(data stored in ACNUC17686 zone)

EMBL: CP000048

ID   CP000048; SV 1; linear; genomic DNA; STD; PRO; 922307 BP.
XX
AC   CP000048;
XX
PR   Project:PRJNA29637;
XX
DT   09-MAY-2008 (Rel. 95, Created)
DT   13-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Borrelia hermsii DAH, complete genome.
XX
KW   .
XX
OS   Borrelia hermsii DAH
OC   Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borrelia.
XX
RN   [1]
RP   1-922307
RA   Porcella S.F., Raffel S.J., Schrumpf M.E., Montgomery B., Smith T.,
RA   Schwan T.G.;
RT   "The genome sequence of Borrelia hermsii and Borrelia turicatae:
RT   Comparative analysis of two agents of endemic N. America relapsing fever";
RL   Unpublished.
XX
RN   [2]
RP   1-922307
RA   Porcella S.F., Raffel S.J., Schrumpf M.E., Montgomery B., Smith T.,
RA   Schwan T.G.;
RT   ;
RL   Submitted (03-DEC-2004) to the INSDC.
RL   Laboratory of Human Bacterial Pathenogenesis, Rocky Mountain Laboratories,
RL   National Institutes of Allergy and Infectious Disease, National Institutes
RL   of Health, 903 S. 4th Street, Hamilton, MT 59840, USA
XX
DR   MD5; 951cb35805c9864d616c4aa8302de9cd.
DR   BioSample; SAMN02641559.
DR   EnsemblGenomes-Gn; BHR0001.
DR   EnsemblGenomes-Gn; BHR0002.
DR   EnsemblGenomes-Gn; BHT0001.
DR   EnsemblGenomes-Gn; BHT0002.
DR   EnsemblGenomes-Gn; BHT0003.
DR   EnsemblGenomes-Gn; BHT0004.
DR   EnsemblGenomes-Gn; BHT0005.
DR   EnsemblGenomes-Gn; BHT0006.
DR   EnsemblGenomes-Gn; BHT0007.
DR   EnsemblGenomes-Gn; BHT0008.
DR   EnsemblGenomes-Gn; BHT0009.
DR   EnsemblGenomes-Gn; BHT0010.
DR   EnsemblGenomes-Gn; BHT0011.
DR   EnsemblGenomes-Gn; BHT0012.
DR   EnsemblGenomes-Gn; BHT0013.
DR   EnsemblGenomes-Gn; BHT0014.
DR   EnsemblGenomes-Gn; BHT0015.
DR   EnsemblGenomes-Gn; BHT0016.
DR   EnsemblGenomes-Gn; BHT0017.
DR   EnsemblGenomes-Gn; BHT0018.
DR   EnsemblGenomes-Gn; BHT0019.
DR   EnsemblGenomes-Gn; BHT0020.
DR   EnsemblGenomes-Gn; BHT0021.
DR   EnsemblGenomes-Gn; BHT0022.
DR   EnsemblGenomes-Gn; BHT0023.
DR   EnsemblGenomes-Gn; BHT0024.
DR   EnsemblGenomes-Gn; BHT0025.
DR   EnsemblGenomes-Gn; BHT0026.
DR   EnsemblGenomes-Gn; BHT0027.
DR   EnsemblGenomes-Gn; BHT0028.
DR   EnsemblGenomes-Gn; BHT0029.
DR   EnsemblGenomes-Gn; BHT0030.
DR   EnsemblGenomes-Gn; BHT0031.
DR   EnsemblGenomes-Gn; BHT0032.
DR   EnsemblGenomes-Gn; EBG00001162698.
DR   EnsemblGenomes-Gn; EBG00001162699.
DR   EnsemblGenomes-Gn; EBG00001162700.
DR   EnsemblGenomes-Gn; EBG00001162701.
DR   EnsemblGenomes-Gn; EBG00001162702.
DR   EnsemblGenomes-Gn; EBG00001162703.
DR   EnsemblGenomes-Gn; EBG00001162704.
DR   EnsemblGenomes-Gn; EBG00001162705.
DR   EnsemblGenomes-Gn; EBG00001162706.
DR   EnsemblGenomes-Gn; EBG00001162707.
DR   EnsemblGenomes-Gn; EBG00001162708.
DR   EnsemblGenomes-Gn; EBG00001162709.
DR   EnsemblGenomes-Gn; EBG00001162710.
DR   EnsemblGenomes-Gn; EBG00001162711.
DR   EnsemblGenomes-Gn; EBG00001162712.
DR   EnsemblGenomes-Gn; EBG00001162713.
DR   EnsemblGenomes-Gn; EBG00001162714.
DR   EnsemblGenomes-Gn; EBG00001162715.
DR   EnsemblGenomes-Gn; EBG00001162716.
DR   EnsemblGenomes-Gn; EBG00001162717.
DR   EnsemblGenomes-Gn; EBG00001162718.
DR   EnsemblGenomes-Gn; EBG00001162719.
DR   EnsemblGenomes-Gn; EBG00001162720.
DR   EnsemblGenomes-Gn; EBG00001162721.
DR   EnsemblGenomes-Gn; EBG00001162722.
DR   EnsemblGenomes-Gn; EBG00001162723.
DR   EnsemblGenomes-Gn; EBG00001162724.
DR   EnsemblGenomes-Gn; EBG00001162725.
DR   EnsemblGenomes-Gn; EBG00001162726.
DR   EnsemblGenomes-Gn; EBG00001162727.
DR   EnsemblGenomes-Gn; EBG00001162728.
DR   EnsemblGenomes-Gn; EBG00001162729.
DR   EnsemblGenomes-Gn; EBG00001162730.
DR   EnsemblGenomes-Gn; EBG00001162731.
DR   EnsemblGenomes-Gn; EBG00001162732.
DR   EnsemblGenomes-Gn; EBG00001162733.
DR   EnsemblGenomes-Gn; EBG00001162734.
DR   EnsemblGenomes-Gn; EBG00001162735.
DR   EnsemblGenomes-Gn; EBG00001162736.
DR   EnsemblGenomes-Tr; BHR0001-1.
DR   EnsemblGenomes-Tr; BHR0002-1.
DR   EnsemblGenomes-Tr; BHT0001-1.
DR   EnsemblGenomes-Tr; BHT0002-1.
DR   EnsemblGenomes-Tr; BHT0003-1.
DR   EnsemblGenomes-Tr; BHT0004-1.
DR   EnsemblGenomes-Tr; BHT0005-1.
DR   EnsemblGenomes-Tr; BHT0006-1.
DR   EnsemblGenomes-Tr; BHT0007-1.
DR   EnsemblGenomes-Tr; BHT0008-1.
DR   EnsemblGenomes-Tr; BHT0009-1.
DR   EnsemblGenomes-Tr; BHT0010-1.
DR   EnsemblGenomes-Tr; BHT0011-1.
DR   EnsemblGenomes-Tr; BHT0012-1.
DR   EnsemblGenomes-Tr; BHT0013-1.
DR   EnsemblGenomes-Tr; BHT0014-1.
DR   EnsemblGenomes-Tr; BHT0015-1.
DR   EnsemblGenomes-Tr; BHT0016-1.
DR   EnsemblGenomes-Tr; BHT0017-1.
DR   EnsemblGenomes-Tr; BHT0018-1.
DR   EnsemblGenomes-Tr; BHT0019-1.
DR   EnsemblGenomes-Tr; BHT0020-1.
DR   EnsemblGenomes-Tr; BHT0021-1.
DR   EnsemblGenomes-Tr; BHT0022-1.
DR   EnsemblGenomes-Tr; BHT0023-1.
DR   EnsemblGenomes-Tr; BHT0024-1.
DR   EnsemblGenomes-Tr; BHT0025-1.
DR   EnsemblGenomes-Tr; BHT0026-1.
DR   EnsemblGenomes-Tr; BHT0027-1.
DR   EnsemblGenomes-Tr; BHT0028-1.
DR   EnsemblGenomes-Tr; BHT0029-1.
DR   EnsemblGenomes-Tr; BHT0030-1.
DR   EnsemblGenomes-Tr; BHT0031-1.
DR   EnsemblGenomes-Tr; BHT0032-1.
DR   EnsemblGenomes-Tr; EBT00001751434.
DR   EnsemblGenomes-Tr; EBT00001751435.
DR   EnsemblGenomes-Tr; EBT00001751436.
DR   EnsemblGenomes-Tr; EBT00001751437.
DR   EnsemblGenomes-Tr; EBT00001751438.
DR   EnsemblGenomes-Tr; EBT00001751439.
DR   EnsemblGenomes-Tr; EBT00001751440.
DR   EnsemblGenomes-Tr; EBT00001751441.
DR   EnsemblGenomes-Tr; EBT00001751442.
DR   EnsemblGenomes-Tr; EBT00001751443.
DR   EnsemblGenomes-Tr; EBT00001751444.
DR   EnsemblGenomes-Tr; EBT00001751445.
DR   EnsemblGenomes-Tr; EBT00001751446.
DR   EnsemblGenomes-Tr; EBT00001751447.
DR   EnsemblGenomes-Tr; EBT00001751448.
DR   EnsemblGenomes-Tr; EBT00001751449.
DR   EnsemblGenomes-Tr; EBT00001751450.
DR   EnsemblGenomes-Tr; EBT00001751451.
DR   EnsemblGenomes-Tr; EBT00001751452.
DR   EnsemblGenomes-Tr; EBT00001751453.
DR   EnsemblGenomes-Tr; EBT00001751454.
DR   EnsemblGenomes-Tr; EBT00001751455.
DR   EnsemblGenomes-Tr; EBT00001751456.
DR   EnsemblGenomes-Tr; EBT00001751457.
DR   EnsemblGenomes-Tr; EBT00001751458.
DR   EnsemblGenomes-Tr; EBT00001751459.
DR   EnsemblGenomes-Tr; EBT00001751460.
DR   EnsemblGenomes-Tr; EBT00001751461.
DR   EnsemblGenomes-Tr; EBT00001751462.
DR   EnsemblGenomes-Tr; EBT00001751463.
DR   EnsemblGenomes-Tr; EBT00001751464.
DR   EnsemblGenomes-Tr; EBT00001751465.
DR   EnsemblGenomes-Tr; EBT00001751466.
DR   EnsemblGenomes-Tr; EBT00001751467.
DR   EnsemblGenomes-Tr; EBT00001751468.
DR   EnsemblGenomes-Tr; EBT00001751469.
DR   EnsemblGenomes-Tr; EBT00001751470.
DR   EnsemblGenomes-Tr; EBT00001751471.
DR   EnsemblGenomes-Tr; EBT00001751472.
DR   EuropePMC; PMC2849321; 20147497.
DR   EuropePMC; PMC2991353; 21124792.
DR   EuropePMC; PMC3233084; 21965393.
DR   EuropePMC; PMC3347450; 22354035.
DR   EuropePMC; PMC3719565; 23716615.
DR   EuropePMC; PMC3754566; 23749977.
DR   EuropePMC; PMC3772144; 24029760.
DR   EuropePMC; PMC3814808; 24205425.
DR   EuropePMC; PMC3833655; 24112474.
DR   EuropePMC; PMC3924360; 24526628.
DR   EuropePMC; PMC3974855; 24699793.
DR   EuropePMC; PMC4128717; 25111141.
DR   EuropePMC; PMC4157404; 25229054.
DR   EuropePMC; PMC4182126; 24813576.
DR   EuropePMC; PMC4470780; 25700888.
DR   EuropePMC; PMC4901232; 27284141.
DR   EuropePMC; PMC5606581; 29056727.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000048.
DR   SILVA-SSU; CP000048.
XX
CC   genome lacks 5' telomeric end.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..922307
FT                   /organism="Borrelia hermsii DAH"
FT                   /host="Homo sapiens"
FT                   /strain="DAH"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="blood of patient with relapsing fever"
FT                   /db_xref="taxon:314723"
FT   gene            <1..524
FT                   /locus_tag="BH0001"
FT   CDS_pept        <1..524
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /locus_tag="BH0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16527"
FT                   /protein_id="AAX16527.1"
FT                   /translation="PLHLLIIHTHAWGEKFNNGNLTNIKPLQIGIIQHNYINLTPYNQH
FT                   YKYYAFIGITMTYNEWIDFNIIPIHFYPHNPTLLSNVYFTLSISLYILKYQIHIHSFII
FT                   NILIGTQLPIALRAAIITGHNISAFLFPALPFASIKLNIPITNLFSIFSTFSSSLREYF
FT                   LIDLAITFPI"
FT   gene            complement(1046..2116)
FT                   /locus_tag="BH0002"
FT   CDS_pept        complement(1046..2116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16528"
FT                   /protein_id="AAX16528.1"
FT                   /translation="MIWYLGEVNGMFRFVLFGLLFSSLVLLGAIPEIDYDYFENDKFDL
FT                   VDIDEFLGRVDFKNILRERCLFIGIRNVTNPSAVQALSRDELNKIREKVNPLGIILFRE
FT                   NFKDARQTRELIEGVKKYLGPDILIAVDEEGGLVSRASENKKLGVYNFPAMEFVGRTGD
FT                   AQLAYKIGEILGKQLRRLGINLNMAPVADTKFAPDSPLGSRTFGYSSYNIGLMVEAFVD
FT                   GIQREGVFAVVKHFPGLGGTKVDTHKDLALLPYSKNFLMVNNFVPFLFGKEAKFIMIGH
FT                   VLVPKISGDVGSMSKDIVDIIRHNLNIFSIIMTDAYDMGAIVNNFSLEHATKKSLSSGV
FT                   DVVLIPEGFRAFNARE"
FT   gene            complement(2079..3533)
FT                   /locus_tag="BH0003"
FT   CDS_pept        complement(2079..3533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16529"
FT                   /protein_id="AAX16529.1"
FT                   /translation="MCEVIDKIFSKKMLDMLNMHKLKVLSKSFKNFPNESHSSILSLVD
FT                   HPVKLKFKKELVEHNLKKYIDDFTKFLFSSEGDFYVFTGDELERLGLLLYPYLSFGILN
FT                   GGSATSYFDILKNNDFNEELYLLYANKIFEAKESFGNLPKGIIPAYVNKDGSYGFSFLA
FT                   LKIRHLLMLSKRYYELYGKSIKPSIFQMTSFKTYELISSFLDNIFDDNLIEDLNCCGLQ
FT                   KTDIFTAIQPLVYCYKKLNDGQYEYFTYDNSGEETLLALPAGHGQNFKVLKDIYFKLYN
FT                   SGKRFVYIGNVDNIGFTVNLKTLAIMAITNSSAGFEFSVKTPLDTKGGVLVLDDDNSLT
FT                   CVDIGSAISKETVLKAECSGNKILFNCATGLFNLEYLIENIGRIISDMPIRIIEQDKEF
FT                   GKYTAIEQITWEVVRMVDNPLIFEVNRGDRFLPAKLFVDTLIMSNYMNDKFADDLFDIA
FT                   KYLNNALNNALKNKYDLVFRRGKWDV"
FT   gene            3680..5467
FT                   /locus_tag="BH0004"
FT   CDS_pept        3680..5467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0004"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BH0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16530"
FT                   /protein_id="AAX16530.1"
FT                   /translation="MLKNYILNMTNLRNAINKMILSPSGFRKIFAKSKDENSTDHEIND
FT                   DDKILIALITLTISNYFKDKPKEYINVGLDSRSTGNIISEIVIKTLILNNDNVNFFGIL
FT                   PIPEILAYTKESQNSKGFIYISASHNPKGYNGIKTGLNDGGVLNSNEIKKIICQIRSNI
FT                   ENENLMNNLITNLQNFNNNALHLKTYEVIITSQDKHKTRSYNSYKSLMQQIIYPDKHNK
FT                   ENTNILKENIIKEPIGIIGEMNGSSRINSIDKEMIESLGIKLELHNTEIGIFKHGMTPE
FT                   GSSLNMCKQILEQKFKQDNSFQLGYVPDCDGDRGNLVAIFKKGQATMIAPQKIFALSVL
FT                   SELSYLYHSGIKDNLAVVVNDATSLNIEKIAMLFNTKVYRVEVGEANLTEMAGLLRNKG
FT                   LIVKIFGEGSNGGNITYPSKVRDPLATLFSIIKLLKIKNIYKIWCALSNNSYNEHYTIN
FT                   DILKTINFYSNVEVSSEKAMLKINVENQEILKSNYEKLLKKEFNNNTVLHKLPIHNYEI
FT                   INYEGINQNISRTGDSSGGLKVLFKNNKQEIIASLWMRGSKTEPIFRVLSEVKSEHNAL
FT                   LYPLLDFHKHLIHTANSLA"
FT   gene            complement(5527..6585)
FT                   /locus_tag="BH0005"
FT   CDS_pept        complement(5527..6585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0005"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BH0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16531"
FT                   /protein_id="AAX16531.1"
FT                   /translation="MQKKVMLTGDRPTGSLHLGHYVGSIVNRLKYQEEYETYIIIADLH
FT                   TLTTKPDLKSISEIPVNVREMVLDYLACGINPEKVNIYLQSAIPELLELNLILSMIVMV
FT                   NRLQRIPSIKDMSVAAGLSEVPYGLLGYPVLMSSDILMAKANLVPVGRDNEAHVELTRE
FT                   LARKFNYLYGENFFPIPEAIFTDSQALVGIDGKAKMSKSLGNAIFLSDDEKLLRKKVMS
FT                   MFTDPKRVRADIPGKVDGNPVFIYHDLFNSNIDELCELKTRYKKGTVGDVEVKERLFEV
FT                   LNQFLMPIRERREFFKVKKGYIDEVIFEGTNKTRKVAVEVIKNAKNLMGISKMWNGVRR
FT                   HAENILKSNLNT"
FT   gene            complement(6588..7667)
FT                   /locus_tag="BH0006"
FT   CDS_pept        complement(6588..7667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0006"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16532"
FT                   /protein_id="AAX16532.1"
FT                   /translation="MPLELKPTDRLKFVKLQSVFYVIALIIMLIAILKIAQTVFKPLAI
FT                   AVVLGFLVYPIYTFLKKLKIPRVLIVFVIFFVLFLFSYLVFSFVYYSVTILIEQLPYYQ
FT                   KQLIFIMVDILEKYKLDSAIISNIDFSKYIYPFLTRISNEIIGFASSLVVLFLLLYFLL
FT                   SEIHIFAIKVKNAFRASVSSMFIEALSTINNQISKYLGIKVFVSFLTGFLVFIGLKLFG
FT                   QDFPRVWAVLTFVFNFIPSIGSILAVFFIVIAALVQFYPNLDLVLYIFIYNTFVQMLIG
FT                   NILEPKMQGHRLDLSPFLLLCFLFFWGWLWGIVGLLIAYPFTVIIKVIVDNIECLKPFS
FT                   VFLSGSKILSVDNVGNKES"
FT   gene            complement(7771..8634)
FT                   /locus_tag="BH0007"
FT   CDS_pept        complement(7771..8634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16533"
FT                   /protein_id="AAX16533.1"
FT                   /translation="MFMGKKEKIIALIFDFDDTLIYGNMQQVLFDEYNVDASLFWDEVE
FT                   NLFITYNKNYCNLIANEMIYLSHFLTYVREGIFKGLNNKVLFELGSKLKFFEGVIDLFK
FT                   EISEINRNLKESDTVINIYIVSSGFRQMILGSSIAPYVTKVWACEFIDTYLMPYYQNLD
FT                   NKFSENSILSSVCYFVDHTIKTRVIFELNKGSYDKINERIPKSRREIPFKNMFYIADGF
FT                   NDIPAFEILNNNLNHYKNTLTVYYGNDENAKRLVKERRVGDLAEANYHKGTKLYNWIME
FT                   KIHLNI"
FT   gene            8739..9515
FT                   /locus_tag="BH0008"
FT   CDS_pept        8739..9515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0008"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16534"
FT                   /protein_id="AAX16534.1"
FT                   /translation="MIMIDIGSINQIKDIFSRVLDVSLISVLVYYIYKNVINSYSVNLL
FT                   KGMIIITSIGIVSYYFNLYTINWLLNYIANILPIAMLILFNQEIKKIIMQIGNFNLSFK
FT                   IANNKEETTKTIAEIIKAIKHLSENKSGSLICIEKKIQLEQIINKGIKLDSIISNEILI
FT                   SIFDYETPLHDGAVIISNNKIIYAGSFLPLSNVESISKTFGTRHRAGLGISESSDAITI
FT                   ITSEETGSISLTQNGKLEYNLSLNEIKKKLNLALIE"
FT   gene            9519..10514
FT                   /locus_tag="BH0009"
FT   CDS_pept        9519..10514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16535"
FT                   /protein_id="AAX16535.1"
FT                   /translation="MIITKKLIRIMKLLFEDWHNKAISILIAIIMFTTFYFNSIESITI
FT                   EKKFNILLEDEVTLGKMPDINKILLTVKINKKDLKYLDLDRIALLVEANNIKEAGEYEL
FT                   PIKIKNFNPIPIVEYKLSKNKIVLTLDKKISKLVKVEPKFKLLEKEGKGEYFIAKYNIV
FT                   PEKLTIHGPEKVIKTINSIKTKIKEFDISTVFISEHLEVISPDPLITLDKNHVIVNITL
FT                   GKKYIQTTIKNPNLIFNNLKDGLEIKNQEKILDPENETFIKIRSGLSEKIIKMHIANKD
FT                   INLTLDLSQIEIPGIYNVNTDIILKNNTHGIEVYEYEPKTIRVEIISTEQ"
FT   gene            10516..10893
FT                   /locus_tag="BH0010"
FT   CDS_pept        10516..10893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0010"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:BH0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16536"
FT                   /db_xref="GOA:B2S1J9"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1J9"
FT                   /protein_id="AAX16536.1"
FT                   /translation="MTKSIGCDIIKVTRFNSFLQNRKKLDRFFTQREIENLEMKGKGIL
FT                   ESLAGKFSAKEALIKALSPLINTKIKYSLKDIEIIALPKGNIIFQLHNDIKVLIEQMDL
FT                   KLYLTISHEREYAIAFVIVED"
FT   gene            10897..11745
FT                   /locus_tag="BH0011"
FT   CDS_pept        10897..11745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16537"
FT                   /protein_id="AAX16537.1"
FT                   /translation="MSKISYFTKYEIECPLCKYKFRKEELLTGSGRLISGELKVDLKRE
FT                   YIKNEKYGNIYPRIYSITVCPNCYLAAFPNEFNAIEVVNNKIKQLLIGSTDERKEIKSI
FT                   FKDNLNFDEPRRLQEGAASYILAIMCYEHLDKNHNPTLNQAKCAIRSAWVFEDLDKEHP
FT                   NQNYNYLQKIFYHKAAYLYKLTIEKEQDNSEPINAETVFGPDTDKNYGYDSVLYLSSLL
FT                   EYFYGNKEDKQYRYNQLADIKTLLSKIAGMGKSSKEKPSILLDKIKEVYFKISNEIKTF
FT                   K"
FT   gene            11746..12483
FT                   /locus_tag="BH0012"
FT   CDS_pept        11746..12483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0012"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BH0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16538"
FT                   /db_xref="GOA:B2S1K1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1K1"
FT                   /protein_id="AAX16538.1"
FT                   /translation="MKKILAEIAYDGSLYYGFQIQPTKPTIQGEIEKALEKISKTKVKV
FT                   HSAGRTDKGVHARGQIISFYIRINIKLKNLKTAINSLLRKDIRIIKLKYVADEFQPRFN
FT                   AKRRKYSYYILNNENHYPWEGYQAYYVKKKLNINRLNEMAKMLIGIHDFTTFSCIKDQT
FT                   NSKLKKIYFARFKKKNKLIIFEIIGSSFLWKMVRSIVGTIIDIEIKNEPVYTFKKILNS
FT                   KNRKFTRTTAPAKALFLDKVFYE"
FT   gene            12476..13054
FT                   /locus_tag="BH0013"
FT   CDS_pept        12476..13054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16539"
FT                   /protein_id="AAX16539.1"
FT                   /translation="MNKSKLLKKLILLKILENNISGNIYSKQEELKKLKNKIIKSRNIE
FT                   ILKHTEQKDIKENNSLTKSIEYKINKNDKKDLLIVYIDKKYLNQNTEIIVKKWCESINI
FT                   FNYKIIDNSNALTLEIKNQQPKAILACEEVELFLNQNLRIQIVRGFELNFKGIPIVFTY
FT                   LPTSQVTNPELKKEIWQDLKIIKGIIKYG"
FT   gene            13047..15023
FT                   /locus_tag="BH0014"
FT   CDS_pept        13047..15023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0014"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:BH0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16540"
FT                   /protein_id="AAX16540.1"
FT                   /translation="MVDSLENNFYYEIAFNIPINRLFFYKYKSKLKTGIRVITNFNGKD
FT                   TIGIIIKRYAKEELKEDFTFKIKDILKVIDESAIIIEHNINLARWISQKTFSGFGETLF
FT                   CGLPKIATSNKGIKNNDNENLNSKLPIQLNEEQNNIYKEIIASNTQNTYYLFGVPGSGK
FT                   TEIFIKLCENYLEQEKQIIFLIPEISLGYQIIKRIKSNLSTNKVYEYNSKVSNSNKALI
FT                   WNKVKNRESLIIIGVKSALMLPFTNLGLIVMDEEHEYTYKSENTPRFHSRHIGFFLQST
FT                   FNAKFIMGSATPSLEAYLAMENNQIKKMILKNKFFERTFKELKIIDMKKERQLISSELL
FT                   YSIQKSLLDKRQALIFINKRGYSKTLECKICGYIICCPNCSFNLTYHKNENKLICHYCS
FT                   YKTNIISNCPDCNSQDIIYKTYGIQFIEKELKKFLPNARIARTDSDLNKKEIIQSINAF
FT                   ENGQLDILIGTQIIAKGFNFKEIKTLGIINADIGMGLPDFRSSERIFAIISQVLGRAAR
FT                   FQSDNTIIIQTKNPDYYAIKYAYEGKYEEFYKEEIKIRKELNYPPFKKIIRIVVRSHKQ
FT                   DAAKHKCLEFFEISKKLLNDEIEYLGPSKAPMSKISKYYRYNIIYLSKSFNLLEKLIRN
FT                   TKEKVKLTRDTYIEIDYYPISLL"
FT   gene            complement(15020..15640)
FT                   /locus_tag="BH0015"
FT   CDS_pept        complement(15020..15640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0015"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:BH0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16541"
FT                   /db_xref="GOA:B2S1K4"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1K4"
FT                   /protein_id="AAX16541.1"
FT                   /translation="MVKIIGIAGGSGSGKTTIVNKISEVIPEFVLISQDNYYKSVGDYE
FT                   YEFLDVNFDHPDAFDNNLFYKQLKKIKENKLIHMPLYDFINHRRKDETVEIVPTPVVIV
FT                   EGIMIFVEERVRNLIDLKIYIDTPNDIRFIRRLERDMSKRGRTLESVIEQYLSTTRAGY
FT                   YRFIEPTKEYADLIIPEGGHNDKALYVLSSFLRTLGKEGADFF"
FT   gene            complement(15633..16022)
FT                   /locus_tag="BH0016"
FT   CDS_pept        complement(15633..16022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0016"
FT                   /product="rhodanese-related sulfurtransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BH0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16542"
FT                   /protein_id="AAX16542.1"
FT                   /translation="MIVSYIKLICLIVFLFFYIWFFIILKMKRTNVALLEKIKNGAKIL
FT                   DIRSPKEYNKSHYAKAINIPFKNLFAKKDKLGSVETQIIIYGKSFNKSFEAEKILKGLG
FT                   FKNVFVAGTLKNMPKLPRAKEEVNG"
FT   gene            16151..17116
FT                   /locus_tag="BH0017"
FT   CDS_pept        16151..17116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0017"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16543"
FT                   /protein_id="AAX16543.1"
FT                   /translation="MKKKRNKWTRIKQKIKFFVLKILRKQLKNTLKDPKLILISTLQIT
FT                   TGSLLMAISTNILYIPHGLLSGGIAGIALMLHYLLRFNLGLTIFILNIPLFIIGIKFLN
FT                   ITFVIQSWIAMALYSLMVNYSQFLQYKMQMNDMILVSILAGLISGLGLGLIFKAKGSSG
FT                   GTDIISMIIKEKYSISIGTTNFLFNLAVLLIAAAFFNIEIALYTLIASFVTAIMTDKTS
FT                   TGFGNQKAILIISDKGKEISYLITNKLKVAATLLDGKGAWAGNDKTIVFIVVPTMRMSR
FT                   IKYISQKVDPNCFITVLNTNEITGGKKIIEPITNKNDIAT"
FT   gene            complement(17113..18093)
FT                   /locus_tag="BH0018"
FT   CDS_pept        complement(17113..18093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0018"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BH0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16544"
FT                   /protein_id="AAX16544.1"
FT                   /translation="MKKLQKEFIVRKDSQRLDIYLSENLCFFTRSQIKKREVKAFKYND
FT                   GVFVSIKLSKPVFVDDRILIEFNEEVNLKEYVAPLNLPISILYEDINVIVVDKPQGILS
FT                   HPGISNLDNTVVNFLLHHISSLRDSFQEDKIRPGIVHRLDKETSGVMICAKNLTTLNFL
FT                   SKQFKERFVKKVYVAVVKGNFKIDSGIIETFIDRDRYDRKRFSVYANRGKRALTEYKVL
FT                   ANMGNYSLVALKPKTGRTHQLRVHMKHLNHPILGDSIYTRLDKVFKEMSLMLHAFKLEI
FT                   NIEEGSLKKFISAFPQRFIDFLSIFYDKETLGLLVNDFIVFLDKF"
FT   gene            complement(18094..18600)
FT                   /locus_tag="BH0019"
