt agctgactac ctagctacag    132900
     tggcacagat gaaaccggat tccggagcct acccacaatt tttgaatacc agctttgtag    132960
     tcaaaaaagg aaaaatcgaa atgctaaaaa taaaaggtaa atcggttgac cttaacaaaa    133020
     aatatcgtat gacaacattt agctttaatg ctactggtgg ggatggctat ccacgtattg    133080
     ataatagacc cggatacata aataccggat ttattgatgc tgaagtactt atcgaatata    133140
     tccgggaaca ttcaccgctg gatgctgctt catatgaacc aaaaggtgaa gtcagttggc    133200
     agtgataacg taattgacga tcatcacgtg ttttttgctg acagtcgctg tgactttgtg    133260
     aaagtagtct ctgcggatgt ttgcgatatg ggaatgcagt tgctgtattt tgtgtttctg    133320
     cttctgccag ttgttgctga atttaacctt gcggcttaac tgatgttgga gcgctgccag    133380
     cttcttcgtc aatttcgctg attaaagttt attcattatg gcatgatctg cgtaagcggc    133440
     tcgtcagaac cgtattgata tttactaaga gctcagatca actttccagg gcaacagatc    133500
     gcgtacccgg tttgccggtc agtcctggat atgctcaatg acgtaacgca gccatttttc    133560
     tggctccaca ttgttcagac ggcatgtgcc gatcagcgag tacaacaccg ccgcatgttc    133620
     gccaccgcta tcggaacccc gccggagaga gtttcactct ccggctgctc acggaaccgt    133680
     acgtgacact ctcgcgtcat acggctcttg atcactcatt cgatgcacgt agtaaatacc    133740
     agtgggcaaa tagcttcgga tactgtttcc ttaccagcgc cagctttcgc tgagccttcc    133800
     ggttcgaaag tctgtattta gactgcatcc acttaagcaa acgtgactgc attgcactcc    133860
     acagtcgata gctgaagttt ctggaccaga actttccata gtactcaatc cagcctctca    133920
     ctatcgcatt gtagcgcctc gcaaaatcca gcaaactctc agctgttgag cgatgtatac    133980
     gccacttctt gattgtttct gttattttgc acattgctgc atttgatgca cccggcatac    134040
     attttctgta caattcgcct ttgaaattct tcagagtacg cactttgaag tcatatccga    134100
     gaaaggagaa actcgtagcg acgtttctcc ttttaaacgt gtcaatgtag gcgatattcg    134160
     tcttccctgc gttcaggacc aacccgactt ccgagaagcg caccgataac ctgttcttca    134220
     gccttgttgc atcactcatt cgtgaacaat gtactacaag tcgagtcacc cgagggaacc    134280
     tccccctctg gtgctcacgg aaccggacgt gaacctctca gctcatccgg ctcttctcat    134340
     tgaggcctgt ccccatagta acggccagtg tgcaaacaac ctcgtttcac tccgcgcaac    134400
     acgggccagc cagtggctgg cccgtcgtcg gtggccccta agtcgcttgt gtttacgggg    134460
     cagccataac acgagtttgc gatcgatttg cctcagcgtc agatacagtg ctgatttata    134520
     aaaagcaccg tagtacttta tccagcctct gattttcgca ttgaacatat gcgccagctc    134580
     gtacaaggac ttgtcactgc gattctcctc acctcctgac ggattgcttt tcctgctctg    134640
     gcactcatcg ccggactgaa gttaacgaag gtcttacccc agcgattcat cgacagacgc    134700
     ggccggaatg tatagcccag aaagtcgaag ctcgtttccg ggtagtcccc ccgtcggtca    134760
     gcatccttac agtaaactat tcgtgttttt tgcggatgca gctgcagccc gcattgcgca    134820
     agccgctgcc tcagtccact tatcagagcg tcagcctgcc actggctgtg acagtggcat    134880
     acaacatcat cggcgtacct ttcgaaggga acgccgggaa actgacgttg catccacata    134940
     tcaaaggcat agtgcaggaa cagatttgag agcagggggg agattacgcc gccctgcggc    135000
     gttcctcgac cccgtgccag cattgctcca tccggcattt gcaccggtgc cttcagcctg    135060
     cgctcaatgt acatcaccac ccagcgtgcc tgagtatgat gctgcactgt cttcagtagc    135120
     aggtcatgat cgatatcatc aaagaagcct ttaatatcga cttccaccac ccagtcaaac    135180
     ttccagcagc gtttcctcgc ctgcgcaatc gcctggtgtg cggatttacc cggtcgataa    135240
     ccatacgagt ctgcatggaa caggggttcc agtaccggct cgagtatctg cttaacgacc    135300
     atctgggcga tccggtccga cacggccgga ataccgagcg gacgtacacc accgtcagct    135360
     ttgggaatgt ccacacgcct taccgcctgc ggcatataac tgccggaagc cattctgttc    135420
     cacagtttgt agagattgtc tgtaacattc tcgtcaaacc cggccagtgt ctgcccgtca    135480
     atgcctgccg ccccacggtt ggcttttact cgtttataag cttcccatac ctgtcgttta    135540
     cttacaggaa atggctttgc cgattttaca gcagtcctcc catcggcatt gtcgcccgtg    135600
     gttgccgccg caccatcagc acaatggggc aagccctttg ctccggaccc attacggtcc    135660
     ttcaccgcta ctacggttta ctccgtccct gtaccatttt tcagcgttcc ccagaagctt    135720
     tccatcggag cgttgtcgta acagttacct ttacgcgaca ttgatgtttt cagaccaaac    135780
     tgctcctgta tgacccggta atcgtatgcg cagtactgtg aacctcgatc ggagtggtgg    135840
     attagcccgg caggtgggcg ctggctcctg agcaccataa acagggcttt acccgtcaat    135900
     attggctcct tctgatgcca ttctatttca ggaaggagtg tccgttaaac tcaggctacc    135960
     tcaaaaagtt atcggtgcgt ttatcgaaaa acatatgttc tactaatttg gatttgcccc    136020
     tatatttcca gacatctgtt atcacttaac ccattacaag cccgctgccg cagatattcc    136080
     cgtggcgagc gataacccag cgcactatgc ggatgccatt cgttataatg ctcgaacgcc    136140
     tctgcaaggt tctttgctgc cgttaacccg tctggtttgg gcatgatact gatgtagtca    136200
     cgctttatcg ttttcacgaa gctctctgct attccgttac tctccggact ccgcaccgcc    136260
     gtgttcttcg gttcaagtcc caacatccgg gcgaactggc gtgtttcatt agcccggtag    136320
     catgaaccat tatccgtcag ccactccact ggagacgacg gaagatcgtt gccgaagcgg    136380
     cgttccaccg ctcccagcat gacgtcctgt actgtttcac tgttgaagcc gccggtagtc    136440
     accgcccagt gcagtgcctc acgatcacag cagtccagcg cgaacgtgac acgcagtctc    136500
     tctccgttat cacagcagaa ctcgaacccg tcagagcacc atcgctgatt gctttctttc    136560
     acggccactc tgcctgtatg tgcccgtttc gatggcggta cagcaggttt tcgctcaagc    136620
     aacagcgcat tctggcgcat gatccggtaa acacgtttgg cattgatcgc aggcatacca    136680
     tcaagttctg cctgtctgcg aagcagcgcc catacccgac gataaccata cgtgggcagc    136740
     tctccgataa catggtgtat acggagaagc acatccgtat catcagtgtg acgactgcgg    136800
     cggccatcca tccagtcatc ggttcgtctg agaatgacgt gcaactgcgc acgcgacacc    136860
     cggagacaac ggctgactaa gcttactccc catccccggg caataagggc gcgtgcgcta    136920
     tccacttttt tgcccgtcca tattcaacgg cttctttgag gagttcattt tccatcgttt    136980
     tcttgccgag caggcgctgg agttctttaa tctgcttcat ggcggcagca agttcagagg    137040
     caggaacaac ctgttctccg gcggcgacag cagtaagact tccttcctgg tattgcttac    137100
     gccagagaaa taactggctg gctgctacac catgttgccg ggcaacgagg gagaccgtca    137160
     tccccggttc aaagctctgc tgaacaattg cgatcttttc ctgtgtggta cgccgtctgc    137220
     gtttctccgg ccctaagaca tcaatcatct gtactccaat gactagtcta aaaactagta    137280
     ttaagactat cacttattta agtgatactg gttgtctgga gattcagggg gccagtctac    137340
     ccagcaagcg ctgtaactct tttatttgtt ttatagcggc agccagttct gaggcaggaa    137400
     cgacatcctc tccggcagca acagcagtga gacttccttc cagatattat tttttccact    137460
     taagcaacag gctgggctga ataccatgca aacgcgccac atgggacacc gtcatgccag    137520
     gctccattgt ctgctgaata atggcaattt tttcctgagg agttttacgt ttacgaagct    137580
     ccagccccag caaagttcca gtcatctcaa aattagaact agtgttagac atatatccaa    137640
     gcctatctct tattttaaga tacatccact gtctggcgtt tcaaggggcc ggctcaaatc    137700
     tatgtacagg ctctcagcat cagcaaagcc tcttactctt ccaactacta ctgttagcat    137760
     agtgatcaaa ttcctgatca gatacatgaa ttacctgaac cgaactattt tcatctacaa    137820
     atgcatctgg cgatttttct acaggatcat aaagattaaa tccctttcct gtttgaacat    137880
     ccaaaaacat aattttttca ccatcgttaa atccagctat ccaatgagtg gcctgttcaa    137940
     tagaaatcat tactacactt ccttttgaag tgttttgtaa aatattttct gcaatacgct    138000
     cacgaaattt actataagtt tcattaggat gtgacactat gccttcacta tcaatttgct    138060
     ctaaatgcct atgaaaaaat ccggtcatat actctgatat ttcattaggt acgggagcct    138120
     ctcttactcc ataccctaac atagccatac aagcatgaag cgcacaccct gaacagttac    138180
     catccccacc agacggattt atcattttct gtaaagtcgc tgccaattca gaatctttat    138240
     ccatatcacc aagactttta gagtttaaag attccagcaa ttttttaaca tttacatttc    138300
     cctcctctgt atgtgcctca tatccagcag ttccctgtaa cgacacccca ttaatcatat    138360
     tgtatcctga cagtatatat actcactata ttttcttcat aacaaatatc cctctgatat    138420
     gacaacaaaa aacggagccg gattcctgtt tttgtgaact gcagctattc gagtctaaaa    138480
     agtgatccac ttaccaccaa cggcctaata tatacagaac ggagtaaaca gggctaacag    138540
     ttcccgacag gtctcatcat tccgtggccc gaaagtgtaa gccaacacac cgccagtttt    138600
     agtgttgtac gcataccaga gccagtgttg ttgcagcctt gctgccaacg aagcgccact    138660
     gctcatcaag ttcacagata agggcaacat cagcgtgagc gactggcgca gatgttatcc    138720
     gccggggcgg gagcttttta atgtccgtat gacggtattg atgccgattt tcagtgtcct    138780
     ggcggtatca cggccccctg cgccgttatg tgccatttca acgatctgct ccttaacgcc    138840
     gggttttctg gcttcataag agtaagtgag ctggaaaaca cgtttacatg agcgacaacg    138900
     gaaacgctca tgccgggaac aactacggcc atgtcgataa acttcatcgg aatgacagcg    138960
     cggacaatga acagtaacgg tagccatgga aaaccttaaa taccagtaga ttaccagaaa    139020
     cttctgtcga ttgaagacat cacccgaagt ttgaattcat tcgaatactt tttacgaggt    139080
     tcttttcgcc agtcctgtaa ttccatactt aggtgttcgt ctatgtcaga tgggcgtcta    139140
     agttaccaat tcttgtctaa tggctacata cggtggtcgg tttacgctta ccgcaggaca    139200
     ggtggtaact gaaaaatagt ttgctgaggc gactggaaac agaagggcaa gatcgattcc    139260
     gacagcagtg atggtcagct acctcatcga taactttgca acagtgccct tcttgaagca    139320
     tcatgcttca tgaagaaaaa ctggcacgtc atcaacgtaa acaggcgatg tatacccgaa    139380
     tggtagcctt cccggcggtg aaaatgttcg aagagtatga cttcacgttc gccaccggag    139440
     caccgcagaa gcagctccag tcgttacgct cactcagctt catagagcgc aatgaaaaca    139500
     tagtgttaca ggggacatct gacatcacaa atccccgggt ggggatttgt gtataagaga    139560
     cagcccatgg aggaagggga tatatcgcag ctctgacgac tcactcctta tttacccggg    139620
     aaatacttct ccagcaatgc atacaggatg gcagcggttt cagcatccat tatgccgtca    139680
     taatttttct gccggaaatg aagctgaaaa gcgcggacaa gcgccttata tccgtcatcc    139740
     gtctccacac cagaaatact gtatccatag gtcttcagcc gtgacacgat atcaacctta    139800
     tccggaatgc cctgcgattc aaaaaataaa tatttagtca gtaattttat ttttttcctg    139860
     aaaaaattac tctttttcga actccagtga gcgttcacga ctcatcagtg tgaaaatgat    139920
     ggcaaaaaca gcagacagta tcagtacgat aaatgtggcc ccccatccca gataatcgac    139980
     aacaagtccc attcccagtg tcgcaacaat tgagccgaag atataggaaa atgagcctga    140040
     cagccctaac agaataagtt tacgcgtaaa tcgcccggaa tccagaagag cattaagtat    140100
     cacataaaca ggttccatac cagtcctgac cgcatcagga cgccagtaaa taaaatctcg    140160
     tagtccaccg gcatcagaga caagagtaat cgtcgttacc ggtatttcga ctggtttgta    140220
     ctggtgtgag cggacaaaac tactgtacgt ctctcataca cgctcgtaag cggccctcac    140280
     ggcccgctaa cgcggagata cgccccgact gcgggtaaac ccttgtcggg accactccga    140340
     ccgcgcacag aggcattttc atcgctgaca ggccgcatgg cctcgcagag ccggaggggg    140400
     actggtgata ttcggacgac cgtaccggct tgcgccgggc ttcggcggtt ttacacctgt    140460
     gctacatgta accaccgtat gccgccttat atgcgctgac tcgcattatt tgccttgttc    140520
     cgtctgaaag taatcactat gattaaatat gattaacaac taatcggggg tgatgctgcc    140580
     aacttactga tttagtgtat gatggtgttt ttgaggtgct ccagtggctt ctgtttctat    140640
     cagctgtccc tcctgttcag ctactgacgg ggtggtgcgt aacggcaaaa gcactgccgg    140700
     acatcagcgc gatctctgct ctcactgccg taaaacatgg caaatgcagt tcacttacac    140760
     cgcttctcaa cccggtacgc accagaaaat cattgatatg gccatgaatg gcgttggatg    140820
     ccgggcaact gcacgcatta tgggcgttgg cctcaacacg attttacgtc acttaaaaaa    140880
     ctcaggccgc agtcggtaac ctcgcgcata cagccgggca gtgacgtcat cgtctgcgcg    140940
     gaaatggacg aacagtgggg ctatgtcggg gctaaatcgc gccagcgctg gctgttttac    141000
     gcgtatgaca gtctccggaa gacggttgtt gcgcacgtat tcggtgaacg cactatggcg    141060
     acgctggggc gtcttatgag cctgctgtca ccctttgacg tggtgatatg gatgacggat    141120
     ggctggccgc tgtatgaatc ccgcctgaag ggaaagctgc acgtaatcag caagcgatat    141180
     acgcagcgaa ttgagcggca taacctgaat ctgaggcagc acctggcacg gctgggacgg    141240
     aagtcgctgt cgttctcaaa atcggtggag ctgcatgaca aagtcatcgg gcattatctg    141300
     aacataaaac actatcaata agttggagcc attacccagg ttgtcatcag caaatatacc    141360
     gaccatctgc ccctgtatcg ccagcagcac attttctccc gaatgggtgt ggagctcccc    141420
     gtcagtacaa tggcggatat ggtcggtgtt gccggagctg cactggcccc gctggtgaaa    141480
     ctgctacgcc atgagcttct gacacgggat gttattcatg cagatgaaac gtccctgagg    141540
     ctccttgata cccggaaagg cggtaaatcc tgctccggct ggctgtgtgc ttacgtcagc    141600
     ggtgaaagaa gcggtccgcc ggtcgtctgt tttgactcgc agaccggacg ggccctcaga    141660
     taccctgaga cctggctgca gtgctggtgt ggcggtacgc tggtgagtga cggatacagc    141720
     gtgtacaaat ctctggcgga taatcacccc ggcatcacat cagcctgttg ctggagtcac    141780
     gcagggcgcg gcttcgcaaa tctgtataag gccagcaggg agccccgtgc aggcgtggag    141840
     ctgagaaaaa tcgcgggtct ttaccgcatt gagaaactca tccgtgagcg ctgtcaacgc    141900
     cacgatgttt gaccgttatt tgccattttc atgcccgcta aatactttcg ttactgatgc    141960
     tgtccgcttt ccaccatttc atcatcactg attggcgttg tgtttttggt cagcactcca    142020
     gctttacgtt tctcttttaa ccggtaactc tctcctttga tattcagcgt ggttgagtga    142080
     tgtagcagcc gatccaggat cgctgttgcc agtacgtgat ctccgaacat ttctccccag    142140
     tctgcgaacc ctttgtttga cgtcagcatg atgctcgctt tttcatatcg acggttcagt    142200
     agccggaaga acagactggc ttcctctctg ttcatcggca gatagcctat ttcatccagg    142260
     atcaacaccc gggcataact cagttgctgt agctgacgct ccagccgatt ttcctgtttc    142320
     gctttcatca gtgtcgcgat cagtctgtcc agtggcataa acagtacccg atgtcccgca    142380
     tccaccgctt tcacgccaag agctatggcc agatgagttt ttccgacacc aggagggccc    142440
     agcaggatca cgttttcgct gcgctccacg aacgccagac cagccagttc ccggacaacc    142500
     ttacggtcga tgcccggctg gaaggtaaag tcgaactgct ccagcgtttt gacccacggc    142560
     agacgagcct gcttcagcct ggactccata ccgcgctgat gcctgccgtt ccattcctgc    142620
     tgtagcgcca tgcacaggaa ctcccggtag ttcagctctt ttttagctgc ctgttccagc    142680
     aggctttcaa cgtgataact cagatgctcc attttcaggc gactcagcag gacttccagt    142740
     tcatgcatca caacagctcc tcataggcac tcagtggtcg atgttccacc tgactgacct    142800
     gctgccagag cggggcgtga tgctccggca ctgtctgcca gccagacgat gctgaacaga    142860
     ggcgatgtga ggccaccagt ttctcattac tgtagatccg caactcgtca tccagcgata    142920
     ttcgtatcga taccggctga ccacacagcg cttcgggaac gctgtaacga ttaccaccaa    142980
     cctcgatata gctgtcccag gacacatggc ggatatcgaa gtaactggta tcgaagtctg    143040
     tatccggtaa cggctgcaga tgttcctgct ccagcgcgaa gcgctgttcc ggcgtttctt    143100