FT   CDS_pept        complement(18094..18600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16545"
FT                   /protein_id="AAX16545.1"
FT                   /translation="MMIRFLLLFFNVFILYSNPLDYSKFDFEYLNLNYKFSLRDNISSS
FT                   ENNINFGNEVFVRLESDDDFLYEDIQENENLNVEKTINSNWGRKVFRFSAISIGAFPIA
FT                   LFIGLFCFDLSYYFNDNMYRKDFPYPFSSGLELSKEETFKKFVISTSAGLAISLIIAFI
FT                   DCLIY"
FT   gene            complement(18608..20272)
FT                   /locus_tag="BH0020"
FT   CDS_pept        complement(18608..20272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0020"
FT                   /product="pyrophosphate--fructose 6-phosphate
FT                   1-phosphotransferase"
FT                   /EC_number="2.7.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:BH0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16546"
FT                   /protein_id="AAX16546.1"
FT                   /translation="MMSVFQKERYKYTPKLPKILENDFQNIGVVLGEKTEALGDRDALR
FT                   EIFKNTYGLPVVNFTQGSSNVDFTKVLNVGVVLSGGPAPGGHNVVAGIFDAIKKSNQNS
FT                   KIFGFKGGPSGLLEDKKIEITQDLIDSYRNTGGFDIVSSGRTKIETDAQYDQVLSVVLK
FT                   NNLNALIVIGGDDSNTNAALLAEFFKKKHHDIQVIGVPKTIDADLRNEHIQISFGFDSA
FT                   TKTYSEMIGNLCRDAMSTRKYWHFVKLMGRSASHVALECALKTHPNICIISEEILAKNK
FT                   TLSELVRDITSVVVKRSLKGYDFGVIIVPEGVIEFIPEVKSLMIELCNIFDSNEGEFKG
FT                   LDVDAIRKIFISKLSGYMREVYVSLPLFIQIELVNSVLERDPHGNFNVSRVPTEKLFME
FT                   MVNVRLEELRKLGEYSGKFVPIDHFFGYEGRSVAPSNFDSDYCYSLGYNAVLLVLNGLT
FT                   GYMSSIKNLNKNATEWLAGGVPLTMMMNMEERYGISKPVIKKALVDLTGAPFNEFVKNR
FT                   EEWAVNNLYVFPGPIQYFGVSELVDEITLTLKLELEN"
FT   gene            complement(20351..21397)
FT                   /locus_tag="BH0021"
FT   CDS_pept        complement(20351..21397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0021"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16547"
FT                   /protein_id="AAX16547.1"
FT                   /translation="MNRMDTKEFYFDLPHNLIAQYPSEKRGLSRLMVLDSGKQKIYHND
FT                   SINDIFKYIDSNTFLVFNDSRVRKSRIYAKTDHGGSVEVLILDRLTGDTFTSLISKAKK
FT                   QSIGRVYTLPQGLLAQIISKSGNEFTLKFNKCVDESYFEQHGLIPLPPYIKRNYDREDE
FT                   DRYRTIYSKYIGSSASATAGLHFSEELFSKLDEKNIEYDFITLHVGLGTFLPVRTKTIE
FT                   EHKMHFESFSIKDSVALRLEEAKALGKKILAVGTTTLRALESAYYKQRGLIRGDQKTNL
FT                   FIYPGKGYEFKFIDMLFTNFHTPESTLLMLVSSFGGKDFVFTAYREAVKMNYKFFSYGD
FT                   ATLFLNHI"
FT   gene            complement(21363..22421)
FT                   /locus_tag="BH0022"
FT   CDS_pept        complement(21363..22421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0022"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16548"
FT                   /db_xref="GOA:B2S1L1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1L1"
FT                   /protein_id="AAX16548.1"
FT                   /translation="MNLEEGSKLLNSDKNFLYDRNESELRPKFLRDFAGQSHIKENLSV
FT                   FIKASRDRNEALDHVFLSGPPGLGKTTLASIIAVEMNTTIKVTSAPALDKPKDIVGILT
FT                   TLDDKSILFIDEMHRLKPVIEEMLYIAMEDYKIDWIIGQGPAARTVRMSIPKFTLIGAT
FT                   TKPGKVASPLYARFGIVSRFELYSEDELVKIIQRNSIILNVKFEDKAAWLLAKSSRGTP
FT                   RVANRLLRRMRDFAQVGGYDLITENIVSDGLEMLKIDHEGLDEQDRNILRSLILKFKGG
FT                   PVGVETLAISVGETADSLEDFYEPYLILKGLIERTSRGRKATDFAYCHLNLNKNNHNDL
FT                   GSEQDGYQGILF"
FT   gene            complement(22473..23063)
FT                   /locus_tag="BH0023"
FT   CDS_pept        complement(22473..23063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0023"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16549"
FT                   /db_xref="GOA:B2S1L2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1L2"
FT                   /protein_id="AAX16549.1"
FT                   /translation="MINKIYGKIIEKRESSIVIVALPFEFEVLVSSFCNAELRLLEDVE
FT                   ILTYLHLREDEIKLFGFLNVSEREVFEELISVDGIGPRAALRMLSGMKYDEFRDAIERE
FT                   DVKRISTVKGIGNKVAGKIFLKLRGKLVKADELTSSVFKFKDLEQSIVNMGFDRKLVVA
FT                   AIKEIMLIDEFLMLREVEQEQFLFRETLKRLSG"
FT   gene            complement(23676..24407)
FT                   /locus_tag="BH0025"
FT   CDS_pept        complement(23676..24407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0025"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16550"
FT                   /db_xref="GOA:B2S1L3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1L3"
FT                   /protein_id="AAX16550.1"
FT                   /translation="MSGHSKWSTIKRKKGALDAKRNKIFTKLIREISIAAKMGGGDIDS
FT                   NPRLRLAINKARVSNMPKDNIEKAIKKGIGDNTGAEYFELTYEAYALHGVALIIKCLTD
FT                   NKNRTASEVRSVLSKNGASLGAPGSVSYMFHKKGLISYSLDKYPEDEIMELALEAGAED
FT                   IYSEGSQIEVITSAETFEAISSVLRTKFEEDIAEIALLPENKISLNKEQIDKVLSLIEK
FT                   LEDFDDVQEVVHNLEIIDEID"
FT   gene            complement(24408..25313)
FT                   /locus_tag="BH0026"
FT   CDS_pept        complement(24408..25313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0026"
FT                   /product="methylenetetrahydrofolate dehydrogenase (NADP+)"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16551"
FT                   /protein_id="AAX16551.1"
FT                   /translation="MNNVFDGKLFANQYYLLLKEFLIHHDLGNKISLKVILANDNPASK
FT                   LYVAVKERVSREIGINFYVIKLAEHSGQDNILQLIESENVNEDTDGIIVQLPLSNEIDV
FT                   NMVLNSIVSTKDVDGLSAINLGKLILGDRKGFIPCTALAVLKVLFDKGIKISGKTVVVV
FT                   GRSSLVGRPLSILLSCKPYDATVITCHSKSINLDLYVKQADIIISAVGKPKLIDASMIV
FT                   GHPYVIDIGISRVDVDGNDVLVGDVDFESIKENVKFITPVVGGIGPVTVLMLMFNTIKA
FT                   HLIRHNKFDVLEKLVKLVEV"
FT   gene            25475..26110
FT                   /locus_tag="BH0027"
FT   CDS_pept        25475..26110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16552"
FT                   /protein_id="AAX16552.1"
FT                   /translation="MKKNLLIVLTLLFLLHTNVKRIEAYSIDRKGNSVMEVDLSLGIPL
FT                   FYNDLSSVSSSNLYPGGIGALKYRYHILSNLAIGLELRYLFNFDINHSFNLLNPDSGIG
FT                   KTFSTVPITFLTTYVFDIGELLQIPIFSNIGFSLSSYGDKSDSISNLRTFDTMPVISIG
FT                   SGILWNFNYQWALGITTAWWTMFEFGNSAKTGHFLLISLSVIVNINKL"
FT   gene            26117..27148
FT                   /locus_tag="BH0028"
FT   CDS_pept        26117..27148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16553"
FT                   /protein_id="AAX16553.1"
FT                   /translation="MNKKDFTKFIMIILTLSVLSCSSESIFSQLSKLQKINSNNNILDS
FT                   SSPSGISLVNDTLYIAAMHLFKKENGNIERVNFSNSYEFVIDLVNISGKTYLLVQNKNG
FT                   QLELYSLEGNNWKLQFQKNLIPIKFLKSIGKNNIASAYILALGENGNQIILNINGNDQT
FT                   PNGTTNNDKFYQISNNNNLITGRFAKIWQLNGGGVINVNSTNEIMAIIETSIRGFQETL
FT                   LLTGREHDTPDNKFKIYSSKNNYKDPIFNRDGIGEFIAYFAREVNGTILIGSNNGFVEL
FT                   IKDKDTFALQPPSQSVLPGSYNGSQLSKTRLNDIIPISNETIYILTQGKGLWKIENKKL
FT                   TKE"
FT   gene            complement(27134..27565)
FT                   /locus_tag="BH0029"
FT   CDS_pept        complement(27134..27565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16554"
FT                   /protein_id="AAX16554.1"
FT                   /translation="MLNKIFVDADSCNLEIIKFLQNFVLNRNADLILVANRHLSLKMSK
FT                   NTSVKVVSDVDSFILELVDKNSMVVTRDILFVKNLLDLQIKVMNDEGQVFDTNNINYLY
FT                   FRSRLNINLGIKVKKYFHEEVNRVRYSNFAMNFHRLFFS"
FT   gene            complement(27555..28190)
FT                   /locus_tag="BH0030"
FT   CDS_pept        complement(27555..28190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16555"
FT                   /protein_id="AAX16555.1"
FT                   /translation="MATYLTFEQRLLRKKRRQKLSKIVLLFLILNYVFTKFVLQIFTFQ
FT                   GDEMLPLITKNNSLIFVSKYMRSFFVPLKVDDIVLYEDLSLRGNFILNFFRDSFFLNKI
FT                   FNTKSYKIARIAATQGDIVYVKGFDVLIHRKANNSYYLNGNLMSGYRLNDFFNFNEVIK
FT                   CFVLKKNEFFLLNENLKILNDSRVFGPVKQSRILSFLALRIMDYKIVK"
FT   gene            complement(28193..29173)
FT                   /locus_tag="BH0031"
FT   CDS_pept        complement(28193..29173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0031"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:BH0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16556"
FT                   /protein_id="AAX16556.1"
FT                   /translation="MYLERLDRFANFLVEIIERYLTYRKKRKYFYKLKAKRRGFMLNFV
FT                   LELLGASIFVLGINQYFLQAYRIPSGSMENTLQIGDLLFVDKFSYGPELLPGVFKIDGI
FT                   KEPDEAEIVIFENVEYKSKGLFFDILHRLLYMLTFSFIDLDRDENGNPSVRFLVKRALF
FT                   ADGKLVRFRNGTVFVKKEGEESFTEENSYKAALGYNFGIKKLIEDSDYKVYDNLAMFIA
FT                   LNQLSVNLENISDFSFFNVREVDRFEVERLEYRYLVAFMPYVDYYMEKAIMRDYGIYVP
FT                   YGYVLPVGDNRDNSYDGRFFGVIDKNKILGKAFFMYFPFSRIGFI"
FT   gene            29357..30826
FT                   /locus_tag="BH0032"
FT   CDS_pept        29357..30826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16557"
FT                   /protein_id="AAX16557.1"
FT                   /translation="MLKENDGLDINEESLTVKLKPILGITPKIYVLFTIIILPLILVFS
FT                   LILNAKLNNPGAYLKVKTNINNAHVYIDEKYIGRTPFQKYVNATKGTLKIQRFGFETYE
FT                   KKIDIQNRLFTSYKFNIDLKLRDPSKIITQRQKELSVMTKIKNTSDNIKLIPVFSLIVN
FT                   DLQNNPEYIKKFFKTSIPYIHSNTMFKDFFIAYKNIYSTNNNSNKEIWESLQQNFNLDN
FT                   RSIIWFFENLDKEQQKQISNETWFKTLIEKLKNENKILNFESQTIDLYLKNFKKITSQN
FT                   IESIQNYKLYSQDLTLKTTYKLKEFLIQNKNVTKAEYQDFLNENPKWALNNKDNLIKEE
FT                   LVDEGYLKTFKQMSSNEDITHISYHAAIEYAKWYSSNLPKGFKARLPISQEWELYQREV
FT                   PKAIENLNINEISKKVGFWNLMQNPSFNESILFQDENDIYSASSHFNSLITEIRTYNYN
FT                   NSSKLKPSTKASFLKYWSSPNIGFRLVIEKE"
FT   gene            30829..31278
FT                   /locus_tag="BH0033"
FT   CDS_pept        30829..31278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0033"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16558"
FT                   /protein_id="AAX16558.1"
FT                   /translation="MNSLLLENKKARFNYFIEDKISCGIVLKGTEVKSIKLKKFSFNDS
FT                   FASIKKDEIWLENLHIAKYKEGNIFNHEEIRHRKLLITKKEIQKLKKFKEKEGYTLIPI
FT                   SIYLKNSLIKVELGICKGKKLFDKREILKQKSIKKDLSREIKQYK"
FT   gene            complement(31415..31945)
FT                   /locus_tag="BH0034"
FT   CDS_pept        complement(31415..31945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16559"
FT                   /protein_id="AAX16559.1"
FT                   /translation="MFFMKKVLILMIIVFCTVVGFAQSYDEMASSSVEKMLLYEAYKKD
FT                   PLIPFLLNCFVGFGIGSLAQGDITGGLLILGFDALGLGLLSYGAYSMVNSISASDGDKT
FT                   SVVALSLVVLGGVTMTLTRLVEVILPFTHASSYNRRLQENLGITLGGFQPEVDMSFDED
FT                   ARFMFELSFIKRY"
FT   gene            complement(32023..33906)
FT                   /locus_tag="BH0035"
FT   CDS_pept        complement(32023..33906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16560"
FT                   /protein_id="AAX16560.1"
FT                   /translation="MDIKTLLKDNFLQYSSYVIKDRAIASVIDGFKPVQRRIIHSLFEM
FT                   NDGNFHKVANVVGNAMKYHPHGDTSIYEALVNMANKDLFIEKQGNFGNLLTGDPASASR
FT                   YIECRLTPLAFDVLYSKEITSYEPSYDGRNNEPLIFPAKIPVILIQGSEGIAVGMAAKI
FT                   LPHNFNEILSAVKSELLGESYELYPDFPTGGIVDVNEYADGNGKVLVRARIEPTDDNKA
FT                   ILIKELPFGETTESLIASIERAIRKNYIKVSSINDFTTENVEIELTLPRGVYASEVIEK
FT                   LYHYTNCQVSISVNLLLLSERYPVIYTITDIIKFHAEHLQKVLKMELELEKSKILEKIF
FT                   SKTLEQIFIEKKIYKILETISKESDVVGIVLSEILKYKDSLSRDIVLDDIENLLKIPIR
FT                   KISMFDIDKNNKDIRTLSKELRSVESNIRSIRGYSINFVDKLLAKYSKIYHRKTEISLI
FT                   KSKNVREIATKNMKVYLNLKAGFVGTSLIDGEFIGNASYYDKILIFKKNSYILKNIEDK
FT                   TFIDKNNVNALIYDINNSKDQVFSIIYLSKTDNFYYVKRFKIDKFITDKVYKFLNDGDE
FT                   FVDLALNPGFVEFSNSRDVVKMINIDDFMIKSRISVGKRIASSTIKKVKFK"
FT   gene            complement(33906..35702)
FT                   /locus_tag="BH0036"
FT   CDS_pept        complement(33906..35702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16561"
FT                   /protein_id="AAX16561.1"
FT                   /translation="MKTNNYDESKIVTLSSLEHIRLRSGMYIGRLGDGSNIDDGIYILV
FT                   KEIIDNSIDEFIMGYGKEIVIKKEDNVISVRDYGRGIPLGKVVESVSVINTGAKYNDDV
FT                   FQFSVGLNGVGTKAVNALSSKFLVRSIREGNFFEAVFSKGNLINTTEGKSDEHDGTYIE
FT                   FLADTEIFGKYKYSEDFLRRRFFHYACLNKGLKINYNDQIFQSNNGLLDFINDEIKDED
FT                   LLYNFVYYSSKTLEFAFSHTNNYGETYFSFVNGQYTSDGGTHQTGFREGFARAINDFLK
FT                   KTYSSTDIREGLVATLSVKIKDPIFESQTKNKLGNIETRSNVAKEVQRVILEILYKDKT
FT                   LAKAIESKVVDNERLRKELSSVRREAKERAKRISFKIPKLKDCKFHFNEKSMHSGSTMI
FT                   FLTEGDSATGSMVSCRDVYTQAIFSLRGKPQNMFEKNKSEIYKNEELYNMMVALGIEES
FT                   IENLRYNKIVIATDADFDGFHIRNLLLTFFLTYFEDLVLNKHIYILETPLFRVRNKSST
FT                   IYCYSEEEKQKAIFELKNPEVTRFKGLGEISPSEFRSFIDVATIKLTKVDLVNIKEIKE
FT                   QLGFYMGPNTPERRNFIMENLI"
FT   gene            complement(35689..36462)
FT                   /locus_tag="BH0037"
FT   CDS_pept        complement(35689..36462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0037"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:BH0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16562"
FT                   /protein_id="AAX16562.1"
FT                   /translation="MKILRSIVAYINFFFFILIFTVLFPVFLIFKLFKFESHFIKFSFI
FT                   LVRFAIKSCLWFAGIKVVITKDNDCSFQKGGVLIMANHIASMDPLFLIYVFVKPFVIVA
FT                   KRSLLSIPLVNFLLISMGAIFINRNSIKSSAITQRKATKVIQEGGAIGIFPEGTRNRGK
FT                   DTRDFKRGSVNLALRTNSPIIPVTLLNTHKIFVKNLILNSGLSIYVHIHSLIDVSILTN
FT                   DEKERLHVIVRDKIVKKLEIMKIQYNIDRNLNEDK"
FT   gene            complement(36467..37918)
FT                   /locus_tag="BH0038"
FT   CDS_pept        complement(36467..37918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16563"
FT                   /protein_id="AAX16563.1"
FT                   /translation="MCFKKWIIFLFLLLFSCVKGNRDFIVFNKEIKKVSEINYSDVDVS
FT                   GDTGDDVFDSLIDLKGYKILSVHQENLNLDVYFEQVVLAQNFADLKTYLFIIGFDPKSH
FT                   EAVVLFKTQVDIDSKNSYNMYLEDITGDYDFDIVVQGFLNEDSVLYVFQRAVANNVASY
FT                   RPIFFDKVNGSIIINKYERSSAYDDKRSRESYSISLERYEKQGEDMVVSKIEKYEYSQL
FT                   QGKYYPLSASEKIRRIDNDVYKTLKHLPKDEVYKFLYGVWYDSDAHQRLGKSNFENVLF
FT                   LSFNRHLNEISIFKNNSQEIAHIEYISRPAYNTLNISTKSIFSDLIVYNFWIKIIDIDN
FT                   IEIKIDTGTDAYDKYGFSGVFKRFNDSVLVDDSEHSLFIPNGNYVYKDIIYDFSYPNLT
FT                   YIVGDNIYYGIFNVFSLNNNLVLEYEVSMDENKISAAFIIEHSERIVQKQKFSTIVLNP
FT                   IKILKDEVNLMKGQKLKLERIEKLG"
FT   gene            complement(37972..39480)
FT                   /locus_tag="BH0039"
FT   CDS_pept        complement(37972..39480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16564"
FT                   /protein_id="AAX16564.1"
FT                   /translation="MRKRVRDAKEIISKVDFNDKRVGLWGLLALILIVFGFIIAPLMPG
FT                   LFDTTDSSNLKFGSYKGQPIYYEKGNKLAQYVNSYSNFYSKLKKDNNLDIEYFIWNLAF
FT                   MKYVEDIAFLDLAKTNSFYVSKNILNKNLMNSPVYLDSSGNFSPKRYNKVSDYQKFKIH
FT                   SESVENLLSSNMQIFLSSSFILPDSIPNAIKSMSEARKNVAYVELSYQDFPKDEVSSYA
FT                   EQNQKLFKSLDIVSIRFKNLKDAGDAYEKLSKGMPFEEVAKFFSEDVTNFKGVASSRKY
FT                   YFDLDLMLEKKEDLAAIFSLKMNEFTSPIKSKNGNEYEIYKALSNIYDFDKNSEHDINS
FT                   VRNYIETYEPNVIETFLENKLNGVLSEINSDGAQQVLKKHNLALKEDTVNLAYNMNVYP
FT                   STLKELSNFSNSKDFYDIIFDLKEGQWSKPFLADHRVYLFSLRPSVNYSVSDNNLIKED
FT                   RIFDSLYQANTKLVIDYVLNKNNFKENFNEAFFSLQDFGLKTSN"
FT   gene            39659..40504
FT                   /locus_tag="BH0040"
FT   CDS_pept        39659..40504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0040"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:BH0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16565"
FT                   /protein_id="AAX16565.1"
FT                   /translation="MTHMHSGFNIKINQEELSRLTKIIYNNFGINLNEKKKLLIESRLS
FT                   SIIKAKNLSSFTEYINYLENQKNQISLIELVDKISTNHTYFFREPNHFEFLENKLLPKM
FT                   LKQMMQSEEEIRIWSAGCSSGEEAYTIAMILNEYIDNNKIHCKVKILATDISITVLNEA
FT                   KRGIYPEDRVKTLPKHLKNKYLNKLTNNKFEVKDILKKMIQFKKLNLMNEFFPFKKKFD
FT                   LIFCRNVMIYFDEKTRNKLAEKFNQHLKNDSYLFIGHSETIRGNKNLEYIMPATYKKIN
FT                   "
FT   gene            complement(40552..41223)
FT                   /locus_tag="BH0042"
FT   CDS_pept        complement(40552..41223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16566"
FT                   /protein_id="AAX16566.1"
FT                   /translation="MIRRKLTKQLEVIKDYLWDMKECVLKIIENSLIALESRDKNLAKK
FT                   IINEDEKMIDDYQYDIEDLCGRIIATEHPVATELREILAIIKIISSLERIADHSTKIVK
FT                   VVLLLESNEGDFSSVDIYQKPLREMADTAKDMLANIFDAYFDGDFIKILKIVKYDNIID
FT                   KLFSKQRTVVIDAMKNNPENLDYLLNILFLNSFLERVGDHVATIGELLYFVKVGEKVNL
FT                   T"
FT   gene            complement(41235..42260)
FT                   /locus_tag="BH0043"
FT   CDS_pept        complement(41235..42260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16567"
FT                   /protein_id="AAX16567.1"
FT                   /translation="MSKECFIYCNFLFFIISIISSLAFENRYSTYELDFSSEKQEFLVN
FT                   TNSKFNFFFKDAAWIYIKNAKNNAFIKLLAESYQDGAMFTFQTSRNVGIIMLTFRYQNV
FT                   KDSREFTKNVILKITKGEGFSKLDEIKPEDNLDLDKGIQTDKSDNNSSLRDIMRRALNL
FT                   SYINDYKGAIELLNRYDFNDDEYILLKAELYYKSGDYLNSYLNYLSLRDRYFNKIFLSL
FT                   INLGIKLNKVENVLKDVKFLVENNVAFGEDIYLDILEFLLMNREYEFFLNLSLLYYPKY
FT                   LNSRFPDRYNYLLGKLYESESKYKDFVKSLSCYKRVIDSYPFSSYYELSKLRYLFLKRF
FT                   F"
FT   gene            complement(42257..42643)
FT                   /locus_tag="BH0044"
FT   CDS_pept        complement(42257..42643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16568"
FT                   /protein_id="AAX16568.1"
FT                   /translation="MREKKIHFQKYFLILIFLSIIVSFLTYFYSYRMIENTRSSVEEDL
FT                   SRKLKLLNIEDFYFDLNSSLNMDDFFFPKPDLPDGKLEDGVMHHQSISEELLKSLWVKS
FT                   DNLFNIDLEEKNELLVDKILENYK"
FT   gene            complement(42670..45135)
FT                   /locus_tag="BH0045"
FT   CDS_pept        complement(42670..45135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0045"
FT                   /product="chromosome partition protein Smc"
FT                   /db_xref="EnsemblGenomes-Gn:BH0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16569"
FT                   /protein_id="AAX16569.1"
FT                   /translation="MGVALFLEKIGLLGFKSFVKMQELKLNSSLNFIVGPNGCGKSNLL
FT                   DAIRFCIGEDNLSILRVKYITDLISAAKSGESNFAEVTLFFNNEDLSVSDFRDRFYIRR
FT                   RLYKDGTSEYFLNDDTLNLKSYMSLINKLRLKNSPYMFINQGKIERISSSGNINLKSLI
FT                   EEASGIDMLRVEEEQAYKRLEKSKENLNSLWILRDELNNKYEKIKNDFLLKGKYQNLKK
FT                   DLEALEKNLRLKKLFNINFELNELKSKLDIKDIDKILSLNSFSIESVKEKLEFYSFREK
FT                   NVIKNIEVIKKEIETLKSKLLEIEIKIQKLEHDRKGKLNLANIFMSNKAQIESVKVSIN
FT                   EELMNLNNSLQAKKKDFFDLTDEINRYTRSFFEIIDLVLSISKESNIEEFELLKKNIFN
FT                   ALKSFEDTLSIKYIKEIRENLLKYIVKEDKLLNLLKEKIEPIFEQNVDLRKFLLSKNNS
FT                   KASLAKEITTIEALVSDKTIKLNEILGEIEYTELSRLKNEDEIKLIDSNLKFLFETRDE
FT                   LMERLNNLNLKLDELSLERSDINVNLDKFLSEAKGNELVASNEINSLNLLDAFKNSSYY
FT                   EYMKKQAEYDVLFNSSLDIEDEIKDFNRVNKNLEKFELTEDMAKIDALQKEINVIEHNN
FT                   YIFFNVEREYNEIKEKVEKIGLQIDDLNLTKESLNKLRRKIKREIDKRFNDAFGEINNH
FT                   FIYFFSRMFKGNGSLFYDKDLGEIEIKINFKDKLAKRNKMLSGGEHSLISIVFLFALYY
FT                   YSPASFCVLDEIDASLDFENSNKLSGLLKELGQKVQLLIITHNMYVAQGSKNLIGVTSD
FT                   NGESVIFNI"
FT   gene            45193..45738
FT                   /locus_tag="BH0046"
FT   CDS_pept        45193..45738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0046"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:BH0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16570"
FT                   /db_xref="GOA:B2S1N3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1N3"
FT                   /protein_id="AAX16570.1"
FT                   /translation="MICGIDEVGRGCIFGPVLSAAVIFKGNPNFLNELDDSKKLKKAKR
FT                   EYLSSLILENSYYAFAEVSNETIDKINIHHASLLAMQIAYEKLDINCDLVLVDGKFIPK
FT                   IKAKKIQAIIKGDSIINEIKAASIIAKVQRDKLMDEYNKIYPLYALNKNKGYPTKEHKE
FT                   AIKKHGISNLHRRSFKFI"
FT   gene            complement(45747..46121)
FT                   /locus_tag="BH0047"
FT   CDS_pept        complement(45747..46121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16571"
FT                   /protein_id="AAX16571.1"
FT                   /translation="MEELMGERGEVYSDKLFTNSDRTYFFNVKENRKGDYFLNIVESKR
FT                   NVNGDFERHSVFVYEENIEEFESNLLRAISVIKKKISENSIARREYHNDFDRHSERIKN
FT                   NNLSFDRNYRLSGRPRNGDN"
FT   gene            46264..46336
FT                   /locus_tag="BHT0001"
FT   tRNA            46264..46336
FT                   /locus_tag="BHT0001"
FT                   /product="tRNA-Gly"
FT   gene            46875..47576
FT                   /locus_tag="BH0050"
FT   CDS_pept        46875..47576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16572"
FT                   /protein_id="AAX16572.1"
FT                   /translation="MQGAFLNNEILWCIMLICTYLILLIMYKFFGKKGLFAWVTSSVII
FT                   ANIQVLKQITIFGFNATLGNIIYASSYVATDILSEFYGRETSKKAVYIGFMGFIAFAFI
FT                   TNIQLYFSTNSFDIYLTSLESIFSSIPILLAASIIAYIISQLNDIYLYQFIKDKFPKFI
FT                   FIRSNGSTLVSELIDTIIFVSIATYFNIFSKEAYLDIIISTYLIKGAAGILGTPFIYIA
FT                   KCIYQNKKTSI"
FT   gene            47626..48309
FT                   /locus_tag="BH0051"
FT   CDS_pept        47626..48309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16573"
FT                   /protein_id="AAX16573.1"
FT                   /translation="MIDIILWITLLAFVYLQLTLLYYLFGKSGLFCFNIIMTILSNLII
FT                   LKKVVIFEQQMSLSGITFLSILCSLNLITEKYNEQSAIKSITLNMLIHITFVIMMHFTL
FT                   HFQQNEFDTSNIHLKILFYNASYISIIFTGTYIIYLCNYVNIKIYSILQKNHVNNKWIN
FT                   HNLSRLCSSCIAYMLANISMHVIAQLYPGKNINMVESSWIFTIIIMLIDTLIYYFLNTM
FT                   KVKKT"
FT   gene            complement(48296..48979)
FT                   /locus_tag="BH0052"
FT   CDS_pept        complement(48296..48979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0052"
FT                   /product="tRNA (guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:BH0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16574"
FT                   /protein_id="AAX16574.1"
FT                   /translation="MVFYLKLYFVSDDTFKRIAILSEFITQKRRERINEVLNNRTNYLT
FT                   LVLEDIFQPQNASATMRTIEILGLSNIHIIETNNKYTLNPGVVLGASKWIDIIKYKCVK
FT                   AAFDNLKGNGYKIVATSLDNKAISLEDFPIDAKLAIFFGTELTGLSHSVLENADLHLKI
FT                   PMYGFTQSYNLSVAVAIVFYSLISRLKKSSIRYLLDEDEKLVLKLDYYRKIIKNYQAIE
FT                   ELKFF"
FT   gene            49033..49704
FT                   /locus_tag="BH0053"
FT   CDS_pept        49033..49704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0053"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16575"
FT                   /db_xref="GOA:B2S1N8"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1N8"
FT                   /protein_id="AAX16575.1"
FT                   /translation="MEVKIEESWKEILKAEFCKGYFKRLVNFIKNEYKTKKGKIFPPPK
FT                   LIFNAFDSLPFKDIKVVILGQDPYHGKRQANGLAFSVNSDIKIPPSLQNIFKEIERSLK
FT                   IQTIPNGDLTRWATQGVFLLNSILTVEESRPSSHKDIGWEIFTNEVIKIISKNLNNIVF
FT                   MLWGNFARGKKELIDASRHLILETSHPSPYSAHNGFLGSNHFSQALRYLKEHNKSPIDF
FT                   Q"
FT   gene            complement(49744..50097)
FT                   /locus_tag="BH0054"
FT   CDS_pept        complement(49744..50097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16576"
FT                   /protein_id="AAX16576.1"
FT                   /translation="MELFRFLIFVFFIITSFMIILLVLFQDEQGDGIGGVFGGGSSSIF
FT                   GAKSSNIAIRITAFFITLFFIFVIALSFINTKRVDNSLLRDVKIDEKSSTFWNDDIKQD
FT                   KDTLDEDTSDKEK"
FT   gene            complement(50109..50873)
FT                   /locus_tag="BH0055"
FT   CDS_pept        complement(50109..50873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0055"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16577"
FT                   /db_xref="GOA:B2S1P0"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1P0"
FT                   /protein_id="AAX16577.1"
FT                   /translation="MRKMFLAGNWKMHYTSVEAAGVAKQIVDGVQNINDDVVIMITPAF
FT                   TSLCKVCEVTKGSNVLLGAQNMSYENSGARTSEISPSMLLEFGVDYVILGHSECRTYLG
FT                   DTDEVINKKILAGLKHPFKYLILCIGETLSERENNKTLDVVLNQIRRGLMSVSESDLKR
FT                   IILAYEPVWAIGTGKTATKEEAQEVHRAIRLEIESLYSTSAADDIIIQYGGSVNVDNVG
FT                   GLMGENDIDGALIGGASLKADSFLNIVNKVAK"
FT   gene            complement(50875..52053)
FT                   /locus_tag="BH0056"
FT   CDS_pept        complement(50875..52053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0056"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16578"
FT                   /db_xref="GOA:B2S1P1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1P1"
FT                   /protein_id="AAX16578.1"
FT                   /translation="MSIKTIKDFDFSGKRALVRCDFNVPLREGNITDDTRIRAALPTIE
FT                   YLKSQGARVVLMSHLGRPKGERNLKYSLMPVAKRLSELLGQDVKMLPDCIGDEVATAVS
FT                   NMKNGDVVLLENIRFYRQEEENCNDFAKKLSQNGDIFVNDAFGTAHRAHASTAGLAAYL
FT                   PAVGGFLMEKEDEFLGKILKNPESPFVSIIGGSKVSSKIAVLESLLPKSNVMVIGGGMA
FT                   YTFLKVEGHSIGKSLLENEYIDVAASFLKKAKELDVKVILPLDHIVASEFKEDSIPEYV
FT                   DAIDIPDGKIGMDIGEKTLRKIEEVLVSAKTVIWNGPLGVFEFDSFSKGTAKVAEYVAS
FT                   CSGITVVGGGDSVAAVNKFNLSEKITHVSTGGGASLEYLEGKILPGIKVLEK"
FT   gene            complement(52082..53089)
FT                   /locus_tag="BH0057"
FT   CDS_pept        complement(52082..53089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0057"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BH0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16579"
FT                   /protein_id="AAX16579.1"
FT                   /translation="MKLAINGFGRIGRNVFKIAFERGIEVVAINDLTDPKTLAHLLKYD
FT                   STFGIYNKKVEARDGAIVVDGKEIRIIAERDPKKLPWGKLGVDVVIESTGVFSSATSDR
FT                   GGYLDHVEHAGAKKVILTVPAKDEIKTIVLGVNDHEITSDLKAVSNASCTTNCLAPLAK
FT                   VLHETFGIEQGLMTTVHAYTNDQKILDLPHADLRRARAGALSIIPTSTGAAKAVGLVLP
FT                   ELKGKLNGTSMRVPVPTGSIVDLTVQLKKKDVTKEEINAVLKKASESRELSGILGYTED
FT                   PIVSSDIKGNSHSSIVDGLETMVLLNGFVKVLSWYDNEFGYSTRVVDLAQKLIK"
FT   gene            complement(53162..55147)
FT                   /locus_tag="BH0058"
FT   CDS_pept        complement(53162..55147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0058"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16580"
FT                   /protein_id="AAX16580.1"
FT                   /translation="MNLKRFLTILLIFNLNFGSLIGATTTAIEYYQKAQTYYIMQKYYD
FT                   AIDELLEAVKINPNYYEAYKFIAEIYYQLKIYNQAQFFIEKAYKMSNGDTEYKILYANI
FT                   LLKNNGTTQAKKFYSEVLAKQKNNIDALVGLASIFEEEGLFVAAANYYLSILEYNQTNY
FT                   NAFEHLMSIYEKLNMNDKAQHLINKVRGNFTSLPDFHKRVAEFSIKTNSLGVAEKYAQN
FT                   YLMLVKTTYKDFGLVDAYRLLALVYLYQSKYEDAADVLQKAILVDQNLDELYYLLGYSY
FT                   LKLGKIDKAVLNLERAKSMKKDLEFYNIALEESFFVSNFRSSFQKNSGTNMEISKRYEN
FT                   DGFKAFKNLDLDRAVFNVKNAIDIYPDNDSARFLLAKIYKFMKLDVMAYEELYYLVEQR
FT                   KVTDTKILDFYDVVAFDIRSSLFFRYGYKTIGDLNKLYDNQTVYRVGIFTQNENKVFGA
FT                   NDLILKYAERILDRNLNVEVVNYRFDYNKNKDYLVSSFAEEFSYARSNNLDLFLMFDLD
FT                   VDVFKNSASLRVDIFSGKTGIKIKTFDYNSGGVLYLSDILSSFSRDFNDYLPKKGEILQ
FT                   IKKDDVLINLGHVNDVKEGDIFLVLKEGALKYNSDSSSFIGYSKSDILGEIFIEEIGDY
FT                   ISRGILKSPALLRDYIQKGYTVFIKK"
FT   gene            complement(55144..55923)
FT                   /locus_tag="BH0059"
FT   CDS_pept        complement(55144..55923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0059"
FT                   /product="magnesium and cobalt efflux protein CorC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16581"
FT                   /protein_id="AAX16581.1"
FT                   /translation="MMFKFLSFKNKKIKRDDDKNIEEKSRFETSLLKNFNSLKETIVKE
FT                   IMIPRISVVFVDYSVSKDEILKVVTSSNHSRFPVYRETIDDIIGIIHTKDILLHMWKKD
FT                   FYEIDLRDIMRKVMFVPESKKIDSLLKEFQENHVHIAIVVDEYGGVSGLVTLEDILEEI
FT                   VGDIQDEFDNELDEIVPLDDGSYLCTARVLIEDLNEKLGLSLPDGDFDTLGGFVYDLFG
FT                   RIPLKNENIKYNNLTFTIKNMHQRNIKVIKISQKESL"
FT   gene            complement(55920..56366)
FT                   /locus_tag="BH0060"
FT   CDS_pept        complement(55920..56366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0060"
FT                   /product="hypothetical metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16582"
FT                   /db_xref="GOA:B2S1P5"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1P5"
FT                   /protein_id="AAX16582.1"
FT                   /translation="MIKEELNLWAEGVEFKHWDAYYNFILSVLNFLCIEEYELSVVLCN
FT                   NEYIQKLNSAFRQKSEPTDVLSFNYLEENGQINHKIQGDLIISLEYLEFSSLEFNVEMY
FT                   DELQRNTIHGILHLIGYTHETNDFQNEEMLVIQEKVLRETRRVF"
FT   gene            complement(56455..56808)
FT                   /locus_tag="BH0061"
FT   CDS_pept        complement(56455..56808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0061"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BH0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16583"
FT                   /protein_id="AAX16583.1"
FT                   /translation="MVISLTKQEFIDKVFDYKNNKEWDFKGKKPAIIDFYADWCGPCKM
FT                   LAPIYDELSKEYGDKIDFYKVDTDKEQEVSMVLGVQSLPTIIFVPVGGKPKVSVGFIQK
FT                   DSFEDAIKDLFKV"
FT   gene            56882..57604
FT                   /locus_tag="BH0062"
FT   CDS_pept        56882..57604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16584"
FT                   /protein_id="AAX16584.1"
FT                   /translation="MNLILINPDEFENGLMLNDLRVKHINEILKLKNNETFKFGILGEE
FT                   HIYSCIYQKDTKLFFKKHHKIAKSNKLKKLKVIIGLVRPIAAKRIITHLGSIGISEIIF
FT                   FNALLSEKSYSCSKLFKKKEYEKYLIEGAMQGGITYIPKVNIINNLIEVLNNTEYDKSD
FT                   TTKILLERESKNKLVDLNIETKNTVVIIGPERGFITKEINLIKEYDFNAYNISSNILRT
FT                   ETATIVASTIITSKMNSK"
FT   gene            complement(57639..58697)
FT                   /locus_tag="BH0063"
FT   CDS_pept        complement(57639..58697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0063"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16585"
FT                   /protein_id="AAX16585.1"
FT                   /translation="MSDNKLPHNKLFLDSKNLNNRNNLHEHDLNFDSKIPTLPKHVANG
FT                   LVLTIFGSLIISCAIFFIFLKGSDIVVVPNLSGLYIEDAITELQDKELIPYVELKFSST
FT                   SLDKGKVIDQSPKAGTVLRLDSKVKIFISKGAVINKVDNFIGKNIDDVLINLKANSINN
FT                   NRILYHLLKPIEIESTLSKGTIIRQEPSPGTKIASLVDLQFLVSKGQEEAPTRYVKNYV
FT                   GLYYKDAIISLLNDEINFDVNLSTGSDFGSVIFQSLSPGSKVENLDKLTITINEPKNNG
FT                   TGIFGILTYKLDIYPSSVDIMVKVKDSNGNSSLLYSFRSRGGLIKLPYEALKGSIIELY
FT                   IYDRLVNQTVVN"
FT   gene            complement(58726..59655)
FT                   /locus_tag="BH0064"
FT   CDS_pept        complement(58726..59655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0064"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16586"
FT                   /db_xref="GOA:B2S1P9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1P9"
FT                   /protein_id="AAX16586.1"
FT                   /translation="MRIFFASSESIALEVLKKVADQHNVVGVLTAPDKPSGRGLFLRAN
FT                   DIKVEATNRNITVLDPVVLNSDVVEIVKRLNPDLMLVFSYGKIFRQEFLDIFPMGCINV
FT                   HPSLLPKYRGPSPIQTAILNGDTVGGITVQKMALEMDSGNILSQSQFEIKSFNTSADIF
FT                   RYVSLNSFNLVLEALSKLDKGNIGIEQDSRQATYCSFFNKQHRILDFNLSAFEIKNKIN
FT                   ACNPWPLARAKLDDDEIIFHRADFIRTNDYSDQAIGKIILFDPSRGILVKTGDGILLLL
FT                   ELQRAGRKVMDYKSFYNGNRDLIGKIFS"
FT   gene            complement(59652..60176)
FT                   /locus_tag="BH0065"
FT   CDS_pept        complement(59652..60176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0065"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BH0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16587"
FT                   /protein_id="AAX16587.1"
FT                   /translation="MSLNFFEGFMEIVFYPDDLLRVKTKAVLNIDDELRNIAFKMVNLM
FT                   DINKGVGLAAPQVGLDLSIFVVRENVMSKPLVFINPLITETSFELSVYKEGCLSIPGVY
FT                   YDLLRPKSITVEAYDENGKFFKIESSSLLARVVQHEMDHLKGVLFIDYYEDKLRNKLLK
FT                   PYMKGRRLVKT"
FT   gene            complement(60178..60867)
FT                   /locus_tag="BH0066"
FT   CDS_pept        complement(60178..60867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16588"
FT                   /protein_id="AAX16588.1"
FT                   /translation="MRFLSLFIIFIAFGFVHLFSLSSDVIFHNSYKEAIDEARNLRKNV
FT                   LILVGRDIKDNLIKDFLKSFEDDKILKAIAKNNVFLIIDVNNEIFGEINLKRSPTLFFV
FT                   DSKSEQIKAAYVGSIKDTVQCNQEFLNYALGVFKLDDIVQKKNNYEINTLDDKVFFYKT
FT                   LDGHWRFRMNGQDKKLLPSKIELKEFLVFKDEKEGKLYAFPKSRKGSIYFSEAENEEWK
FT                   LFGQIKS"
FT   gene            complement(60864..62642)
FT                   /locus_tag="BH0067"
FT   CDS_pept        complement(60864..62642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0067"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16589"
FT                   /protein_id="AAX16589.1"
FT                   /translation="MEISTKILSLRNLMRKSEIDAYLIASYDPHMSEYSHVRFNVREFI
FT                   TGFTGSAGTVIVTETDAVLFTDGRYFLQASSELEGTEFKLMKLGVKGYPDIFSYINTNL
FT                   KGLRLGIYAEDVSIKLYNDLIKNCRHTEIEILHEDLVSKIWQGRPVLEGSKIFELSEAQ
FT                   KNDKRTDKLDRVNARLEEKAIDFCIVSSLDEIAWLLNLRGLDIESSALFYAFLFIARSE
FT                   RYKNVLFVNVDKLDSDLRERLETESFEIEDYGNFYSFLAEINHEGKFFIPVESNVKILE
FT                   AIGKPNAVLGQSVVNELKAIKSDYEISKMKEAHIIDAVSLIKFLYEFKSLSKDELSRLD
FT                   EVDVADMLLNFRAARDEFFSSSFDSIVGFKENSALPHYKPKKGAKNLDGAGLLLIDSGG
FT                   SYLGLGTTDVTRTILIGEASCKEREDYTLVLKSFIALASLKFPFGISGASLDGIARFPL
FT                   LKQGLNFSHGTGHGVGFFLNVHELPVSISPLSAYAFKGSEITSIEPGIYRESQYGIRTE
FT                   NLVFVKQSYSNEFGTFLEFENLTLVPFEKELIVTEMLSKDELDYINSYHEFVYFSLKEY
FT                   LSGDELKFLEILTSKI"
FT   gene            62762..63652
FT                   /locus_tag="BH0068"
FT   CDS_pept        62762..63652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0068"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16590"
FT                   /protein_id="AAX16590.1"
FT                   /translation="MKNIKAVVSDLDGTLLLSNIQIGAFSELVITKLIKENKKFIIATG
FT                   RSKNEIIPLIENLSSHVSFFITLNGARVYNNQWQLISRYDLSSEIVNEILNLRESKYKD
FT                   IPHFLQKSEDIDEKLYADNITKNAINNMFEKHELLRKHKYIEHELKDISIKYHEINNFR
FT                   EFKNFNNIAKILLLHHEEAQLIKYEAIILEKYRKEINAYLSTPHSLEIVNSRVSKGNAL
FT                   KDVLQSININLNEVIAFGDGFNDVDMLENVKKGLLMGNANYRLKKMLSYLEIIDTNDNE
FT                   AVAHYINDNILEDPV"
FT   gene            63665..64903
FT                   /locus_tag="BH0069"
FT   CDS_pept        63665..64903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16591"
FT                   /protein_id="AAX16591.1"
FT                   /translation="MKKDLIKYAELIILKGINLQKNQCVLITGSIENYEFLRILAQKAY
FT                   EHGAKYVELNIEDADILKTRLKSSPEDLLEFIPDFKHKFFEEMVNEKWAKIRIDNTENL
FT                   DALKDNDSKKISKYFKALSLASKKFSSAIMNNELAWCTVCAPGPKWAAKVLNKPECQKT
FT                   LEEFFDIQKKIMLLDSENPIKAWEDHGKKLHQRCEILNKLKLEKMIFKNKKTNLEIYLL
FT                   ENSIWTGGSEKVKGTDIEFNANMPTQEVFTTPNYKKTNGIMHVTRPITVLGNLITGIWL
FT                   EFREGKVINFGCDDDQSRNILKRHIETDIQAQYIGEVALVDNSSPIYQSGLTFYSILYD
FT                   ENASCHIALGNAYPSCLSNEQELKSDDAKLDYGCNVSLIHTDFMIGSNDINVIGIDKSD
FT                   KEHTIIRNGQFVI"
FT   gene            64921..65388
FT                   /locus_tag="BH0070"
FT   CDS_pept        64921..65388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0070"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16592"
FT                   /protein_id="AAX16592.1"
FT                   /translation="MIKELFINDLFLSCFVSGIVAQMIKYIIQAMKTKKIKLNPKYLLK
FT                   SIFLETGGMPSSHSSTVTALATSILITEGINTNFIIALAFALITIRDSFGVRYMAGVQA
FT                   EYLNTLSEQLKMKVKIEPLKIKVVKGHKKKEVFTGILIGIISAWTICNRII"
FT   gene            65410..66879
FT                   /locus_tag="BH0071"
FT   CDS_pept        65410..66879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16593"
FT                   /protein_id="AAX16593.1"
FT                   /translation="MNLLKFLHTLLILLLISCNMAKFGDYKPLYFKGEKDLKTANDYIN
FT                   ALGYKTISEYTTKVNILDFPDFKEITIDKLIHLNDHDLRKDPFLKKLPNLFNIGTKKIL
FT                   YVESTFTNSDLKKLKHDQNIEAEMHSFNYKTKIKYFSSITFIVIITLLLILNIKYAPFI
FT                   ILFLISSCTIFIFSDEILYFYPLTILSYLLFTLIDNFNKNYNKIYLRNISFTVLIDKIK
FT                   IPIFLFLFIVLYFIVIINFLTTNLEALLIIFVSISTLCIFLIFTWIKTESNFKHTFLSL
FT                   IEIKERKRETKILKFKILIYIMLFIASLMPFFYAQNILNSYENFNYLYSKKLNYFDYLN
FT                   PNNIYLMVGYNEEIPNIVGYMYHIFYQNELKYKSTSQYGKVNTNVREDYFAIENNKITI
FT                   NPKTIYKVDKEFISKNLNKELSRLFLENENPILIYKETPTNITINKDNFTILFTLSFPF
FT                   FLLLFLFKAIKFTILLNMSEKNYKKYIRGIL"
FT   gene            66876..69194
FT                   /locus_tag="BH0072"
FT   CDS_pept        66876..69194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16594"
FT                   /protein_id="AAX16594.1"
FT                   /translation="MMSNLKTLKIKTKRQYKVNINEIQMPECVLIPLEIENSKSTIYII
FT                   ENQRISEGQILSKNKNAELYTYAPISGTIEKIYIANFPNEHQLKSALIRFHGRIKNEQE
FT                   CSVEEESREKTLEKLIRLGIPWFNEHSLFQYVSKCKKIDKMILLINGKDPFTNISEILI
FT                   KEKLNEIIYGFETIDKIFKCKEILIVLSNYNLKKELETLNIFKDKRLKIKLIPNISYPY
FT                   SNHEMIMHFLYNEESTKNNINPNKNILLANVEDLYNVYNTLKTNSPYKEKFITINGNQK
FT                   IQSKIIKVKIGTSIQQIINEDIDTKKYDVFLNNPANKIKINNLNTPITRDIYSITILRK
FT                   KSIFSKIKLLKIPSFSPLYMEEIILSKIKDNNNLVNKKLQCLQYTETEIEDEINKVKKE
FT                   IKEKILNLGLNNEPIYTENNLKDIYLTIILALMPSLIFSFTNNVKFLIDTFILTITSLC
FT                   LYIPIMLKSKHKYLSFFIYTALIISIILPLNLSIMLKIMALFFTFLIFFYFSKLSKFLV
FT                   NPILISFMFLLVNFPSSFKQTYSKELSRQEDIIPTWHKIIHQNPNIQNLESLKGFKRHE
FT                   NKHIDMIEKFINDKILSHLNIMIPRFHIETLFGLQNEKYLSPILIYIGFSFILGKFIIN
FT                   KLIPLSFYASLLLIAYTSKNFGLYSYISFDMLTLIMSPIPMILVFAMGTELQIAPPFKF
FT                   EQILYGLTLSLVYFITLSYIPLETLSAVISIFILQVSSTLIKRYSLTFQIKKILHHLSM
FT                   NKAKVIEHKNDNGEEIIKL"
FT   gene            69191..69760
FT                   /locus_tag="BH0073"
FT   CDS_pept        69191..69760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16595"
FT                   /protein_id="AAX16595.1"
FT                   /translation="MRNSLIMYLLINNLLLIHFIGIEDIKIKDNKTLSKKYLIIMITSL
FT                   LIYSGLFYVYKLFKDHNLLFIIPIIYITLIYMLTIVLKILNNILIAYNNKSKYSNDFLL
FT                   SNSSLIAITFFALDKSHNFLEGINILILSSLSVLIALILTILIKKNFEKRLKSKILANE
FT                   TTYFFIMFILSLIPNIIILINNSESL"
FT   gene            69776..70837
FT                   /locus_tag="BH0074"
FT   CDS_pept        69776..70837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0074"
FT                   /product="bacterial peptide chain release factor 2"
FT                   /note="RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:BH0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16596"
FT                   /protein_id="AAX16596.1"
FT                   /translation="MNFWKKFKMSGGSFDKDKLKTQLKEYEKQINNENFWNDNKKAQEI
FT                   LKNQNILKAKIEPWEDLIFKLQDLRELCEIAESEEDTILLDKDINKLKEQYKHLLTISY
FT                   FKEDIDISNAFLTIHSGAGGTEACDWVSMLYRIYLRYSERRGYKTELIDLLEAEGGIKS
FT                   VTIEIKGKYAYGFLKSEIGIHRLVRISPFDAAKKRHTSFASVFIDPVIDDKIEIIIKPE
FT                   DIRVDTYRASGAGGQHVNKTSSAVRITHLQTGIVTQSQTDRSQHRNKELAMKVLKSKLY
FT                   EHYKALEQQKSKSKQEEKKDISWGNQIRSYIFQPYTLVKDHRTKFENPNIISVMDGNID
FT                   NFIEEYLKWKNLS"
FT   gene            70819..72228
FT                   /locus_tag="BH0075"
FT   CDS_pept        70819..72228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16597"
FT                   /protein_id="AAX16597.1"
FT                   /translation="MEKSKLIIIILFSILTIKLAYPQSNIEYGFSYIIDTQDENKNLKE
FT                   SIEQTLNKIYNTINEHIVNDNDKDFIRRIYIHQNIVNKEREFSKLKEDMDKKRLQNAIS
FT                   SREENKIEIKINELKKDIENIKIKQKELEEYLKNLKKIKATYKKHEEKIHLSNLNTEFL
FT                   IRQELFFMNYIHFKKVEKHYLVEISNITPKGIKTQKEIFKLSSSVDDIAHKIAELSLEE
FT                   ILGREFIKLRINIINNLEAKIYINEKFVAKGLYNNDIWDISELPNKEIIINITSTTYKP
FT                   YTVKQKIKSGDTINLNIKLKKANSKKISITSNVKSKVFQKGVFIGETPIEIEEPEGTES
FT                   ILLQAQGYKNMFKIINKEDKDINIEMLKDNKSELIIKRDKFYINLGIFTLNLIGTAFAI
FT                   TKYNESSELYDMALHNIIKRRITSQDLYNAKSEQMITTFLLGTGITFSIGSFIPLIIHL
FT                   VQYIQEASRGE"
FT   gene            72273..73127
FT                   /locus_tag="BH0076"
FT   CDS_pept        72273..73127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0076"
FT                   /product="cell division protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:BH0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16598"
FT                   /protein_id="AAX16598.1"
FT                   /translation="MRLLGIFDKIKNLFKNQEKTQIFENLEDILLEADIKNDIVIEIIE
FT                   YIKKVKVKDEKETLLKLKDFLKSYINQQPLNLENKRLNILLIIGINGVGKTSSIIKLAN
FT                   KLKNEGKNVLIAAADTFRAAAIQQIKIQSEKIGIKVISQNQGSDAAAVIFDSISSAKSK
FT                   NYDILIIDTAGRLQNKENLIKELQKMDNVIKKQIIETDINYKKILVIDSISGKNVNNQA
FT                   EIFNKAIEIDGIIATKFDSSSRAGGILNISKLFKKPIYFFTFGEQVEHIKEFNTDDYLN
FT                   RLL"
FT   gene            73124..74176
FT                   /locus_tag="BH0077"
FT   CDS_pept        73124..74176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16599"
FT                   /protein_id="AAX16599.1"
FT                   /translation="MTKKIVILFLAFIIPNAYGQRYFISDVFFNKYQEIYEIPQTGFYI
FT                   EYTKINEIEKFSLFKDLKLTKYKTQETIEDKKKLTFYNEQNIKTNEEIYDNLNNKIQEI
FT                   KYSPKGIILESVDYFYKNNDLIYKEIKILNQKPKTLHYMKDTNGKLLKITGSDFQVWNY
FT                   GISGEIKSTYFDIKKSKIKVIQYDDQKRHLESIILDNNKIKSKEKNQYLDEHEVINTAE
FT                   EDNIKTISKYKGPNLIRKEIYKNNEITKISDFEYNESGNVIVENITVKENKKEHNTKTT
FT                   YEYNSDNNLKSKTIYENDSILLKTNYSNDNEYEQEIYYNGNPIFKVRYKNDEIIEEINK
FT                   NITRDENGTK"
FT   gene            74157..75395
FT                   /locus_tag="BH0078"
FT   CDS_pept        74157..75395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0078"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:BH0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16600"
FT                   /protein_id="AAX16600.1"
FT                   /translation="MKMGLNKFLLKRLILDEQNSSSLTIVIILSIVLGQIIIIITISIM
FT                   NGFQNDFFTSISTLESGNLKIESKLNDQELNALKEIKEIIQINKIYETQGIGIENYYYP
FT                   SILNIIALDTEDIIKDKDFILLTGLTQSELQLNDDEIIIGDVLSHNLGLFEGDIIGLIL
FT                   SDEIKNLQTLKDEVKHFKIKAIFKSNYAKINESTVFMNINYFYKKQLIKDSDINYQIKT
FT                   QNLYPSKKLINKIKNINSNIQFKPWNEYNKEFYKALKIERNTMLIILTSIFLVIAVNTY