     tgaactggcg aagctcccgt ttgtcagcca catcggctat ccattgctcc agttgttgat    143160
     tgacatgagt gaagctgtcg aacctgcggt accggacgaa gaagttctcc ttgaggtatt    143220
     tcaccatccg ctcaacctta ccttttgttc tggccctgcg tggacggcat gcccgtggca    143280
     ggaagttata gtggtcagcc agcaacagga atccggagtt gaacacgact ttcccgttgt    143340
     tattcttcag caccgcagcc ttctggttat caaccagcac cgttttcaca caaccaccga    143400
     agtagcggaa ggcgcgaacc agtgattcgt aggtatgctc agcatcctgt tttggtgcgg    143460
     cgaagacatg gaagctgcgg gagaacccca gcgtattaac cgcaaagtta actttgcacc    143520
     gttgcccggc aacctccacc tcaacttcgc cccagtcatg ctggagctgg tatccaggct    143580
     gagtttcgaa gcgaactgtt ctttttgacg gacgcatttt acgtttgggc tggatgtagt    143640
     aacgcagcat ggaacgtccg cccgtataac ccattgcctt aatctccgcg aagataacct    143700
     cgctattcca gacattctct gccaggcgca tgtcgatgta atccataaac ggtttcagct    143760
     taaccatttt gtggcgggtc tttctggctg gcggttcagg gtatttgagg tagcgtctga    143820
     ccgtccgttc agagcaacca atctgagtcg caatatcgac gatgtatgag gtagcctgag    143880
     tttaacggac actccttcct gaaatagaat ggcatcagaa ggagctaata atgagcagaa    143940
     aaacccaacg ttactctaaa gagttcaaag ccgaagctgt cagaacggtt cttgaaaatc    144000
     aactttcgat cagtgaaggc gcttcccgat tatctcttcc tgaaggcact ttaggacaat    144060
     gggttaccgc cgccagaaaa gggctcggta ctcctggttc ccgcacggtg gctgaactgg    144120
     aatctgaaat tctgcaactg cgtaaggcgt taaatgaagc tcgccttgag cgagatatat    144180
     taaaaaaagc aacagcgtat tttgcacagg agtcgctgaa aaatacgcgt taatcgaaca    144240
     atggcgacaa caatttccca ttgaagcgat gtgtcaggta tttggtgtat ccaggagcgg    144300
     ttattacaac tgggtacagc atgaaccctc agacagaaaa caaagtgatg agcggctaaa    144360
     actggagatt aaggtggcac atatccgcac tcgcgaaaca tatggaaccc ggcggctcca    144420
     gacggagctg gcagagaatg gcatcatcgt tggtcgtgac cgactggcac gtcttcgtaa    144480
     ggagctaagg ctacgctgta agcagaaacg caagttcaga gcgactacga actcgaacca    144540
     caatctgcca gttgcgccaa atctgctgaa ccagacgttc actcctacag caccaaatca    144600
     ggtctgggtg gcggacctga cgtatgttgc cacacaggag ggatggttgt acctcgctgg    144660
     catcaaagat gtttatacgt gcgaaattgt cggctacgcc atgggagagc gcatgacaaa    144720
     agagctgaca ggtaaagccc tgtttatggc gctcaggagc cagcgcccac ctgccgggct    144780
     aatccaccac tctgatcgag gttcacagta ctgcgcatac gattaccggg tcatacagga    144840
     gcagtctggt ctgaaaacat caatgtcgcg taaaggtaac tgttacgaca acgctccgat    144900
     ggaaagcttc tggggaacgc tgaaaaatga gagcctgagc cactatcgtt ttaataaccg    144960
     ggatgaagcc atctcagtaa tacgggaata cattgagatt ttctacaatc gtcagcgtcg    145020
     tcactctcgt ctggggaata tctccccggc agccttcagg gaaaaatatc atcagatggc    145080
     tgcttaaaaa aagaacaaat ggtagtgtcc gctattgcca gtacacctca gtacgcgccc    145140
     tgctggcgca tttgctttat catgtaaaag tcctctctgc tcagcatgtt gatgtccttt    145200
     ctggtgtgag aaccttaagg aaacaacatg ttgggtggag cggacaatcc aaatggcgaa    145260
     ttaccgtctt atatcactgg cgctgacagc gccctgtgga aaaaatacgg cagtggcgat    145320
     aacggtactc ccggccgata gtgaatgacc tgtttgcctg gcttgaagag caggagccgt    145380
     gctgtccgcc cgacgggcca ttaaataagg cgattaacta tattctgaac cggcgcgatg    145440
     aactgagctg cttcctgggt gacggagcgg tgcccctgga caacaatatc tgcgagcgtg    145500
     ccattcgccc ggttgttatg ggacggaaag cgtggctgtt cgccggttca ctgatggccg    145560
     gaaaccgggc ggcacagata atgagccttc tgtaaacagc aaaacgtaat ggtctggagc    145620
     cacatgcctg gctgacggac gtcctgacgc gtctgccgga atggccggag gagcgactgg    145680
     cagagttgct gcctcttgag ggatttacct tcaccgggtg agtgatacct gccgtcaggt    145740
     gttcgtgaac cgggctataa ccagcagtcg gttgttgaac gcctgacaac aggaaatcag    145800
     ccaggccagc aaccacgcgg actgacagag aatcagaacc tgaatcagcc tgaaatcata    145860
     cccggggcag tacttcatca ccagtcacca atacccgtgt cagtacttcg cggcctgacg    145920
     cgatcacccg actcagtact tctgagcccg cctccggtac cattctctgt gggcccgtac    145980
     acaacaacag aaaagggggc ccggcccggg gcgcaaccgt attacacttc cggaaaatcg    146040
     ttatacgcag aaaaatcgga tcacgctgtg cctgctttca tgtaatttac ttacggtgtt    146100
     ataagtatgc taattatcgt ataaaaaaat cgcagcagaa aaaattgtat taaaaactta    146160
     tagcgaatta atggtgtatt ttttatggat attgatggtt tgtaccatta atatatactc    146220
     atatacatat cataagtatg tttttgaggg cttatcatga agcagcgtat tactgtcaca    146280
     tacggtgcaa acaggccatt cacggttaac tgaaacagta tcgttttttt acagccaatt    146340
     ttgtttatcc ttattataat aaaaaagtgc tgaagttcat ttcatggaat gaacttcata    146400
     aaaactccta cttatttctt ttaacaaagc catttgtcca ccggctttaa ctggatgccc    146460
     atcatgttac cgataaataa taacttttca ttgccccaaa attcttttta taacactatt    146520
     tccggtacat atgctgatta cttttcagca tgggataaat gggaaaaaca agcgctcccc    146580
     ggtgaagagc gtgatgaggc tgtctcccga cttaaagaat gtcttatcaa taattccgat    146640
     gaacttcgac tggaccgttt aaatctgtcc tcgctacctg acaacttacc agctcagata    146700
     acgctgctca atgtatcata taatcaatta actaacctac ctgaactgcc tgttacgcta    146760
     aaaaaattat attccgccag caataaatta tcagaattgc ccgtgctacc tcctgcgctg    146820
     gagtcacttc aggtacaaca caatgagctg gaaaacctgc cagctttacc cgattcgtta    146880
     ttgactatga atatcagcta taacgaaata gtctccttac catcgctccc acaggctctt    146940
     aaaaatctca gagcgacccg taatttcctc actgagctac cagcattttc tgagggaaat    147000
     aatcccgttg tcagagagta tttttttgat agaaatcaga taagtcatat cccggaaagc    147060
     attcttaatc tgaggaatga atgttcaata catattagtg ataacccatt atcatcccat    147120
     gctctgcaag ccctgcaaag attaacctct tcgccggact accacggccc acggatttac    147180
     ttctccatga gtgacggaca acagaataca ctccatcgcc ccctggctga tgccgtgaca    147240
     gcatggttcc cggaaaacaa acaatctgat gtatcacaga tatggcatgc ttttgaacat    147300
     gaagagcatg ccaacacctt ttccgcgttc cttgaccgcc tttccgatac cgtctctgca    147360
     cgcaatacct ccggattccg tgaacaggtc gctgcatggc tggaaaaact cagtgcctct    147420
     gcggagcttc gacagcagtc tttcgctgtt gctgctgatg ccactgagag ctgtgaggac    147480
     cgtgtcgcgc tcacatggaa caatctccgg aaaaccctcc tggtccatca ggcatcagaa    147540
     ggccttttcg ataatgatac cggcgctctg ctctccctgg gcagggaaat gttccgcctc    147600
     gaaattctgg aggacattgc ccgggataaa gtcagaactc tccattttgt ggatgagata    147660
     gaagtctacc tggccttcca gaccatgctc gcagagaaac ttcagctctc cactgccgtg    147720
     aaggaaatgc gtttctatgg cgtgtcggga gtgacagcaa atgacctccg cactgccgaa    147780
     gccatggtca gaagccgtga agagaatgaa tttacggact ggttctccct ctggggacca    147840
     tggcatgctg tactgaagcg tacggaagct gaccgctggg cgcaggcaga agagcagaag    147900
     tatgagatgc tggagaatga gtactctcag agggtggctg accggctgaa agcatcaggt    147960
     ctgagcggtg atgcggatgc ggagagggaa gccggtgcac aggtgatgcg tgagactgaa    148020
     cagcagattt accgtcagct gactgacgag gtactggccc tgcgattgtc tgaaaacggc    148080
     tcacaactgc accattcata atcacatcgc ataaaactgt cagcgccagt gataggacag    148140
     gtgaaacctg tcaatacgta ccggcttacg ccgggcttcg gcggttttac tcctctgcca    148200
     tatgcaacaa cggagtgccg ccttacatgc cgctggcgcg gcatatcctg gtgacgatat    148260
     ctgaacagtt atatactgtg tatatacgtg gtaatgacga ggtggcaaat ggcacaggtt    148320
     aatatgagtg taagaatcga cgcagaactg aaggatgctt ttatggccgc tgcaaaaagc    148380
     atggaccgta atggctctca gttaatccgg gattttatgc gccagaccgt tgaacggcag    148440
     cacaattctt ggttccgtga ccaggttgcg gcaggccgtc agcaactcga atgcggtgat    148500
     gtgcttcccc atgacatggt cgaatcctct gctgctgcat ggcgggatga aatgagcagg    148560
     aagattgctg ataaatgatg gagatgttct ggaccatgct ggccatccag gacaggaagc    148620
     gcattcgtag tacattgcgg agcagaacct gatggccgcc attgaaccgg acgaacggat    148680
     tggttattca gccagcagcc tggcagggca gccgtataaa ggccgcaacg gtcgtgtgga    148740
     aggaacatct ggaccacaca aggtagcgtg taacgttatt ttgtgtgaaa atctcttgtg    148800
     atttttaaat atcgtaacaa aggtatgaca tgaaaataac atctaccatt attcaaacac    148860
     cttttccatt tgagaataat aattctcatg ctggcatagt aacggagccc attctcggta    148920
     agttaatagg tcaggggtcg acagcagaaa tctttgaaga tgtgaatgat tcatctgctt    148980
     tgtataaaaa gtatgatctt attggcaacc agtacaatga gattctggaa atggcttggc    149040
     aagaatctga gctttttaat gctttttatg gcgatgaagc atccgttgtt atacagtatg    149100
     gcggagatgt gtacctccga atgctgcgcg tgcctgggac tccccttagt gacattgata    149160
     cagctgatat ccctgataat atagagagcc tttatctaca gttgatatgt aaattgaatg    149220
     agttgagtat aatccattac gatcttaata caggtaatat gctgtatgat aaagaaagtg    149280
     aaagtttatt cccaatagat tttcgcaata tttatgctga atattacgct gcaaccaaaa    149340
     aagataaaga gattatcgac cgacgattac aaatgcgtac aaatgatttt tattcgttat    149400
     taaacaggaa atatttatag ccgtatttgt tgatgctata agccagaggc tcttctatga    149460
     gaatatgggg accattccct cgcgatatta acgtaatatc ttaattgtat gcaccgccag    149520
     aatgcgttca gtgcgatcac ggcagcagac aggtaaaaat agcaacaaac cacccgaaaa    149580
     accgccgcga tcgcgtatga taaattttaa ccacatgcat acctgtgcag caaggcgaat    149640
     cacgcacgga tttccagcca gagacacctg aaacgtaacc ggctcattta aaccgtctgg    149700
     tttgttacct ccggttccac aaaaataatg tccatcattt tgaagtggac actatcgtat    149760
     ggaataccgg acctgaatca ctgaagcttt acgccttcat ttcgaagaac atttaccacg    149820
     ggttgtggcc ggacgtcgcc tgggcgtacc aaaatcaact gtctgtggta tgttcgtgcg    149880
     cttccgcaac gctggccttt catggcctct gcccgcaggt atgtcggagc aggaacttga    149940
     tgcccttctt tacggaagtg cctccacagt acctgtcgta cttactgaaa gcaccgttat    150000
     gcccaaactc ccggtggtaa aaaaacgtcc ccggcggcct aatgccgatc agttaaggat    150060
     cagttgaccg atccagtggc tgtgtaagaa tccggaaacg ctcacttgtt tccggatttt    150120
     tttatgcaca ttggacaggc tcttgatctg gtatcccgtt acgattctct gcgtaaccca    150180
     ctgacttctc tgggggatta cctcgacccc gaactcatct ctcgttgcct tgccgaatca    150240
     ggtactgtaa cgctacgcaa gcgccgtctt cccctcgaaa tgatggtctg gtgtattgtt    150300
     ggcatggcgc ttgagcgtaa agaacctctt caccagattg tgaatcgcct ggacatcatg    150360
     ctgccgggca atcgcccctt cgttgccccc agtgccgtta ttcaggcccg ccagcgcctg    150420
     ggaagtgagg ctgtccgccg cgtgttcacg aaaacagcgc agctctggca taacgccacg    150480
     ccgcatccgc actggtgcgg cctgaccctg ctggccatcg atggtgtgtt ctggcgcaca    150540
     ccggatacac cagagaacga tgcagccttc ccccgccaga cacatgccgg gaacccggcg    150600
     ctctacccgc aggtcaaaat ggtctgccag atggaactga ccagccatct gctgacggct    150660
     gcagccttcg gcacgatgaa gaacagcgaa aatgagcttg ctgagcaact tatagaacaa    150720
     accggcgata acactctgac gttaatggat aaaggttatt actcactggg actgttaaat    150780
     gcctggagcc tggcgggaga acaccgccac tggatgatac ctctcagaaa gggagcgcaa    150840
     tatgaagagc tcagaaaact gggtaaaggc gatcatctgg tgaagctgaa aaccagcccg    150900
     caggcacgaa aaaagtggcc gggactggga aatgaagtga cagcccgcct gctgaccgtg    150960
     acgcgcaaag gaaaagtctg ccatctgctg acgtcgatga cggacgccat gcgcttcccc    151020
     ggaggagaaa tggcggatct gtacagtcat cgctgggaaa tcgaactggg atacagggag    151080
     ataaaacaga cgatgcaact gagcaggctg acgctgagaa gtaaaaagcc ggagcttgtg    151140
     gagcaagagc tgtggggtgt cttactggct tataatctgg tgagatatca gatgattaaa    151200
     atggcggaac atctgaaagg ttactggccg aatcaactga gtttctcaga atcatgcgga    151260
     atggtgatga gaatgctgat gacattgcag ggcgcttcac cgggacgtat accggagctg    151320
     atgcgcgatc ttgcaagtat gggacaactt gtgaaattac cgacgagaag ggaaagggcc    151380
     ttcccgagag tggtaaagga gaggccctgg aaatacccca cagccccgaa aaagagccag    151440
     tcagttgctt aactgactgg cattaaggcc gccggggacg tttttttacc accgggagtt    151500
     tgggcataac ggtgctttca gtaagtacga caggtactgt ggaggcactt ccgtaaagaa    151560
     gggcatcaag ttcctgctcc gacatacctg caggcaaagg ccatgaaagc cctgatttcc    151620
     ggaagcgagc gaacagtcca caaactgttg aacgtggtgt cagcggcgga cagggataag    151680
     ccctcgtcaa cagttccgtc agcactgcga cagcgttctt tacccggtca aaacagcgtt    151740
     gcggtgcacc acgcctgacg gatgaactgc gtgctcaggg ttaccacttt aacgtaaaaa    151800
     ccgtggcggc aagcctgcgc cgtcaggggc tgagggcaaa ggcctcccgg aagttcagcc    151860
     cggtcagtta ccgcgcacat ggcctgcccg tgtcagaaaa tctgctggag caggattttt    151920
     acgccagtgg tccgaaccag aagtgggcgg gagacatcac gtacttacgt acagatgaag    151980
     ttcggttaca tcctgtcagc acagaacctc acgctttttg agcggcacga cggatccccc    152040
     ccacccagta tccgacagac ttttcactgc gttcgtaaaa acccttcttc cctcccagca    152100
     tatccactaa ttccggtgac atatcctgca gataagtctg caaatcatgc cccagatctt    152160
     ccggtgactg caactcataa accgcgcgcc acacatcacc ctgccttatt ttaagccccg    152220
     ggttaagaat atactgtccg tggttcagcc tcagaaaaag cttttttcca taaggatttt    152280
     tgctgttaac ttcatgttga gagagctggc tgctgatata actccttcgt ttgcggcgtt    152340
     ccggcagcaa cgcttcagga agatgaacca cacactctgc cagtcgtgcc gcactgaagg    152400
     cttccgaaaa aaacagagca cttcccagat gcgtgtggaa cagcgcctgc atcaggatca    152460
     ccagaaacat tgccatctgc cggttgtcca gtttgatgag gcgtccttcc acctgcagtg    152520
     acagactttc aggtttcagc agggtataca actgcgcact tttctgttgc gcataacggg    152580
     gcgtactgac cgccgctgac agaacttgat gataagccgc cagcccgtca ttaccggtca    152640
     gcaagggatc tgcaccacgc tccagcagta actgaaccag tgcaatatta cctgcccggg    152700
     ctgctgacat cagcggagta agattaaacg gcgaacggtg atcaacacca taacgttcaa    152760
     tatcccgcaa cacggcaacc gggttattca ttgagtatgg ccggaaatac ttcagctcca    152820
     gtaactgcag agtcttcgtt ctgggctgcc ttgtgggctt aaaatcttcc cggtacagtg    152880
     cattatacag cgggaacagg gaataaatca gactgtactc cagcgcctgc agttgtatgg    152940
     ttttatcggc tgtacctgcg aggatatgct gtttccactg tcgtgcatcc tctgcggtga    153000
     taatctgcca tggcatctca gatgtctgca ggatccggct acggatggtg tccgcctgct    153060
     cctgcttccc ctgtttttca agcagatgtg cggttttctg ccactcatca cggctggaaa    153120
     tctcttcctg cagattcaga ggctcttcct gatgcgtgag cgcaagcaga ctccacagag    153180
     gatgctccac ctgctgttca acaagataca cattgtgtgt agcacgggtg agcgcaacat    153240
     acagcgcgtt ggtaaaaaat ttatagattt ccgctgaacg atcctgcctg tcccgcggac    153300