FT                   YLQKRIIINKSKSISIILFLGLKSQKIRQVFLMHSVIICILGGIIGLIAGITISLNINE
FT                   ILNIIDILINSSINLINYILKLKLENIEIKIVKNTVTPKIFLSDLMFTLFFACLFTIYS
FT                   SLRVTKKLNMLTK"
FT   gene            75410..76090
FT                   /locus_tag="BH0080"
FT   CDS_pept        75410..76090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0080"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16601"
FT                   /protein_id="AAX16601.1"
FT                   /translation="MKNILCIKGIYKTYTKNKTKIKVLENLNLNVKDGDFISIQGKSGC
FT                   GKSTFFNIISGIDKMDSGDIISCGISLKDASEKTLSLYKNKKIGLVFQNHNLIDEFSVF
FT                   ENIILPKIIEGKDNLETINKKALRLMKILEINTRAEHYPSELSGGEAQRAAIARALINE
FT                   PNIILCDEPTGNLDINTAKTVEYLLIDTAQTFNKTLILVSHNPEFSNKADIKYELKDKT
FT                   LKRI"
FT   gene            76087..77337
FT                   /locus_tag="BH0081"
FT   CDS_pept        76087..77337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0081"
FT                   /product="lipoprotein releasing system transmembrane
FT                   protein LolE"
FT                   /db_xref="EnsemblGenomes-Gn:BH0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16602"
FT                   /protein_id="AAX16602.1"
FT                   /translation="MMRPNTKELTKIAYIIFTNSKNKKALIGSGISLSLVMIPLIIVYY
FT                   MSNNIMNSTIDKYIENEGFSVQIEYNEIQKDTHLRSKLEKFKKEYQHDELKYFFERRTY
FT                   GIIGNQKKQGVLIRAVEDKFIDENKHIKLIDGKKSFNKNEILISKQIRDRLNLNINESI
FT                   YIVVPNNKHQKIFPRAKKFNISGIIETGLREVDKNLVLISLQDANIMSEEFSKSIIGIS
FT                   VKPNTKEKANNLKKNIAKEFQKYKIKTFYELYLNKYKNLDISKKLLIFIMAFIVIFASI
FT                   NISSSLCMLILENKKKIAIFKSIGMNNSSIKLIFILIALVLSSISCLIGIIIGNYITIN
FT                   IEHLINIIDIIINTILKIFGADNTELLNSDYYISEFNIKISTKFSLIILLSYTLISVAT
FT                   TLIPLNIISKLKEKEIL"
FT   gene            complement(77372..78655)
FT                   /locus_tag="BH0082"
FT   CDS_pept        complement(77372..78655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16603"
FT                   /protein_id="AAX16603.1"
FT                   /translation="MSKTSEDRIKIYLSRLSKYKNRVLRERDIDEIIERVDISDADIEN
FT                   IEMRFSKVYDKARQLERMGELSDALRELETVYLYSLHNKSSFASFFNLYKRLVKRIATK
FT                   EINKKFIHVSLQAQEFGIVSGINLKNYNDAERLKQRILILLLSFILIAIIAFITYTLMH
FT                   SFISGYEELDGVEDVKKTNSQGLPSVTRASDLIVESTNLVESPYVLYYVEVEDAKVLVF
FT                   EDAHAYQLKAGVISAKEPIKRISYSVTVYDDLGKPILNKVFEKTSDFQNKWSKGVYAPI
FT                   DFIYNISKEINEHPKKMVLDIRLIEFFSEVDNVSSINLETSSSILNFKYLGSYFNETFG
FT                   IYEANSLIEVYNDSKDNIKDLEIEVAYVARDNHIIRSLQRKLISETNSFLKPYSKQSFS
FT                   LKTIFPKEIYPNIKEELSSIKIVNVFAK"
FT   gene            complement(78648..78965)
FT                   /locus_tag="BH0083"
FT   CDS_pept        complement(78648..78965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16604"
FT                   /protein_id="AAX16604.1"
FT                   /translation="MKEIIYRFEKAEDYKLVPVNNIYGSVTNTGEIFCDLVFESTEIPE
FT                   EIVYTKTKEGVLEEISGELKGSKEKIILINSFVGISVTKDTAKNIAYWLLKKVDELEDN
FT                   E"
FT   gene            79170..80438
FT                   /locus_tag="BH0084"
FT   CDS_pept        79170..80438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0084"
FT                   /product="cysteine desulfhydrase"
FT                   /EC_number="4.4.1.-"
FT                   /EC_number="4.4.1.16"
FT                   /note="selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16605"
FT                   /protein_id="AAX16605.1"
FT                   /translation="MDLKLAKDKNEKLKIIRKDFPILNKTINDKKIIYFDNAATSQKPQ
FT                   SVISSVVEYYANYNANVHRSGHGLAIQSSLKVEETRKIIKKFINAKSFKNIIFNSGTTD
FT                   GTNTIANSLLFSKLLKENDEIITTTLEHNSNLLPWINIAKYLNLKIKLAKFNKMGIIQP
FT                   DEIKNLITDKTKIITISGINNILGTIQDLETIGKIARDNKIILFIDAAQMAPHMNIDVE
FT                   KINCDFLVFSGHKMLAPTGIGVLYISDKIIDKLNSSKLGGNAIENIFIENGEPNFKTLE
FT                   SPNKFESGTPNIAGIIGLGKAIEYINNISMDFIQEHDRELIEYCVAKLKEIDEVEFILN
FT                   KDIKRKSIISFTVKNIHSHDVETYLDTMGIATRSGKTCAYLAFLSENIKKDHLLRISFY
FT                   LYNTKKEIDIFISCLKKTIKEFY"
FT   gene            80608..81012
FT                   /locus_tag="BH0085"
FT   CDS_pept        80608..81012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0085"
FT                   /product="NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16606"
FT                   /protein_id="AAX16606.1"
FT                   /translation="MFSEETKKELIRLSKIRKYYFQTDKNQNSVYHQSKCGDQIIFQIN
FT                   ENNEKIKLKYNAYGCVILLSSAYILTKLCDNKPRNTILEIITKTINRNFENLEEIDKSL
FT                   KNFENFLYTNRKDCFMLPYKALKEILNTTK"
FT   gene            81034..82563
FT                   /locus_tag="BH0086"
FT   CDS_pept        81034..82563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0086"
FT                   /product="magnesium chelatase subunit ChlI-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16607"
FT                   /protein_id="AAX16607.1"
FT                   /translation="MKIYSHSSIGYEGELIEVEVDIRKGIPGIDIVGLAGSEIKESRER
FT                   VKSAIKNSEFTFPKDRILINLAPAGIKKIGTAIDLSIAISIITTKDNQNNNLEILILGE
FT                   LQLDGQIRAIKGILPAISLAKERGIKCIIIPFDNLAEALLIENLNIWGVKTLKEALEII
FT                   GHLNHNIFPSKPTINFKIEENEEKFEYDFKNIKGQHRIKRALEIAVAGGHNIMIFGPPG
FT                   SGKTLSIKCVRSILPPLTDKEIIETNRIWSVAGKLIDTKIISQRPFRQPHQTASKEGII
FT                   GGGSNALPGEVSLAHNGILFLDEALEFQKSILQSLREPIEDKMISIVRASSKSFKYPAN
FT                   FQLMLATNPCPCGNLGKNDTECFCSQQEVSNYWKKLGAAMLDRIDIRVPVKPVDNAKLF
FT                   QEDNESSSEIRKRIIKARNIQSKRYGNFENIHKNSDLKPEHIATFCELDKILQDEMIYI
FT                   LNKLNISSRATHSILKLSRTIADLKEDDHISREALLEAIEHRKHGGKLLEE"
FT   gene            complement(82586..83536)
FT                   /locus_tag="BH0087"
FT   CDS_pept        complement(82586..83536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0087"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:BH0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16608"
FT                   /db_xref="GOA:B2S1S1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1S1"
FT                   /protein_id="AAX16608.1"
FT                   /translation="MLKRNKVVLVGAGGVGSSFAYALTIDNSLVHELVIIDVAQDKAKG
FT                   EVMDLNHGQMFLEKNIKIAFGNYDDCSDADIVVITAGLNQKPGETRLDLVGKNTKIFKE
FT                   IVTGVVSSGFNGIFVIASNPVDIMTYVTMKYSNFPTHKVIGTGTTLDTSRLRYFLAERF
FT                   NVNTQNIHSYIMGEHGDSSFATWDETKIAMKSLSEYIAEGTIREVELDEIHKKVVNAAY
FT                   EVIKLKGATYYAIGLGIKKIVNAIISDQNLILPISSYINGQYGNFIKDIYIGAPAVVCK
FT                   EGVKEVLDFKISDRELEKFKISANQLKSYIDKIEF"
FT   gene            complement(83726..85393)
FT                   /locus_tag="BH0088"
FT   CDS_pept        complement(83726..85393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0088"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16609"
FT                   /protein_id="AAX16609.1"
FT                   /translation="MDIERERGITIKSQAVTIDYKCSDGNIYELNFVDTPGHVDFSYEV
FT                   SRAISSCEGALLLVDASQGIEAQTVSNFYMAFEHNLEIIPVINKIDLPSANIDFVKEQI
FT                   EHDLGLDSNIAVPISAKNGIGIDELLEAICKYVPSPKGSVKGPLKALIFDSHYDSYRGV
FT                   IVHFRVFEGQIKTGDKIKLIHADREYLVEEIGIFKIILEKKDILEAGDVGYFIAGIKNI
FT                   SDVKIGDTVTLVDDPASVPLEGFKEVKPVVFSSVYPVDANQYDDLLKAMDRLKLNDASL
FT                   TFEKDASAALGHGFKCGFLGLLHLEVIQERIEREFDLNVILTSPSVRYKIIPKKGNPYF
FT                   IESPEQFPGNENIEVALEPYIRANIIVPAEFLGNVMSVCLLKRGVQENLIYLDTKRVEV
FT                   IYKMPLAEILFDFYDKIKSVSRGYASFDYALLGYEETALVKLDILVNGDRVDALSQLVF
FT                   RDGARSKALNICKKLKDEIARQQFKIAIQGSIGSNIIARETISPVRKDVTAKCYGGDIT
FT                   RKRKLLEKQKEGKKRLKMIGNIEIPQSAFLAVLKSDDN"
FT   gene            complement(85574..86578)
FT                   /locus_tag="BH0089"
FT   CDS_pept        complement(85574..86578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0089"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16610"
FT                   /protein_id="AAX16610.1"
FT                   /translation="MRKFNIFIDMLRPFLLLFIFGFILNLNSSVVEEFPYWILLEKGRQ
FT                   LIYSKEGFVKSNLTIAMNYLQEALLRKGIYPEANYYLSVAYSMIGNVVLEKLHLQKALE
FT                   NKDYLLDKFFEKNILFSLAKIAELEDHHVDMIDYLNEILSKFSNSDDYYNYHYVVQKYE
FT                   DTKGNKFNMSFYLHSYLKQVRGTSGLDFTFNLYRFNNYNVIDAHQLLAKVYFKIGAYEL
FT                   AIAHGLVAAVGILTRMYDYVSYYEPLYEFKNLRAFARKINEYTDIKTSFESTDFWEIVY
FT                   NIAYATYIYDNGKHKLRAVDTWKLIVDLAPKFSPYVLKSKIQIKNFLIGKSVH"
FT   gene            complement(86616..87050)
FT                   /locus_tag="BH0090"
FT   CDS_pept        complement(86616..87050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0090"
FT                   /product="V-type sodium ATP synthase subunit K"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:BH0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16611"
FT                   /protein_id="AAX16611.1"
FT                   /translation="MDIGLIGVNSALTIAAIGSALGMGAAGSAAIGAWKRCYMQGKPAP
FT                   FLLIVFVSAPLTQIIYGYILMNTLAGIMTQTDPWLLFGAGFGGGLAISISAFAQGRTAA
FT                   GACDAFAETGKGFATNLLVLGLIESVALFVMVFLMIFKFV"
FT   gene            complement(87065..88897)
FT                   /locus_tag="BH0091"
FT   CDS_pept        complement(87065..88897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0091"
FT                   /product="V-type sodium ATP synthase subunit I"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:BH0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16612"
FT                   /protein_id="AAX16612.1"
FT                   /translation="MMIVKMNKVLILTLLKYKRESLEILRELGVVHINFCNKVSESLER
FT                   VVEERGILRQALSLLGDDSEVKILSSSNENFLDVARSIVSLGSEIKDLKDMQQSLLHKR
FT                   DIISCWGYFPLELINKLRESNIYVQFFKSGIGEYKKLLASSETKVTLINNYKGTAYFVA
FT                   INDSKQIVDTAEEYEFEFDLDFIENKLKVIGEILNQKLTQLSILNKYGDVLRDKIKEYD
FT                   QIVEFEQVMTDMDVERDNFVYITGFVPEDKQEDIKNATLNGEFVVQFAEPDADDVVPTY
FT                   IKRRGIAKLAKPIFNVLDTIPGYKERDVSCIFMLFFFVFFGMIIGDAAYGVIFLLIGIL
FT                   FSLSNIIKGKPLTSIHALIFYLSTSAIIYGSMTGTWFGSSTFFLDLFPILKSLKLEYLT
FT                   GRSGMQNIMFICFTIGVLQISLAHMWNFIQKVKEKPYIHSIAQIGWLIVIPGLYYLALN
FT                   LILGRDRFPMHSIVLNMIYVGVMLVFIFEKQDGSNFFICVLKSFGGIIEQFLATVSGFA
FT                   DIISYIRLFAVGLAGLAISDSFNSMSASLLKSSNIGLIISGIIVILFGHILNITLSLLS
FT                   VVVHGVRLNMLEFSNHLGQEWNGYSYRPFRKIKD"
FT   gene            complement(88906..89526)
FT                   /locus_tag="BH0092"
FT   CDS_pept        complement(88906..89526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0092"
FT                   /product="V-type sodium ATP synthase subunit D"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:BH0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16613"
FT                   /protein_id="AAX16613.1"
FT                   /translation="MASKKGLEMPKVKLTKNELKKQKDSLKMFSRYLPTLQLKKQQLHL
FT                   EIRKIDALKKIRKLEQDKLKRDIKAWISLFGERFAFQDWIQIRRVVRSFANIAGITIPV
FT                   FDSVEYEDIKHDLLLTPYWVDKGIEAIKRVIQVKAEIEVLNEQTRLLETELNTTSQRVN
FT                   LFEKVMIPAAKINIKKINVYLGDQQTAAVVRGKMAKASLIKGR"
FT   gene            complement(89505..90806)
FT                   /locus_tag="BH0093"
FT   CDS_pept        complement(89505..90806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0093"
FT                   /product="V-type sodium ATP synthase subunit B"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:BH0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16614"
FT                   /db_xref="GOA:B2S1S7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1S7"
FT                   /protein_id="AAX16614.1"
FT                   /translation="MKRVYSKIESIVGNVITVMAQNVKYGELAIVKSKDTSSLAEVIKL
FT                   DREKVSLQVYNGTIGISTADEVKFLGHPMQVTFSENLFGRIFDGAGNPKDGGPRLEDNL
FT                   IEIGGPSVNPAKRIVPRNMIRTGIPMIDVFNTLVESQKLPVFSVSGEPYNELLVRIALQ
FT                   AEVDLIILGGMGLKNDDYLKFRDSLEKGGALSRTIFFVNTANDPVVESLIVPDISLAVA
FT                   EKFALQGKKVLVLLTDMTNFADAMKEIAITMEQVPSNRGYPGDLYSQLASRYEKAVDFE
FT                   GAGSITILAVTTMPGDDVTHPVPDNTGYITEGQYYLKGGRIEPFGSLSRLKQMVNGKTR
FT                   DDHRTIMDSMIKLYASSKESIEKKAMGFNMTEWDEKLLKYSGMFESKLMDLSVNIPLEE
FT                   ALDLGWEILSSCFEPKEIGIKTELVEKYWPQKKD"
FT   gene            complement(90807..92546)
FT                   /locus_tag="BH0094"
FT   CDS_pept        complement(90807..92546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0094"
FT                   /product="V-type sodium ATP synthase subunit A"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:BH0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16615"
FT                   /db_xref="GOA:B2S1S8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1S8"
FT                   /protein_id="AAX16615.1"
FT                   /translation="MEARGKVVGVIGNLVTIEVVGTVSMNEIVFIKTGGRSLKAEIIRI
FT                   RDGEVDAQVFEMTRGIAVGDDIEFTNKLLTVELGPGLLSQVYDGLQNPLPELAAQCGFF
FT                   LERGLYLSALDRKKKWHFNATAKVGDIVVAGDFLGFVIEGTIKHKIMIPFDRRDSYSIV
FT                   EIVSDGDYTIDDKIAVVENDAGGKHIITMSFHWPVKIPITNYKERLIPSEPMVTQTRII
FT                   DTFFPVAKGGTFCIPGPFGAGKTVLQQVTSRNADVDIVIIAACGERAGEVVETLKEFPE
FT                   LIDPRTGKSLMERTCIICNTSSMPVAAREASVYTAITIGEYYRQMGLDILLLADSTSRW
FT                   AQAMREMSGRLEEIPGEEAFPAYLESVIASFYERAGIVVLNDGSFGSVTVGGSVSPAGG
FT                   NFEEPVTQATLKVVGAFHGLTRERSDARKFPAINPLESWSKYRGVVEFGKTEYARDFLA
FT                   KGNEINQMMKVVGEEGISNGDFLVYLKSELLDSCYLQQNSFDSVDAAVNPERQNYMFDM
FT                   LYDILQSDFKFESKLEARGFINELRQNILDMNLTPFKEEKFNKLEVSLKNLVRSKKLDF
FT                   RGA"
FT   gene            complement(92558..93103)
FT                   /locus_tag="BH0095"
FT   CDS_pept        complement(92558..93103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16616"
FT                   /protein_id="AAX16616.1"
FT                   /translation="MLSSYYYVMSSLPYLDLEARKVWSISDFFDNVEIALSKEDFLFLK
FT                   DLSESKFVRGSLKVIDQFLEFEEIIRYTLAALRADKLGFPRDVYLESPYFSHYYLGILK
FT                   PLCLKENPFEIELELDMLKWQFLTELEVGNDFNFEKLVIYFLKLILVSRRNLFIEEIGK
FT                   KNFDDICQKLSIQISKNF"
FT   gene            complement(93114..93710)
FT                   /locus_tag="BH0096"
FT   CDS_pept        complement(93114..93710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0096"
FT                   /product="V-type sodium ATP synthase subunit E, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BH0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16617"
FT                   /db_xref="GOA:B2S1T0"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1T0"
FT                   /protein_id="AAX16617.1"
FT                   /translation="MQFEVKDLINKIKKDGLEEAEKLASEIILNAKRDAEAIILKAESD
FT                   AKELKMQAEKEAGEYKIHSLEASRQAVRDLIIATENNIKSLFKIALKDSVSEVYDDNFL
FT                   RELIIRVVDIWSKKDKIDIILNESAVSNLLSILRVNIGNRLDDAIELKPFKGISKGFKI
FT                   QQRDGNLYYDFTSDTIADILFEYLNPRFKEVIKLG"
FT   gene            complement(93834..94220)
FT                   /locus_tag="BH0097"
FT   CDS_pept        complement(93834..94220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16618"
FT                   /protein_id="AAX16618.1"
FT                   /translation="MDISKFEEFENALFNICLDVDCVLENEFGTSYKVHPNRPSRGRTA
FT                   NGLLDGLFRVTTSFTLGYGSKFGRGYLIIIEIITLDIVDVEFSNRVIERGIKVFDEKLK
FT                   EKFPGKKLSIVHDINVYKIIGVFF"
FT   gene            complement(94221..96581)
FT                   /locus_tag="BH0098"
FT   CDS_pept        complement(94221..96581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0098"
FT                   /product="MutS2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16619"
FT                   /protein_id="AAX16619.1"
FT                   /translation="MNLGDIKVMQKKYLEKIDFYQILSSVSSYVTISDTVKLLGEQQIL
FT                   KTEEEVNQVCFFVKLIKNLIEVYDEYPDSCLESISDSIVLLLKENSKISIEEIKNIIFF
FT                   LREVVKIMFFLDRNEFKVQNEIEILKKLLFLDPSLKHLLETLCKYIDVDELKIKRGVVK
FT                   DYDEIDFEIRNLDKRIEKEIKQIIGLNAKYLTSTLVYYKSGKYTIALKSSFKNKIRGNI
FT                   ISISSSGETFYVEPNEIVSNNNKLGFLSLKKTRIVLKILQELSDEIRKHIVLLQVLYNN
FT                   FLYYDSLKARAIYGIRNQGIFPKFDSNLNIVNASHPLIQNAKSISFCPLNSRVVVITGP
FT                   NAGGKTVTLKTVALLSAMFQFGIPVPVDESSTFKIFDNILVDIGDDQSIANCLSTFSSH
FT                   MNNIAYILKYATRDSLLIFDEFCSGTDIEQGQALAVAILEHLIGIDSYVIISTHYNALK
FT                   YFAYTHEFVINASMQMDLDKMEPNYNLMFSVPGESFAFNVASKSSIDSNIVFRAKEIYS
FT                   SNKTEVNEILERLAEKEREIHLLENELRDKLKLIELKEIEINNIRENIILKERDLEERF
FT                   IKEQKEFLKNSRKTLENLVREIKEGSVCTIKNKEFISNIADNITAKTAKLKLINQEIAT
FT                   KVEFKVGDKVRVSGSNSSGEIIGVTKKGFIVNTGVFNITVSSSNLEKILDNKQSRNDCK
FT                   TNFSFSFESQDDVLGLTVDIRGMRVVEAIDFLNKKIDNMLLKNVCKFEIIHGKGEGLLM
FT                   EGVHAFLRDVKFVKKYYFAHPSDGGVGKTIVEF"
FT   gene            complement(96529..97470)
FT                   /locus_tag="BH0099"
FT   CDS_pept        complement(96529..97470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0099"
FT                   /product="GTPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16620"
FT                   /protein_id="AAX16620.1"
FT                   /translation="MNDLRFEVLWGVNNIYSILEVNTNSIYEGVIKGKVLNTQDKEYSP
FT                   LVPGDFVCGDIYDEVKVYIKDRLQRKNVLWRYNKKAALRQVIVSNIDNVLIVSSANLPE
FT                   IKNSFIDRVLVIAEEQGITPIILINKVDEGISDKVDTLIKIYENLGYRVIKTSAITFQG
FT                   IDEIKEIIKNSKASFVGQSGVGKSSLINAVDLNASQAINEISYKYARGRHTTVYAMAFH
FT                   SDNGVVIDTPGIKEFGIESLEYFNLRYYFREFKDLNDLCKFNSCLHINEPNCFIMSQIG
FT                   FQISEIRYNSYLKIVNELRRYKSYAKEILGKN"
FT   gene            complement(97467..98231)
FT                   /locus_tag="BH0100"
FT   CDS_pept        complement(97467..98231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0100"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16621"
FT                   /protein_id="AAX16621.1"
FT                   /translation="MSNLEDVIVIFDSGIGGLSYFEYISKRFVNRNYVYIADNKNFPYG
FT                   EKSPEFLLKEILELVLKLEQMYNIASIVIACNTASISVYDKLNLRFPIIYTLPSVGLVE
FT                   ELACKRVILIATSSTINSEFVQREKKCHWNLILKSASELVNFVEYGDRFKEDALRYLRA
FT                   LQLEVEANRRDMVFLGCTHYLHIKDMIESFLGIPVYENRELVANELAKVLGPIKCSDNC
FT                   FIRYFYLTQDENLCFYKNFCKRYGLHFKGIIN"
FT   gene            98375..99760
FT                   /locus_tag="BH0101"
FT   CDS_pept        98375..99760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0101"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BH0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16622"
FT                   /protein_id="AAX16622.1"
FT                   /translation="MYKSIKEILSNPILDTMITVKGWIRTKRSNGKISFVEINDGSNIK
FT                   GIQAVIDEEDPQFEKQEFKKLTTGASISLTGILILSPAKGQAYEIKTTKFNVIGEADQE
FT                   TYLLQKKRHTFEFLREIPHLRIRTNTFGAVARIRNQISYKIHEYFQKNGFFYIHTPIIT
FT                   SNDGEGAGEIFRVSTLDLNNIAKGQEIDFKNDFFGKQAFLTVTGQLHGEAYAMALSKIY
FT                   TFGPTFRAENSNTTRHASEFWMIEPEMAFFTLEDNINLAEDFLKYILRETLNHCGQDME
FT                   FFDNFIEKGLIKKIEDVINSNFEVITYTQAIKKLENATKTFEIKPYWGMDLQTEHERYL
FT                   TEEIIKKPTTVIDYPKEFKAFYMKMNEDNKTVKGMDILVPRIGEIIGGSEREDNLDKLN
FT                   KRIKELNLEVETLNWYLDLRRFGSTPHSGFGLGLERLIQYITGMANIRDVIPFPRTPKT
FT                   LYF"
FT   gene            99783..100355
FT                   /locus_tag="BH0102"
FT   CDS_pept        99783..100355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16623"
FT                   /protein_id="AAX16623.1"
FT                   /translation="MQRKILCKILLMSSTLMLFSNEKPENNLKIFSNIEEEITSKKPNY
FT                   KYSKAKPKLNKSNKINYPHTKKNYHHNTTREKNRNLQIDKPNKRQDVRRPTNNIVKIRQ
FT                   SNKIYYPKDKINIQTSNSEKNVWYNIKVYPTHTKDRFKKIKALNKINTQIKKDFALIGP
FT                   IPKDNLGEITKALHIRGYNELEYIKIE"
FT   gene            complement(100358..100954)
FT                   /locus_tag="BH0103"
FT   CDS_pept        complement(100358..100954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0103"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16624"
FT                   /protein_id="AAX16624.1"
FT                   /translation="MLMKKFVSYEEIRVNGLKLAYKIYKNGFIPDIMYVSLRGGAYLGN
FT                   IISEFFKFIKLEKPLLYAAVVARSYDVSNKQKEIMIDGWTYDPKYLRAGDNVLFVDDIF
FT                   DTGRTIIHLREEVLKRGIDSKNVKIAVYDYKERGYVDYKPDYYVNKYSSEDELNTWIHY
FT                   SNHELIGLSENEYKLNFVNLDDELNDILKFLSSKL"
FT   gene            complement(101256..102710)
FT                   /locus_tag="BH0104"
FT   CDS_pept        complement(101256..102710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0104"
FT                   /product="protease Do"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16625"
FT                   /protein_id="AAX16625.1"
FT                   /translation="MEVYKMKKNFISVFLTSFLALAIGFFVGIHYLESDKNTIVFAQEK
FT                   GDTGQSLQDSFRKVSKKILPSTVEIYATGIVKTRDFLNFFFFFDAPGLNLEKKAQWGGS
FT                   GVIIGRDSKKTNLFYALTNSHVVDNAVEFEIGTYDNKTYKANLVGKDDKKDIALVSFEA
FT                   NDAAIEVAELGDSDKLEIGDWVIAVGSPHHFSFSVTAGIISGLHRSVTPNLKARNSFIQ
FT                   TDAAINRGNSGGPLVNIKGEVIGINTWISSPSGGNIGLGFAVPINNAKSSFDVLMSGKK
FT                   NESAWMGVDLHRLRGKDPELFKSLGYEDDSGSLAIISGVFDGTAAFKAGLKAGDIINKI
FT                   NGVQMNFFYDVKQYINDFYAKEKIKVEILRGKEKKNVEIELDVKPKINNEKEYVSDIKL
FT                   LPGFTVYPLTKAVKTQLGLRSWINGVVVDSVDSTLGTNPKVATGDVIMIVNSKNIKSLR
FT                   DFYDAVEYRKNTYSILRDGQTLKVSF"
FT   gene            complement(102754..103506)
FT                   /locus_tag="BH0105"
FT   CDS_pept        complement(102754..103506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0105"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:BH0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16626"
FT                   /protein_id="AAX16626.1"
FT                   /translation="MKLRLKSREEIKKIRASARLLAQTLLEIEKNIVPGISTKMLDLIA
FT                   SDFIAKNGAKSAFKGYNGFRGTICASVNEEVIHGVPGSRELKDGDIISVDCGVILDGFY
FT                   SDMAKTFKVGKVNPKISKLLEVTEASLYRGIAEMKVGNRVLDISKAIESYIKPFGFGIV
FT                   REYTGHGVGFALHEEPGVPNYYEPFFKNIRIQEGMVLAIEPMVNLGGHKVSVKNDGWTV
FT                   FASDLSCSAHFEHTVAVVDGLPLILSKI"
FT   gene            complement(103511..105166)
FT                   /locus_tag="BH0106"
FT   CDS_pept        complement(103511..105166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16627"
FT                   /protein_id="AAX16627.1"
FT                   /translation="MKANKILLFLILFLVLFISIFVYLSLNPYVLYMLKGERDFNDVII
FT                   EVDGYLSNGNLEGAEKIIRFYSYYVDTEYKWLSLIKRAKLYSDKIKHYLLMRDILDLSV
FT                   KSLPGNLKLRALEVYSKLKVGAVLEAYDIAKQYLLGYKEYKHLYDEAFMKSLILSYDIK
FT                   DIKDFLIKMEQERDALAFETVGLNLQNNAFLINAMLLYIEKKDLDSAKRILLQIKEDKD
FT                   FAKELAYISYGLDNLDFTITNLKLINNNNEPSLMFLLADAYLKKGDIHNAKNEYLKLYT
FT                   DFPDYSMMIYLGLAFIAKKENDLKRAIAYLNKANEKFKENEMMSYYLANIYFEANDYFN
FT                   ANEIVKKYKDSPLFFKLYFVLNYLNLKYEAKKSFLWRLFYRSNYNTDIAQLLAWNLLLY
FT                   SDLKDLDLFFKIYNPVDEVQDWYYFYKFYYLFLKKDLRVAEKVIFENQMGKYLYGVYYN
FT                   LGVLRFYQKNYKESEEYFSKAVALLPFTLDDKSKITLREREDVARMYLKRGINYLYLGE
FT                   FAKGREAILTSHSFYETNRGKLYMNMIEILKERD"
FT   gene            complement(105153..105593)
FT                   /locus_tag="BH0107"
FT   CDS_pept        complement(105153..105593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0107"
FT                   /product="N utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BH0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16628"
FT                   /protein_id="AAX16628.1"
FT                   /translation="MVMNLRHKARVLAFQKIYSIDVNCKAKDNIYDIFGLEDHGVDLEE
FT                   DLKLFYSVLVNGTCDNLESIDKLISDISLNWRLDRMDKVDLAILRVSVYSLKFQNLDVP
FT                   KRVIIDEAILIAKKYGSKNSYKFVNGILDALLKDMESSFESK"
FT   gene            complement(105613..106647)
FT                   /locus_tag="BH0108"
FT   CDS_pept        complement(105613..106647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0108"
FT                   /product="basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16629"
FT                   /protein_id="AAX16629.1"
FT                   /translation="MIDIKVIFMGNFLCFLLFFIVGITSFAQNTPVVIINLHSNEIITK
FT                   TEFDSKVNTLKKTQGRDLSNAERKQVLQILIADVLFGQEALKQGIKVGDEEVMQTIRAQ
FT                   FGLASLTDEQIRQMIESQGTNWNELLSSMKRSLSAQKLILKMAQPKFSEIKTPSEKEVI
FT                   EYYEANKTKFVNPDISRISHVFFSSKDKKRSEILTKAKDIANQIKSKKITFEEAVRKYS
FT                   NDEGSKAKNGDLGFLARGDQNAQNVLGLDFIKEVFMLNKGDISQPISSKEGFHIVKVTE
FT                   MYSQRFLGLQDKISPNVNMTVKDAIKNNMVNIHQQQIVARVQQEIYDKLNKSASIQILD
FT                   SSLK"
FT   gene            complement(106718..107923)
FT                   /locus_tag="BH0109"
FT   CDS_pept        complement(106718..107923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0109"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16630"
FT                   /protein_id="AAX16630.1"
FT                   /translation="MGFDMRKIAIIDGLRLPITKFGGALKGINIVDVSSDVVKALLGRN
FT                   NIDRVDEVIIGNVISAGLGQNIARQIALKAGLGEITPAFTVNKVCGSGLKSLELAFNSI
FT                   ALGNSEIVLAGGVEDLSNAPYLLPRGVRFDGLKFGDFKIEDSIYKDALVDTPSSTVMGL
FT                   TAENLAEMYEITREMQDQFAYNSHMKATAARDNGYFNDEIYPLSVFDRKTKLKRVICSD
FT                   EEIRDSLSLEKLSSLKPVFKEGGTVTAGNSSSLDDGACFLILASEDFVCKTGVQPLAYV
FT                   GGFKSVGLNPLHMGFGAFLAIEEIIGKFNLIPSEIDFIETNEAFAAQSLSVLKALRQKY
FT                   DVQDSIINVNGGAIALGHPFSVSGARILLTLARLMRINNKSKGIASLCIGGGQGIAAFL
FT                   YR"
FT   gene            108001..109356
FT                   /locus_tag="BH0110"
FT   CDS_pept        108001..109356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16631"
FT                   /protein_id="AAX16631.1"
FT                   /translation="MYLVKFNLKTIIIMLAINSYAYNYSIRYQNDGVDKYHFDNLNDAL
FT                   GFAFSDCFDDLRSGSLIFMHESKYNFMINAEAHMLTFRGNKDSPEQSRKRADLLEIGFM
FT                   YYLPFSIKTKTQYFGNINIGIGIKNLLYGNWGGALIQRAVHFTLRQMRPIPKNYENYNY
FT                   RGFLSAAINYSYMRFFNLENYIDLSYFADYFFKTSISMDFKNESIGIETKFFYQAQNEI
FT                   NNMETYSQLQKAETGIGIQYRLHSKNFFTINNLNLNNFSNKEKFFSVGGFGIVFTEEYE
FT                   NNSEDNLYTLNQNFSFGYDIMIPFQTRNSIYYRIMPQLNYYFAIATNYDINLSVLNSRT
FT                   NRFSSGLTYELFTKNQFTLYACSGIFLSYNQDTKDVKSIYRPLKIKDTLQAGFEIEPGM
FT                   SINTFIYNKTTYNIKIFTKINYSPIVYNTNNHTLETHKFTFNYIGIGIKINI"
FT   gene            complement(109543..110928)
FT                   /locus_tag="BH0111"
FT   CDS_pept        complement(109543..110928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0111"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16632"
FT                   /protein_id="AAX16632.1"
FT                   /translation="MAFTSVSTASTLLFNEGAEKAVISSIFYNPGKVEEALLYLKPDDF
FT                   YNQNHEMIFKAMISLYEKRENIDPITVFEEVSSLTPKSQLLSNFKALTGLQDYLSFLSG
FT                   YLPTDKTINVYVKIVKEHRIRRDISKISRELNDLANDSTKKVEQFVEEAQRQILSIELD
FT                   CSNKNFNHAKVIAERVHAEIYERSVKKREVNFGIPTGFKKVDSLIGGFRESDFIIIGAR
FT                   PSVGKTAFALNIASSIALRNDKKRKVGFFSLEMTSDALIKRIIASQANIDSFKIQNSIL
FT                   SSHEIKAINDVVNDISNSEFYIEDTANISLLTLATQARKLKRFSGVDILFVDYISLISL
FT                   EAKNIPRHEQVASISKALKELARELKIPIIALSQLTRDTEGREPSLASLRESGALEQDA
FT                   DIVILLHRDKDLRGSSDDERVVSAVDTKVIVAKHRNGPTGRADVLFLPHVVKFVNKEHE
FT                   SDY"
FT   gene            complement(110945..111439)
FT                   /locus_tag="BH0112"
FT   CDS_pept        complement(110945..111439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0112"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16633"
FT                   /db_xref="GOA:B2S1U6"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1U6"
FT                   /protein_id="AAX16633.1"
FT                   /translation="MRVILKEDFINLGKEGDTVDVKDGFARNYLLPKGFAVFSNKHNID
FT                   IFNQKRRAILKRQETRKKIALELKAKLDKVSLEFVMQSNDGGKLFHSINSLNIADELLK
FT                   LGFEIERRKIDIHYGTLKTFGIYDVTIKLYEGINAVIKVEIKREEKKKSLKKSKSVAKE
FT                   V"
FT   gene            complement(111454..111744)
FT                   /locus_tag="BH0113"
FT   CDS_pept        complement(111454..111744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0113"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16634"
FT                   /db_xref="GOA:B2S1U7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1U7"
FT                   /protein_id="AAX16634.1"
FT                   /translation="MYKDVDSHQRDSRSDGHQDGFKKNPNFRFFKKKTCKFCDMDRVPD
FT                   YKEFDFLKKFITEQGKILPRRITGTSAKHQRRLALEIKKARYMALLPFVKQ"
FT   gene            complement(111757..112194)
FT                   /locus_tag="BH0114"
FT   CDS_pept        complement(111757..112194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0114"
FT                   /product="single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16635"
FT                   /protein_id="AAX16635.1"
FT                   /translation="MADINSLVLSGRLTKDSELTYTEAGMAILKFGLANNRRVKKSNEW
FT                   VDYAQFFDCVIFAKRAESLSVFLKKGKQVVVSGSLKYESWQDKNTGDKRSKCSVLVDEI
FT                   QMFGMPLAAQGANNVGFESYKKPDPFTDIGFGDSFNEDIPF"
FT   gene            complement(112215..112610)
FT                   /locus_tag="BH0115"
FT   CDS_pept        complement(112215..112610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0115"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16636"
FT                   /db_xref="GOA:B2S1U9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1U9"
FT                   /protein_id="AAX16636.1"
FT                   /translation="MIKKYEACFLFKSEELEYKVALEDVKKQLTAFNASDFVENSLGER
FT                   ALEYSIRKQSRGRYEIIEFKMDSSNLKELEVQLRLIKNLLRYMILVKINKKVNVKKVKR
FT                   RNFREFKDNRDTREKELPESTADVKVD"
FT   gene            complement(113133..114845)
FT                   /locus_tag="BH0116"
FT   CDS_pept        complement(113133..114845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0116"
FT                   /product="PTS system, glucose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BH0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16637"
FT                   /protein_id="AAX16637.1"
FT                   /translation="MERPIVINFFKVLRFANLQKFSNAVRLPISVLTIFCLMLGIGSAL
FT                   SSPSNLFYVDNIVFKVVLGLIKNTSNIIILNIPLLFVIGITVGVARAQKGPAALSALIG
FT                   YLIFNVTENYFLDLFSELVEPNLMSSVGQVNILGIQTLNTGILGALSVGLLVGYLHNKF
FT                   YYIELPGPFNFFAGFRFVPIVVFPFCILLGGIFVFIWPYFNELIVSFGFFIAKFNYFDS
FT                   FLYGVLNRMLIPLGLHSILTFPFNFTSLGGTEVINGQVVGGIQNIFYAQLSDPYLTRFS
FT                   SSISRFNSGFYLSIMFGLPGAAFGVYRGIIHDDKSKVFSLLFSGAFAAFLTGITEPLEF
FT                   LFVFTAPLLYFVHAIYTGFALLIANVFDIAVGAAFSAGFFDFFMFGILQGHDKTNWIYL
FT                   LPLGFAFFALYYFTFKWVYNYFDFQIFGVGEPFFAGIEGEVEGMGIAHLIIQGLGNLDN
FT                   IQEFDVVSTDLSFVVFSPELISEDILKKTGALNIVTIDNTIKIDYGTNVYYIKKAIENY
FT                   SPERLFKASVVVASDNVKQGIKAYIEMKEDDKLEKQGSTGKLYKLNDNNDNDN"
FT   gene            115070..115759
FT                   /locus_tag="BH0117"
FT   CDS_pept        115070..115759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0117"
FT                   /product="conserved membrane protein"
FT                   /note="hemolysin III-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16638"
FT                   /protein_id="AAX16638.1"
FT                   /translation="MFKKKKKHKSYHASIPKNELFSSISHLIGIILSIIGTTILITLSI
FT                   NSEKYLHAVLFLIYGSSMTLLYTMSTLYHMFTRGSKIKQLFRKFDHISIFILIAGTYTP
FT                   PCLILMPNVYGKIILIAVWGFAILGIIFKSIYINSPGWINGCIFILMGWSIIFGIKLIY
FT                   EILPIKGFVWLGLGGILYTLGGIVYSTSKKLNPIANMRMHDLFHILILLASFAHFWFML
FT                   KYVLPIN"
FT   gene            complement(115811..117094)
FT                   /locus_tag="BH0118"
FT   CDS_pept        complement(115811..117094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0118"
FT                   /product="membrane metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BH0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16639"
FT                   /protein_id="AAX16639.1"
FT                   /translation="MYIFLSILAFTFIIFIHELGHLLFAKLFKVKVEVFSIGIGPSLFK
FT                   IKIKETEYRFSPIFLGGYCKLKGSEHLENELKLNRQLEADKDSIFGISHFKKILIYFAG
FT                   PLFNLIFAFIIFVAIEMIGIVYPDYPSKIVVINNSASSKFKDGDVILSVNNNNIKYYSD
FT                   LNKFVSLKDSRMTFTVLRNGDRISFEEHTSLDKLIKEIGPWVDLIIAKVKTNSSAEVAG
FT                   LKPNDKIIGINDVALNNNEDLNNLTAKLDVNVVDIRYERNGEILTSKLVFQDTNKSLGI
FT                   HLLPGLDRVVKADNLGIALKNSFNKVLNILGNILKSIISLFTNFKNNSKNIVGPVGMMS
FT                   IVIGSFSFGILYWLNTIAIFSLLIAGMNLFFVVIPMLDGGQILISLIELLRGKRFHAKY
FT                   IYYFYIIGILLMLSLFVLGFLNDLRNLI"
FT   gene            complement(117111..118016)
FT                   /locus_tag="BH0119"
FT   CDS_pept        complement(117111..118016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0119"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:BH0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16640"
FT                   /protein_id="AAX16640.1"
FT                   /translation="MIETWNVLRIGREILGDKSLFNLKSRKLTFIARLGTFLFFVPLVL
FT                   FLIFLEYENYLLINILIFMFSGIAAKEVNDLLKVKSSSISSILSFFLGVSPPILTYLHY
FT                   NIFDLGINIIFYLGITLVFSNWIVNLVFIKENEIVNFLSQATSIIFILVYPGFLMSFVV
FT                   AITTLPRAPILLLILFSMVSGNDTFAYLVGYFLGKNSYRPTIISPNKTIMGFLGGILFS
FT                   VIVAMVVVFLGLINLTYGEAMIFGILIGFFTIIGDLFESGLKRSAGVKDSGNIIPGRGG
FT                   ALDSIDSYLLTGPIFYLYLS"
FT   gene            complement(117964..118656)
FT                   /locus_tag="BH0120"
FT   CDS_pept        complement(117964..118656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0120"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BH0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16641"
FT                   /protein_id="AAX16641.1"
FT                   /translation="MSSNSLPMHVGIIMDGNRRWALKKGLSFFEGHKEGLKRAKEIVKH
FT                   SLKLGIKYLSLYVFSTENWNRTKSEIEYLMFLIADYLSSEFEFYSANNIKILVSGDIEA
FT                   LSEKVRKSIIDAIEFTRNFDGLMLNLAINYGGRNEIVRATKKILGSGLQFGTLDEVVFS
FT                   KFLDNPELCDLELLIRTGGDMRISNFLLWKIAYCEFVFSSALWPEYSISHYDRDLECFK
FT                   NRKRNFGR"
FT   gene            complement(118661..119215)
FT                   /locus_tag="BH0121"
FT   CDS_pept        complement(118661..119215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0121"
FT                   /product="ribosome recycling factor"
FT                   /note="RRF"
FT                   /db_xref="EnsemblGenomes-Gn:BH0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16642"
FT                   /db_xref="GOA:B2RZI6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZI6"
FT                   /protein_id="AAX16642.1"
FT                   /translation="MEEYKALLDEKMDRVLLSLDSEYKSLRTGRISSALFDKVLVDYYG
FT                   EKTPLTRVANISIPEARLIVIQPWDKSLLSKIEQAILSSDLSMNPSSDGSVLRIKVPVL
FT                   TVERRKEIVKQAKKIAEEYKVAARNVRQELNNKAKKQEKDSQITEDDLRRILDDIQRDT
FT                   NSYIKKIDEIFDLKTKEIMEF"
FT   gene            complement(119250..120086)
FT                   /locus_tag="BH0122"
FT   CDS_pept        complement(119250..120086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0122"
FT                   /product="protein translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16643"
FT                   /db_xref="GOA:B2RZI7"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZI7"
FT                   /protein_id="AAX16643.1"
FT                   /translation="MSISPQEVKKLRDATGAGFGDCKKALDAVGGDFELAKKKLREMGI
FT                   ASADKRSGRDAKEGRVFSYVNKERVGLLLISCETDFVAMNGDFVTFGNSLIKQLVESGK
FT                   DSLDEQQELEIKNLAATIKENIHVSKIYISNIASNELVKNYLHGEQSKIGVFIKLRVDD
FT                   VLKIEDGSLNSLTMDLALHVAAFAPLYLSVGDVCPNYIKEQEEVFMKQMEASGKPENVI
FT                   KGIVSGKLKKHLGEITLLEQGFVKDDKLTVKEKIEEVSKSILTKIEIIDFKYFSVG"
FT   gene            complement(120104..120868)
FT                   /locus_tag="BH0123"
FT   CDS_pept        complement(120104..120868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0123"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16644"
FT                   /db_xref="GOA:B2RZI8"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZI8"
FT                   /protein_id="AAX16644.1"
FT                   /translation="MAVITMKSLLEAGVHFGHQVKRLDPRMKRFIFSERNEIHILDLQK
FT                   TLQGIKDSYELVQSVIKSGKKVLFVGTKKQASEIIEQEAKRSDMPYVNNRWLGGMLSNF
FT                   NTIKKSVQKLKKLEKMEIDGTFEMISKKEVSQLNREKLKLSKNLTGIKDMEELPGAVFI
FT                   IDPKREQIVINEARKLGIPIISVVDTNCNPDVIDCPIPGNDDAIRSVALFTKIISDAIL
FT                   ESDKEVGIQIVENLNEEDLMSEIEVKNEKKEL"
FT   gene            complement(120904..121503)
FT                   /locus_tag="BH0123A"
FT   CDS_pept        complement(120904..121503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0123A"
FT                   /product="septum formation protein Maf"
FT                   /db_xref="EnsemblGenomes-Gn:BH0123A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16645"
FT                   /protein_id="AAX16645.1"
FT                   /translation="MIYKENFEIALVSSSLVRAEFLEALKINFLSLSVDIDENLIMKTG
FT                   ETGVTERIAVLKLTSAIEKYGKDKCLITVDTLLKNDSVYVGKIRDEKEAFSKIMGYSNK
FT                   LIEVETSFCIFIPTKEKIVKACEISFIKFRELTPDIVYHYIELGHWKNKAGGISLKNGV
FT                   ADILIEYINGSYSNIIGLPIGLFYDILIRENVISAM"
FT   gene            complement(121493..121771)
FT                   /locus_tag="BH0124"
FT   CDS_pept        complement(121493..121771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16646"
FT                   /protein_id="AAX16646.1"
FT                   /translation="MVTFFFHLILTNIIVSFVISFIIVFFGILRFGFLLVYFISFLGSV
FT                   LFLFFIPLFYSDYYNRQVDILFYLFPVIGSIVLISLLRFSERSKNDL"
FT   gene            complement(121785..122552)
FT                   /locus_tag="BH0125"
FT   CDS_pept        complement(121785..122552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16647"
FT                   /protein_id="AAX16647.1"
FT                   /translation="MKKFSNTTFVVISLLIFGCGIEDIAIIDSPLVVDSRASRDTLAFK
FT                   LPSGYFNNHNNSKIRGFDIYYKFYPEGSNYHFGSFTKSVQRDFDALKSVFNNVNEFNRR
FT                   GFYKINLDGDRSSGRPTLKLDKSWIQGKFPLYIEFNFENLRKSTPGSVFISIRNGSDSS
FT                   APLIKHIKTIYRSYVVNGLYSEFSEALKKSKVADSDKRPFDLKHISDNFFTKDVSPKYN
FT                   LVIFVMAAGNAIEDELYSVIVNIGSLNSFELSN"
FT   gene            complement(122576..123184)
FT                   /locus_tag="BH0126"
FT   CDS_pept        complement(122576..123184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16648"
FT                   /protein_id="AAX16648.1"
FT                   /translation="MLMFKNKFFVGILAVIVFVGIILCFYDSMDIDHVKAGGEVVENLE
FT                   RDLNLYLRAKNAEEKLKLEPKIEEAVNKRDDVAHEFLPRFYLARSTYFQIKGLYKEALK
FT                   DLDIVIGSKWIERELAYINKAVVYEKMGQVEDALLIYDNVIKQTKLDFIKIRALLGKAV
FT                   LIEAKDKKLAIEIYSKIANFSYENNLYVNVAKNKLLQLR"
FT   gene            complement(123171..124838)
FT                   /locus_tag="BH0127"
FT   CDS_pept        complement(123171..124838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0127"
FT                   /product="SSU ribosomal protein S1P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16649"
FT                   /protein_id="AAX16649.1"
FT                   /translation="MRMEKQEDLQENYLKVLEKVELGSSVSGVVINIMKDYVLVDIGYK
FT                   SEGFIKIDEFETIPNVGDKLDAIVTRVGGELGLVLSVAKLDSLNLQDKIDEYIANRKVL
FT                   KGKILVELSSGYKVQINENVTGFMPSYLSSKIRDEKLKRGLVVEFYVIQADKTDGLRLI
FT                   LDRRTLERERELLKRKELVNSYSEGDIVDGVVERITDYGAIIKVKNLVLGVLHKRNIAF
FT                   SRVENIEDFIRVGDKLRLQIIKLSVNTGKMELSLKALKANPWDSVESRYKIESIVKGKV
FT                   VKILPFGAVVELDSEISGFLHISNFSWVRVIKSPQELVKVGQIVEVKILEIDKENQKIS
FT                   LGIKQVNENPWNSLSQRCDVGKVVQGVVKNITKTGAFVSIEEGIDAYISKFDISWVDEI
FT                   NPEEYFKLGSSISGKVIEFDAKKQNIRLGIKQLEENPWDDFSKSYKKGDTLEVEVLEKK
FT                   SKGVQVRVYGKIMGFISKIQLGDTKESSLDTFENLNVGDKLKVMITNIDFKNKLVLLSY
FT                   RAYKEQKSSEEISSYLFKEDDEESYKPFANLLKRNADV"
FT   gene            complement(124846..125502)
FT                   /locus_tag="BH0128"
FT   CDS_pept        complement(124846..125502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0128"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:BH0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16650"
FT                   /db_xref="GOA:B2RZJ4"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZJ4"
FT                   /protein_id="AAX16650.1"
FT                   /translation="MIIAIDGPSASGKSSIAKALGSRLGFKFISSGYFYRIITLIAQKF
FT                   TLNEYDLLSESKILELVLQNDIKFNGVDFLLNGVNVTSHILNERIDLQVSLYSSYIGVR
FT                   NIVNKKLREIVKLKDDNYIIEGRDITTVVFPEAKVKIYLDASVKVRALRRYNQRDDDIT
FT                   LNELEQALERRDEIDQNKEYGKLKLAKEVFYIDTSYKCLDDVCDIIIKTFNLKKK"
FT   gene            complement(125486..126247)
FT                   /locus_tag="BH0129"
FT   CDS_pept        complement(125486..126247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0129"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BH0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16651"
FT                   /protein_id="AAX16651.1"
FT                   /translation="MTNINSRGLRAHVFLAEKGMGSRRFCEELIRKNLVKINGTLAKLG
FT                   DKVFLGDRVEYRRQVFVLRDLKIESKIYIALHKPKNYLCSNFDPEGRKLAISLVQPLFK
FT                   ERLFSIGRLDFKSSGLLLFTNDGQFANSIVHPRSEVEKEYIVESKKDVNEDLLINFKHG
FT                   IKIEREIFKLKSYEMLGNNSVKLVLTEGKNREIRKVFLSKNIFLKKVHRIRIGNIKLDN
FT                   LKEGQIKVLSLAKINRFKTQLLGGILNDNSN"
FT   gene            complement(126219..127022)
FT                   /locus_tag="BH0130"
FT   CDS_pept        complement(126219..127022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16652"
FT                   /protein_id="AAX16652.1"
FT                   /translation="MLRKIKNKMVGLDDYLIVCNDFKGGIEIFFDYVRNKREILKTFNL
FT                   NKIIEDFLTFSESIEIDVKDLIKFYSFSTSLLYLKTQILYPVKLKDKKLVEREIVQKLI
FT                   NYSEKSAEIRSATHNLKDGVCLNVFKSSFFRENGTFLESVDNIQDCKIEINKVKSTVRV
FT                   ARVERKHDDIPRNIKLRSNVILGTYDAKFLDKKTRIIALLTKEDNLIFEFLLDFDDKFY
FT                   FFERFCYFLIALEYKMSNIIDLVYTNDKLVLRKGKSIDEYKQQRA"
FT   gene            complement(127022..128092)
FT                   /locus_tag="BH0131"
FT   CDS_pept        complement(127022..128092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0131"
FT                   /product="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16653"
FT                   /db_xref="GOA:B2RZJ7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZJ7"
FT                   /protein_id="AAX16653.1"
FT                   /translation="MSKLKDNPDNSLNDRLNREKAIELARVQIEKDFGKGSLIKMGESP
FT                   VGKGIESISSGSILLDEAIGVGGYPRGRIIEIFGPESSGKTTLTLQAIAEVQKNGGIAA
FT                   FIDAEHALDPAYAKALGVNIDELWISQPDTGEQALEIAEYLIRSGGVDLIVVDSVAALT
FT                   PQAEIDGEMGDSQIGLQARLMSKALRKITGILSKSNTCIMFINQLRMKIGVMFGNPETT
FT                   TGGNALKFYSSLRLEVRKIDQVTGSSADDIVGNKIRIKVVKNKVAPPFRKVELVIYFGK
FT                   GISREASILDASVKYNLIQKTGSWYSMGDDKLGQGREHAVSYLVKEKEVTDELESKLRK
FT                   IIFEDPNQDFLEVGTT"
FT   gene            complement(128102..130807)