     gggaataacg ggcctcgccc tcaagatcag ccggtgtaag accctcgcaa atatcatcaa    153360
     atgcctgccg ggcagcgctt actatattgt aaaggatcac cgtttcgtat tccagcccct    153420
     taacctcctg aaccgaaaag accagcggcg tactgaacca gcatcgcgcc tgtgctttct    153480
     gttccggatg catcacaatg accgctacac gattcgaaag tgaggttttg gcattcagtt    153540
     cctgctttgt ctcttccctg tcgtccagca accggatggt cccttctgcc tgaccgcagc    153600
     ttctgacaaa atggtgactt tcccgatcaa tagcactaaa gcggacctgt ttgagtctca    153660
     gcaaccggtt agccagtgca gtgacgtggt gcccgttacg gtaattcgcc tgcaggatat    153720
     taacggttgt gtcgtttccc tgttgctgcc ggaaaaagag acttttgagc gaactccatg    153780
     agaaaaagct cggatgaact atctgattgg catcaccaca gagtaaaaac tgaccgggat    153840
     gacgtagcgt tttcagtacc agttgcagtt gaacaggcgt catatcctga acttcatcaa    153900
     caaaaatgac atcataacgg ggagttgcca acgaaagata ctgatgactg agcagattac    153960
     tgtcatactg atgcgactgt ttcagccatg cgatataacg ttcaaacagg acatagaccg    154020
     tcgggcggtc ctccatgcca tagagcgact gccgtatccc cagtgacaga tacgcctccc    154080
     gggacagcgg cccattcccg gaggcaaccg caccgatcac gcccctgaac tcctcataca    154140
     gggtatgggc agcccccagt gcggcgatag ccctgttgcg gggcagccag tcgctgaacg    154200
     cactgaaagt cacctccctg cctttcggaa tgcgcagagt ttccagaaat tccgtcagcg    154260
     aaagaaagtc aatattctgt acctcactcc cttcccctga agcgtcatag agagtacgcg    154320
     ctttttccac cagaaatgag gaaaggctga gatacagtat atcaccagca gcctgcttca    154380
     ttttttccag taccagcgcc gtcttaccac ttcccgccga gccaacaatc accagcggta    154440
     gcgggtgttc gtacagtgcc tgctgatcat catcaaagga cagcatttta tccaggcggt    154500
     ggaaacgccc atgagacgga ttgatatacg tcagcgcttc agtcgcgata tcaacaggat    154560
     ccggcactgg ttgttgttgt aagcgccctt catcaatcac cacgtttctg cgaagaaaac    154620
     gtgaagtgtt ataggcatga ttgcgaatat attccagaac aaggcagata gtttcaccgt    154680
     ggtagcgata cagcgaaaac agtaatcggt cccggatact gagccgggcg cggtaaagat    154740
     tggtgtcaat tttacgaaca tcagcctgaa caaagttatc ggtggcaata gcctgtgcaa    154800
     attttttata acccgggatc gtgtcaggat tcagagtatg ataaagacag attttcatgg    154860
     ctgccggttt ccgtcgtgca aaaaacatgc tgattttacg aaggaatgcc ttactgaaca    154920
     accttgcccg gaataccccc cgaaatcaga tggaacaatc agaaaaatgc tctgcagtta    154980
     tggaataaag aaggtggggt ggtacgccgg gagggcgatc cgctggaaat ggcgcagtag    155040
     ctgcaggcct gtcatgatgc cggaatagaa gttcgtgtac aggttaatga aagcgtcacc    155100
     ccgtaaataa actctgcgct gaaattcctt tttttcattg gagcacctgt gttgttctga    155160
     ggtgaacata tcacctctgt gaggtagcct gagtttaacg gacactcctt cctgaaatag    155220
     aatggcatca gaaggagcta ataatgagca gaaaaaccca acgttactct aaagagttca    155280
     aagccgaagc tgtcagaacg gttcctgaaa atcaactttc gatcagtgaa ggcgcttccc    155340
     gattatctct tcctgaaggc actttaggac aatgggttac cgccgccaga aaagggctcg    155400
     gtactcctgg ttcccgcacg gtggctgaac tggaatctga aattctgcaa ctgcgtaagg    155460
     cgttaaatga agctcgcctt gagcgagata tattaaaaaa agcaacagcg tattttgcac    155520
     aggagtcgct gaaaaatacg cgttaatcga acaatggcga caacaatttc ccattgaagc    155580
     gatgtgtcag gtatttggtg tatccaggag cggttattac aactgggtac agcatgaacc    155640
     ctcagacaga aaacaaagtg atgagcggct aaaactggag attaaggtgg cacatatccg    155700
     cactcgcgaa acatatggaa cccggcggct ccagacggag ctggcagaga atggcatcat    155760
     cgttggtcgt gaccgactgg cacgtcttcg taaggagcta aggctacgct gtaagcagaa    155820
     acgcaagttc agagcgacta cgaactcgaa ccacaatctg ccagttgcgc caaatctgct    155880
     gaaccagacg ttcgctccta cagcaccaaa tcaggtctgg gtggcggacc tgacgtatgt    155940
     tgccacacag gagggatggt tgtacctcgc tggcatcaaa gatgtttata cgtgcgaaat    156000
     tgtcggctac gccatgggag agcgcatgac aaaagagctg acaggtaaag ccctgtttat    156060
     ggcgctcagg agccagcgcc cacctgccgg gctaatccac cactctgatc gaggttcaca    156120
     gtactgcgca tacgattacc gggtcataca ggagcagttt ggtctgaaaa catcaatgtc    156180
     gcgtaaaggt aactgttacg acaacgctcc gatggaaagc ttctggggaa cgctgaaaaa    156240
     tgagagcctg agccactatc gttttaataa ccgggatgaa gccatctcag taatacggga    156300
     atacattgag attttctaca atcgtcagcg tcgtcactct cgtctgggga atatctcccc    156360
     ggcagccttc agggaaaaat atcatcagat ggctgcttaa aaaaagaaca aatggtagtg    156420
     tccgctattg ccagtacacc tcactgttca ggtagccaaa ttcagtgtgc cacctcaagg    156480
     ttcttagtga gtcgttttta aaagatatga taatatatca ttgtttatga attgttgatg    156540
     tttaatttag taaattatat caaatatgcc atgggtttgc tatgttattc atccagtatc    156600
     tggaaataaa atgcaccagc tttattgggt tttccttttg tctctgctta ctaggtgcca    156660
     gaaactttaa atgttaaacg aagggggcat tttgttcaaa gccaatcatg ttccggtatt    156720
     aatgtatcat catgtcagtc attgccccgg actggttaca ctttctcccg tgacattccg    156780
     gaagcaaatg aaatggttgg ctgaaaacaa ctggaaaaca ctgtcatcag atgaactgga    156840
     gtttttttat cggggcggaa aactcccccg gaaaagcgtt atgttgacat ttgatgatgg    156900
     ataccttgac aactggtttc aggtatatcc tttattaaaa gagtttaatc tcaaagcaca    156960
     tattttttta attaccggtt ttattgggaa tggtccggtt cgtcactctc ctggaaagga    157020
     atattctcat cgcgattgcg aacatcaaat agcgacaggg aatgctgata atgttatgct    157080
     tcgctggtct gaagtaaacg aaatgttgca atctggtctg gtcgaatttc atgttcatac    157140
     gcatactcat acacgctggg ataaaaagtt cagttcacga gaagaacagt gtaaacatct    157200
     tcggcaggac ttgttgagcg ggagagaata tttgaaagaa atgacaggaa aatgcagtaa    157260
     acatttgtgt tggccggaag gttattataa caaggattat attcaggtcg ctgaagaact    157320
     tggattctat tatttatata caacagaaag aagaatgaat gctcctgcta aaggaactac    157380
     acggatagga agaataagca ccaaagaacg ggaaagttgc gcatggctga aaagacgact    157440
     tttttattat acaacaccgt ttttttcatc gttgctggcc tttcataagg ggccaagatt    157500
     accggatgat taataatgaa tatactattt acggaatcat caccgaatat aggtggtcag    157560
     gaattacagg ctgttgctca aatgaaggcc ctgaagaaaa tggggcattc agttctgctt    157620
     gtctgcaggg aaaacagcaa aattgctttt gaagccagta aattgggaat tgatatcaca    157680
     ttcgcgttat ttcgaaacag tcttcacatc cctactgcat ggagattact cggaatagtt    157740
     catggttttc agcccaatgc aatcgtttgt cacagtgggc atgatagcaa tattgttggt    157800
     ttagtacggt tattcacttg gaaacatcca ttcagaatta tcaggcaaaa gacatatttg    157860
     acacgaaaaa caaaagtttt ttcaataaat catttttgcg atgaggtgat tgttcccgga    157920
     acaagtatga agacacatct ggagcaggaa ggatgtcgaa cccgggttac tgttgtgcct    157980
     ccaggctttg atttccagaa attatacgtt gattcccgaa acagtttgcc tccaaatgtt    158040
     ctttcttggc tggcgtcccg aaggggatgc cccgttattg ctcaggtagg aatgttgcgc    158100
     ccggaaaaag ggcacgaatt tatgttgaat ttactgttcc atttaaaaat gaatggacga    158160
     cagttctgtt ggttgattgt ggggtctggt tcgcctgaac tgcgggagca tttacagtat    158220
     cagattgaca gtatgggcat gcatgatgat gtttttattg ctgacaatgt ttttcctgcc    158280
     gcccccgtat atcgggttgc cagtctggtg gttctgcctt cagaaaacga atcgtttggt    158340
     atggtactgg cagaagcatc ggcattttct gtgcctgtac tggccagtca gattggtgga    158400
     atccctgatg ttattcagaa caaccagacc gggacattgt taccagcagg taataagcac    158460
     gcatggatgt gcgccctgaa tgattttttt aatgaccctg ggcgttttta tcagatggct    158520
     cgccaggcaa aacaggatat agaagagcgg tttgatatta ataaaactgc gttaaaaata    158580
     ctcacattag cgaagcacaa gtaacaatat gttttctgta agtaacttat catttatcgg    158640
     tttccttaaa aggattgttt tttcctcaga ttcactcccg gggaagtggg aacacagaaa    158700
     attccggttc atgtacattt tgcgatgtgc tataaatccg gttgccagta ttcgatatta    158760
     ttacgaactg cgttccttgc agtgcattga ggatattctg gcaatacaac ccacgttgcc    158820
     agcaagaatt catcgacctt atttgcataa aggggggcga gcctggtccc gggggcaata    158880
     tattcttgag cattatcgct ttgtgcaaaa tttgccagaa aaatattctg aatttttgtt    158940
     tccacaaaaa tcggtatcat tagtccaatt catcgggaaa gatggagagg attttgatat    159000
     ccagtgttct cccagtggtt ttgaccggga aggagagttg atgttgtcat tgtttttcaa    159060
     taaaatagtg attgcccggt taacattttc agtcattctg actcaaaatg gacacaccgc    159120
     ttttattggc ggattacagg gagcccccaa aaataccgga cctgatgtta ttcggtgcgc    159180
     aacccgggcc tgttatgggc ttttcccaaa acggattatt tttgaagcat tttgtgcgtt    159240
     gatgaaagct tgtaatgtct ctgagtgtct ggcagtcagt gagcacagtc atgttttccg    159300
     gcaattgaga tactggtatc agaaacgcaa aacctttgtt gctgtctaca gtgatttctg    159360
     ggagtctgta gcagggaaaa cctgtggtga ctggtacaaa ttaccaacac aggtggttcg    159420
     aaagccgcta agcaatatag ctagtaaaaa acgctctgag tatcgaaaac gatacgcttt    159480
     gttggattat atccatgaaa ctgctatccg ctctttggat gcatatcctg taaactcaga    159540
     acatcaggac ttaaattaag gtttgatgta ttctctgaat aaaatattaa tgatgatttt    159600
     ggtaggggca ttcgcactaa ataatgaaaa aatacaaatc cgagtttatt cctgaattta    159660
     agaaaaatta tctttcccct gtttactggt ttacatggtt cgttttggga atgattgcag    159720
     gtatttcaat gtttccccct tcattcagag atcctgtctt ggccaaaata gggcgttggg    159780
     tgggcagatt gagcagaaaa gctcgtcgca gggcgacgat taatttatcg ctttgtttcc    159840
     cggaaaagag tgatacagaa cgggaaataa ttgtcgacaa tatgtttgcc acagcattgc    159900
     aatccatagt gatgatggca gaactggcaa ttcgtggtcc ggaaaagttc cagaaacgag    159960
     tgttctggaa aggcctcgaa attcttgagg aaatccggca caataacaga aatgtgattt    160020
     ttctggttcc ccatggctgg agcgtggata ttcctgcaat gttgctggca gctcaggggg    160080
     aaaaaatggc cgccatgttt catcagcaac gaaatccagt gattgattat gtctggaatt    160140
     ctgtacggcg taaattcggg gggcgcttac attcccggga ggatgggata aaaccattta    160200
     ttcagtcagt acgccaggga tactgggggt attaccttcc agatcaggat catggtcctg    160260
     aatacagtga atttgctgat ttttttgcga cctataaagc gacattacca attattggac    160320
     gtctgatgaa catcagtcag gctatgatta taccgctttt cccggtttat gatgaaaaaa    160380
     aacatttcct gactattgaa gttcggccac caatggatgc atgcattgcc agcgcggaca    160440
     ataaaatgat tgcccgacaa atgaacaaaa cagtggaaat tttggtgggg tcacatccgg    160500
     aacagtatat ctgggtttta aaattgttaa aaacgcgcaa atcaaacgaa gcggacccgt    160560
     acccttgaaa ttataaagta caggtatttc cactagttgt ttcttacagg ttaccaatcg    160620
     aaacacatcc cccttccgtg tgttgcccgt ttggcacgga ggactgtgta gatgcagttc    160680
     gttaaattta atttatgcct aaatagctgc gcttaatacc gctacacttt tgccagtcca    160740
     tgtttgcctc cggggaatgg gctgacggtt tccataaaat ggcgaacttt tttcaacagt    160800
     tgccacattg agctgcactg atgattacgc gttattgtgt cgtgaagtgc ctgccatagc    160860
     cgttcaacat gattcaccca tggcgagtaa accggctgat aaatgaccct gaacttcggg    160920
     ttctccttca gccagctctg tgtttcccgg cttttgtgga taatgtagtt gtccacgatc    160980
     agcgtgatgg ttttcgcccg acggtatgtc gctttaagcc gcttcagcag gctgatgaac    161040
     agcgccgaac ttttgctgtt gccgcccaca cagctgactt tacctgtccc gctgtgcagc    161100
     gctccggcca gataatattt ttcattctgt cccggcgtga ccacccgttt ttgctgtccg    161160
     cgcagttgcc agtccgcacc gattttggga ttaagatgga tatccacttc atcttcataa    161220
     aagacctgat gttctgcgct gcattcgtcc agtgctttat ggattgctgc catcttttca    161280
     tctttatgcg ggtcacggat acgcagagtt ggcgcagccc ttcgccacac aatccccgca    161340
     gacggcaacc agcggcgaac ggttccggca tttaactggc aaccggttat ctcattgatt    161400
     tttattgcca gcagttctgt actccagcgt gaacgctggt agccaaagtc gccgggagaa    161460
     tgttttacca gctcacgtaa cagtgtgcag atatgctcaa acggccagcg acgggcacgc    161520
     ccggcaggta atgatttcag tccctcaaca cccgactgcg tgaaccagtt aatccagcgt    161580
     ccaacagagg agcgggcgca gcagagcgtt ctggcaacgt cgctgacacg gtcgccccgg    161640
     tgcagcatca gcatggcagt cagtctgcgg gcataatttt tatcgtgtgt tttatggatg    161700
     gctttctgca tcaggcgtcg ttcgtcacgg gaaattggtg ctatgatcgg cattgctcag    161760
     tccggttggt gatttgtttt gatttggcga ttgatcagat cgcacaatcc gggctaagtt    161820
     ccctcaaagt gatctactat tccgcgcagc tatttagaac ggcacggaac cacggcagct    161880
     tgacggctgc aatgacgtgt gtcgtctggc ggtggagtat ctgctgtatg cagcccgaaa    161940
     acgggggctg gaaatcggca tcttctgcac catccacact ttacgccttc actttgaaga    162000
     acatttaccc ctcgttgtag ccggacgtcg cctgggcgta ccaaaatcaa cagtttgtag    162060
     tatgtttgtg cgcttccgca aagctggcct ttcatggcct ctgcccgcag gtatgtcgga    162120
     gcgggaactt gacgcccgtc tttacgggag tgcctccaca gtacctgtcg tacttactga    162180
     aagtaccgtt atgcccgaag tccccggggt aaaaaagcgt ccccggcgcc ccaacttccc    162240
     ttatgagttc aaaatcgcct tagtggagca gtcactgcag cccggagcct gtgtggcgca    162300
     gattgcccgt gaaaatggaa tcaacgataa cctgctcttc aactggcgcc atcaataccg    162360
     gaaaggtggc ctgctgcctt ccggaaaaaa tatgccggca ctgcttcccg tgacgttaac    162420
     gccggagccg gataaccatg gttttgacat catctatatg ctttcgacac atcatcagcg    162480
     gttcactttc gttcgtctct tcgatccata cctgatcggc tcacgtccga ccttttccca    162540
     tctcgctcac caccacatct cttaaatgca gcagcagtgg gtggtttggt gcctgcgcct    162600
     gcacgccgac accgaggggc cttccctcat ctcttgtgca gcatggctgc acagggactc    162660
     acgtccctgg tgcgcgcctt cgtggcacac catcatcggc gtacctttcg aagggaacgt    162720
     cgggacactg acgttgcatc cacatatcaa aggcatagtg caggaacaga tttgagagca    162780
     ggggcgagat cacgccgccc tgcggcgttc cttctgtcac cggccttacc agacctgcgt    162840
     ccattacccc tgcattcagg aacctgcgga taagtgacaa cacccgttta tccgatactc    162900
     gtttctctat ccggctcatc agcacgtcgt gatttatccg gtcgaagaac ttctccagat    162960
     cgaggtcgac cacccagtga tacccggccc cgatatattc ctgggcctgt atcactgcct    163020
     ggtgggccga acgaccggga cggaacccgt agctgttgtc gctgaacgag ctatctcaca    163080
     gtgcctgcaa tacctgcatc atagcctgct ggatgaagcg atccaccacc atctggatgc    163140
     ccagcagacg ttcgccgccg ccgggcttca gtatggatac tcttctcaca ggggatgggc    163200
     ggtatctgcc ggacagcagt tgcgctttca gctctggcca gtggtgcctc aggtagtccg    163260
     gcagttcact tacgcgcatg ccatcgactc ccgccgcacc ttgattgcgt cttgtcgatg    163320
     gaacagcaat cagcgcgccc gggggcggca gcgctgaatg gcgactacat atgggatatg    163380
     atcctcatac ctgtcagttc actgattttg agctaaccga cagcagagac gctgaacggc    163440
     tggatcgatt tgcgcaaacg gcagacgaga tacgaattgc tgaccgggga ttcggttcgc    163500
     gtcccgaatg tatccgctca cttgcttttg gagaagctga ttatatcgtc cgggtttact    163560
     ggcgaggatt gcgctggtta actgcagaag gaatgcgctt tgacatgatg gattttctgc    163620
     gcgggctgga ttgcggtaag aacggtgaaa ccactgtaat gataggcaat tcaggtaata    163680
     aaaaagccgg agctcccttt cctgcacgtc tcattgccgt atcacttcct cccgaaaaag    163740
     cattaatcag taaaacccga ctgctcagcg agaatcgtcg aaaaggacga gtagttcagg    163800
     cggaaacgct ggaagcagcg ggccatgtgc tattgctaac atcattatcg gaagatgaat    163860
     attcagcaga gcaagtggct gattgttacc gtctgcgatg gcaaattgaa ctggctttta    163920
     agcggctcaa aagtttgctg cacttggatg ctttgcgtgc aaaggaactt gaactcgcga    163980
     aagcgtggat atttgctaat ctactcgccg catttttaat tgacgacata atccagccat    164040
     cgctggattt tccccccaga agtgccggat ccgaaaagaa gaactaacgc gttgtggaga    164100
     ataacaaaaa tggtcatctg gagcttacag gtggccattc gtgggacagt atccctgaca    164160
     gcctacaaaa cgcaattgaa gaacgcgagg catcgtctta acgaggcacc gaggcgtcgc    164220
     gttcttcaga tggttcaacc cttaagttag cgcttatggg gtaaatcccc gcctttttcc    164280
     tgccggtccc cggacagagc acaaaggaag tcgccgccgg ctccgcttta cccggccatg    164340
     cggggcatgg ccttgtgggt tttcagctct gtagcctcag cgtcgtgtgc gggctgtgcc    164400
     gtgcctccat cttagccggg ctggcgttga tgcaagggta cgcttcgccg ctgcggtcac    164460
     ccggtccctc cttcccgtct gccgtgattt tccggtcgtt cacccgctca gatttcgcgg    164520
     tttcaccctc caactcccgc cagccgtgtg cgtcaggctg cggcttccct tgcgccctgt    164580
     gcatccccgc cttatcgccc ggctaagatg gaggcacggc accgcccggt gtcgcggaat    164640
     atgtgaacaa cggaggaaaa catcatgcaa tatgcgaaac ctgtcactct gaatgttgaa    164700
     gagtgcgacc gtctctcctt tctgccttac ctgtttggca acgattttct gtatgccgag    164760
     gcgtatgtgt acgcgctggc gcaaaaaatg atgccggaat atcagggcgg cttctggcac    164820
     ttcatccgcc tgccggacgg tggcggttac atgatgccgg atggcgaccg tttccacatg    164880
     gtgaacggtg caaactggtt tgaccgtacc gtgagtgctg atgccgcagg catcattctg    164940
     acttctcttg tgattaaccg ccagttgtgg ctgtaccacg acagcgggga tgcaggactg    165000
     accctgaggt agcctgagtt taacggacac tccttcctga aatagaatgg catcagaagg    165060
     agctaataat gagcagaaaa acccaacgtt actctaaaga gttcaaagcc gaagctgtca    165120
     gaacggttcc tgaaaatcaa ctttcgatca gtgaaggcgc ttcccgatta tctcttcctg    165180
     aaggcacttt aggacaatgg gttaccgccg ccagaaaagg gctcggtact cctggttccc    165240
     gcacggtggc tgaactggaa tctgaaattc tgcaactgcg taaggcgtta aatgaagctc    165300
     gccttgagcg agatatatta aaaaaagcaa cagcgtattt tgcacaggag tcgctgaaaa    165360
     atacgcgtta atcgaacaat ggcgacaaca atttcccatt gaagcgatgt gtcaggtatt    165420
     tggtgtatcc aggagcggtt attacaactg ggtacagcat gaaccctcag acagaaaaca    165480
     aagtgatgag cggctaaaac tggagattaa ggtggcacat atccgcactc gcgaaacata    165540
     tggaacccgg cggctccaga cggagctggc agagaatggc atcatcgttg gtcgtgaccg    165600
     actggcacgt cttcgtaagg agctaaggct acgctgtaag cagaaacgca agttcagagc    165660
     gactacgaac tcgaaccaca atctgccagt tgcgccaaat ctgctgaacc agacgttcgc    165720
     tcctacagca ccaaatcagg tctgggtggc ggacctgacg tatgttgcca cacaggaggg    165780
     atggttgtac ctcgctggca tcaaagatgt ttatacgtgc gaaattgtcg gctacgccat    165840
     gggagagcgc atgacaaaag agctgacagg taaagccctg tttatggcgc tcaggagcca    165900
     gcgcccacct gccgggctaa tccaccactc tgatcgaggt tcacagtact gcgcatacga    165960
     ttaccgggtc atacaggagc agtctggtct gaaaacatca atgtcgcgta aaggtaactg    166020
     ttacgacaac gctccgatgg aaagcttctg gggaacgctg aaaaatgaga gcctgagcca    166080
     ctatcgtttt aataaccggg atgaagccat ctcagtaata cgggaataca ttgagatttt    166140
     ctacaatcgt cagcgtcgtc actctcgtct ggggaatatc tccccggcag ccttcaggga    166200
     aaaatatcat cagatggctg cttaaaaaaa gaacaaatgg tagtgtccgc tattgccagt    166260
     acacctcatt gagcggcata acctgaatct gaggcagcac ctggcacggc tgggacggaa    166320
     gtcgctgtcg ttctcaaaat cggtggagct gcatgacaaa gtcatcgggc attatctgaa    166380
     cataaaacac tatcaataag ttggagccat taccgcgtat ccgcatgttc agccagatcg    166440
     ccaatattat gctttactgc ctgtttattt ttttctggat actcgttggt ctggttttat    166500
     gggtaaaaat aagctggcag acgtttgtga atggctgtat ttactggtgg tgtaccacgc    166560
     tggaaggcat gcgggattta atcaagtctc agccggtata tgagattcag tattacggca    166620
     aaaccttccg gatgaacgct gctcaggtac tgcatgataa atatatgatc tggtgcggtg    166680
     agcagttatg gtctgcattc gttctggcca cagttgtggc actggttatt tgcctgatta    166740
     ccttctttgt tgtctcctgg attctggggc gtcagggtaa acaacagagc gaaaatgaag    166800
     tcacaggtgg tcgtcaactg acagacaatc cgaaagacgt tgcccggatg ctgaaaaaag    166860
     acggcaggga ctccgatatc cggattggcg atctgccgat tatccgggat tccgaaatcc    166920
     agaacttctg tctgcacggc acggtcgggg ccggtaagtc ggaggttatc cgtcgtctgg    166980
     ccaactacgc ccgtcagcgt ggtgatatgg tggtgattta tgaccgttca ggggaatttg    167040
     ttaaaagtta ctatgatccc tccatcgata agatcctgaa tccgctggat gcacgctgtg    167100
     ccgcctggga tttgtggaag gagtgcctga cacagccgga ttttgataat accgcaaata    167160
     ctctgatccc gatgggcaca aaagaggacc cgttctggca gggttcagga cgtaccattt    167220
     ttgcggaagc ggcgtatctg atgcgtaatg accccaaccg cagctacagc aaactggtgg    167280
     acacactgct ttccatcaaa attgaaaaac tgcgtaccta cctgcgtaat tcaccggcgg    167340
     ccaacctggt ggaagagaaa attgagaaaa cggcgatttc catccgtgct gtgctgacca    167400
     actatgtgaa agccatccgt tacctgcagg ggattgagca taacggtgag cccttcacca    167460
     tccgtgactg gatgcgtggt gtccgggagg atcagaaaaa cggctggctg tttatctcgt    167520
     cgaatgccga cactcatgcc tccctgaagc cggtgatctc catgtggctg tccattgcca    167580
     ttcgtggtct gctggcaatg ggagaaaacc gtaatcgtcg tgtgtggttc ttctgtgatg    167640
     agttacccac attacacaaa ctgccggacc tggtggagat cctgccggaa gcccgtaagt    167700
     tcggtggctg ttatgtgttt ggtatccagt cctatgccca gctggaagat atctacggtg    167760
     agaaagcggc tgccacgctg tttgacgtca tgaacacccg tgcctttttc cgttctccca    167820
     gccataagat tgcggagttc gctgtcggtg aaattggtga gaaagagcac ctgaaagcca    167880
     gcgaacagta ttcctacggt gctgatccgg tacgtgacgg ggtatcgacc ggtaaggata    167940
     tggagcgcca gacgctggtc agttattccg acattcagtc cctgccggat ctgacctgct    168000
     atgtcaccct gcccggaccg tatccggcag tcaaactctc actgaaatat caggaacgtc    168060
     cgaaggtcgc tccggagttt attccgcgtg acatcaaccc ggaaatggag aaccgtctga    168120
     gtgccgtact tgccgcaagg gaagcagaag gtcgtcagat ggccagcctc ttcgaaccgg    168180
     atgtcccgga ggttgtttcc ggagaagacg tgactcaggc tgaacagccg caacagccgc    168240
     aacagccgca acagccgcaa cagccgcaac agccgcaaca gccgcaacag ccgcaacagc    168300
     cgcaacagcc gcaacagccg caacagccgc aacagccgca acagccggtg tctcctgtca    168360
     tcaacgataa gaagtcagat tcaggtgtga atgttccggc aggggggatt gagcaggagc    168420
     tgaaaatgaa accggaagaa gagatggaac agcaactgcc acccgggatc agtgaatccg    168480
     gtgaagtggt ggatatggcc gcttatgagg catggcagca ggaaaatcat ccggacacct    168540
     ggcagcagat gcagcgtcgt gaagaggtga acatcaatgt gcaccgggaa cgcggggagg    168600
     atgttgagcc gggagatgat ttctgatgaa caggtcagct ccagtcttca gttctcaggc    168660
     cgcccacacg ttcaaattcc cgggtgttat tagtcacaat aatcagcccc cgactgcggg    168720
     catgacctgc gatcatttga tcaaatggcc cgacagggcg tccctgacgg gcaagttctg    168780
     ctcttatctg gccggtgtgt gtggctgcag cagcgtcgta atccagaaca tcaatgcggg    168840
     aaacaaatcc ctcgatcaca gcgagattac gttcaggcat ctggcttttt tctgcaccat    168900
     atatcagctc catcagggtg accgaactga tacacattct cccctggttc aggttaaaac    168960
     gctccctgac gctggcgggt ttgttcttta tcgtaaaaat gcagatgttg gtatcgagca    169020
     taaacttcag catcagaatg actccctttc ctgcatgccg ggctgttccc tgttatccat    169080
     aaaatcggcg ctgacgctgt gtccgtcgaa ccattcgtcc catgtctctc cggctggcgt    169140
     aatgattctg gttcgtccga cagcaatcac ttcaacgcgt tttacgtttt ccggcaatgc    169200
     aaccgctttt ggcagtctga ccgcctggct gcggttgctg agaaatacgg tggtttccat    169260
     tatttgcctc cttatgtgga tatgtcttgt gtatatctat tgtgggattg atgccgggat    169320
     atgtcaaagg gatatacgtt tatgatgagt atcgcgcagg tcagatcggc cggaagtgcc    169380
     gataattatt ataccgacaa ggataattac tatgtgctgg gcagcatggg agaacgctgg    169440
     gccggccagg gggctgaaca actggggctg cagggcagtg tcgataagga tgtctttacc    169500
     cgccttctgg agggcaggct gccggacggg gcggatttaa gccgcatgca ggatggcagt    169560
     aacaggcatc gtcccggcta cgacctgacc ttctccgctc ccaaaagtgt ctccatgatg    169620
     gccatgctcg ggggggacaa acgtcttatt gaagcacata accaggccgt ggattttgct    169680
     gtccgtcagg tggaggcact ggcctccaca cgggtgatga cggacggaca gtcagaaacg    169740
     gtgctgaccg gtaatctggt gatggcactg tttaaccacg acaccagtcg cgatcaggaa    169800
     ccacagttac acacgcatgc ggtggtgact aatgttacgc agcataacgg cgaatggaag    169860
     acactgagca gtgacaaagt ggggaaaacg gggttcattg agaatgtgta cgctaatcag    169920
     attgcctttg gcaggctcta ccgggaaaaa cggaaagagc aggttgaggc gctgggctat    169980
     gaaactgaag tggtcggtaa gcacggtatg tgggaaatgc cgggtgtacc ggtggaggcc    170040
     ttttccggac gctcacagac tatccgggag gccgtcgggg aagacgcctc gctgaaatcc    170100
     cgggatgtgg cggcgctgga tacgcgtaaa tccaaacagc acgtcgatcc tgaagtcaga    170160
     atggccgagt ggatgcagac gctgaaggaa accgggttcg acatccgggc atatcgtgac    170220
     gcagcggaac aacgggcata tacccgcacg cagacacccg gacccgcttc acaggacggg    170280
     ccggatgtgc agcaggcggt gacacaggcc attgccggat taagtgaacg caaagtgcag    170340
     tttatgtata cggacctgct ggccaggacg gttggcatac tgccgccgga aaatggtgtg    170400
     attgaacggg cacgcgccgg tatcgatgag gccatcagcc gtgagcagct tatccccctc    170460
     gatcgtgaga aggggctgtt cacgtccggg attcatatgc tcgatgagct gtcagtccgg    170520
     gcactcagtc gtgacatcat gaaacagaac cgggtgaccg tacatccgga gaaaagtgtc    170580
     ccccggacgg ccggttacag cgatgccgtc agtgttctgg cacaggaccg tccgtcgctg    170640
     gccattgtgt ccgggcaggg cggtgcagcc gggcagcgtg agcgggtggc tgaactggtc    170700
     atgatggccc gggagcaggg gcgggaggtg cagattatcg ctgctgaccg tcgctcgcag    170760
     atgaacctga agcaggatga acggctgtcc ggtgaactga taaccggacg tcgtcagttg    170820
     ctggaaggca tggccttcac gccgggcagt accgttatcg tcgaccaggg cgaaaaactc    170880
     tccctgaaag agacgttaac cctgctggat ggtgccgcac gtcataacgt acaggtcctg    170940
     ataaccgaca gcgggcagcg aaccggtaca ggcagtgcac tgatggccat gaaggatgcc    171000
     ggggtgaaca catatcgctg gcagggggga gaacagcgac cggccaccat catcagtgaa    171060
     ccggaccgta atgtccgcta tgcccggctg gccggagatt ttgcggccag cgtgaaagcc    171120
     ggagaagaga gcgtggcaca ggtcagcgga gtacgggaac aggccatact gacacaggcc    171180
     attcgcagtg agctgaaaac acagggcgtg ctcggacacc cggaggtaac catgaccgcc    171240
     ctgtcaccgg tctggctgga cagccggagc cgttatctgc gggatatgta ccgcccggga    171300
     atggtgatgg agcagtggaa cccggagaca cgcagtcatg accgctatgt gacagaacgt    171360
     gtgacggcgc agagtcacag cctgaccctg cggaatgcgc agggcgaaac gcaggtggtg    171420
     cgtatttctt ccctggacag cagctggtcg ctgttccggc cggaaaaaat gccggtggca    171480
     gacggtgagc gtctgagggt gacagggaaa attcccggac tccgcgtctc cggcggtgac    171540
     cgcctgcagg tggcatccgt cagtgaagat gcgatgacgg ttgttgtgcc gggacgggct    171600
     gaaccggcca ccctgcctgt gagcgattca ccgttcacgg cactgaagct ggagaacggc    171660
     tgggtggaaa cgcccgggca ttccgtcagc gacagtgcga cggtttttgc ctccgtcaca    171720
     cagatggcaa tggacaatgc caccctgaac ggtctggccc gcagtggtcg tgatgtccgg    171780
     ctgtattcct cactggatga aacccgtact gcggaaaaac ttgcccgcca tccctccttt    171840
     acggtggttt ctgagcagat aaaggcgcgt gccggtgaga cattgctgga aaccgctatc    171900
     agtctgcaga aagccgggct tcacacgccg gcacagcagg ccattcatct ggcccttcct    171960
     gtgctggaaa gtaaaaacct ggccttcagc atggtggacc tgctgacaga ggcgaagtcg    172020
     tttgctgcag aaggaaccgg ttttgctgac ctgggagggg aaatcaatgc gcagataaaa    172080
     cggggtgatt tactgtatgt ggatgtggca aaaggctatg gcacaggcct gctggtttcc    172140
     cgtgcgtcgt atgaggcaga aaagagcatt cttcgccata ttctcgaagg taaggaggcg    172200
     gtcacgccgc tgatggagag agtacctggc gaactcatgg agaaactgac atcaggacag    172260
     cgcgccgcca cccgtatgat actggaaacg tccgaccgtt tcacggtggt gcagggctat    172320
     gccggtgtgg gtaagaccac acagttccgg gcggtgatgt cagccgtgaa catgctgccg    172380
     gagagtgaac gtccccgtgt cgttgggctg ggtcccacgc accgcgcggt cggggagatg    172440
     cgcagcgccg gcgtggatgc gcagacactg gcgtcctttc tgcatgacac gcagctgcag    172500
     cagcgcagcg gagaaacgcc ggatttcagc aacacgctgt tcctgctcga tgagagctca    172560
     atggtgggca ataccgacat ggcacgggca tacgccctga ttgcggtcgg tggcggtcgg    172620
     gctgtggcca gcggtgacac ggaccagctg caggccatcg cgcctggtca gcctttccgt    172680
     ctccagcaga cgcgcagtgc tgccgatgtg gtcatcatga aggagattgt gcgtcagacg    172740
     ccggaactgc gggaggcggt atacagcctg attaaccggg atgtggaaag ggcgctgtcc    172800
     gggcttgagc gtgtgaaacc gtctcaggtg ccacgtctgg agggcgcatg ggcaccggag    172860
     cactccgtga cggagttcag tcacagccag gaagcgaaac tggcagaagc gcagcagaag    172920
     gcgatgctga aaggcgaggc ttttccggat gtccccatga cactgtatga agccattgtc    172980
     cgcgactata ccggcaggac accggaagca cgggagcaga cgctgattgt cacgcacctg    173040
     aatgaggatc ggcgcgtact gaacagcatg attcatgatg cacgggaaaa ggccggagaa    173100
     ctggggcagg tgcaggtcat ggtgcctgtc ctgaacacag cgaatatacg cgacggggag    173160
     ctgcgtcgtc tctccacctg ggagaataac ccggatgccc ttgccctggt ggataatgtg    173220
     tatcaccgga ttgccggtat cagcaaggat gacgggctga taaccctgca ggatgcggaa    173280
     ggtaacacgc ggctgatttc gccccgggag gcggtggctg aaggcgtcac gctgtacacc    173340
     ccggacacca tccgggtggg gaccggtgac aggatacgct tcacgaagag tgaccgggag    173400
     cgcggttatg tggccaacag cgtctggacg gtgacagcgg tttccggtga cagtgtcaca    173460
     ctttctgacg gtcagcagac ccgtgtgatt cgccccggtc aggagcgggc agagcaacat    173520
     attgacctgg cctatgccat caccgcccac ggtgcacagg gggcgagtga aacctttgcc    173580
     atcgcgcttg aaggcacgga aggtaaccgg aaactgatga ggtagcctga gtttaacgga    173640
     cactccttcc tgaaatagaa tggcatcaga aggagctaat aatgagcaga aaaacccaac    173700