FT                   /locus_tag="BH0132"
FT   CDS_pept        complement(128102..130807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0132"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16654"
FT                   /protein_id="AAX16654.1"
FT                   /translation="MSNITIERLDNILQEDKWTRIVVNNYSLAKIKELDELIDSIISEN
FT                   LTEEALDICGKHLKDVKKSIAGLYISGMLIYSRRPLNDMSLLTVVDLFSQNLKWSLVEH
FT                   ICNKMLLTSENKHALYTLAKIYAQNNENDKLPDIWMRIVESDVDDTVFVRQLATHYENI
FT                   DLQKSIYFFRKAIYRFIDKKQMSGIREIWSKLIKYVSDDFDSFLLILQKVEKELGFKKV
FT                   VVLYEDLYGHYSVSGNIDETIEILKGILKLDNKNQKARENLVIFLREKYKDIKNIEEYL
FT                   EKSDIENLDKNFVDVYSDFEKYLFFAKGNFVYHQTWFVGIVKDVNEQGIVVDFVSKRGH
FT                   FISFDMAISALSPLEKEDIRVLKAIKPKEELVENLKRDIEWALRIIIKSYKSIDLKGIK
FT                   RELVPSLMTQSAWNAWSVKAKQILKDNPHFVMASGKADCYIYNERASNFNEKVYDKFKI
FT                   EKDFYKRYEIFMHYCGTSGGVVKDLHVEEEMLNYFLIYVNNFTKVDHYVISSYVILKSL
FT                   KNSESGVAFKINIEKDINLEVLLREYSKNIVDLFDSILNAEIKKELVSLIKEELVDWVA
FT                   YYKQLFPYYVNKKLIDSLYKEDIKETSQLFNYVIKNYKVYKDAYIWILKHYVSYSLNLD
FT                   YSDSELLVNLIKILTDSVVKINNKNNSVANKRIYKMVINLLIKDKYLSIVLNKVMDEEL
FT                   AKRIYMTCFYIRDFPPKDLLHIKTAIRTVFSAIEFEDEKLQFSGDKVEIGFLTILSSLS
FT                   KKQKELQYLKDVEIPENSKEIGKARELGDLKENAEYHSAKERQQFLTKRLNSLMLEIDV
FT                   AKVVDTKELQSSVVGFGTKVTMINKDTGREEFYLIFGPWESNPDEGIISYKSPFGENLL
FT                   DAKEGDNLDFVINDTRFQYYVKKIEPARIN"
FT   gene            complement(130843..131787)
FT                   /locus_tag="BH0133"
FT   CDS_pept        complement(130843..131787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16655"
FT                   /protein_id="AAX16655.1"
FT                   /translation="MSSEKIAELIKDIYLSFRKGDFKTALMKSEEAHSLDFDNIEILTA
FT                   LKSSVYWNGQVESLDRIDKDYEKAEFLIREWNNFARRYLKKMNSDFIQGRNSIKYFIFQ
FT                   LCLDIYKNIYKLQPENLDLLIKIAKSYKGMGNYERAIAVFLQILGDAKDNADVVAELAD
FT                   SYALIDEIKEAKVLFREAFFINPQKIDIDALESEMILKLIEAIKSDRNISDTLIKEWIP
FT                   VYGALNGVFNIKRELRPIELGHLKQSVYSLRNELKEKSYRSINESILLPRLINKYFWLI
FT                   DHYVRIKEDRVRIDEILSYIKEIDIGIYQQYVN"
FT   gene            131967..133112
FT                   /locus_tag="BH0134"
FT   CDS_pept        131967..133112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0134"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16656"
FT                   /protein_id="AAX16656.1"
FT                   /translation="MKMEPNKLINKSIRYYNSHKYSDVIKLLEKEIFFYKNYYFYHYIL
FT                   GMSYLRMGNLGNAQTYLKKAYTLNPTEPDVKQSIAILLAAQGKEDKAIQIWLKMIEENQ
FT                   EIKRSELSLETIRKNPIQGTLFMNKNKIYAKLFPEIKIETGQNLSKLIRILLTVAGLVF
FT                   SLISIFLFIRSKETTTLTSNDSKVKEKKAINNIAAYIDDIKINEKEKIENHEGQFVFIL
FT                   TETEIKNSFQKIKTHLKKGKNNFARIEINKILNSNASESIKLKAKNLASFISRPDFITF
FT                   DDYLVLKEIKKNPLIYSNIYVKWEGIANNIEKKDNITYFDFYVGYNKNALEGIITTKTT
FT                   FDIDINFKDCVEILGQINYDYNTNTLTLNAITIRKIEKQKG"
FT   gene            complement(133200..134570)
FT                   /locus_tag="BH0135"
FT   CDS_pept        complement(133200..134570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0135"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BH0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16657"
FT                   /protein_id="AAX16657.1"
FT                   /translation="MDIRTLKGFRDYLPKEALIRTHIIKQIYSVLVSYNFDLIDTPILE
FT                   YSEFLLRKGGHEVEKQIYRFKDNGDRDVSMRFDLTVPFARFMATNRSKIQFPFRRSQIG
FT                   KVFRGENTQRGRYREFIQFDFDIVGEDTFRSDAEILSIVYCGLEEIFLNFIEGINRKFV
FT                   IHFSHIGILNAYIDKLGLENKATFILRNIDKLDKMGIESVRENLLSQLSEEHVDLILGF
FT                   ISLEGTFWDKLKVLKSILEDNDAVKRVEDIFVHLSALGIQDAFNFNLKIVRGLDYYTGL
FT                   VFEAEMMGINMGSICSGGRYDNLLSLFSNSLQKVSGVGGSFGIDRIQDIIEIEKFNYIK
FT                   LFVVKASSRVLIVNIDDSLQDYYYKLADKFRRHDYSKINNIACEVYPKSKDGKNIKVQI
FT                   EYALGKAIRFLIFVGQEEYRENKLKVRDLTKKEELLLSFDEAIKFIKGNDKFLCTPF"
FT   gene            134714..136591
FT                   /locus_tag="BH0136"
FT   CDS_pept        134714..136591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0136"
FT                   /product="division specific D,D-transpeptidase"
FT                   /note="cell division protein FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:BH0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16658"
FT                   /protein_id="AAX16658.1"
FT                   /translation="MHKNFASSLRLNIVLIIFLTITLLTIYKYFMLMSSKDIQYFSQNI
FT                   NHISKRGNIYDRNGKIIAFSSKSHSIGTDPNKIKNIVNTSETLGAILKIEPQILKKKLS
FT                   SKKGFIYIKRKVTREESELIKRIQSEGRLKDIILYPDYTRIYPFKELTSNITGFVGTDN
FT                   IGLAGIELSLNTILNEDLTKQKSINEKLSTNNIYLTIDIDLQKSINQIAKKYFNENKPE
FT                   NMLAIVMDAKNGEILSMLQLPQYDANYYSKYPKEIWNNFATSLTYEPGSINKIFTVAIL
FT                   LDSGLLKLNEKFLDNGIYQKKFKSGEVVTIKTLNPPYDYIDPSGILIYSSNVGIAHITD
FT                   KVSNEYFYNKLIAFGFGKRVGFPFPGETKGILTHHSKWSGRSKATIGFGQEIGVSAIQI
FT                   LQAASVLSNDGVMLKPKIIKRISNEMENTIQEFQKEEIKKVISKHTAKEVLKMMREVVN
FT                   KGGIPKLKMKNLNISAKSGTSQVIDKNTGKYSDEDYTSSILVIYPTENPKYIIYVIYRY
FT                   PKKIIYGTRIAAPMAKEIIELIESQNNKDEYNEIKISSKISIPKPTIKYDTTETLPNLT
FT                   GLSKRDLMKILNKYTNTKIKIKGNGFVYKQSQPPNTKLKDINELEITLK"
FT   gene            complement(136593..138488)
FT                   /locus_tag="BH0137"
FT   CDS_pept        complement(136593..138488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0137"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16659"
FT                   /protein_id="AAX16659.1"
FT                   /translation="MSIVKTFFEIAEKRGDGVAQIYSGGNKDYIRVTYEDLKNNVLKFA
FT                   AFLKKMGLGYQDKVFICSENRIEWSVIDFAILALGAVDVPKGSDVTLFEAEVIINNIFP
FT                   NIIIVENLNLLDLVVQVNFEIKPVVVIIDDLDERDKIRFSNFQVYTYKECISIGDKSRR
FT                   DEEIIETFNNINPDDMATIIYTSGTTGNPKGVMLSHANFLYQVSSFSRMISTSEGQIFM
FT                   CILPIWHSFQRSFSYNIFLKGMTCLFSSIVPRNMLDDIKNINPHYIAAVPRLWIAIKQN
FT                   IFKEVAKKPFLARLLFKVFVKAACLNDICYRIISGLYPDNGFDLLMPMKKILGILGLVI
FT                   LFPLKILGDLIVFKKIKKVLGDNFVVGITGGGSMSLFVVRFFNSIGIELANAYGLTEAS
FT                   PGVASDEHGKIMLGTCGKILPGTVAEIRDENGNKLKKPGKGVLFIKGPQVMLGYYQDED
FT                   ATRQVIGDDGFLNTGDIVKLSKDNVVRIIGREKDTIVLNNGENIEPAPIEIKLEESLLI
FT                   EKAVVVGQDQKFLGALILPNFEEINKYLESMGQKIFDAHNRQQIIANNIVLKAINDEIR
FT                   KLINKANGFKPFEQILRFVLLEKPFEVGKEMSIKMDVKRNYILNLYKNEIKNLFS"
FT   gene            complement(138726..139019)
FT                   /locus_tag="BH0139"
FT   CDS_pept        complement(138726..139019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16660"
FT                   /protein_id="AAX16660.1"
FT                   /translation="MYRAEIISNISLEFDLHEHISRIEEDLGEYIYYSKIHNVKGKGRK
FT                   GEKQGNEVWPEENFILVVYTNKLVVIEKLRNVVEILEQEYPTEGIRFFVIGN"
FT   gene            complement(139038..142307)
FT                   /locus_tag="BH0140"
FT   CDS_pept        complement(139038..142307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0140"
FT                   /product="acriflavin resistance plasma membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16661"
FT                   /protein_id="AAX16661.1"
FT                   /translation="MRLNMLVKKIIGKPITMLILFSLLIMLSIYTFSRLKIELMPRIEE
FT                   NDITVSTQYAGRSAKEVEEKVTSILEGSLSLVKNIKTITSKSFKGNSIVDLRFYHGTNL
FT                   DLALNEIRDALELSKNLLPQEVSLYRIYRGRSGNASVLSFVMYADRPVLELKRYADNIL
FT                   KPKLERLNGVGRVQVIGGGDKHILIEVSQNRLEAYGLTLSEIVPFISSQNVEFSVGNML
FT                   DSDLEYQIQVSGEFHSIKDLEDVVIAYKKPSTYSLGNNSMVQVRLRDIASVRSAFQDLQ
FT                   DYAYYNDKPSIVISVQKQSGANSVIVADAVSAEIEKIKLALPKDISLDIAYDNAKHIKK
FT                   AISSVADSAYSGAILALCIILFFLRSFRATVIIGITIPLAIVLTFCLMYFADISLNIMS
FT                   LSGLALSVGMLVDCSIVVIENIYKYRQKGAKLISSAILGTQEMLMPIMAATLTSICVFA
FT                   PMLIFKAELDIIGDYVRDFAFTIVISLTASLFVAVFLVPVLSSYYVGLYTTFQKPIKNK
FT                   LIKRIDNFLYGIYSVGEHFYVKLLNYVLIRKLAFLLVVMFSFILSLILFPFLNVSLFPY
FT                   DHSSLMHFDFNFPHKTSLENSKFYSDKILEILKSEIKVYKSIVSKINSSGFAFEVTLPF
FT                   KEEASGEFVGDEEDIRYRVYKRVESLYPNFNSNAFSEGNSFGAPIEIKITASDFEYARE
FT                   YGELLISLLKKKFPNLVSPRLNIQEELQIDIEIDREKAYSYGINMETLSREIRANIDGI
FT                   SAGKYIENGVSYDILLRINRSNIASLKDLDKIFIVNAFGVKIPLSVIAKLKKTKGISEI
FT                   SREDQSLVVKLTAGIAPGENLALVTANVVDFVTNKVPRKDGVLVKFEGEYSEFTSSMQQ
FT                   FMVIICMAILLVFGVMAAQFESLLKPFIILFTIPLTLIGVVPFYFISGEKISVFTAIGM
FT                   LMLVGVVVNTGIVLVDYINLLLKRGFNLEDAVLEAGRSRFRPILMSALTSIIGLFPLAF
FT                   SGSSGNSLIKPIAFTFIGGMVASTFLTLLFIPIIFEIFYKLSIKDFILFKSWGSVDKID
FT                   VKGGSEGFANRNANNTDILKSNAKGNSKADANSDDVFIDED"
FT   gene            complement(142311..143288)
FT                   /locus_tag="BH0141"
FT   CDS_pept        complement(142311..143288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0141"
FT                   /product="acriflavin resistance periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16662"
FT                   /protein_id="AAX16662.1"
FT                   /translation="MNLILNVRGNFKYYLLLIVLLFAFSCNEETDSEVQGDINTNDISN
FT                   DTINEPYRFPVIAMKVQKGALSNYIPLNGDIDIKIKAEVFPDIAGKIISLNIKLGTYVK
FT                   KGQIIATLDPSKPGFTYLKSPVRAPISGYVLAVSCKIGDTVGPQTSIALIGKMDVMQIK
FT                   TYVSEKYILDVKAGNDAIIELESYPNERFKAKISEVSPVLDFKSRAVAVYLEPVGDNSR
FT                   KMVVGMFAKIKLITKHLENVVKIPSHAFIEREGKLCVFRLNADTKTVERVFPLIDFEID
FT                   NIMSIRDGINEGDLIVIEGISSLSDGAYVDIVDIRDGLDVENNV"
FT   gene            complement(143301..144575)
FT                   /locus_tag="BH0142"
FT   CDS_pept        complement(143301..144575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0142"
FT                   /product="outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16663"
FT                   /protein_id="AAX16663.1"
FT                   /translation="MNIKRLVLIFLLSFSSYAEIIKISAEDAVCMALKNSLDAKNAEYR
FT                   EKIKKLYKDNSWNVFMPNVGFASNFSRQNFFMSSVEGREHWNLDFGVSADFSISPSVVN
FT                   KIRLTVFNYEDAKIAREKTIKSIRLNVLKMYNELLAFKSILEVLRSQLENSKLKFEQVS
FT                   VAYRNGLISEIDYIDAKLRYSKLQPDLDEQIIKFEETEERFKLLLGLDVLQDFETIGEL
FT                   SDEILDVSLFDEVIDINEHLEVKGLNNAAKVMQATLDSLWLDAFLPKFSFSVSYNPGSI
FT                   AFSNGPGGSFKQGLGVSLGLTYSLTEILPFSKSFTGIWDQDYQLKMLKHQIENKIREFK
FT                   SNIIQKRKGVRLYKSILDNSKMNLEMSKRNYQVAFDAFNAGTIDLVKLNDIEVSYKQSD
FT                   LQFIKDKLNYANVILEYKDLINELD"
FT   gene            144681..144947
FT                   /locus_tag="BH0143"
FT   CDS_pept        144681..144947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0143"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16664"
FT                   /protein_id="AAX16664.1"
FT                   /translation="MFNLIFILLTKIYQKTFSKIIGFSCIYEPSCSNYALKCLRKYNII
FT                   TALILIALRLLRCNALFKGGSESLPTKKPILNSLKEFRQRLIK"
FT   gene            complement(144936..145835)
FT                   /locus_tag="BH0144"
FT   CDS_pept        complement(144936..145835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0144"
FT                   /product="glycine betaine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16665"
FT                   /protein_id="AAX16665.1"
FT                   /translation="MKGLLISVFISFILTLFSCDKDDNFKDSGDLQRLRSVKIAYVNWI
FT                   GETVATNIMKVVFERIGYNVEILPVTASIMYQYLASGQVDGMVSAWIPTADKFYYEKFK
FT                   DKFVDLGANYEGTLQGFVVPSYVKISSIAELKGRGAKFKNRMVGIDAGAGTQLSVEETL
FT                   KHYGLDKEYELISSSESVMLASLESAIKRHEWILVPLWKPHWAFTKYDIKFLDDPLLSM
FT                   GGPENIHSLVRIGLKEADPDAYYLFDNFYWGDDLLLPLIEKNYKEPGQEYRNAVEFVDT
FT                   HKEYVKNWVPDRYKDLFN"
FT   gene            complement(145872..146771)
FT                   /locus_tag="BH0145"
FT   CDS_pept        complement(145872..146771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0145"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16666"
FT                   /protein_id="AAX16666.1"
FT                   /translation="MSRDFIVANIDKAFDFLVDNFSNSNGIGFAKIVIFFYDNLKKLFL
FT                   LINPVLFIIIICVLSFLFLKKRLALLIMLGFCFILYFNLWEVSMDTISIIFVSVFFSVI
FT                   WGILIGILGGYYLKFYVFLKPLLDLMQAMPPFIYLIPAIPFFGMGTSSAIFATIIFAMP
FT                   PVIRYTRLGIIQVPGEVIEAAKSFGSSNIRILFQIQLPLALQSIIEGINQSIMMAISMI
FT                   VIAAMVGSSGLGRTVIYSVERLHFGEGLISGLAVVVIAIILDRIMQAIFIKFSYLNTDN
FT                   YGGKKENKFKRFLEMYNK"
FT   gene            complement(146778..147908)
FT                   /locus_tag="BH0146"
FT   CDS_pept        complement(146778..147908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0146"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16667"
FT                   /protein_id="AAX16667.1"
FT                   /translation="MEFTLYKVSVKVRNLYKTFSYNKNKKQIVKAIKSYENGKDRADIY
FT                   KESSVFIANANISLDVYENEILVIMGMSGCGKSTFVRCLNGIHKIDSGSILVDNIEMND
FT                   INQKDLSALRKDKFAMVFQNFGLFPHMNVLRNVTYGLEVKNVPKKIRIQKAIDILKLVG
FT                   LEDYKYKYINELSGGMKQRVGIARALVVNPDILLMDEAFSALDPLIRGEMQGELLRLVD
FT                   KLKKTVVFITHDLIEAFKLGNRIAFMKDGEIVQVGRPLEILRDPRTDFIANFIKNLPVL
FT                   NILKIKDIVKMDFALGAAADKFNVIIEKENDSFSLYDVSINKRYSNLVSLNLGLDDEIK
FT                   SVVKYLNKLDYLLVKGEQGNVIGYIDLGEIAGLLAR"
FT   gene            complement(148025..149029)
FT                   /locus_tag="BH0147"
FT   CDS_pept        complement(148025..149029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0147"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:BH0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16668"
FT                   /protein_id="AAX16668.1"
FT                   /translation="MIINHNTSAINASRNNSINATNLSKTQEKLSSGHRINRASDDAAG
FT                   MGVAGKINAQIRGLSQASRNTSKAINFIQTTEGNLNEVERVLVRMKELAVQSGNGTYSD
FT                   ADRGSIQIEIEQLTDEINRIADQAQYNQMHMLSNKSAAQNVKTAEELGMQPAKINTPAS
FT                   LAGSQASWTLRVHVGANQDEAIAVNIYASNVANLFAGEGAQAAPVQEIGQQEEGQAAPA
FT                   PAAAPAQGGVNSPINVTTAVDANMSLAKIEGAIRMVSDQRANLGAFQNRLESIKDSTEY
FT                   AIENLKASYAQIKDATMTDEVVASTTHSILTQSAMAMIAQANQVPQYVLSLLR"
FT   gene            complement(149153..151153)
FT                   /locus_tag="BH0149"
FT   CDS_pept        complement(149153..151153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0149"
FT                   /product="flagellar hook-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:BH0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16669"
FT                   /protein_id="AAX16669.1"
FT                   /translation="MSSGFFVPGVDSKYNTKEIRESMLKPDKAKIDSSVKKLEGLEQEK
FT                   RAWQMINKKISTLNSLARQITSINSPFNHMSGNSSNDDVISVSARYGAKNETYKIDINQ
FT                   VAGSDVFLSANFKQKEINIPTGDYVFLVGNKEIKIRNNGDIESLVKDINNRGKGFLSAK
FT                   IVKSDSAGNSRLILRSLKEGADNKLIMKDNALKLAKQIGILSELTTNFSPNLTEIIDSQ
FT                   QNSGNRISLDKNDLVLEPLSEIAISIPDNIEISNRSKIKFEIKYYDTDDKGILNEIVFN
FT                   PGEATFEGAKVEGEDSIINLEPDHKLPLKEKKYIQMNMIKIQSGTDSLELPPINVTSDF
FT                   EKVEVEIGSLLDLKEINIENKVNNKVFVVRNIEIFDPKNRDGYLPINAKSFAENAKVKF
FT                   DGVDVERDSNIINDLIPNVTLNLKQASDDTVVVRVEPDYEGIKKLLLDFLIAYNEVLAE
FT                   INIVSLNESSLEGQKSDLLEEWSYLSEEEKEEAYKNLGILRSELALQNLKSRLESIMFN
FT                   SYRTNDPNFSIINQIGVFTNSISSSGGLSRYLKLDEKKFNEIIQSNISSVKELFAVDFN
FT                   DDRIYDDGLAKMIGDYLSLLISAGGFVYNKIRSYDLRIPNQKNVVEDYRKKYEERENKV
FT                   EGELNTLDFTVKRMKEQEEILKSLNLQRQNR"
FT   gene            151334..152539
FT                   /locus_tag="BH0151"
FT   CDS_pept        151334..152539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0151"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BH0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16670"
FT                   /protein_id="AAX16670.1"
FT                   /translation="MPNFCLFNAKSVLTGNDKIDNSAVLIKDSKIFDIVTADRLEKIDL
FT                   QNYEMIDVKGNYITPGLYDNHIHGFHGYGTDQCSTNSIIKMSQHLAEYGVVGFLPTLYP
FT                   RPTEEMIATIKACTEAIGKEKGAKILGLHLEGPFFSPEKKGAHPISYLQKPSIEIMKKF
FT                   IDAAGGTFTDSFGRKRTNIATMTVAPELKGMRELAMFCMENNITLQAGHTNAKYENMIE
FT                   GFQVGILHTTHFFNAMSKLDHRNPNAIGAVLIHGDVSCELIADGHHIHPKLVLMLRKLK
FT                   DISKLVLVTDGLTPTLQPSGKLIANGEEVYLKNDGLFHIVENDTIAGSASTMIQGIKNL
FT                   VEFGYSLSDAIQASSYNPVRIINLEKKGSICHGYDANINVLDKDLNLKLTMIESKIIFN
FT                   RL"
FT   gene            152569..153372
FT                   /locus_tag="BH0152"
FT   CDS_pept        152569..153372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0152"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:BH0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16671"
FT                   /db_xref="GOA:B2RZL5"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZL5"
FT                   /protein_id="AAX16671.1"
FT                   /translation="MRLIIRTNYNDISKWAANHVAMRIKEFSPTKEKPFILGLPTGSSP
FT                   IGMYKNLIEMNKIGKISFENVVTFNMDEYVGLDKNHPESYNSFMWNNFFSHIDIKKENV
FT                   HMLNGNAINLTNECTEYENKIKSYGGIMLFVGGIGPDGHIAFNEPGSSLKSRTRLKTLT
FT                   QDTIIANSRFFENDINKVPKSALTVGVGTIMDSKEVMIIVNGHNKARALRHAIEKGVNH
FT                   MWTISTLQLHKNAIIVSDEAATYELKVGTVKYFNDIEKDNFNNDI"
FT   gene            complement(153469..154080)
FT                   /locus_tag="BH0153"
FT   CDS_pept        complement(153469..154080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0153"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16672"
FT                   /protein_id="AAX16672.1"
FT                   /translation="MFKLPELGYAYDALEPYIDAKTMEIHHNKHHNAYTVNLNSVLEKT
FT                   EINYSKDIESILKNIQRFPKEFQTAIRNNAGGYSNHILYFRILKPGNKDNILENFEEHV
FT                   NSTFGSLGNLKMVLKDSAMSIFGSGWAWLVLHANRELQVISRPNQDSPLMEDYKPILGI
FT                   DVWEHAYYLKYQNRRTEYIDAFFKALNWEEVSRVYNEIIE"
FT   gene            complement(154094..156802)
FT                   /locus_tag="BH0154"
FT   CDS_pept        complement(154094..156802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0154"
FT                   /product="protein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16673"
FT                   /protein_id="AAX16673.1"
FT                   /translation="MRPDMLRSIFEATIGSKSKRDLKNYLPILRNINKLESWALSLSDE
FT                   DFARETEKFKDELKEGKTLEDILERAFALSREAARRRLKERPYDVQLIAGLALHQGKII
FT                   EMKTGEGKTLSSVQAAYLNSLTGDGVIIVTVNDYLAERDSNWMKPVFELLGVSVGVVLS
FT                   NMDSAKRKMEYDKDITYVTNNELGFDYLRDNMCFDLSQKSLSNFNYCIIDEIDSILIDE
FT                   ARTPLIISGSTEGDTSAYLEVNSLVSLLKECSKDPKTGDYPLEIDELDGDYTIDEKSKR
FT                   VSFTANGLNNLEQILVAKGIIKGSMYVDTNFNYVHYMTQALKAHLLFLKDREYIVGDSG
FT                   VEIVDEFTGRILKGRRYSDGLHQAIEAKEGVRVASENKTMATITFQNLFRMFKKISGMT
FT                   GTADTEAKEFHRIYNLDVVVVPTNKLVARVDEDDIIYYTEEFKFKAITDEVYEAYKRGQ
FT                   PVLVGTVSIEKSEVLSNMFRNKGIRHEVLNAKNHFREALIIAEAGAKHSVTIATNMAGR
FT                   GTDIKLGGNLEHRVRKKFGTGMSLEDFQKAMQTEREQYLKDYEEVKALGGLYVIGSERH
FT                   ESRRIDNQLRGRGGRQGDPGRSRFYVSLEDDLMRLFASDNLRALMGKLGMATGEPIVHS
FT                   LLTKSLVNAQKRVEDRNFEIRKHLLEYDDVITKHREFIYSQRNSILADSNIKERILLSL
FT                   REYLDFLFDQTKGEVVTSSILSEINSVFAYMMDNIGSVETMSILDLKDKLMEIAKSNLD
FT                   AKEELIGAELLNEFLKHEYLRNIDFKFQDHLANLDSLRESVYLRSYANKNPITEYKEEG
FT                   FAIFSELVKDIKVETLRRTLQMRVGIDSSGYKDKKPKNVRATHKEFSGIASGERGNASG
FT                   IQIVRSIPKIGRNEPCYCGSEKKYKNCHGKI"
FT   gene            156854..157987
FT                   /locus_tag="BH0155"
FT   CDS_pept        156854..157987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16674"
FT                   /protein_id="AAX16674.1"
FT                   /translation="MKKFYKIHLTLFFMIISCNIKTLNEIGEQQFKIPFGTLPGEITPL
FT                   INKFTNSSFDIKTYNGLVYIVEAKANKLMIFNSYGKLIQTYQNGIFKTNFDLKIKKIDF
FT                   ENIQAIYPSKDFIVVSDKIDNKKSKFDEKENIAYSTRILILNKDSSVEVLGQEGQNGTP
FT                   FPQVYDINIDDGNNIAIITIYHEGYIIYSYDKDLSPLYKIYVNTNILQIPEEERKKYNI
FT                   SIDKVFFEVNKKIIYAKTTYYENIRTNENINDLGVKIKNQYFYTMSLNKNKEFEIKNKI
FT                   TLPQNLLDDQQESFINIIGIQKDKIIASTNMKNLSNTLIWKLDNKGKIKEQMVLIEPPN
FT                   LKFLAESLSKDGILSILYGEKSGVSVYWWNLNNLLKL"
FT   gene            158010..158435
FT                   /locus_tag="BH0156"
FT   CDS_pept        158010..158435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16675"
FT                   /protein_id="AAX16675.1"
FT                   /translation="MKNKNCKEKIQNKHKQRLKKNLILGIIFVIILIIIKVILIPKLQE
FT                   LESKYNPTITIEHKIKNENLYIKINIKSHDIKDLGKANIEVYLDNKLIENNMIYIDKIH
FT                   YTLYTNVAYRNEGLLNIMLINQKGDKAYFSKRLNFGG"
FT   gene            158439..158855
FT                   /locus_tag="BH0157"
FT   CDS_pept        158439..158855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16676"
FT                   /protein_id="AAX16676.1"
FT                   /translation="MLQIYFMSVLLNILGGIVLAFPILGERFKCLIIFEEFVNLVNNNK
FT                   NARSIFGTIFLVTSIFEIIMPYDLPIIGNLLPTISLFFIGFIFFLSQKMPINLQNNKEY
FT                   GKFKSFIESNKKLIGILALIIGTIHFLVPKVPFL"
FT   gene            158961..160061
FT                   /locus_tag="BH0160"
FT   CDS_pept        158961..160061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0160"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16677"
FT                   /protein_id="AAX16677.1"
FT                   /translation="MTKHKEIIINLQNLNHNLTSIKNHIQKRELVATLKSDAYGHGLIQ
FT                   TFKFLKEKGVNYFGLFWIDDALKLKKIDKNVNILLYINTDKNAIKNLVKFNITPFVADS