     gttactctaa agagttcaaa gccgaagctg tcagaacggt tcttgaaaat caactttcga    173760
     tcagtgaagg cgcttcccga ttatctcttc ctgaaggcac tttaggacaa tgggttaccg    173820
     ccgccagaaa agggctcggt actcctggtt cccgcacggt ggctgaactg gaatctgaaa    173880
     ttctgcaact gcgtaaggcg ttaaatgaag ctcgccttga gcgagatata ttaaaaaaag    173940
     caacagcgta ttttgcacag gagtcgctga aaaatacgcg ttaatcgaac aatggcgaca    174000
     acaatttccc attgaagcga tgtgtcaggt atttggtgta tccaggagcg gttattacaa    174060
     ctgggtacag catgaaccct cagacagaaa acaaagtgat gagcggctaa aactggagat    174120
     taaggtggca catatccgca ctcgcgaaac atatggaacc cggcggctcc agacggagct    174180
     ggcagagaat ggcatcatcg ttggtcgtga ccgactggca cgtcttcgta aggagctaag    174240
     gctacgctgt aagcagaaac gcaagttcag agcgactacg aactcgaacc acaatctgcc    174300
     agttgcgcca aatctgctga accagacgtt cgctcctaca gcaccaaatc aggtctgggt    174360
     ggcggacctg acgtatgttg ccacacagga gggatggttg tacctcgctg gcatcaaaga    174420
     tgtttatacg tgcgaaattg tcggctacgc catgggagag cgcatgacaa aagagctgac    174480
     aggtaaagcc ctgtttatgg cgctcaggag ccagcgccca cctgccgggc taatccacca    174540
     ctctgatcga ggttcacagt actgcgcata cgattaccgg gtcatacagg agcagtctgg    174600
     tctgaaaaca tcaatgtcgc gtaaaggtaa ctgttacgac aacgctccga tggaaagctt    174660
     ctggggaacg ctgaaaaatg agagcctgag ccactatcgt tttaataacc gggatgaagc    174720
     catctcagta atacgggaat acattgagat tttctacaat cgtcagcgtc gtcactctcg    174780
     tctggggaat atctccccgg cagccttcag ggaaaaatat catcagatgg ctgcttaaaa    174840
     aaagaacaaa tggtagtgtc cgctattgcc agtacacctc atgatggccg gctttgagtc    174900
     agcctacgtg gccctgtcgc gtatgaagca gcatgtgcag gtgtacaccg ataaccgtca    174960
     gggctggacg gatgccatca acaatgccgt acagaaagga actgcccacg atgtgtttga    175020
     gccgaaaccg gaccgggagg tcatgaatgc agagcggctg ttcagtacgg cgcgggagct    175080
     gcgggacgtg gcggcaggcc gtgccgttct ccgtcaggcg gggctggccg ggggagacag    175140
     tcctgcacgg tttattgctc cgggacgtaa atatccgcaa ccgtatgtgg cactgccggc    175200
     gtttgaccgt aacggcaagt ccgccggtat ctggctgaac ccgctgacca cggatgacgg    175260
     aaacgggctg cggggattca gcggtgaagg tcgggtaaaa ggcagcgggg atgcgcagtt    175320
     cgtggccctg cagggcagcc gtaacggaga aagcctgctg gctgataata tgcaggatgg    175380
     cgtccggatt gcccgtgata atcctgacag tggtgtggtg gtaagcattg ccggtgaagg    175440
     ccgtccgtgg aatcccggtg ccatcaccga tggccgcgtg tggggggata tcccggacaa    175500
     cagcgtccag ccgggagccg gaaatggcga accggtcacg gcagaggtac tggcacagcg    175560
     gcaggctgaa gaggccatcc gccgtgaaac ggaacgtcgc gcagatgaaa ttgtccgtaa    175620
     aatggcagag aacaaacctg acctgccgga cggcaaaaca gagctggctg tcagggaaat    175680
     tgccgggcag gagcgtgacc gggctgccat aactgaacgg gaagccgcgc tgccggagag    175740
     tgtgctgcgt gaatcacaac gggagcggga agcggtccgg gaggttgccc gggaaaatct    175800
     gctgcaggag cgtctgcagc agatggagcg ggatatggtt cgtgacctgc agaaagagaa    175860
     aaccccgggc ggagactgat acaggaagac aaacactgat gacaacggat aacacgaaca    175920
     cgacacgtaa cgattcactg gctgcacgga ccgatacctg gttgcagtca tttctggtct    175980
     ggtcacccgg acagcgggat atcatcaaaa cggtggcact ggtgctgatg gtactggacc    176040
     acatcaatct gatattccag ctgaagcagg aatggatgtt tctggccggg cgaggagcct    176100
     ttccgctttt tgccctggtg tgggggctga atctgtcccg tcatgcgcat atccggcaac    176160
     cggccattaa ccggctgtgg ggatggggaa ttattgccca gttcgcatat tatctggcag    176220
     gctttccctg gtatgagggg aatatcctgt ttgcctttgc agtggcggca caggtgctga    176280
     cgtggtgtga aacgcgcagt gggtggcgta cagcagcggc cattcttctg atggccctgt    176340
     tgggggcctt tgtccggcac cagttacggc attgccgggc tgctgatgct ggcagtcagc    176400
     caccgactgt accgggcgga agacagagcg gaacgtctgg cgctggtcgc ctgcctgctg    176460
     gctgttattc cggcgcttaa ccttgccacc agtgatgcag cggcggtggc cggtcttgtg    176520
     atgacggtgc tgaccgttgg tctggtgtcg tgtgcaggaa aatcattacc ccgtttctgg    176580
     cccggggatt ttttcccggt attctacgcc tgtcatctgg ctgtgctggg cgttctggcg    176640
     ctgtgacggg tgtggtatct ttgaccgtaa caggatgatt cgtcagaggc agaacacagc    176700
     atgacagagc agaagcgacc ggtactgaca ctgaagcgga aaacggaagg ggagacgcct    176760
     gtccgcagcc ggaaaaccat catcaatgtc accacgccac caaagtggaa ggtgaaaaag    176820
     cagaagctgg ccgagaaagc agcccgggaa gcagagctgg cggcaaaaaa agcgcaggcc    176880
     agacaggcac tgtccattta tctgaacctg cccacgctgg atgaggccgt gaataccctg    176940
     aaaccctggt ggccgggatt atttgacggt gacacccccc ggcttctggc ctgcggtatc    177000
     cgggacgtgt tactggaaga cgtggcgcag cggaatatcc cgctctcgca taaaaaactg    177060
     cgcagggcgc tgaaggccat cacccgttca gaaagctatc tgtgtgccat gaaagccggt    177120
     gcctgccggt atgacacgga agggtatgtg acggagcata tttctcagga ggaggaagcg    177180
     tatgcggcag cgcgtctgga taaaatccgc cgccagaacc ggataaaggc agaacttcag    177240
     gccgtgcttg atgagaaata aaaaaaagcc tccatcagag aggaggcagg gaaataaggc    177300
     ttaaaaggaa ataacttccg cttccgaaag gaagccagtc cactgaatta tttatcacaa    177360
     taatactgac aactaaaggg ggacaagaaa atgaatggat tcagaaacag ttcacggaac    177420
     ggccaggtct ggcgttacca gcgtgccggc gggcgggccg ttattctgga agtcagtgga    177480
     cgctggatgg aagcggcaga agcatggcga cgggctgcct gtgttgcgcc caggacagac    177540
     tggcagcagt ttgcccgaaa aagggctgaa cactgccacc ggcgctgccg gggaagggtg    177600
     taacgaaaaa agcagccttc attactccag gagtcagaag gctgaaagga gtttatgaga    177660
     tttgcttctt aatatccggt cgggcagtat gaccggacag ttctgagtag cacagagtct    177720
     tttccgcatt aagtcgattt tttatatttt gtgattaatt tcacaaaata aggtgttatt    177780
     caatgtgtgc tgccctattc aggggggctg aaatacaggt gccatttatc tgatatggag    177840
     aataacatga ggaaatatat tccactggta ttatttatct tttcatggcc ggtattgtct    177900
     gcagatattc atggacgggt tgttcgtgta ctggacggtg ataccatcga ggtcatggac    177960
     tcactgaagg cggtgcggat caggctggta aatattgatg caccggaaaa gaaacaggat    178020
     tatggccggt ggtcaacaga catgatgaaa tcactggtcg caggaaaaac ggttaccgtc    178080
     acatattttc agcgagatcg ttatggtcgt attctcgggc aggtttatgc accagacgga    178140
     atgaatatta atcagtttat ggtccgggcc ggggctgcct gggtatatga gcagtacaac    178200
     acagatcccg tgctacctgt ccttcagaac gaagccagac aacaaaaacg tgggctctgg    178260
     tcagatgctg atccggttcc cccctggata tggatgcacc gtaaataaag cgatggcaat    178320
     cctatcattc atctgttctc agcgggaata aaaatggcaa aaacaaaaca ggaatggctg    178380
     tatcagttac ggcgatgttc atcagtcaat acgctggaaa aaattattca taaaaacaga    178440
     gacagtttat caaacagtga acgtgaatca tttaattcag cagcagacca ccggttagcg    178500
     gaattaatca ccggaaagtt atatgacagg ataccaaaag agatatggaa atatgtaagg    178560
     taataattca gcaataatta attgccagga gcagataaat aatgaagttg attattttta    178620
     ttctcattgt tctgattatt gcagcgctac ttatccggat tatcctcaga agtgtaaatc    178680
     agcattctcc tttgctgatg caattgcatg cggcaggtat acggaccggt gatgcagagc    178740
     gaatactgtc cagcggtgaa tactggcaac gtcagaagac gctgctgaca gaaagggaag    178800
     tcagttttat gaaaggactg ttcagaattg tggatatgaa gcggtgggta atggctccaa    178860
     cttattgata gtgttttatg ttcagataat gcccgatgac tttgtcatgc agctccaccg    178920
     attttgagaa cgacagcgac ttccgtccca gccgtgccag gtgctgcctc agattcaggt    178980
     tatgccgctc aattcgctgc gtatatcgct tgctgattac gtgcagcttt cccttcaggc    179040
     gggattcata cagcggccag ccatccgtca tccatatcac cacgtcaaag ggtgacagca    179100
     ggctcataag acgccccagc gtcgccatag tgcgttcacc gaatacgtgc gcaacaaccg    179160
     tcttccggag actgtcatac gcgtaaaaca gccagcgctg gcgcgattta gccccgacat    179220
     agccccactg ttcgtccatt tccgcgcaga cgatgacgtc actgcccggc tgtatgcgcg    179280
     aggttaccga ctgcggcctg agttttttaa gtgacgtaaa atcgtgttga ggccaacgcc    179340
     cataatgcgt gcagttgccc ggcatccaac gccattcatg gccatatcaa tgattttctg    179400
     gtgcgtaccg ggttgggaag cggtgtaagt gaactgcagt tgccatgttt tacggcagtg    179460
     agagcagaga tagcgctgat gtccggcagt gcttttgccg ttacgcacca ccccgtcagt    179520
     agctgaacag gagggacagc tgatagaaac agaagccact ggagcacctc aaaaacacca    179580
     tcatacacta aatcagtaag ttggcagcat caccgaagcg gtggtatctg tgtccgcagg    179640
     tacgggtcgc ggatatcgtc cagctgaacg ggaatatccg gccacgatca cgccagtggt    179700
     ggcagttatt caggatggtg tctcagtggc atgttgatgt ggttatcgtt gagctgcgtt    179760
     cgttcagtat tgttgcagca gtagagctgg atgatgccag ccatttacga ccggaacgca    179820
     gacgccggga tattcttctg gaagaggttc tgaggcaggc tggtattccg ttgctcagaa    179880
     gccacgatgc cagaaaactg ctgcagatga ccggagaatg gctgaataca acaggggctg    179940
     atcagcagtc accggaacat cgtagctgac gccttcgcgt tgcttagttg tccaaccccg    180000
     gaaacgggaa aaagcaagtt ttcctcgctc ccggcgtttc cataactgaa aaccatacta    180060
     tttcacagtt taaatcacat taaacgacag taatccccgt tgatttgtgc gccaacacag    180120
     atcttcgcca caattctcaa gtcgctgatt tcaaaaaact gtagtatcct ctgcgaaacg    180180
     atccctgttt gagtattgag gaggcgagat gtcgcagaca gaaaatgcag tgacttcctc    180240
     attgagtcaa aagcggtttg tgcgcagagg taagcctatg actgactctg agaaacaaat    180300
     ggccgcagtt gcaagaaaac gtcttacaca caaagagata aaagtttttg tcaaaaatcc    180360
     tctgaaagat ctcatggttg agtactgcga gagagagggg ataacacagg ctcagttcgt    180420
     tgagaaaatc atcaaagatg aactgcagag actggatata ctaaagtaaa gactttactt    180480
     tgtggcgtag catgctagat tactgatcgt ttaaggaatt ttatggctgg ccacgccata    180540
     aggtggcagg gaactggttc tgatgtggat gtacaggagc cagaaaagca aaaaccccga    180600
     taatcttctt taactttggc gagtcagaaa gattaccggg gcccacttaa accgtatagc    180660
     caacaatcaa gctatgcggg gagtatagtt atatgcccgg aaaagttcaa gacttctttc    180720
     tgtgctcgct ccttctgcgc attgtaagtg caggatggtg tgactgatct tcaacaaact    180780
     tattaccgcc aggtaaagaa cccgaatccg gtgttcacac cccgtgaagg tgcccggacg    180840
     cttccgttct gcgggaaact gatggaaaag gcggtgggct tcacctcccg ttttgatttc    180900
     gccattcatg tggcacatgc ccgttcgctt ggtctgcgtc ggcgcatgcc accggtacta    180960
     cgtcgccggg ccattgatgc gctgctgcag gggctgtgtt tccactatga cccgctggcc    181020
     aaccgcgttc agtgctccat caccacgctg gccattgagt gcggactggc gacggagtct    181080
     gatgccggaa cactttccat cacccgtgcc acgcgtgccc tgacgttcct ggcagagctg    181140
     gggctgatta cctaccagac ggaatatgac ccgcttatcg gctgcaacat tccgaccgac    181200
     atcacgttca caccggcgct gtttgccgcc ctcgatgtat cagaggaggc ggtggcgtcc    181260
     gcgcgccgca gtcgtgtgga atgggaaaac agacagcgca agaagcaggg actggatacc    181320
     ctgggtatgg atgaactgat ggcgaaagcc tggcgttttg tgcgtgagcg tttccgcagt    181380
     taccagacag agcttaagtc ccgtggaatg aagcgtgccc gtgcgcgtcg tgatgcggac    181440
     aggcagcgtc aggatattgt caccctggtg aaacggcaac tgacgcgtga aatctcggaa    181500
     gggcgcttca ctgccagtcg tgaggcggta aaacgtgaag tggagcgtcg tgtgaaggag    181560
     cgcatgattc tgtcacgtaa ccgtaattac agccggctgg ccacagcttc cccctgaaag    181620
     tgacctcctc agaataatcc ggcacgcgcc ggaggcattc gcacgcctga agcccgccag    181680
     tgcacaaaaa atcagcgcta catacaaaaa acaacctcat catccacctt ctggtgcatc    181740
     cggtcccccc tgtttttgat acaaaacacg cctcacagac ggggaatttt gcttatccac    181800
     attaaactgc aagggacttc cccataaggt tacaaccgtt catgtcataa agcgccagcc    181860
     gttagcttta cagggtgcaa tgtatctttt aaacagctgt ttatatctcc tttaaactac    181920
     ttaattacat ccatttaaaa agaaaacctg ttcactgcct gtcctgtgga cagacagata    181980
     tgcacctccc accgcaagcg gcgggccccg accgaagccg atttagttac aacatgcaaa    182040
     cataaacccc taaaaaaccc aagtccgacg cagaactgaa accacaacgc ccctcctcat    182100
     aactgaaaag cgccgctgcc cccgcccgaa gggcgggaac agagtcgctt ttaattatga    182160
     atgttgtaac tacatcgtca tcgctgtcag tcttctggct ggacgtatcg agtacacgct    182220
     cgtaagcggc cctgacggcc cgctaacgcg gagatacgcc ccgacttcgg gtaaaccctc    182280
     gtcgggacca ctccgaccgc gcacagaagc tctgtcatgg ctgaaaacgg gtatggctta    182340
     gcagggctgg ggatgggtaa ggtgaaatct gtcaatcagt accggctaac gccgggcttc    182400
     ggcggtttta ctccggtatc acatgtaacc gcagcgtgcc gccttacatg ccgctggcgc    182460
     ggcatcagaa taatacaagc agcatttaat gcatttgcaa aagtgtgagt aataaagact    182520
     tgttaagtgg tcgtttcagg gatatcgtta agacttgtta aacagtctca aaggtgcgtt    182580
     atgcctaaca tcattctgtc tgagaccagt gcaagtgtca gtgaactgaa aaaaaatcct    182640
     atggctacag tcagtgccgg agatggttac cctgtcgcca ttcttaaccg gaatcagccg    182700
     gcattctact gtgtgcctgc tgaactgtat gaaaggatgc ttgatgctct ggatgaccag    182760
     gaactggtga aactggttac tgaacgcagc aatcagccac tgcatgatgt ggacctggac    182820
     agttatttat gacttatacg gtaaaattca gggatgatgc gctcaaggaa tggctgaaac    182880
     tggataagac cattcaacaa cagtttgtga aaaaactaaa aaaatgcagc gaaaatcctc    182940
     atataccgtc ggcaaaacta agagggctaa aggactgcta caaaattaaa ctacgtgcat    183000
     cgggatttcg tctggtttat caggtgattg acgatatgtt aattattgcg gttgttgcgg    183060
     taggaaaacg agaacgtagt aacgtttata atctcgccag tgagagaatg agatagtaac    183120
     atataaataa cctttcccgc agataactca gaattgttat tttctctgtg gactcgacgt    183180
     ataggaaatt gaaaaactaa gcgatacccc tgtccgcgcc ttatgccacg tgagcctttc    183240
     tgtttttccc caccactccg gtgttttctc tctctgcatg gtcgattctt ataccgcaac    183300
     aggctgtttt ttatacttgc accgattccc gggcacactt agcctgtgtc aggccggcat    183360
     atacctcagc agactgatat cccgcgcgtt tttcttcagc ccctccacat tcagccccgc    183420
     aatggcccgg cggtatacca tccggccgcc acacagcacg cattcgaacg ggtcacgact    183480
     caggaactgt ttcaccattt gtgcatagca cactttcgcc actggttccg gtttatccat    183540
     ccccagagca cggtacacct gcggcagctt ctctccacac acccggttgg caaggaaccc    183600
     gaagtacctc accatcttaa aaaacttctc cgggatgtgc tgtttcagcc tcgcgaccag    183660
     ctcacgctgt gtcagcgttt ccgtcgccgt ttctcccgtt ttgtggtcca ggtaacggaa    183720
     gctcaggctc gcccctccgt tgtaatgtgc cagccgggag gccgctatcg gcggcttctt    183780
     cagataacga cccaggtagc gcgccgtatt cctcccgccg gccgtttttt tcgacatgta    183840
     cacatgccag tattttcctc cggctttcag caccaggctt ctccactgtg attccgtcgt    183900
     gatatgtgac aacgactccg gcatcgccag cccctctgac cacgctttca gaagccgttg    183960
     ccgcatattc cacatccacc gcgaacgcat cgcgtctttc aggaagctca gctttttcca    184020
     ctgaccatgc ttattcagac atccacaggt tacagacaca tgtacatgcg gatgccagtt    184080
     gagacgacgg ccatacgtgt ggatggcgca gaagataccg ggttcctgcc cccgtttccg    184140
     ggcggcatac agcagattct ccaccgccag acggcacacg tcattcagca gccaccggtt    184200
     gctttcgaac accggccaca gcgtgtccgg cagggtgaag accagatgta cccagtcgca    184260
     gtcaggaaga cgattcagct gtgtcgctat ccacaggtct gtggcctttt ttccgcagga    184320
     cgggcaggca cggctgccgc atgagttagt gacgtatctg acgtgggggc actcaggttt    184380
     atcgcagttg tattccttca ctcccagtat ccgcgtgccg caggccagca tttttgtgac    184440
     agcctcaacc tcgatatcgc gcagaccgcc cgcatccagg aaggacgtcc agcactggtt    184500
     ggctgtgaac aggcgtttca gcgggcgggg agtaaaagcg gacaacatga ggacggatta    184560
     acccccggta tcctgtagcc gggtaagggc tgctgtgtcg ccacggcgct ccaggatgga    184620
     ggccgcgacc atcgcaggtg gtgggtccat gggtttgagc atcttcatcc agtcccattc    184680
     acgttgtgag agcttctcag caccaacaga gagcagaacg gtatctatac ttttgcgggt    184740
     caacataaga ggatgagtcc ttaataaaac aggtcctcag agcatacata ttctgcggag    184800
     cgtgcggcaa caacaggacg aacaggggcg gttttcaatt tgcagccgtc aggctgccgt    184860
     ggttcatcgt gatgcgtact gcaatcgtaa tgtcgttgaa cggtgctttg ggcggctgaa    184920
     agaatatcgc cgcatcgcca cgcgttacga caaaacggcg agaaattacc tggcgatggt    184980
     gaaactgggc tgcatccgac tcttttatca acgcttacgt aattaaggga cacagcctgg    185040
     cactctgcga gtaaacttgc tggtaaacta ttattgacag ttggttttgt tttgagactg    185100
     taatttaaat tgtgtaattg cctgtttttg atatgttcac tccaacaacg gagacaggta    185160
     aattatggac gaaaagaagc ttaaagccct tgcggctgaa ctggctaaag gcctcaaaac    185220
     cgaggccgac ctcaatcagt tttcccgtat gcagacgaaa ttaactgtcg aaacggtgct    185280
     taatgcggaa ctaactgacc atctcgggca tgaaaaaagc tacatccggt agtaaacatt    185340
     atcagtgggt tatgcgatat gatttgagcc gttttcagac aatcgcaggg ccagtacctc    185400
     gtcagtcagc tgacggtaaa tctgctgttc agtctcacgc atcacctgtg caccggcttc    185460
     cctctccgca tccgcatcac cgctcagacc tgatgctttc agccggtcag ccaccctctg    185520
     agagtactca ttctccagca tctcatactt ctgctcttct gcctgcgccc agcggtcagc    185580
     ttccgtacgc ttcagtacag catgccatgg tccccagagg gagaaccagt ccgtaaattc    185640
     attctcttca cggcttctga ccatggcttc ggcagtgcgg aggtcatttg ctgtcactcc    185700
     cgacacgcca tagaaacgca tttccttcac ggcagtggag agctgaagtt tctctgcgag    185760
     catggtctgg aaggccaggt agacttctat ctcatccaca aaatggagag ttctgacttt    185820
     atcccgggca atgtcctcca gaatttcgag gcggaacatt tccctgccca gggagagcag    185880
     agcgccggta tcattatcga aaaggccttc tgatgcctga tggaccagga gggttttccg    185940
     gagattgttc catgtgagcg cgacacggtc ctcacagctc tcagtggcat cagcagcaac    186000
     agcgaaagac tgctgtcgaa gctccgcaga ggcactgagt ttttccagcc atgcagcgac    186060
     ctgttcacgg aatccggagg tattgcgtgc agagacggta tcggaaaggc ggtcaaggaa    186120
     cgcggaaaag gtgttggcat gctcttcatg ttcaaaagca tgccatatct gtgatacatc    186180
     agattgtttg ttttccggga accatgctgt cacggcatca gccagggagt gttctggagc    186240
     ggaaattgtg gcagaatttc ccatagagaa aaatattcga ggaccagaat aatctggtcc    186300
     ggtggttatt tgttgtagtg tacgcatggt atggccagac aatggattac ctgcaacatt    186360
     tacgaaggca ttctgagcta atctcaggac actttccgga agtgttgtca gattattatt    186420
     cattagcaca gccctgttca tactaaaagg taattccggt agttgttcta taaaattatt    186480
     agccagagcc agcccttcaa gcttatctgg aaagggggga atgctgtcta atctgtttcc    186540
     agaaactacc agtaatttta gttccggtgg caatagtggc agaatatgca atcggttatt    186600
     atgaacccgt aaatgagtta gattttcagg aagaaatggt aattctttta tcttgttatc    186660
     acccgcatta agctcttcta acgtctcggg taaggcaggt aagctttcca gttgattaaa    186720
     ttgagcatgt attaccttaa gcattggtgg taaatcaggg agatgtgtta ataggttttt    186780
     tcttatttcc agtgttgtta tctgaggcgg taaatctggt aatgttttta aatctaactc    186840
     agataaattt aattctgcct cttgattttg taaacatatt ttcagcctat tgaaggcgat    186900
     attgcgttgc tcgcctgggg taccgttctt ttcccattca ctccaggctt ttaaataaaa    186960
     ttcattacaa gatggagtca gttccatagg taaagaaaat ggagttaacg agtatatatt    187020
     gtttatttga tgcataatac tagaaccgat tgcctgtata ttggttgatt taatcattat    187080
     aactaaaatt tcttatcaat gataagaatt ctagtgaaat agaatatagc ttattaattt    187140
     taaaacagtt tgctttgtac cctttctccg ggtattgctt tccccctaag ccgtctatgg    187200
     gaaggagtct gctgttattc ctgagaatgg taattcagcc ataaaaaggt atttaaggtc    187260
     attgcgtctc tccctgtact cgaataatgg tgaagaaagc atgatgaata tatcacgata    187320
     acgttcagta cgtatcgagg atagatggag ttactcctct ctgaaataga attactgctc    187380
     tatttttttc tgttttcaga agttattagt aacaaaccct gatatatttt tttgaaaata    187440
     gagcttaaac gagtctgaaa ttaacttcag aaatcagaat accgttggct ttgtttttta    187500
     tcaattccgg cttcatttat ctttgtcaac cattgtattt ctgtagctgt gaatttcaac    187560
     cttttcgttc ggttggtagc aggtatttgc aattcgtata tggctgtttt ttttattaaa    187620
     aacagtatat ccatctgtag taacagtaga agataataat atagtatttg atacttcagg    187680
     gatgatattt tcttattttt tgggaagaca agggaatata gtttgtgtaa gcatattact    187740
     tccttatgtt atattttggt aaaaaattta tttttttaca ttatagtcgg ctaaatgaag    187800
     tttactgtaa aaaaacgata ctttttcggg tggcgcttcc aatcagtaga atatgtgttt    187860
     ttcaatgaag gagccgatga cttttcgtgg atttccacgg aacgcgagaa gcagattgtt    187920
     ttacgtgcca gccgcttgat cgataggaat taaaacccca aaaagattaa aaaaacacca    187980
     caaaacggat gtttcttcaa caccactttt gctccatatg aacggaaccg acgattaaac    188040
     tggatggctc tgattgattc agggtatgaa tggcggtttt ttgctccgtt tccctcaaaa    188100
     tggacgcaac ttcccctctg cggctctcag ccgcaccacc gcatccgggc cagcagctca    188160
     tgcatcagga cctgctctgc cagacggtag ccccgcttca gccccgtaaa acgcatctga    188220
     ctcccgcaca gcacgcactt cagcgggtca accttcagta acctctgata catccctctc    188280
     caggtgattt gcatcgccgt ttttctcact gtctccgtta tgatgtacac cacttcttcc    188340
     agtaaccgcc gtttcgccgg actcaaaaaa ccgtagtacc tcaccatacg gaacccctta    188400
     tccgccacat gccaggagaa cctttccatg aactcatctc cactcatcaa caggtattct    188460
     tcccgttttg ttcggtgact gttgtaacgc agaccgattt catcctgacc ggcataatgc    188520
     tccagacgac tcatcggcac tggtggcttt ttcaggtaag agccaaagta caccgccaca    188580
     tgggtggcat tatccatcac ccgggatacg ttgacattcc agccacggcg gtaatgcgtg    188640
     tccaggaagc gattccattc ccgtttactg cttccttctg ctgccagcgc atccggcatc    188700
     accaggtcag ggtatttccg tgacagcaac cgtgttatcc ggtagcgcca catgctcatc    188760
     accttacggg cgtaaaaatg aagatttttc caggtgtggc ccgacgtcac accaccggca    188820
     gttgtcgata aatggatatg cggatgccac tgctggtcac gcccccatgt gtggatcacc    188880
     gtgaatatcc ccgactccac atctgcctga tggcagattt ccagtatcac atccgctgca    188940
     atgcggctca tctctgtcag taaccaccgg ttgtggaaca ccagggacca gtactggcag    189000
     ggaagtgtga acacaatatg ctgccacggg cagtcgggga ccaggctcag cagatactgt    189060
     atccactgtg cgccagcctt caccccgcag tgcgggcagg agcggctttt acaccggaag    189120
     cagacctttt ttgtatggca acagtccggt gatgaacagc accactgtgt ataccccatc    189180
     agtgtggtcc cgcacgccat gattttggtc accgactcaa tcaccaccgg acgtactgcc    189240
     ccttccggct gcttctccag ccagttaagc cagcggtttc cctgctgaaa gatatcggca    189300
     aaacggggaa gcatcagaag ggcggggcga ctccgtccgg ccagtgaacc gtgccacact    189360
     ccgggcagta cataccgccg gcgctgatac cggaaagaat ggtcgcaaat tcccgctccg    189420
     tgcagcgggc gatttccgga tacccttcgt catcaacacg tacaaaccag aagaccagct    189480
     ttttgtttcc cgcatccaca aagaacggtg aggtgtactg gcaatagcgg acactaccat    189540
     ttgttctttt tttaagcagc catctgatga tatttttccc tgaaggctgc cggggagata    189600
     ttccccagac gagagtgacg acgctgacga ttgtagaaaa tctcaatgta ttcccgtatt    189660
     actgagatgg cttcatcccg gttattaaaa cgatagtggc tcaggctctc atttttcagc    189720
     gttccccaga agctttccat cggagcgttg tcgtaacagt tacctttacg cgacattgat    189780
     gttttcagac cagactgctc ctgtatgacc cggtaatcgt atgcgcagta ctgtgaacct    189840
     cgatcagagt ggtggattag cccggcaggt gggcgctggc tcctgagcgc cataaacagg    189900
     gctttacctg tcagctcttt tgtcatgcgc tctcccatgg cgtagccgac aatttcgcac    189960
     gtataaacat ctttgatgcc agcgaggtac aaccatccct cctgtgtggc aacatacgtc    190020
     aggtccgcca cccagacctg atttggtgct gtaggagtga acgtctggtt cagcagattt    190080
     ggcgcaactg gcagattgtg gttcgagttc gtagtcgctc tgaacttgcg tttctgctta    190140
     cagcgtagcc ttagctcctt acgaagacgt gccagtcggt cacgaccaac gatgatgcca    190200
     ttctctgcca gctccgtctg gagccgccgg gttccatatg tttcgcgagt gcggatatgt    190260
     gccaccttaa tctccagttt tagccgctca tcactttgtt ttctgtctga gggttcatgc    190320
     tgtacccagt tgtaataacc gctcctggat acaccaaata cctgacacat cgcttcaatg    190380
     ggaaattgtt gtcgccattg ttcgattaac gcgtattttt cagcgactcc tgtgcaaaat    190440
     acgctgttgc tttttttaat atatctcgct caaggcgagc ttcatttaac gccttacgca    190500
     gttgcagaat ttcagattcc agttcagcca ccgtgcggga accaggagta ccgagccctt    190560
     ttctggcggc ggtaacccat tgtcctaaag tgccttcagg aagagataat cgggaagcgc    190620
     cttcactgat cgaaagttga ttttcaagaa ccgttctgac agcttcggct ttgaactctt    190680
     tagagtaacg ttgggttttt ctgctcatta ttagctcctt ctgatgccat tctatttcag    190740
     gaaggagtgt ccgttaaact caggctacct cacggaatat tcaggtctgc gcagcattca    190800
     acggcatcgt caaaactatc aaagcgcaga acttctgcgt cttcttcgtc aaaaaaatca    190860
     tcttcgtgaa gcttcacgac atagcgggga agtttgcttc tttgagaggc gggtttacgt    190920
     ttacggggtt tagctgaacg ggccatataa ccacctgaaa gacaatgaca ttgcctgttt    190980
     ttataacggt aattgcagac catgacaagc cgcagccgtc aggctgccta ctcgatcagc    191040
     ctgctgaagc ggcttaaagc gacataccgt cgggcgaaaa ccatcacgct gatcgtggac    191100
     aactacatta tccacaaaag ccgggaaaca cagagctggc tgaaggagaa cccgaagttc    191160
     acgtatagga aattgaaaaa ctaagcgata cccctgtccg cgccttatgc cacgtgagcc    191220
     tttctgtttt tccccaccac tccggtgttt tctctctctg catggtcgat tcttataccg    191280
     caacaggctg ttttttatac ttgcaccgat tcccgggcac acttagcctg tgtcaggccg    191340
     gcatatacct cagcagactg atatcccgcg cgtttttctt cagcccctcc acattcagcc    191400
     ccgcaatggc ccggcggtat accatccggc cgccacacag cacgcattcg aacgggtcac    191460
     gactcaggaa ctgtttcacc atttgtacat agcacacttt cgccactggt tccggtttat    191520
     ccatccccag agcacggtac acctgcggca gcttctctcc acacacccgg ttggcaagga    191580
     acccgaagta cctcaccatc ttaaaaaact tctccgggat gtgctgtttc agcctcgcga    191640
     ccagctcacg ctgtgtcagc gtttccgtcg ccgtttctcc cgttttgtgg tccaggtaac    191700
     ggaagctcag gctcgcccct ccgttgtaat gtgccagccg ggaggccgct atcggcggct    191760
     tcttcagata acgacccagg tagcgcgccg tattcctccc gccggccgtt tttttcgaca    191820
     tgtacacatg ccagtatttt cctccggctt tcagcaccag gcttctccac tgtgattccg    191880
     tcgtgatatg tgacaacgac tccggcatcg ccagcccctc tgaccacgct ttcagaagcc    191940
     gttgccgcat attccacatc caccgcgaac gcatcgcgtc tttcaggaag ctcagctttt    192000
     tccactgacc atgcttattc agacatccac aggttacaga cacatgtaca tgcggatgcc    192060
     agttgagacg acggccatac gtgtggatgg cgcagaagat accgggttcc tgcccccgtt    192120
     tccgggcggc atacagcaga ttctccaccg ccagacggca cacgtcattc agcagccacc    192180
     ggttgctttc gaacaccggc cacagcgtgt ccggcagggt gaagaccaga tgtacccagt    192240
     cgcagtcagg aagacgattc agctgtgtcg ctatccacag gtctgtggcc ttttttccgc    192300
     aggacgggca ggcacggctg ccgcatgagt tagtgacgta tctgacgtgg gggcactcag    192360
     gtttatcgca gttgtattcc ttcacgccca gtatccgcgt gccgcaggcc agcatttttg    192420
     tgacagcctc aacctcgata tcgcgcagac cgcccgcatc caggaaggac gtccagcact    192480
     ggttggctgt gaacaggcgt ttcagcggtc ggggctgaaa atcaccacca cttcgggtca    192540
     tccgccttca tctccgcttc tgtttcgtat aaatcaaaac gacggcaggt atggcagaac    192600
     gtgacgtatt cgtacggtga atccgggtac attttgtgga aggtttccca gaaacagacc    192660
     gtgcaggagg gatgaccggt gataaagtct gcaaatacgg actgataagg gtgattattg    192720
     gctctggcga cggctttcag aacctctttc accattctgg tgtggacttt ctggtgctcc    192780
     aggttgtgtg acatgggaac tcattctgga tggttactct gaaagctcat attctgccac    192840
     accccgattt gcagccgcca ggctgccgtg gttcagggtc atttatcagc cggtttactc    192900
     gccatgggtg aaccatgttg aacggctatg gcaggcactt cacgacacaa taacgcgtaa    192960
     tcatcagtgc agctcaatgt ggcaactgtt gaaaaaagtt cgccatttta tggaaaccgt    193020
     cagcccattc cccggaggca aacatgggct ggcaaaagtg tagcggtatt aagcgcagct    193080
     atttagcctc acagaattta caaacatact gttatcattt tgaaggcaga tttggtctta    193140
     tacaggcatt gctttataat ctgcactcca aattctgcgg gctatccgcc ggtttgcagc    193200
     agggaagtgt gggactgtat atgtctcttc acacggagtg ttctcgatta tgtcctctaa    193260
     tcccagatat cacttgttgt atcgcagttg gctatatcct gtttctgcgc agcgctttgg    193320
     gagctgaaac tcaagggcgg tagcgtactt ttttgtcagg cttattcttc atttttattt    193380
     ttaacccatt gataaataat ggattggttt catgtcaaaa gcatctgaac cacaacagac    193440
     cccttatctg atcccgcaag gggtctatcc aacttatatg ccaaaagcag aggatgaaat    193500
     cgatcttttc gagcttttag gcaccttgtg gaagaaaaaa tgggttattt tatgtgtcac    193560
     gttgctgact acggggttag cagcagtgta tgcctttacc gcaaaagagc agtggacggc    193620
     taaaacctat attcaagcac cacgtattgc tgaattaggc agctatctta aatttcacca    193680
     agcgtatgcc cgaatattaa atcaaccgtt agatacgaat gcgttggcta atggattgtt    193740
     ttccgatttg attttgattg ctgaatcgcc agacaccaaa gttaaatttc tagagagtac    193800
     tgagtattat aaaaaggaaa caaataattt atctactgaa caagataaga aaatttggtt    193860
     agctgagcaa gcgaataaag gtcttgtgat tacgccacca aaggaaaagg gaaatacaag    193920
     ttactacata atacaagcat cggcagactc agcgcaagag gcatataaac tactgcaggg    193980
     atatctaaag aatgttaata atcaagctgt aacattaagt cttgatgagt ttggtcaaaa    194040
     tgttaatact cttttggtta atctaaataa agaaattatt gacatagatt tccagagaaa    194100