FT                   QYLSLIEQECRKQNKKIKAHLKVDVGMNRYGIKIEDALNLAIQIQNSKSIEFEGICTHL
FT                   PTTENTKITQTQIEKFVYFINKLKSKNINPKFIHASNSEHIANYKISEKFNMVRPGLIL
FT                   YGYHPNPNISNNNLQLKPVLNLYSKIIFLKNIKKGEQISYSGLFTAKEDMQIGLIPVGY
FT                   FDGIPQNTSNNFYCIIRDRKCFIKGKICMNISIIEIPKDLKINIGEKVEIISERLSLDI
FT                   LSKESGISKYEILCSIGKHEKKKYLY"
FT   gene            complement(160053..161696)
FT                   /locus_tag="BH0161"
FT   CDS_pept        complement(160053..161696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0161"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16679"
FT                   /protein_id="AAX16679.1"
FT                   /translation="MYNKFIKIRLIDQGMIMFLVMFFVAYSLFSEEIYYRFVDYDINYR
FT                   IIGKYEISKEDAEEECGYKFTYDGGKLVFVDYIGKLSILMPSFFGVSQIKIKHSEDIER
FT                   RLFLNGGFSAKNSKDVYVEQIEYFPNGSPKSIFNYNKSNEIIRDKYGVAYYHFIYNDDR
FT                   SFYVYRFSEVGFQIKDLNDVYYTKVIYNDSDRTKTVLYYDDNNYNIKAKNGIYGFRLTY
FT                   DSAHNIVKEEYLDQVSYLYANPFSVATKTYRYDFDGKLIEVLNYDIKNNLTPDENNVAI
FT                   YRYEYNLKEKDYFYKEYNYDTNNNLTVSQNGYAMRKAIFYLQNNEKRVINYSNKINQKY
FT                   NSDIPASYEEKCEIMDDFKGIAVYSYKYDNKFYLIESLFFDKNFNLISDSNGVMIYKYT
FT                   YNEDGLLKSQEHYGDFDNPIDDAAGVFRYKFAYDVNGNVILKSNYSKSGVLVADRSAIF
FT                   EYAYEYDKQNRLISQKNFGSLGQLQDDIHGVSMYKYEYNKFGKISKKTHHGPDLRLRDN
FT                   IGGISVYKWIYDSKGNLVDFQKFNSLGNLI"
FT   gene            161677..161886
FT                   /locus_tag="BH0162"
FT   CDS_pept        161677..161886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16678"
FT                   /protein_id="AAX16678.1"
FT                   /translation="MINLLYNKLVQEFKMAKISKNAQRSGSKELLSKWGGKIIMKSKFE
FT                   NGKIKHYAECQASKNTARRPKDLF"
FT   gene            complement(161890..163641)
FT                   /locus_tag="BH0163"
FT   CDS_pept        complement(161890..163641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16680"
FT                   /protein_id="AAX16680.1"
FT                   /translation="MKKLPEIFYLNDKELDILISQIGISSDAQKMILRIILEHNQNVIN
FT                   YANFIEDYSVKIRALKGELDFLFRKLYEVKRGIIVNQATSNGELMPYKIIITDENSYDF
FT                   YYYAIEDLFLKHYAGIELFSTLLTVRNIDKNLLAFEKEFVILSNSDVNLKYFQDNASLK
FT                   KIFVLNSLIIPSGQALYFVEFMKRILFGIASNRIVKDVFMRAKNLKLSEYDRILDEGIN
FT                   GVGVAYNLLLGILENKDEILNKKGVNISKHYFTFLEILNIYIVNEKSLEESRNLESIKI
FT                   DETLKSIEKAIEFKPGFINIEEFKNILQEHSGGLSDPEHFLKIANEYFFESNINTSLPK
FT                   IFSIKHGMYLYKPCAYSMFLKEFDQILVDIRDRLKNEFTRMLSNGKNSSTILTEEGLEK
FT                   TLIEFIANYDINNYCLKNKAVFLDFIVSHYRRVSKTQNIQTHLKDIIKTEAAKYFKNSN
FT                   TFLPLYRIYKVDLSKILNSAYRDLPLLKRLLLFLTGKQQSYKEALSRLNSKPMAKDHAG
FT                   LFDPGERVKRQLDKRRKQREELREQIRNSYAKKGKGASKGQALSRTYTKSEQDEAWMKF
FT                   EDKLNKK"
FT   gene            complement(163719..164696)
FT                   /locus_tag="BH0164"
FT   CDS_pept        complement(163719..164696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0164"
FT                   /product="sodium-calcium exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:BH0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16681"
FT                   /protein_id="AAX16681.1"
FT                   /translation="MEYIQFFYVILGIFLLYLGGNYLLKSSVNIAAYFQVPNLLIGVVI
FT                   VSLSTSAPELFTSLIASLKGKNEIIVSNIIGSNIINMLLALPLTGLFLKIETDFKRLKF
FT                   SFIILFLLMFLLLLLSFDFGTLSFFKVPYYRTSALLILIVFLSYLFLFYREEKKYNSIA
FT                   KDLENLNCDYGFKFLFLNTLLLLLSICFLYLGSKLLIDSSIYIAHNIFNISEKVIGIVF
FT                   VAFGTSIPEIVVSLFAVIKKESEIALGNIIGSNIFNIGFILSSNSFVNPVLMSDIYFAD
FT                   FSIMFAVSLILLLIVRFRGVFSRGPSILFLFLYILYNSFLFGVF"
FT   gene            complement(164718..166583)
FT                   /locus_tag="BH0165"
FT   CDS_pept        complement(164718..166583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0165"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16682"
FT                   /protein_id="AAX16682.1"
FT                   /translation="MDVIYMKLNACIMFLYIICLLFSYFFLCFHLYSLDETRYFKKGDL
FT                   FFIHKGALYKKHNNTIFKVEPKGLETRWVYPFVKPVPKRITSVYEEFYSPNSLLTTGDS
FT                   VYVSHNYFKSFIKLVSNEKFNKNSYITSSALSRGEYKHIAIGTSNSGLYLSVNDNLTFK
FT                   SLNSLIAKIYLGAGYYDMISAIEFSRNNTNELYCSYGIYGDIILINTALGVVKQLTFPF
FT                   KKQIVRIIDLSDAKMEKLLVRTYDNHFYSYVNGKWTFDGHFSVYGEDTLEKLKRMNLAS
FT                   NKGSIYLTAYTLRNKTAIDERFEFIKRLGMNAVIIDFKDDSGILTYLSKLALPNKMKAV
FT                   KNLIDVPYILNKAKELGIYVIARVVVFKDSKLYFYNNCEYALWNKKTNQPWANIVKVKH
FT                   GDFFKSLQKEHWVDLFSQDTWDYNLSIAKEIQSLGVNEIQFDYIRFPTDGPVSLITSRF
FT                   NKYNMRAIDALESFLIMARKSISIPISIDIYGNNGWFITNSIGQNISMIADYVDVISPM
FT                   FYPSHYTNDFLKHELYYTTRAYKIYREGSNRASVFSSGNVIIRPYVQAFLLGSERRVSE
FT                   KVYLEYFSHQLRGVKESLGNGFSLWNASNIYYMVKGNLSEFLGFS"
FT   gene            complement(166640..168121)
FT                   /locus_tag="BH0166"
FT   CDS_pept        complement(166640..168121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0166"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BH0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16683"
FT                   /protein_id="AAX16683.1"
FT                   /translation="MKRKSGILLNISSLPSKYGIGDLGKGAYKFIDFLVASSQSYWQIL
FT                   PYSPSNFIEFPYSSYSAFAGNINYIDLSAIDRFIDVSLSTLECLEDRSIDYDKLKAKEV
FT                   VLRNAALNFLHRATVDEMHAFEKFKKSAAYWLLDFASFIAFKEYYSKLQFPQTFNLLFS
FT                   KEILKRDAKALTKLRETLEVEIEIQQVLQYFFFSQFKALKRYANSAGIKIISDIPIFVS
FT                   YDSADVWAHQKYFKLKFDASKDKVTGVPPGCLSRKEYLWDNAAYNWKALRKDDYVWWVN
FT                   RIDFLRKYVDIIRIDYFRGFVSTWEVAVEESPALSGRWVKCPGKDFFKHVLNEINNLEI
FT                   WVEDLVKDRGDTFRLRDYFSFPGTRVMQFAFDFDSNNLYLPHNYIRNCVVYTGSHENNT
FT                   IREFVSSIDNKHKKYIFDYFNTSEDAVVWDMIRGAMASVANSVIIPMKDYLDLIADFRM
FT                   NMPDTMLDNFRILSSDLSVDLSKKISNITKLYGRT"
FT   gene            168283..169440
FT                   /locus_tag="BH0167"
FT   CDS_pept        168283..169440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0167"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16684"
FT                   /protein_id="AAX16684.1"
FT                   /translation="MNVKAVILLFLTNTLAFSAEILEFKYTKGSKFRIETTDNQEIYLN
FT                   GILNSKTKTNIQVSSEVKDVKYDFADIKSYFRVLKRDNESDVYLLKEEFEGNFSINKQG
FT                   EYKINNDQKRPSVRGIPRFPKTPIKVNETWTYPAEEYIQASEISKEIKDFVTKFDVNYV
FT                   YKGKEKIDDKYYDIIHSNYESKYSVKNILFSQKVNQIIYFDSKSGNTYKYNDTYVFQMK
FT                   NGNNNIKMIGNSSGKIISIELPNDNTIENEVKEYISTKQIDSIKIEKNENGIKLSLDIE
FT                   FYPDSFQIIQKEYSKLKHIANLLEKFKNNNILIEGHTAKFETEQAMQELSEKRAHSIGN
FT                   YLLKMKVKNKNQIFFKGWGAKKPKYASSSPLASKNRRVEITILNN"
FT   gene            complement(169444..169827)
FT                   /locus_tag="BH0168"
FT   CDS_pept        complement(169444..169827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0168"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16685"
FT                   /protein_id="AAX16685.1"
FT                   /translation="MQKSNFEHEFIEKMHNFLLESKKEILNSIRSVEDSKREIINNDMH
FT                   LKDIIDIAFDNMDGNNLEALSSVEKKKLHLINQALYRISQNTYGNCLACDKNIARERLE
FT                   AIPYAFLCISCQTKKEKKSRRSV"
FT   gene            169994..170215
FT                   /locus_tag="BH0169"
FT   CDS_pept        169994..170215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0169"
FT                   /product="bacterial protein translation initiation factor 1
FT                   (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16686"
FT                   /protein_id="AAX16686.1"
FT                   /translation="MNTKEEAIETEGIVKESLPNTMFRVELKNGHVVLAHLSGKMRKHF
FT                   IKIVPGDKVKVELSPYDLTKGRIVYREK"
FT   gene            complement(170263..172308)
FT                   /locus_tag="BH0170"
FT   CDS_pept        complement(170263..172308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16687"
FT                   /protein_id="AAX16687.1"
FT                   /translation="MGNERRRKNCIFTRRLVIFLVLFFINFKIYSLSGTDYLVSTKVLQ
FT                   GSKVVHVIRLNLPQDIDEESLKFKISKDINENTEIASISKVPDGDNLVTEIKIEYDFDK
FT                   PGFVKIPPLKVTYHDEVYLSSEFEVVILRKDEFQSFGLPVKLYWDFDREEIYEYQSVGF
FT                   VLRSNWLVNNSLKSIASSFSAVKDAMIDRTPIFENIKYRTFNSKEILDVPLYNFILTPL
FT                   RGSKGVVIPSVSFNIGENIARMSPGISLKVKPIPDEVKSLAVGTFKIDYEFPNSTLINQ
FT                   DTFTILIKITGQGNLPHIRFPEIETYNSKVIYNKKNYNFEPSKYGYKGSISKIYTLKPD
FT                   HKGSLFLNIGDFTYLDPDDGKVYKLEGKRLKYEYSGEFKKSNDSRQELFSDLSLLSYHD
FT                   ILKYKNKTFLFFVPAYYLILIPGILFSLAIFIKYKKFFIASGCGLVILILTLAVSLNAI
FT                   NDGSLSEDNINDLIEDYKSKNYDDALNKVDNILKKNPSYSGLWLNRALILSKMDRYFDA
FT                   IYSAYKSFFASPSNDTFYKVIDFIETKNGINENIRNNSFTLSNIFFIISLILINVLVVI
FT                   ISYKFYAKNLKKIILFLLLSVTCFTLFQTYYFYVDQQSEIGIIRGDLVSLYKVPDNFSR
FT                   SWRFLKGNISVYVLNRKDDFVLIQTNHGLQGWVHKNFIVSVKDNLI"
FT   gene            complement(172257..172844)
FT                   /locus_tag="BH0171"
FT   CDS_pept        complement(172257..172844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16688"
FT                   /protein_id="AAX16688.1"
FT                   /translation="MGRNFLICLLMSLMFTFFLSCSNIRAMSLMAIGNYEYIRGDYQGA
FT                   ISTYYNLVDDKHGAAWGYYNLGIVYYSLGEYESSLRMFSYAKRDNDFFLNFNINYNEGI
FT                   IYYNQGLYRKAEMAFKEALRINPASYNAKYNLELAIIKKRTIPDDLNNLSVNRSQNFIE
FT                   NNENFLRYIEGLERVLWVTSVEEKTVSSREDW"
FT   gene            complement(172826..173815)
FT                   /locus_tag="BH0172"
FT   CDS_pept        complement(172826..173815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16689"
FT                   /protein_id="AAX16689.1"
FT                   /translation="MSIGNYYAFYLFIILFLVLFVYVYNFRKSLPFFKTLSLMYVNNAY
FT                   IKNYYIKKILMIFFFILSLVSLIVSILDISWGQKATEDERANLRISFVFDISRSMLTFD
FT                   EGKSINRLESAKNFISLVLNNFENAECSLTIFKGKSLLVLPFSKDKASLHKILNYIEPG
FT                   LISSPGSFLGEGVFSAIRGIKDNSYYNFLIILTDGDEWGENNYYSFPNLVDAFNVTSFV
FT                   VGIGSNKPSPLIDNNLSVKDKDGNIVKSMLNEDNLYLLTSSLKGSYYNLYLKGTNYVIN
FT                   EIRNDMMKKSSSDILLIGILRYKIFLAISFLFIVLYVFVKVIKWDETF"
FT   gene            complement(173812..174837)
FT                   /locus_tag="BH0173"
FT   CDS_pept        complement(173812..174837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0173"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16690"
FT                   /protein_id="AAX16690.1"
FT                   /translation="MKNLIEVIMLTFNEPLYLFLLVILPVIIYFSHFFKRRGGKVKFPI
FT                   SVYGNFGSIKLRDYGLNLLYFLTYTFFYLAIVVMILTLAGPSISKKKMTYLSNGADIVI
FT                   VLDISPSMGAIEFSSKNRFEFAKELIKYFAYQRENDNIGLVAFAKEASLIVPLTIDRDF
FT                   FSRKLDDIYIMDLGNGSALGLGVSIALSHLKHSEAPKRSVIVLTDGVVNSDEVYKDQVI
FT                   NLAQGLNVKIYSIGIGSGEELSVGFKLRSGKFYQGTLREVYDPSMLLEIASKTGGLFYS
FT                   VSDDFSFKLAIQDFSKKENVERKVRITVDNDDVYNEFLLIIFCLLILYFIFSKVFLKEV
FT                   L"
FT   gene            complement(174797..175699)
FT                   /locus_tag="BH0174"
FT   CDS_pept        complement(174797..175699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16691"
FT                   /protein_id="AAX16691.1"
FT                   /translation="MKNTIVFVALFLSFDLFSYEIKNEIFIPTRYYVGDTVELKFLLIL
FT                   GEDEKFVPVKFEEIKNEFVEVNSLLYRPESGEIIIYFVSFYVGSNTLPHIYVGDIISND
FT                   KSFKLILNNIRINTSKLIADDDSLKIQDIEGVLFLPGTSTYFVIFILALILVPYFFIKF
FT                   LRLIKQLLVFLIMKHNLRKPYRIFQKQLIILSNYIKSDEEQVVFYNLLNSSLRVYLSKK
FT                   TGFDFNAITTTEISEILQNLNVPYEIRSTFVNMLRLSDFSKFSGINLSGGNLSFVLDDL
FT                   REAAFNFEEFNRGDNVNIQ"
FT   gene            complement(175696..176577)
FT                   /locus_tag="BH0175"
FT   CDS_pept        complement(175696..176577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0175"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16692"
FT                   /protein_id="AAX16692.1"
FT                   /translation="MQYSNESNASTKTKIKALKFFSRKMLLELNFGGYRSIFKGLGLEF
FT                   HEFRPYEETDDARLIDWNVSSKTDSIFSKVFKEDKGMNLHLLVDNSLSMSLGSLVNKKE
FT                   IQDLLVSIFAHMAFFNNDKIGITFFSSETDKFISSRKGHSHLGRILNETINRQLKRGSN
FT                   LTYVFKNTAEYYKKRSLIIIISDFKANDYFKSLTVLSKRHNIIAIRLTDFFDENLPQYG
FT                   VLTYEDIETCEDFLASGFSKTILNSYKNYWTLDKIKWRKECIKRGINFIEISTKDDVFR
FT                   KLKALLKKENSI"
FT   gene            complement(176593..177585)
FT                   /locus_tag="BH0176"
FT   CDS_pept        complement(176593..177585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0176"
FT                   /product="MoxR protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16693"
FT                   /protein_id="AAX16693.1"
FT                   /translation="MKSSFQIDSEVENALSLINKFRREVASRILGQREMIDAILMGILT
FT                   EGHVLLEGVPGLAKTLTIQTVSDVLDLGFKRVQFTPDLLPSDLTGNMVYKSTTGTFKVR
FT                   KGPVFSNIILADEINRAPAKVQSALLEAMSERQVTLGDETHKLPDPFFVLATQNPIEQE
FT                   GTYNLPEAQLDRFLLKVNVKYPSIQDEIKLLKIFSVDGGLENIKVAKVMNAYSLADLKR
FT                   IVGKVKVDDKIMLYIVTLIAASRENDKKTYPFAKYIEFGASPRASLSLLKCARVNALYE
FT                   GRLFVLPEDVKAVAYNVLRHRITPSYEAEVEEMNTDDIIKILLSAVALP"
FT   gene            complement(177655..178278)
FT                   /locus_tag="BH0177"
FT   CDS_pept        complement(177655..178278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0177"
FT                   /product="methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16694"
FT                   /db_xref="GOA:B2RZN8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZN8"
FT                   /protein_id="AAX16694.1"
FT                   /translation="MINYFELSLKNLGVSFTSESIDKLKFYIKRVLLFGSRFNLVSKND
FT                   LRFDAVLLHALDSVVGFPIIKDNNPHQVLDVGSGAGFPGIILAIFDNSRKYVLLERSNK
FT                   KVTFLRMMSLELGLDNVKVLERDVADEKDKYEFITIRAFRDIREYASILRLILKNGGLI
FT                   MAYKGRFDKIKFEISHIESLFSKIEIKESAISDAKERNFLLLYK"
FT   gene            complement(178275..180155)
FT                   /locus_tag="BH0178"
FT   CDS_pept        complement(178275..180155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0178"
FT                   /product="putative tRNA
FT                   (5-carboxymethylaminomethyl-2-thiouridylate) synthase
FT                   subunit GidA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16695"
FT                   /protein_id="AAX16695.1"
FT                   /translation="MFRKIDMDFDAIVIGGGHAGIEASLALARLNFKTLLITQNLDTIG
FT                   KLSCNPAIGGLAKGNMVREIDALGGEMGCLIDFSMIQFRILNKSRGPAVQAPRAQADKL
FT                   VYQVKAKETLERQDNLDLFQDTVSDFLLNSMRNKIEGVITERGNKFTSRVVVLTTGTFL
FT                   RGKIFIGEYRACMGRISEPAACGLEKILLELGFDMGRLKTGTPARVHRKSINFAKTEIQ
FT                   FGDSDIIPFSFSNTKIDKAQLSCYITYTNKKTHEIISDNMHLSPLYSGEIVGNGPRYCP
FT                   SIEDKIVKFKDKDKHQIFIEPEGLSTEEMYLNGLSSSLPEDIQKRLINSIDGLENAVIT
FT                   RPGYAVEYDYINPIELYASLETKRIKGLFVAGQTNGSSGYEEAAAQGIMAGINAALRLQ
FT                   GKDPMILPRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIRWGYEV
FT                   GLVSEEKYSRYFCKEKQVEEIKELLRQRRLKEKEASTLQLKKHINKDFYHIIKDPYVNL
FT                   SDLLNIDPKLNASKVILEQVELDIKYEGYINRQRDLIRKMNNLELIKLPLDFNYEIEGL
FT                   SREAKEKFARIQPANLAQASRISGVRNTDIQVLLIHFSNPKNKVVLDLAL"
FT   gene            complement(180140..181534)
FT                   /locus_tag="BH0179"
FT   CDS_pept        complement(180140..181534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0179"
FT                   /product="tRNA (5-carboxymethylaminomethyl-2-thiouridylate)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16696"
FT                   /protein_id="AAX16696.1"
FT                   /translation="MSKLFQREDDIVALATPFLSSALCVIRSSGVSSIDKFSKIFSDPK
FT                   RLLEAPGHTIHYGYIIDKETCEKLDEVVVCLYRAPKSFTGQDSIEVMAHGSLIGIKRII
FT                   DFFLKVGFRMAEPGEFTLRSFLAGKLDLTKAEAVNELISAKTNKTHALAVNNLSGSLFT
FT                   KIDLIKKDILNFLSALSVHLDYETDEYEVVIPFDVISKSRDELKRLIDSYDTARKLDHG
FT                   ITLVLAGSVNVGKSSLFNLLLKEDRAIVSSYAGTTRDYIQASFELDGILFNVFDTAGLR
FT                   ETSDFVEQLGIVRSNSLIKEASLVLYVIDLSARLTNDDLKFIDSYMGHSKVLFVLNKMD
FT                   LEQDSQTVDFFNSGNINSSNLVKISTKTLFGIDSLYDKIRSLTCFDYIDINAYDVIVSS
FT                   SRQVELLKKAYTLIIELLNKIEQDISYDMLAFDVYEVINLLGEITGEVTSEDVLNNMFK
FT                   NFCLGK"
FT   gene            181680..182174
FT                   /locus_tag="BH0180"
FT   CDS_pept        181680..182174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0180"
FT                   /product="flagellar protein FlbF"
FT                   /db_xref="EnsemblGenomes-Gn:BH0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16697"
FT                   /protein_id="AAX16697.1"
FT                   /translation="MKIKLETELKNTLQEEVFLVEKIYDMYLNIKKYLDEKNEMMFKET
FT                   INKTNIYLHKFKDIEKKRDEIWKEFTDHEKFKSTYMAIEKLCSVYKKEIYNYFHRLRIG
FT                   VLNIQNLNYLISSYAETSLDILDLIFKDAQESVENITYKNPYGPKSGNLNEASVLINKK
FT                   L"
FT   gene            182193..184076
FT                   /locus_tag="BH0181"
FT   CDS_pept        182193..184076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0181"
FT                   /product="flagellar hook-associated protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16698"
FT                   /protein_id="AAX16698.1"
FT                   /translation="MDSTFSGIEIGKKSLFAHKDAMNTIGHNLTNTSKPGYSRQRVIMK
FT                   TEMPIYAPQLNRANKAGQLGQGMMVQSIERIRDDLLDIRIAEESHRLGYWNSKDKFISL
FT                   LENIYNEPEDQSIRKRLNDFWDSWQDLSRQPQGLAERNITLERGQAFAEIVRSRFHSLN
FT                   RIYTMANDEVKITIEEINNYLRNISDLNRQIAKAIAMKDQPNDLMDERDLIVDKLSNLI
FT                   SISIENKRDPNEFLIHTEGKHLIQGAIANEFILEAANGPTRTKWNILWNNREPANINTG
FT                   KLGALINVRDNEIKNEINEIDNMAINITELVNEVHISGHGLDQKSGRIFFDQEYKLTDE
FT                   SGRYDSNGDGKFDSVHIFKINSTNEIFPEEKLGFSGILRFQAINKNDFIEIPYLTTDTV
FT                   QDIINKINNSNSQVTARINAEGKLEIKAIKEEERDSAIFRIRYIEDSGLFLTTYTGILN
FT                   ASGAEGAYNYQDVNTTNQLINTASYSISPLKNPAAWLKVSKEISEDPSKIASGIRTPTN
FT                   NMPIGNNETALRIASFVNSQIMIGKNVTLNDYFANTTSNIAIKGQIAEITKNSQEQILR
FT                   SLTDLRLSISGVNKDEELANMIEFQQSFIAASKFITVSAELIDTIINKMGV"
FT   gene            184080..185351
FT                   /locus_tag="BH0182"
FT   CDS_pept        184080..185351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0182"
FT                   /product="flagellar hook-associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16699"
FT                   /protein_id="AAX16699.1"
FT                   /translation="MINRVSHPLTYDNLKASSTDKEVKITRLLESLYQGGKRITSLRDD
FT                   PTGVTHAIRLDSDIFKLNTYVKNINSAKGKLRYMEGYLQSLANILTRAKEITVQGANGT
FT                   YEADNKKMIAKEINAILEDVLAIANVKGADGYSIFAGTKINAEAFKITRANRINRLTQD
FT                   RSETQIIRVDYNGNQAERTTEIYNGIYIPTNYPGSEIFFSQNHYITSSKNVNEFIVKEN
FT                   TKIYIDNIEITLTAGDTAADIIAKINESDAPVEATLDRVLNSIAIKTTTPHQIWITEEG
FT                   STVLQDLGILTQNNDTKEPPYNIANNTEVRSRTIFDSLIDLRDNLEENREELIGSRSLA
FT                   EIDESLNKIFATLADLGTKENRLDLSYERISKEIMDMKDDMVKYTNLDVTKAITDLNMT
FT                   SLAYQVSLGVSARIMQTTLLDFLK"
FT   gene            185353..185745
FT                   /locus_tag="BH0183"
FT   CDS_pept        185353..185745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0183"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16700"
FT                   /db_xref="GOA:B2RZP4"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZP4"
FT                   /protein_id="AAX16700.1"
FT                   /translation="MKNEFSIKFNFPDGILGFEEIKEFIIKDSEYKPFSIMQSINGEIN
FT                   FLVTSPFNFLEKYLPNIEEKDWLDVQAENEDEKVILCIINMHVKTYKEITANLKAPIIL
FT                   NKKKLIGKQAISTNEEHYLRYRVFKE"
FT   gene            185748..185984
FT                   /locus_tag="BH0184"
FT   CDS_pept        185748..185984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0184"
FT                   /product="carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16701"
FT                   /db_xref="GOA:B2RZP5"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZP5"
FT                   /protein_id="AAX16701.1"
FT                   /translation="MLVLSRKANESIKIDSNIEISILEIKKDSVKIAIKAPENIKILRS
FT                   EIYDIIKEENKKSILQDKNNIHKIKNLFDYFNK"
FT   gene            complement(185969..186631)
FT                   /locus_tag="BH0185"
FT   CDS_pept        complement(185969..186631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0185"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:BH0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16702"
FT                   /protein_id="AAX16702.1"
FT                   /translation="MNTLAIEYSYKTLLIHFEINGEVFSIVKSKDEINYALSVPKLFND
FT                   FVLESGIDLNNLDLLINSSGPGSFTGLRISLSFIKGLSLGLSVPFVNIPTFDVFARLVN
FT                   PRSNALTLGFTAGKYFLGCYRDYKLCSKIFCFSKSELFKYLDNLDLKFVIVGNGIEFIY
FT                   EKLKNKFKIISDMGSFGTVLTELGKFKYLKSRQGDDILSGPFYVRLSDAEINSYLLK"
FT   gene            complement(186612..187040)
FT                   /locus_tag="BH0186"
FT   CDS_pept        complement(186612..187040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0186"
FT                   /product="ATP/GTP hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16703"
FT                   /protein_id="AAX16703.1"
FT                   /translation="MILSFKTEDEMIDFSKSFFNPLPIGKIFSLCGDMGAGKTTFLKGL
FT                   ALNLGISYFTSPTYNIINVYEFVDFKFYHIDLYRLNILDEFELIGGMELLLDMSSVIAI
FT                   EWPEIIIDVLPKNRLMFLKFKIKDTSRILEFSDEYSCN"