     atcagaaaag cttgatcaaa tagctcatat tcagcgagat ttaacaactg cggaacaagc    194160
     cggaatcatt gattatcgct ctagcaaagg cggcttcgat aatgcgcaaa gtagctataa    194220
     gttcttgctc ggcgaaaaac tgttatcagc agagctaaaa gcaactaaag atgcgccaat    194280
     tatttaccca tttagatatt acgaagtgaa acgtcaaatt gatgagttag aaggaatgtt    194340
     acgcgataac attcaggcgc aagcatatcg atatcaaatg aagccatctg agccagttat    194400
     aaaagacaaa cccaacaaag cattaatttt gattcttggt gcattaccag gggcaatgtt    194460
     tgctatagtt ggtacattag tttatgcgac attaaaagat aaaaccaagt tagattaaac    194520
     tgggttacgt attgttgtgt caatgcgaaa tagatgttct atgtgcactt tatgatggat    194580
     aagaaaatga aattcgatac tttgaatgcg aaaattggga ttataggcct tggttatgtt    194640
     ggattgcctc ttgctgttga gtttggaaag aaagtaacga cgattggatt tgatattaat    194700
     aagtctcgta ttgatgaatt acgaaatggt cacgatagta cattagagtg ctcaaattta    194760
     gagttgttag aagcaactaa attgacgtac gcctgttcat tagatgcact aaaagagtgt    194820
     aatgtattta ttgtaactgt tccaactcca attgataaac ataaacagcc agatctaaca    194880
     cctctaatta aagcatctga aacattgggt aagataataa agaaaggcga tgttattatt    194940
     tatgagtcaa cagtttaccc tggagcgaca gaagaagatt gtataccagt tgtagagaaa    195000
     gtatcaggtc ttaagtttaa tattgatttt tttgccggtt attcacctga gcgtattaat    195060
     cctggggata aagagcatcg tgtaactaat atccttaagg tgaccagtgg atctacaccg    195120
     gatgttgctg agtatgtaga tcagctatat aaattaataa ttactgtcgg tacgcataaa    195180
     gcatcatcga taaaagtagc agaggctgca aaagtaattg aaaacacgca gcgagatgtc    195240
     aatattgcat tgattaatga gttatctatt atatttaata agttagggat tgatacctta    195300
     gaggttcttg aggctgcagg tacgaagtgg aattttttac cttttaggcc cggtttagta    195360
     ggtggccact gtataggtgt agatccttat tatcttacac ataaagcgca aagtgtcggc    195420
     tatcatccgg agatgatttt agccggacgt cgtttaaatg atagtatggg gcagtatgtc    195480
     gtttcccagt tagtcaaaaa aatgttgaaa caacggattc aagttgaagg ggcgaatgtg    195540
     ttagtgatgg ggcttacatt taaagagaat tgcccagatc tacgaaacac taaagtgatt    195600
     gatattattt cagagttaaa agaatacaat atcaatatag atattataga tccatggtgt    195660
     tctaccgatg aggcacaaca tgaatatgga ttaactttat gtgaagatcc taaagttaat    195720
     cattatgatg caataattat cgctgttgca cacaatgagt ttcgcgagat gggagagagc    195780
     gctattcgtg cattaggtaa agacgagcac gttttgttcg atttaaaata tgtgcttgat    195840
     aaaaaaagta tcgatatgcg cttgtaagag tgattaaaaa aatcaaatcc tctttgatat    195900
     gatacacctc agcattttat gctaggttta gcacttgatt aatatacatg gatatttata    195960
     tgtctcgcta tgaagagatt acacagcagt taattttttc accgaaaact tggttaatta    196020
     ctggtgtcgc tggctttata ggatcaaatc ttttagaaaa gttacttaaa ttaaaccagg    196080
     ttgttattgg gttagataac ttttccacgg gacatcaata taatcttgat gaagttaaaa    196140
     cattagtttc cactgaacag tggagtcgat tttgctttat agaaggtgat attcgagatc    196200
     tcactacctg tgagcaagtt atgaaaggtg ttgatcatgt cttacatcag gctgcgctag    196260
     gttctgtacc tcgttcaatt gttgatccta taacaaccaa tgcaactaat attactggat    196320
     ttttgaatat cttacatgcg gctaaaaatg cacaagtaca aagttttact tatgctgcat    196380
     caagctcaac ttatggagat catcccgcac taccaaaagt agaggaaaac attggtaatc    196440
     cactttctcc ttatgcagtt actaaatatg ttaacgagat ttatgctcag gtatatgctc    196500
     gaacatatgg ttttaaaact attggattac gttattttaa tgtatttggt cgtcgtcaag    196560
     atcctaatgg agcttatgct gcagtaattc caaaatggac agcagcaatg cttaaaggtg    196620
     atgacgtata tattaatggc gatggtgaaa cgagtcgtga tttttgttat atagataatg    196680
     ttatacaaat gaatatatta tctgcattag cgaaggacag tgctaaagat aatatatata    196740
     atgttgcagt tggtgataga acaacgttaa atgaattatc tggttacatt tatgatgagc    196800
     ttaatttaat tcaccatatc gataaattga gcattaagta tagagagttt agatctggag    196860
     atgttaggca ttctcaggct gatgttacta aggctataga tttactaaag tatagaccaa    196920
     atataaaaat cagagaggga ttacgacttt caatgccgtg gtatgtgaga tttttaaaag    196980
     gctaaattat attaacatga ataaataatc tatttcacct ctgttattaa tgcaggggtg    197040
     aaaatccatg tatttattct aaatggtcag tgtatgttta gaaaaatgat tgatgcaggt    197100
     ggtacatttt tacttaaagc aatatttcaa ataggagttt ttgtttattt cacacatgtg    197160
     tcagatatta ctacatttgg tattattagt tatgtgttta ctgtttattg gtttgtgctt    197220
     aacttctctg attatggatt tagaacaaaa ttagtgaaag atatttctga taatagttat    197280
     tctgcatcag aattattatc aagaagtgat ggagttaaaa catatgtttt tttcttcatt    197340
     tttataatct tcatgtttta ttcttatgtt tctgattcaa tttcattaac tctgcttgtt    197400
     tatatttcat ctgcatattt tgtttgtatt tcaagtggta gatttagctt gctacaggct    197460
     gttggtcggt ttagatgtga attatatata aatatctact caacaattat atatattggg    197520
     tgtaatttat ttttatctct gtttatcgaa cctctatatt atagtgcgat atcaatattc    197580
     atatactcaa tttcgctttt ggttttctca tcacataaat gcaatgtgcc atgttttcat    197640
     ataaaaagac caagtatttt agtttataaa gattttttgg atgcaactcc gttcgctatt    197700
     ctggtgttac taaatgttgt tttatctagt attgaccttt ttatattaaa agaatatttc    197760
     tcttataata gtgttgctat atatcaggtg gtaactaggg ttaataccgg tctaataata    197820
     gtgtttaatg ttatttatac tgttttattg ccttcatttt cttattatct gaaaaattct    197880
     gaatggggta atataaggaa attacaacga tatatatcac tgttagtctt attactatgt    197940
     ttatgctatt atttttttgg catctatttc gtagggatat tgtttggtga tgagtataag    198000
     gtaatatctt ctgcaacatt tttgataatg tttatggctc ttattaaata taatttttgg    198060
     ctaataaatg aactttatct tgtgtgtagt ggaaatcaaa gcgagcgagt taaatcgtat    198120
     tgtattggtg tggtcatttc aatggcggtt ttcttttatt ttatacctcg gtatggatgg    198180
     agtggggcgg tttttggaag tgccattgca acattagtaa ttggaatatt ttatattatt    198240
     tctgtgaaaa aagattgtgg gaaaattctt catgataagt attcactaat gatgatcttt    198300
     gtcccaattt tcttttattt tattattaat ggtcagcagc ggttgttata ttaatatgtt    198360
     gtggttttat atcgttccat taatatgttt agactcgatt ggaagcctaa taaaggttaa    198420
     gtatgttaat atacctatat cctgtacttt tgttatttaa tatccttccg gttttttttt    198480
     atggacaaat gaactctgat ttagagcgtt tttttggagt tcctattggc tatattccag    198540
     atctaatatt ttatttcttt gttgttttaa catctataat aacgttgagg tttcacgttt    198600
     ctctgtggac aaagaaatta ttatttttag gcatcatatt cctgatttat atcagcattc    198660
     agatgttgtt gttatcagcg gatatatcag gtgtcgtaat tttattatcg tttttttcta    198720
     attttatagc tttggttctt ttggtgtcat tttgcattgg taaagatgag ctttatttaa    198780
     ctcattcggt tagaaatata aatgttgtaa tgtgttttgg tattatctgt ggagttgtaa    198840
     aattatttat tggttattct gaagatagta attttatagt ttatttaaat agaaatgcca    198900
     ccgcaattat agtagtgtgc ttttattgtg tatattcata cttttatcgt ggtcgaaagt    198960
     cttggtatgt ctcatctgta ttgtactctc tgttctttct ttttctggat agccgagcag    199020
     gaataatatc atttgctata tcgttgtttt ttgtttttct tcagttaaca aagaaggaaa    199080
     agttattaat atcattgttt tttgttcctc ttctaacttt aggtatttct tttactgata    199140
     taggcactcg tcttgaacga atgctgtctt cgtcacaggt tatattctct ggtggtaaca    199200
     ctcttacaaa aagtcagaat gattatcgtc gagttgagtt agtatttatt ggggttgatg    199260
     ttttaaaaga aaattattta attggcactg gattaggtgt tgcaaattat gtaaaggcta    199320
     tagataaaaa gtttttagga agtaccaact ttgggttggc gcataatttt tatttatctt    199380
     attcggctca gttagggatt attggtttta ttttgcttat ttctgtattt tatataatgc    199440
     tgtctccaat ttttaaatgc ggagggtata ttggtaaagg atgcgttttt gctttggctt    199500
     tctatgtctt ttttaatgag tatatattga cgccagcgat atatatttat atttctattt    199560
     ttttatcggt ggtttttata cgtaattcta aatagctgcg cggaatagta gatcactttg    199620
     agggaactta gcccggattg tgcgatctga tcaatcgcca aatcaaaaca aatcaccaac    199680
     cggactgagc aatgccgatc atagcaccaa tttcccgtga cgaacgacgc ctgatgcaga    199740
     aagccatcca taaaacacac gataaaaatt atgcccgcag actgactgcc atgctgatgc    199800
     tgcaccgggg cgaccgtgtc agcgacgttg ccagaacgct ctgctgcgcc cgttcctctg    199860
     ttggacgctg gattaactgg ttcacgcagt cgggtgttga gggactgaaa tcattacctg    199920
     ccgggcgtgc ccgtcgctgg ccgtttgagc atatctgcac actgttacgt gagctggtaa    199980
     aacattctcc cggcgacttt ggctaccagc gttcacgctg gagtacagaa ctgctggcaa    200040
     taaaaatcaa tgagataacc ggttgccagt taaatgccgg aaccgttcgc cgctggttgc    200100
     cgtctgcggg gattgtgtgg cgaagggctg cgccaactct gcgtatccgt gacccgcata    200160
     aagatgaaaa gatggcagca atccataaag cactggacga atgcagcgca gagcatccgg    200220
     tcttttatga agatgaagtg gatatccatc ttaatcccaa aatcggtgcg gactggcaac    200280
     tgcgcggaca gcaaaaacgg gtggtcacgc cgggacagaa tgaaaaatat tatctggccg    200340
     gagcgctgca cagcgggaca ggtaaagtca gctgtgtggg cggcaacagc aaaagttcgg    200400
     cgctgttcat cagcctgctg aagcggctta aagcgacata ccgtcgggcg aaaaccatca    200460
     cgctgatcgt ggacaactac attatccaca aaagccggga aacacagagc tggctgaagg    200520
     agaacccgaa gttcagggtc atttatcagc cggtttactc gccatggatg aatcatgttg    200580
     aacggctatg gcaggcactt cacgacacaa taacgcgtaa tcatcagtgc agctcaatgt    200640
     ggcaactgtt gaaaaaagtt cgccatttta tggaaaccgt cagcccattc cccggaggca    200700
     aacatgggct ggcaaaagtg tagcggtatt aagcgcagct atttaggatg agaatatgtt    200760
     gttagaatat gttgaaagaa aaatttcctt agccttgagt aagtatccta aggtaaggga    200820
     tgttattaag ttcttttatt tatatatcgc atcattattc ggaattattt tgaataaaaa    200880
     taagacggtt attcaatcaa aaatatacga gatttcaatt gatgattctg aagaatcatt    200940
     ttttggctat tatgaccata gtccaatgag ctctaatggg cggtacgtat tgttccactc    201000
     tagtgcgttt agcactaaac gacatccaaa gaaagttaag tatatatcta tttgcgtaaa    201060
     agaccttctt aataacaaag tttataagct atatgatacg cgagcattta attggcagca    201120
     gggaagccga ttaatgtgga ttgatgatga caatataatt tttaatgact atgaaaataa    201180
     tggatacatt agtgttgtct attctttgtc tttgatgaag gttataaaaa aaataaacta    201240
     tccgatttat gatgtgaata attacaaggc tgtgacgtta gatttctcat ggctggctaa    201300
     atatgatagc gattatggtt attataataa aaaatcattt tctacagata tttcaatcat    201360
     taatttgaat acggggggaa tagaattatt tttatcctta gacgaaatgc taaagagaac    201420
     taattttaaa tgtaatattg atgttgaaca tgtggtcaat cattttatgt ttgctcccga    201480
     tggacgttcc gttatgttca tacatcgata ctatacacct aaaggaaagc gtgaaaggtt    201540
     aatacattgg aatttaataa atgataatgt tcgagtccta ataaatgaat cgattattag    201600
     tcattgttgt tggaatggga atgatgaaat tataggtttt tttggtgcag aaatagattc    201660
     gctaaattat tatagattgt caattgaatc ctgtaataca gagaaattgt tttttgatgc    201720
     aagaaaatat tctgatggac atcctactat agttcataat agatatatta tatctgatac    201780
     ttacccagat aaaaatagaa ttaaaaagtt gtttgtttat gaccttgtca aaaatgatta    201840
     tcgcgagctt ggattatttt atgagtcaat gagttttttt tcttattctc gatgtgactt    201900
     acatccaagg atctcggttg ataatagatt tttgtttgtt gattcagttc actcagggaa    201960
     aagaaaacta tattttatga ggagtggtat ttgtgagtga tgttctagta tctttaatta    202020
     tagtttgctt taatgcagag aagtatattg aaaaatctct tttggcattt attaatcaag    202080
     atgttggatt agataaattt gaattgatta ttgtagatgg ggattcatct gataatacaa    202140
     tatctattgt tcaggatgtt ttttctaaac atagcaacat taagcataaa attatcaata    202200
     ataaaaaaag aactcttgct acgggttgga atattggggt gctagaagct aatggtaagt    202260
     ttgtgtgtag agttgatgca catagtgata ttccaaataa ctatatatct aaattattag    202320
     atgattattt taatattatg cagtttgatg atagcgttgt tggtgttgga ggtgtattaa    202380
     ctaattctta taaaactaag tttggttcaa ttgtagcgga tttttatgca tcgaaatttg    202440
     gtgttggtaa ttctccattt aggtgcgtag acaaaaataa tcgactaaaa aaaacagata    202500
     cagctgtctt tgctttatat aataaagatg tgttttttga tgttggactt tttaatgaag    202560
     tattagatag aaatcaagat attgattttc ataagagagt tttaagcaat aatttgtcat    202620
     tatatacaga taatagttta tttgttgagt attatgttag agataatttt aaagatttca    202680
     taaagaaagg ttttcttgat ggtttttggg ttgttatgtc tggagcatat tattttagac    202740
     atatagtgcc actttttttt gttttgtatt taattgtatc tttttctctt ttctttgcta    202800
     ctggtgatta tatatattta tcttttttat ttttttattt tcttatttct attttgtttt    202860
     caattcgaga tgggcgaagt tttataggta gagtatttct tccttttata tttttgtctt    202920
     atcatatttc ttatggatgt ggatcgttat tatctttttt gaaaaggtat tttaaatgaa    202980
     aaattttatt ccttttgcgt tacctgaaat tggcgaagaa gaaattgcag aggtaattga    203040
     ctctttacgt tcaggttgga ttacgacagg tcctaaggct aagcaatttg aacaagaatt    203100
     ttctaattac ctaggagcga acgttcaatc attagctgtt aactctgcta cgtcgggctt    203160
     acatttggct cttgaagctg ttggcgtaaa gccgggagac caagttattg tcccatcata    203220
     tacattcact gctactgccg aaattgtcag gtaccttggt gctgatcctg taattgttga    203280
     tgtagatcgt aaaacattta atatatcagt tgatgccatt gagaaggcta ttactaatga    203340
     aacaaaggcg attattccag tacacttcgc tggattagct tgtgacatgg attcaatctt    203400
     atcaattgct aaaaaatatg acctaaaggt tgtcgaggat gccgctcatg catttcctac    203460
     aacatataaa ggaagtaaga taggaacgct tgattcagat gctacggttt ttagcttcta    203520
     cgccaataaa actatgacaa ccggtgaagg cggaatggtt gtttcaaaaa ataaagatat    203580
     aattgagcgt tgtaaggtaa tgcgtttaca tggaatcagt cgtgacgctt ttgaccggta    203640
     ccagtctaaa actccttctt ggttttatga ggttgtagct ccagggttta aatacaatat    203700
     gcctgatatc tgtgcggcaa tcggtattca tcaacttaga aagatcgatg attttcagaa    203760
     aaaacgtcaa cgaatggcaa aaatttacga tgatgcgtta aaagaattgc cacttgaatt    203820
     gcctgaatgg cctactaatg ctagtgatat tcatgcttgg catctatatc ctatccgctt    203880
     aaaaactgat tcggctatta atcgcgatga ttttattaag aagttatcag atcttggaat    203940
     tggttgttct gtccatttta taccgttgca taagcaaccg gtttggcgtg atacatataa    204000
     tttgaacgcc agtgactttc cagtttctga ggagtgttat ttaaatgaaa tatctattcc    204060
     tctttatact aaaatgacgg atcaagatca gttgttcgtt atcaaatcga ttagacaatt    204120
     atttatgtaa tggtatttta tattaaatga aacgtatttt tgatgttatc gtggcaggct    204180
     taggcctgct ttttctattt cctgttttta tcattgtgtc aatgttaatt gttgctgatt    204240
     ctaaaggggg ggtttttttt aggcagtata gagttgggag atttgggaaa gattttagga    204300
     tacataaatt tagaacgatg tttatcgatt cagaaaaaaa aggacggata acagttggtc    204360
     aagatgctcg ggtaaccaga gttggatggt atttacggaa gtacaaaatc gatgagcttc    204420
     ctcaattgat agatgttctt tctggaacaa tgagtttggt tggcccaaga ccggaagtga    204480
     gggagtttat tgatgagtat cctgatgata taagggaaaa agttttatcg gttaggccag    204540
     ggataactga cttagcatct atagaaatgg tagatgaaaa tgagattttg tctagttatg    204600
     atgacccacg tagggcttat atagatataa ttcttccaat caagcaaaga tattatttag    204660
     attatgttgc taacaattca gtaaagtatg attgtgtgat aatttggaaa actattatta    204720
     agattttgtc gcgataataa ggtagtgtag gatgattgat agaatattgg agctgccaag    204780
     aattgttaag agaggtatca tcatctgcat tgatgtagtt atggtgatat tctcattttg    204840
     gttgtcttat tggttgaggc ttgatgagca aacggctttt cttagtgcac cgatgtggtt    204900
     tgctgcagct attcttacca tatttaccgt gtttatattt atcaggattg ggctttatcg    204960
     ggcagtctta cggtatgtta gtgcaaagat aatgttgcta ataccagttg gtattctggc    205020
     ctcaacgtta tctcttgtcg ttatatcata ttcgctatcc ataatgttgc cgcgcactgt    205080
     tgtcggaatt tattttttgg ttttactttt actgacatca ggctctagat tgctttttag    205140
     aatgatactt aactatggag ttaagggtag tgcgcctgtt ttgatttatg gcgctggtga    205200
     atctggccga caattattgc cagcattaat gcaggcaaaa gaatattttc ctgtggcatt    205260
     tgtggatgat aatcctcgct tgcataaggc tgtcattcat ggtgtaacag tttatccctc    205320
     ggataaactg agttaccttg tagatcgcta tggtataaag aaaattcttt tggcgatgcc    205380
     gagcgtcagt aagtcacaaa ggcagaaagt gattactcgt ttagagcatc taccgtgtga    205440
     agttctctct attccgggta tggtcgattt agtcgaaggt cgagcacaaa tcagtaatct    205500
     aaaaaaagta tcgattgatg acttactagg tcgtgatccg gttgctcctg atgccaaatt    205560
     gatggccgaa aacattactg gcaaagccgt tatggtcact ggggcgggag gctcgatcgg    205620
     ctctgagctt tgtcgtcaaa ttgttcgata taagccggcc aaattggttc tatttgaact    205680
     gtctgaatat gccctctacg ctattgagaa agagctctcg gcgctgtgtg acaaagaagt    205740
     tttgaatgtt ccagtgatcc ctctgttggg ctcggtgcag cgtcagaatc gcttacagat    205800
     ggtgatgaag tcctttggta ttcaaacggt ttatcatgcg gccgcttata aacatgtgcc    205860
     tctggttgag cataatgtgg tggaaggggt acgtaataac gtgtttggta ccttgtactg    205920
     cgctgagtca gcgatcgaaa gtggcgttga aacttttgtg ttgatttcca ccgataaagc    205980
     ggtgcgcccg accaacacta tggggacaac taagcgtctg gccgaattgg tattgcaggc    206040
     tttgtctgca cggcaaagcc aaactcgctt ttgtatggtg cgatttggta atgtactcgg    206100
     ttcttcgggc tctgtcgtgc cgttgtttga aaaacagatt gcccaaggtg ggccagttac    206160
     cttgactcat cgtgacatta ttcgctattt catgacaatt ccggaagcat cacagttggt    206220
     gattcaagcg ggggcgatgg ggcatggcgg cgatgtcttt gtcttagaca tgggcgatcc    206280
     ggtcaagatt tatgacttag ccaaacgcat gatccggtta agtggcttga gtgtacggga    206340
     tgataaaaat ccagatggcg atattgccat tgaagttacg ggattacgtc caggtgagaa    206400
     actgtatgaa gaattactga ttggtgattc agttcaaggt acctctcatc cacgaattat    206460
     gacggccaac gaagtgatgc taccgtggca ggatctatcg ctcttactta aagagctgga    206520
     tcaagcttgt catgactttg atcatgagcg aattcgcagt ttgttgttac aagcaccagc    206580
     ggcattcaat ccaactgatg atatttgcga tctagtttgg cagcagaaaa aatcgctgtt    206640
     atcacaagcg agcaatgtca ttcgcctgtg attgcttagg tttaaccttc cacaccaatt    206700
     cttcacctct cttacaaatc cccgctaggc ggtacatcgt gaccgccttt accctgatgc    206760
     ctgctcttta acaaacagga catcagtgta tgtttaaacc ttttagcgcc gaatttttcg    206820
     gcactttctg gctggttctg ggtggctgtg gtagcgcctt gatctctgct gctttcccac    206880
     agttaggtat aggctttttg ggcgtggcgt tggcgtttgg tctgacagta gtcaccatgg    206940
     cttatgcggt cgggcacatc tctggtgcgc attttaaccc cgcggtgacc ttgggtctgt    207000
     gggccggtgg acgcttccca gcagcgcgcg tgttacctta cattatcgct caggttatcg    207060
     gcggtattgc cgctgcggca gtgctgtatg gtatcgccag cggtaaggct gggtttgatg    207120
     cgacaaccag cggttttgcg gctaatggtt atggcctcca ttcacctggc ggctatgcgt    207180
     taagcgcctg tatgctgagc gagtttgtcc tcagtgcgtt ttttgtccgg agcgacagaa    207240
     aaacgcgctc ctgcgggctt tgcgccactg gcgattggtc tggtaatcac cccgtaaatt    207300
     aaccagcgtc aaaagtagaa ttttctcgta ccataaacgc aggagattct ttatgaaaac    207360
     atcaaaattt accgacagcc aaatcatggc gatcctcaaa tgaaccgccc cgggaatcct    207420
     ggagactaaa cttcctgaga aagaggtaaa caggatgact aaaaatactc gtttttcccc    207480
     cgaagtccgt caacgggcag tccgtatggt tctggaaagt cagggcgaat atgactcaca    207540
     atgggcgaca atttgttcca ttgctccaaa gattggctgt acgccggaga ctctgcgtgt    207600
     ccgggttcgc cagcatgagc gggataccgg gggcggtgat ggagggctca ccaccgctga    207660
     acgtcagcgt ctgaaagagc tggagcgtga aaatcgtgaa ctgcgccgca gtaacgatat    207720
     ccttcgccaa gcttccgctt attttgcgaa ggcggagttc gaccgcctct ggaaaaaatg    207780
     atgccactgc tggataagct gcgtgagcag tacggggtcg gaccgctatg cagcgaactg    207840
     catattgccc cgtcaacgta ttagggattt gaagcccaac cgtacgaaaa cgtacgctaa    207900
     gttcatttct tgaacaacct ggctgactct atgtatttgt acagcgttgg cctcgatatc    207960
     cccatcaaca cacaaatctg cgcaactgta tgttttttct cgttatagag ttgaacagca    208020
     agggcctgtt tatccttact cagtgttttc ggcctgccgc ccttacgtcc tctggctcgt    208080
     gctgcttgaa gcccgacctg agttctctct cttgtcaggt tgcgttcatc gataggaatt    208140
     aaaaccccaa aaagattaaa aaaacaccac aaaacggatg tttcttcaac accacttttg    208200
     ctccatatga acggaaccga cgattaaact ggatggctct gattgattca gggtatgaat    208260
     ggcggttttt tgctccgttt ccctcaaaat ggacgcaact tcccctctgc ggctctcagc    208320
     cgcaccaccg catccgggcc agcagctcat gcatcaggac ctgctctgcc agacggtagc    208380
     cccgcttcag ccccgtaaaa cgcatctgac tcccgcacag cacgcacttc agcgggtcaa    208440
     ccttcagtaa cctctgatac atccctctcc aggtgatttg catcgccgtt tttctcactg    208500
     tctccgttat gatgtacacc acttcttcca gtaaccgccg tttcgccgga ctcaaaaaac    208560
     cgtagtacct caccatacgg aaccccttat ccgccacatg ccaggagaac ctttccatga    208620
     actcatctcc actcatcaac aggtattctt cccgttttgt tcggtgactg ttgtaacgca    208680
     gaccgatttc atcctgaccg gcataatgct ccagacgact catcggcact ggtggctttt    208740
     tcaggtaaga gccaaagtac accgccacat gggtggcatt atccatcacc cgggatacgt    208800
     tgacattcca gccacggcgg taatgcgtgt ccaggaagcg attccattcc cgtttactgc    208860
     ttccttctgc tgccagcgca tccggcatca ccaggtcagg gtatttccgt gacagcaacc    208920
     gtgttatccg gtagcgccac atgctcatca ccttacgggc gtaaaaatga agatttttcc    208980
     aggtgtggcc cgacgtcaca ccaccggcag ttgtcgataa atggatatgc ggatgccact    209040
     gctggtcacg cccccatgtg tggatcaccg tgaatatccc cggctccaca tctgcctgat    209100
     ggcagatttc cagtatcaca tccgctgcaa tgcggctcat ctctgtcagt aaccaccggt    209160
     tgtggaacac cagggaccag tactggcagg gaagtgtgaa cacaatatgc tgccacgggc    209220
     agtcggggac caggctcagc agatactgta tccactgtgc gccagccttc accccgcagt    209280
     gcgggcagga gcggctttta caccggaagc agaccttttt tgtatggcaa cagtccggtg    209340
     atgaacagca ccactgtgta taccccatca gtgtggtccc gcacgccatg attttggtca    209400
     ccgactcaat caccaccgga cgtactgccc cttccggctg cttctccagc cagttaagcc    209460
     agcggtttcc ctgctgaaag atatcggcaa aacggggaag catcagaagg gcggggcgac    209520
     tccgtccggc cagtgaaccg tgccacactc cgggcagtac ataccgccgg cgctgatacc    209580
     ggaaagaatg gtcgcaaatt cccgctccgt gcagcgggcg atttccggat acccttcgtc    209640
     atcaacacgt acaaaccaga agaccagctt tttgtttccc gcatccacaa agaacggaat    209700
     attcaggtct gcgcagcatt caacggcatc gtcaaaacta tcaaagcgca gaacttctgc    209760
     gtcttcttcg tcaaaaaaat catcttcgtg aagcttcacg acatagcggg gaagtttgct    209820
     tctttgagag gcgggtttac gtttacgggg tttagctgaa cgggccatat aaccacctga    209880
     aagacaatga cattgcctgt ttttataacg gtaattgcag accatgacaa gccgcagccg    209940
     tcaggctgcc tactcggggg ttcatcgcag cagctacaga tactggaaaa accgtcctga    210000
     aaaaccagac ggcagacggg ctgtattacg cagtcaggta cttgagctac atggcatcag    210060
     ccacggttcg gccggagcaa gaagcatcgc cacaatggca acccggagag gctaccagat    210120
     gggacgctgg cttgctggca ggctcatgaa agagctgggg ctggtcagct gtcagcagcc    210180
     gactcaccgg tataaacgtg gtggtcatga acatgttgct atccctaact accttgaaag    210240
     gcagttcgcc gtgaccgagc caaatcaggt gtggtgcggt gatgtgacct atatctggac    210300
     gggtaagcgc tgggcgtacc tcgccgttgt tctcgacctg ttcgcaagaa aaccagtggg    210360
     ctgggccatg tcgttctcgc cggacagcag gctcaccatg aaagcgctgg aaatggcatg    210420
     ggaaacccgt ggtaagcccg gcggggtgat gttccacagc gatcagggca gtcattatac    210480
     gagcaggcag ttccggcagt tattgtggcg ataccagatc agacagagta tgagccggcg    210540
     cggaaactgc tgggataaca gcccaatgga acgcttcttc aggagtctga agaacgaatg    210600
     gatgccgatg gtgggttacg taagcttcag agaggcagct cacgccataa cggactatat    210660
     cgttggatat tacagcgcac taagaccgca cgaatataac ggtgggttac ccccaaacga    210720
     atcggaaaat cgatactgga aaaactctaa ctcggtggcc agtttttgtt gaccacttca    210780
     tacaattaat atacattaag taacaggcat tcgagccttg atttgagaaa gcctgtcatt    210840
     catttgtttt atgtagctat ctatttcctc tgatgcataa ctaaaaagtt ctcccatttc    210900
     acgagcaata ataatctcag atttaataga ctttaactct ggcgactcat ctcttaacac    210960
     ttgcataatc tctcttttta tatcatatag ttctataaac cgatttgccc gtagttctcc    211020
     ttggggagaa tcatttctga atacaacaat tatatacaaa aaatcactat tttctttagg    211080
     gaagatctta caactaatct ctgggagctc acataatgca tgtaagtcag gatggtacaa    211140
     actatccaca gaaaattgcc ccataggacg ttttccagat ataactgtca accagcttcc    211200
     ttccggtgta ctggcttcgt ctctggaaat aggctgaaaa tcttccggac atggagaata    211260
     cattgtcttc atataattaa gtcgtctgga tttctcatta ataaactcct ctatttttaa    211320
     ttgtgccata cttctggtta taccagagat atacttcttg ccatatatgt ttggtgattc    211380
     attaaagtaa ccatgttcaa ctctaggata aatatttctc actatatatt cagtatttgc    211440
     agtatttatt ggaaatacgt tcttaatatt cttgatggga ctaatcattt taatctctat    211500
     actcaaatat aaacattacc atgaacaata taattgttcc taagtggaat gtctccacgg    211560
     agaacacttt atctatcggg aaatagtgcg ggcaacagtg tttaattata tcgagtgcga    211620
     ttacaatcgc tggcgacggc accgttggtg tggcggcctc agtccggaac aatttgaaaa    211680
     ccagaacctc gcttaggcct gtgtccatat tacgtgggta ggctcacaga gcctcactta    211740
     cgactgcgtc catattatgt gggtaggatc aataaagacg ttttatatgt gtctgcttgc    211800
     agccagaaaa tttataccct gcaggtatca taaacatgct tgataactta attggggctc    211860
     cctcttcctt ttatggtgta attgtttgat tgaatacttc cggggatttc agtatgaaat    211920
     gaagtatatt taatatactt tacaaaaagt ttgtattagt ggaataagga caatagctta    211980
     tccaaactgc caagcctctt tattataagt aagatctggc actggaatat tctcaaaagg    212040
     actaacatca tcaccacgac cttcaaccaa ccattttatt gcatttaaat cccagaatag    212100
     ttcagtagtg gtcaatttgg gaaacgcaca atattgtacg gttacgttat cgcaatagag    212160
     tgaactcccg ccctatacgg cgttttcaag gattagtcct taatcggaca accacattaa    212220
     agcataataa ataattaagc tttaataata tactatagat acagttctat tataaaaaat    212280
     actattttag gtgatgcatt aaattagtag aatatttatt cttttataaa agcaccaatg    212340
     aattgtccaa gtaaacatga ggtaaaatgt gtagaggata actgagtttg gtcactttaa    212400
     ctgtattagt cgcagtctga ctctcgactt taaaaggatg ggaactacct gtactgatag    212460
     tgagaaagct ttccattgaa ataagtcaaa taaaagttga tggcttcagt gctaaagtga    212520
     ggtgcccgct agccgtattc actcgaatcg gaattcaatg tattgcttct gccatttcca    212580
     taatatttca cgggaaaaac aaaatctgaa aaactatact taagtgttgt attgagtcag    212640
     ttgagataca aatacatatt tatcagcaca cgttacgtca aatacaggag gttgtcatgt    212700
     tggtactgaa aggcacgttg gctattgcag ccgtgatgac aatttattgt cttatcgttg    212760
     ttcttatgga acgcttttct gattgatttc atattggcga gagaacaaga aggtgagtag    212820
     aattgtcgcg gaatcctgaa actatcagcc tcaggtatga acaccaaaag gtaggtagag    212880
     aaatctatgg cccccgttac tttattcgca caatgaggta ttttttttat ttttacaaaa    212940
     gttcaataaa tattataata aaagatatgt tcttggtaac ataaacaaat atttaattaa    213000
     aataatgctt ggcattgacg tttatcttat aaagtaagaa gatcatggac atttcaacca    213060
     aaaaagtaga gttctcgatg aaattaaaat tccttgtact tgcactttgt gtaccagcga    213120
     tctttactac acatgctacc actaactatc cacttttcat accggacaac atcagtacgg    213180
     atattagtct aggatctctg agtggcaaaa caaaagaacg cgtttatcat cccaaggaag    213240
     gggggagaaa aattagtcaa ctggactgga aatacagtaa tgcgactatt gttagaggtg    213300
     gcatcgattg gaagctaatt ccaaaagtgt ctttcggagt ttccggttgg actactttag    213360
     gtaaccagaa agcaagcatg gttgataaag actggaacaa ttccaatacc cctcaggtat    213420
     ggaccgacca gagctggcat cccaatacgc atctccgtga tgctaacgaa ttcgagctga    213480
     atcttaaagg ttggttatta aataatttgg attatcgact tggactaata gcaggttacc    213540
     aagagagtcg ttacagtttt aatgcaatgg gagggagtta tatttatagt gaaaacgggg    213600
     ggaacaggaa taaaaaaggg gcacatccta gtggtgaaag aacaatagat tacaaacagc    213660
     tcttcaaaat accttatatt ggattaactg ctaattaccg ccatgagaat tttgagtttg    213720
     gagcagaact gaaatatagt ggttgggttc gttcatctga tacagataaa cactatcaga    213780
     ctgagacaat ttttaaagat gaaataaaaa accaaaatta ctgctctgtt gctgcgaata    213840
     ttggatacta tgtcaccccc agtgcaaaat tttatataga aggctccaga aattacattt    213900
     ctaataaaaa aggtgataca tctctttatg agcaaagtac caatatatct ggcaccatta    213960
     aaaatagtgc aagtattgaa tatattggtt ttctcacttc cgcaggtata aagtatattt    214020
     tttgaattgg ttcaccgagt tgattacgtt ttcatggcta aaaattgccg cccattgtga    214080
     gtcatattcg ccctgacttt ccagaaccat acgaactgcc cgttgacgga cttcggggga    214140
     aaaacgtgta tttttagtca ttctgtttac ctctttctca gggcgtttag tctccaggat    214200
     ttccggggcg gttcaaaaaa ctcttcgttg attactgtgg acttactgtt ggcattaccg    214260
     accctgagac cggagaaata agaaccgctt agatcatcgt ggctgttctc ggggtatcaa    214320
     gttacacatg ggcagaggct acccaaggtc tactattatc gcctgaaagc gctgatggaa    214380
     cagtgctatc agggac                                                    214396
//

If you have problems or comments...

PBIL Back to PBIL home page