FT   gene            complement(187037..187297)
FT                   /locus_tag="BH0187"
FT   CDS_pept        complement(187037..187297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16704"
FT                   /protein_id="AAX16704.1"
FT                   /translation="MKFISLNNIRKQDSHIYYRSVYFADAFYEYEGSSETKQVKFTIEA
FT                   TPLGEKHITIDFLDSLNYPVLSLMIAIKRHVIDLDIKGELP"
FT   gene            complement(187499..187846)
FT                   /locus_tag="BH0188"
FT   CDS_pept        complement(187499..187846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0188"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16705"
FT                   /db_xref="GOA:B2RZP9"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZP9"
FT                   /protein_id="AAX16705.1"
FT                   /translation="MARVKNGIVHVARRKRLLKKTKGFWGTKKSNYKKAKDTLRKGMMY
FT                   ATRDRKARKRDFRSLWIVRISAALTGMGITYSRFFEGLKKSNIKLNRKILSNLAIEDIE
FT                   TFKKIVYEIKN"
FT   gene            complement(187867..188064)
FT                   /locus_tag="BH0189"
FT   CDS_pept        complement(187867..188064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0189"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16706"
FT                   /db_xref="GOA:B2RZQ0"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZQ0"
FT                   /protein_id="AAX16706.1"
FT                   /translation="MSKMKTCKSARKRYAFTSKGKVKYKKQNLRHILTKKSSKRRRKLG
FT                   KSGLVSSSETKRIKTLLPYA"
FT   gene            complement(188082..188642)
FT                   /locus_tag="BH0190"
FT   CDS_pept        complement(188082..188642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0190"
FT                   /product="bacterial protein translation initiation factor 3
FT                   (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16707"
FT                   /db_xref="GOA:B2RZQ1"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZQ1"
FT                   /protein_id="AAX16707.1"
FT                   /translation="MINRSAGKDRDRSRSGDKELRINHKIKAREVRVIFDDGTQSVLPI
FT                   EDAMRCARDAELDLVEVSPNVLPPVCKIIDYGKYKFHQGKRQKEQRKNQKIIKLKEVRM
FT                   QPKIDTHDLDFKYRNILGFLKEGNKVKVTIRFRGRELAHTHLGYGILEGILERIGDANY
FT                   ILESPAKMEGKTMFLVIAPKSKK"
FT   gene            188820..189482
FT                   /locus_tag="BH0192"
FT   CDS_pept        188820..189482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16708"
FT                   /protein_id="AAX16708.1"
FT                   /translation="MNIFLLTSLPLVFKIYMLIKHPQLKPIRQSYINSTSILLAMTIFS
FT                   LLYLTEEFILYKNLLINYQTKFSLAYSIFVKEQIYYYVFPLFIFTFFFTFNPNSLLKKN
FT                   PIFLIYFAFGLLLSKNLALIITNSKVFGTYEYIKIPLLHILELIFTAMICEKGIRLHIT
FT                   QNINGYQLIFVPILILEAIITLLKVLILINAQIYALMISIILLGIIILNKKTIGNVK"
FT   gene            189482..190240
FT                   /locus_tag="BH0193"
FT   CDS_pept        189482..190240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16709"
FT                   /protein_id="AAX16709.1"
FT                   /translation="MPHTIKTFIIAMIFTLCFSCKNSKITDKNFSYIIIFSDVTEYFFK
FT                   IENTPFIQEETLFINEKDIEIIKDKLNNVKKILLTHKSSNDIFNDIINVNTIKKKTFYL
FT                   SEVKFSLKKAIDFIFNDPSIDLTTSLIMKDNTLNQEDSEHLEKSAKEQNINITIIDDKN
FT                   IQYLKNLITPKITSVLLFSMKNNRVFLKKLAESAFFKKIEFILIGNTKKDFKEVNAKYI
FT                   ISINELDLIEITQNINKNFQYEFNIYNKTT"
FT   gene            complement(190322..191119)
FT                   /locus_tag="BH0194"
FT   CDS_pept        complement(190322..191119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0194"
FT                   /product="sec-independent protein translocase protein TatD"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16710"
FT                   /protein_id="AAX16710.1"
FT                   /translation="MKLDFERSIFLKKLIDTHVHFNELNKNSIDIHYLINECFRNGFSY
FT                   FLDVGLHPSDFYERKHLLDTYPNISLTVGIHPLNKALSDDFELIERILAKEDVVAVGEI
FT                   GLDYLKAGNKRCQIEALSIQLDLASKYKKPVILHVREAYDDIYNIIKSSNFISRGILHC
FT                   YSGTYEYAKKFIDFGFKISFAGNLTFKNSEPLREVLKKLNIKDILIETDSPFLAPVPLR
FT                   GKINAPLFLGYTCLEIAKIKNCDVDSVVTALYDNFKDLFKDLI"
FT   gene            complement(191116..192258)
FT                   /locus_tag="BH0195"
FT   CDS_pept        complement(191116..192258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0195"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16711"
FT                   /protein_id="AAX16711.1"
FT                   /translation="MLDKKLLCDFGDISQISDNELLDVTEKSKRGYQLIKEERLSEAEE
FT                   LFDDILQKDDDNNYALVGLGDIERKKRNFDKAIIYYQRCLAKHSNNNYALFGLGDCYRS
FT                   LGDYKKATDVWEEYLKYDSENITVLTRVASSYRKLKNFQKSRQSYLRVLELVPDNDYAL
FT                   VGIGHLYYDFKEYKEALKYWLKMYEINQVKIDVRVLTSIGNCYRKLKEFSKGIYFFKRA
FT                   LEISPNNFYAIFGLADCYRGNKEYHEALKYWLTIIERDSKNNLVLTRVGDTYRYLKEYD
FT                   NAQIYYKKALDVDFDMFAILGLALLQKEQGQYEEALSAIKNLIKTNPKNSILYVNAAEC
FT                   YEALGQIGDAVDILSSFLQLGMKNVTIIDYINNLKKKLDT"
FT   gene            192556..193629
FT                   /locus_tag="BH0196"
FT   CDS_pept        192556..193629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0196"
FT                   /product="bacterial peptide chain release factor 1"
FT                   /note="RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16712"
FT                   /db_xref="GOA:B2RZQ6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZQ6"
FT                   /protein_id="AAX16712.1"
FT                   /translation="MFLEKLSPIESKIKILEEKLQDINLVKNQKEYAKTVKEYNYLEKI
FT                   KAKKDEYENILSQINENQKILSEEENLEMKELVKQELAHLNLKKDEVEHMIKILLLHQD
FT                   ENDSKNIIIEIRAGTGGEEAALFAHNLYEMYTKYSEKKKWKTELINFNETELGGFKEVS
FT                   FEIKGKDVFKKLKHESGVHRVQRVPITESNGRLQTSAATVAVLPEVEDTDIEINEKDLR
FT                   IDVYRSSGAGGQHVNTTDSAVRITHLPTGIVVQCQNERSQHKNKDQAMKILRARLYEFE
FT                   NLKKQEQRSNDRKQQVGSGDRSERIRTYNFPQNRVTDHRANISLYKLEEIMQGELDFLL
FT                   DTLALKFQEQSLKDNSI"
FT   gene            193639..194472
FT                   /locus_tag="BH0197"
FT   CDS_pept        193639..194472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0197"
FT                   /product="peptide release factor-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16713"
FT                   /protein_id="AAX16713.1"
FT                   /translation="MTINEAIKSSKQHNLNTLEILLLLEKILKNRKELILANTNKTLTK
FT                   QEEHKLLSQIKNIKSGTPINYILGTKEFMGIKFYINKHVLIPRADTECLVEEALIQIKK
FT                   HNLNRILDLCCGSGCIGLTIAYYLKRKVTLSDISTKALRVSLRNTQRLKLENYIEIQHS
FT                   DLLKYIDKEFELIITNPPYLNKDELKIKEKLAKEPRIALLGFGRDGLKIPKKIIIQAKH
FT                   KLTKNGLLIVEMAPWQTNSLKKFAIQEGFEYLKTIYDIENRERALVLRIKHDTSL"
FT   gene            194456..196459
FT                   /locus_tag="BH0198"
FT   CDS_pept        194456..196459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0198"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /EC_number="3.1.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:BH0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16714"
FT                   /protein_id="AAX16714.1"
FT                   /translation="MIQVYEIAYLLKINDIDKLKNIFRKIVNNTYQDEIQKKLIFKALE
FT                   ISEQLHYGQYRESKEPYIIHPIMVALFLIKFQLDFKTIIAGLLHDVLEDTSVKKEEIIK
FT                   EFDQEVLSLIDGVTKIHDLHNKTRAIKEANTISKMFFAMTHDIRIIIIKLADKLHNMAT
FT                   LSHLPKNRRERIARDCLATYVPIAERLGISSLKIYLEDLSLKYLYPKEYKEIKNFLSAT
FT                   KIEREKKLYKGKLIIEKELKKIGIDVVITVRSKHFYSIFRKMKTRNNNIAQIFDTLGIR
FT                   IICKKQKECYEILEIVHKVWKPIPGRLKDYIAIPKENKYQSLHTTVRIPEDNQLIEIQI
FT                   RTEEMDRIAKYGVAAHWLYKEQVELKADDISFINRIKKWQQESVNKNQYSMYDIHKELL
FT                   NTFIYVYTPEGEIVELPFGSNSIDFAYTIHTDIGDQALYAKINGKISSLTKPLKNEQIV
FT                   EIFTSPEAKPDVIWLNSVRTKKARSKIRSWLNKNDNTIFVDNNIIAYLIGENKEQKRLF
FT                   SLFKSLTKDKLKSITIASDCNPLTDEDIIGIIQKDTIVVHKEHCKEIIHQKKSHLVEVE
FT                   WEATPTRKVYHIIIFLKNLKGLFNYLDNLFTIFDVRLISEKIEDCGNGHGIINIIISSN
FT                   AKNVSMILTSLKENPNVLQIMQVEEDIKNYDN"
FT   gene            196449..198692
FT                   /locus_tag="BH0199"
FT   CDS_pept        196449..198692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0199"
FT                   /product="pili chemotaxis protein CheA-like PilL"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16715"
FT                   /protein_id="AAX16715.1"
FT                   /translation="MIIKILLLILIHALIPHKIIKADEREQCSKQIRKHITKINELNGS
FT                   LEQTKRIGNIYNYIKQYFLENNIQYKEHSLQEIGFIGYSQKTIHAKIKGIAKTNYNIII
FT                   PIEIQYNLKNNLAIAIAITLIDNFKNKKLKNSLNIYFIEDDSHKQISTISSRLLLNNNA
FT                   LEKNTNTIYLMLNEEKENNLIDFKNQSNIINSKTNLSFLENFIKAFENNKVNFNVSKIN
FT                   DKNINEIYNLYLKEEIPILIISNNKEQPFLTYVNHNNLCGIYKSIEEAIKAQKNIQNEN
FT                   ALHYIIINTLFKKWIINENTLIIIIYAIYNFTILIFITRFKKTSIIFRKTKENYHKIIK
FT                   LFFILFLSTYISTLLTNKMLKAYENFIDYNIINPIYLVNFFLTLFNFNLISYFTYNFKI
FT                   HLTLKELKYLAISISIIELIIVLYIKIEFILTIILKNILIFIIPNKGKILKKIVIMFMW
FT                   ITNLMLITSIQTTLMMSKPIALSYFISISLFSAILTNIVEHLKHKTATIRQELNKSEKI
FT                   ESIILFLIIAITIISHDIEKISTIKIDQIISFPEKTNKISVEYLQDNRNTIEISTKDFN
FT                   LNLDKNKKHAKKEIKIQKDLIDLSFQKIDVAERTIYEVKIATNKIAKQIHLFLKNASEL
FT                   IIYQSNTPYKIASNNIIFTVNNIKSNTINITFTIKSQEKIQYDAFAYFHIDEHHVKIYD
FT                   QKTKKEVKNINIDYSYAIKYSGILPKSAKYDQDPFFKLQNDKEIENLKNFKLN"
FT   gene            complement(198689..199786)
FT                   /locus_tag="BH0200"
FT   CDS_pept        complement(198689..199786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0200"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BH0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16716"
FT                   /db_xref="GOA:B2RZR0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZR0"
FT                   /protein_id="AAX16716.1"
FT                   /translation="MMKKNLMLIFGGVSFEHEISLRSAYGIYSALMKLDKYNLYPSFID
FT                   KITGIWYLLDSVPDAPELIKRDSSAIISLIPGCGIFVNDEDLEIDVVFPIVHGRTGEDG
FT                   AIQGFLKMMDIPCVGAGILGSAISINKYFCKLLLKSFNIPLVPFIGFRKYDYFLDKEGI
FT                   KKDIKQSLNYPVIVKPAMLGSSIGISIAYNDTQIEKCIEEAFEYDLTVVVEKFMKVREI
FT                   ECSVIGNEQIKIFTPGEIVVQDFVFYDYDAKYSTIPGNSVVFNIPARLDMKHLLDIKEY
FT                   AFLTYKCLELRGMARIDFLIEKDTNLIYVNEINTIPGFTDISMFSKMCEHDGLDYESLV
FT                   DNLVSLAFQSYAKRKERIDFKRLEN"
FT   gene            complement(199788..201332)
FT                   /locus_tag="BH0201"
FT   CDS_pept        complement(199788..201332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0201"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--L-ornithine
FT                   ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16717"
FT                   /protein_id="AAX16717.1"
FT                   /translation="MFFVEFMSMNRKMLNNILSKLDKNMIKEVRGSCEVEILGLTYDSR
FT                   CVLSRFVFFALPGLHFDGQKFIESAIQQGSNVIVHTNDIDSYDPNVTYIKIDACNIKRF
FT                   MSNFSHIFYDEPSKKLKIIGVTGTDGKSSVCFYIYTLLKSMGVKVGFISTVFFEDGSGT
FT                   LVKNPYRQSTPESTEIHLVLSKMVENNVEYAIVESTSHGLDARTSRLIDISYSVAVLTN
FT                   ISHEHLEFHGTMQHYLNAKLNLFSSADANGGFGIVNMDDNNFSVFLNAINRVYTYSLEN
FT                   KNADFFVSKINEQMGFIEFEFYHKDVKYDARVNLTGSFNVENVMAALIVVSQVMNIHIS
FT                   ELIEKLVNVEGLCGRMQGVDFGQDFSLIIDYAHTPGAFLKIFPMFKRLAKNRLISVFGS
FT                   AGERDTFKRKLQGEIADRYSDIIILCDEDPRSEDSMQIIRDIAEGISGKTLNKDLFFIP
FT                   DRRSAIEKAVDIAYAGDLVVTLGKGHESSIIYEDRSIFWDEQAVIKDIILNLRDRG"
FT   gene            201441..201513
FT                   /locus_tag="BHT0002"
FT   tRNA            201441..201513
FT                   /locus_tag="BHT0002"
FT                   /product="tRNA-Cys"
FT   gene            201605..202846
FT                   /locus_tag="BH0202"
FT   CDS_pept        201605..202846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0202"
FT                   /product="magnesium and cobalt efflux protein CorC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16718"
FT                   /protein_id="AAX16718.1"
FT                   /translation="MLELIIILTFIILSAIFSASETAYTSLSLIQLQDIKKKGKLGTVV
FT                   YNLAQDPSKLVTTILIGNNIANIAASALTTKFVLDKYGNNALALSTGIITIIVLIFSEI
FT                   FPKQVAILNNESIVLSTSILLKILTIIFTPAIYVINGIVKILLSLCKIKSSQKMTKDSI
FT                   KNMLFLAEKLGILENDDRIFMQKMLNIGEVRASEVMTHRTEVFSLSSASKLKDKIKLIK
FT                   KEGYSRIPVYKGQNREQIIGILITKDLIEISKKKLEKNIIKFVKPAVFVQQNKRIKDIL
FT                   DIMRQKQKIMAIVIDEYGGFSGILTIEDIVEKIFGAIFDEYDFEEKKQLITKKDENIYL
FT                   ISGETTFDEIEETVGIKIQHKDYINTIGGYIMDLLDKIPTSGEQVNTEHGEYLIEEIQN
FT                   HKIKKITFKKFEKE"
FT   gene            202994..203926
FT                   /locus_tag="BH0203"
FT   CDS_pept        202994..203926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0203"
FT                   /product="HflK protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16719"
FT                   /protein_id="AAX16719.1"
FT                   /translation="MLNNILKFFNKTYEYMIILIILVIILIITIANIFVVGPSEEAIVL
FT                   RLGKLNRILEPGIHIKIPLIEEKAIVPVKIVQEVKFGFNANNNIEANLDENEGIIITGD
FT                   LNIIKVEWLVQYKISDPYAFMFKVEDPEKTIIDIAKSSMNRLIGDNTIFEIINDNRVGV
FT                   TEGVKASMNEIIKTYDLGIDIVQVQIRNAMPPKGKVYEAFEDVNIAIQDKNKFVNEGRK
FT                   EFNQIIPKIRGEALKVLEEAKGYKESRINNALADTAIFNAILNAYIQDPEITIERIYNE
FT                   TMREILESRDNIEIIDKNLNNFLPFKEVK"
FT   gene            203928..204899
FT                   /locus_tag="BH0204"
FT   CDS_pept        203928..204899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0204"
FT                   /product="protease activity modulator HflC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16720"
FT                   /protein_id="AAX16720.1"
FT                   /translation="MKYILRFLFSIAKILAFTLTFGLVSLAIMQPLYILRENEISITTR
FT                   LGKIERTENTAGLKYKIPFIENVQIFPKNILRWDGEPQRIPTGGEEKQLIWIDTTARWK
FT                   IVDVNQFYTAIKTMNRASTIINAAIEPAVRGVIAKYPLLEIIRSSNDPIQRLSDGILTP
FT                   QDATDNTTYKITKGRKIIENEIIEVSNQNTKDNGIEIVDVLIRKIGYDPSLIDSVHNRM
FT                   ISERQQVAEEQRSTGIAEKTEILGSIEKEKLKLLSEAKAEAAKIKAEGDHEAAKIYANA
FT                   YSKNVEFYKFWQALESYKATLKDKRKIFSTDMDFFKYLHNKK"
FT   gene            205310..205382
FT                   /locus_tag="BHT0003"
FT   tRNA            205310..205382
FT                   /locus_tag="BHT0003"
FT                   /product="tRNA-Phe"
FT   gene            205590..207134
FT                   /locus_tag="BH0205"
FT   CDS_pept        205590..207134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16721"
FT                   /protein_id="AAX16721.1"
FT                   /translation="MILKEIKKVEDLTEKDIIFSKIGNLAKLSTRVNEKIIELLNKGNV
FT                   SHIPVINNHENIPHEKLINTVNEELLNNEINFLKEELIEALKDIYKPFSEKDKMFIIAG
FT                   RKTLINLNTLMEREPDLIYFKEIIEGSFKILPKHKIISIQKILLKIYDYFNFQKIIDKD
FT                   NINNIKTIQKLYLHSIRRDYEFFREQVKTEGDSILLHAIDTTIYFLITIAQLNKERAAK
FT                   DAPRSTLKFFIDKSNYTEFTEFFYDNDIILQAALGVLLHPIGLMHTTILQKLREKISLK
FT                   NKDTKEQYMSKIEILEKSINVSKNLFRLREDISAITKMIINGQKSYLNIKNRAETTTKK
FT                   FTHELIRIFCIIDIYDEMVNPIIIKEPVNPLEAIEFLIKNSEKYYWAKDKPEEYLKNKK
FT                   FDIEMLKNFLKILAPFDCGTIVDAYTKDYEGPLFKAVVMKYTTGILPIVSIIKQKDRSY
FT                   KIGDILLNLESREIIIKGQNGDIKKSPFKNTDKFELRHNIEELKSDEFQLLTSMQD"
FT   gene            complement(207140..207712)
FT                   /locus_tag="BH0206"
FT   CDS_pept        complement(207140..207712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0206"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16722"
FT                   /protein_id="AAX16722.1"
FT                   /translation="MKNDLEFVLMHVSAGKYKGWKVAFPKIGGVRPVMAIVREAFFSII
FT                   FNQIVGSSFLDVFAGTGIMSLEALSRGASLAHLVDYNKSSKSVLIKNFEVVSEPYKFCF
FT                   KKAELFLKKRDLYYDLIYLDPPFGYSFKENLLKIISENESLNKDAKIIIHYPSRENLDS
FT                   NILRLSKYDSRKYGGSRLDFFKVSPYV"
FT   gene            207771..208604
FT                   /locus_tag="BH0207"
FT   CDS_pept        207771..208604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0207"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16723"
FT                   /protein_id="AAX16723.1"
FT                   /translation="MKGIILAAGYGTRFLPITKTIPKEMLPILNKPSIDYIIEEFTSSG
FT                   IKEILIITSRRKGALDNYFDREIELETEFAKKYREDLLKKIKLKDINISFIRQNEMMGT
FT                   GHALLQVKPWIGTESVIVAYPDDLHVGSPPLTAQLIELHKKTGKNILSVIENPKDINRY
FT                   GVIELNKDNIHVKDIVEKPEIGKEPSNKASIGRFLYTHEFFKFLEEGFKLHQKGEYHHI
FT                   YALKKLMSENKVLYKEIEGERLDIGDIGGYLEAIIKIAKRNDQLLQIIKDSLRTK"
FT   gene            208601..210313
FT                   /locus_tag="BH0208"
FT   CDS_pept        208601..210313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16724"
FT                   /protein_id="AAX16724.1"
FT                   /translation="MNISTKCQEFYDALSILKKYIHINIEEKILRYSILSKLYKLNEEA
FT                   IKDLIKISQDYELKKNKINITLEEYYYEETQDQKIKNWILAIIREKNLLQIKKETNLIS
FT                   KRPGITYKLNSTNFLKIIEMQNNSKYTQEKKELYKQLILNFSSNLKIANLEPTIDILIA
FT                   VKHRNKEKIRYIIKYNQSFQRLFKSSLRKKQSRVIKLKKLLILIYWPVGCLSKSLFNKI
FT                   LTKNYRYIIDEVLTLKYDEILKYLQTIKTLSLNEIFYKGSNKNSNFNYFFSEFTKYTPN
FT                   DFQNTLKTYLFSLEKTAIKQYLEWFFKDKVPNKWKDFIFAIEYIKTHKLLNLNANIENM
FT                   IIAKFKAEDFFVSFEKMNFNPYESSKIFQNKYIKKIFLQNVINYIKNNTTKIDTYGWIA
FT                   FYIYADKDTKTKFSKDIKNFFKSKNFEIQNQIFVYFLSFYPNIDKKHFEFISEIMIHLD
FT                   EDKITIPQEIIKMQKTSSNRLNYRKSYIFIQSLILRTRVFKILHKNIKLELLFKLEEFK
FT                   TEKLLPAICYIICYYKPDALKEEQTISPKQKEEIIKFITLFTKEQNKFDFKTL"
FT   gene            210327..212144
FT                   /locus_tag="BH0209"
FT   CDS_pept        210327..212144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0209"
FT                   /product="mucin 2 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BH0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16725"
FT                   /protein_id="AAX16725.1"
FT                   /translation="MLESNKIVLIKDMKKCLLSLKNLIILLILLLNANLAYSQRLIKIG
FT                   QEEIKNKNYLQAIKILSEAIQKYPKVQNGYYFLAIAYRENNQLTEAEGALLDGIAIGGD
FT                   IDYKLYFELGNIMFKRGEGYYNLAIKYYSNSVKNMPNYDKALLNRANSYVEQGKINFKE
FT                   KDYKNAWDSYSMAIHDYSQFITLRYESEKKNSILHMIDLLRNKKAALEKLDKSLKNRSE
FT                   HIAIGQQQDHGNKEPQINKKEPTGKDKPADKEPQINKKEPTGKDKPADKEPQINKKEPT
FT                   GKDKPADKEPQINKKEPTGKDKPADKEPQINKKEPTGKDKPADKEPQINKKEPTGKDKP
FT                   ADKEPQINKKEPTGKDKPADKEPQINKKEPTGKDKPADKEPQINKKEPTGKDKPADKEP
FT                   QINKKEPTGKDKPADKEPQINKKEPTGKDKPADKEPQINKKEPTGKDKPADKEPQINKK
FT                   EPTGKDKPADKEPQINKKEPTGKDKPADKEPQINKKEPTGKDKPADKEPQINKKEPTGK
FT                   DKPADKEPQINKKEPTGKDKPADKEPQINKKEPTGKDKPADKEPQINKKEPTGKNKPAD
FT                   KDKFKDNLKTDSLIELDKINWQEELNIDE"
FT   gene            212137..214491
FT                   /locus_tag="BH0210"
FT   CDS_pept        212137..214491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0210"
FT                   /product="surface-located membrane protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16726"
FT                   /protein_id="AAX16726.1"
FT                   /translation="MNKRKNLPILIILIILLIASFGGLGYYVYKERLNKNNQEIMLNEV
FT                   KNSIMDRNYKKAHSITKILKDKYPQNTDIAMLENTLSELANNSPFESKNLQRDTANQIL
FT                   DKIQGKEQLIPINNENSEIAFNNRYIKDTTKIENYADRKDDIGIKNEDILEFNQNTVPE
FT                   NLSNNTSKIVKQQESNLNSNKSIENQKNLFNLKKLKENLNKELNQTKTIQLNTPNKIIK
FT                   KHKQNEDKLIEKNTDFKENKTKQIDKVNKIPPTLKPKTKIESTNTKNATKNQIIEKIER
FT                   PYSYVIKKVLYEILDNINTGNPSLAKERLNELIKKGLSHKFNKVNDLIDKLKNQEAANL
FT                   LIKLIKQDIEPNSTGTEKAPFNKELLKQEHPKEKISPIKDQSIDNQIKMEEEPKTYANH
FT                   LRQASTDLQSLKMLASTNEEQKDFKKAEEIYEKIVSITNNAEDHYKVGIIKFKLKKYEE
FT                   AIKAFGKTISLNPKHKKAYTNKGTSLILSNKPKQAIEAFKKAITIDKNYDNAYYKKGIA
FT                   EEQNDDKQNAFLSFKKAYGITKNPHYALKAGIIANHIGDFKNSEKYLDKARASIKEKND
FT                   IMLYNLAIAKFENNNLNESLKTINQALVINPKKPEYLYLKASIYLTKENYNEAIPLYNA
FT                   VILKNPDNITAHINLARAYEKSGNELKAIEILEKISNKNHLLALNNLGILYKNQKNYQK
FT                   AIKIFQKAEALSSLEAKYNLATTFLALKDNKRAMEKLKEYIKINPNNPEALHALGTIEY
FT                   NDNGSDKILKEVINKFPNYKQNKTIMKIIGK"
FT   gene            214488..216326
FT                   /locus_tag="BH0211"
FT   CDS_pept        214488..216326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0211"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:BH0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16727"
FT                   /protein_id="AAX16727.1"
FT                   /translation="MNKIKFLDKSLVQKIAAGEAIDRPCSILRELLDNAIDSGADKIEV
FT                   FIEEGGIRRILITDNGSGISREDLKICYLPHTTSKINEEQDLEKIQTLGFRGEALSSIA
FT                   ICSNLTITSSTTGEDSYQIEVENGTEKYFKKQSAINGTIVDVTNLFHNFPARKRFLKKD
FT                   SIETKMCLKVFEEKAVTHPGIDFKLNINNELRKVYFKESLIDRVQSVYGEIIDNNKFGK
FT                   IEAEYENIQMKIFFAPPNFSRKDKRNIKIFVNRRPVEEKNLSEAIIDGHSRILTNRNFP
FT                   VCYLFLEIDPRYIDFNIHPQKKEVRFFNLPFLPKQIASNINEFFDRGQKEILQDYHNII
FT                   IKRQLTNDDHLLHTEDDPTNSDFQAYKITQNEALTLDKPQNNKITNIIEDKVKFESQPP
FT                   TQKDKPSFKNYIQNIFLKTSTMLNDLQKPIEKHEFKYIGQLFSEFLIVESDNEVYFIDQ
FT                   HALHEKIIYQILIKSEKIIQKLLVPIEFQVDCEDKDKILASELEEYKKIDITVNKIKEQ
FT                   TYQLESIPNICNKYESVIIQFLKTRKSKTIDSLEADLYATIACRQAIKRNDTISSEFSQ
FT                   FLINEFFNLKLKHCPHGRKIYHKISKFELEKNVNRK"
FT   gene            216347..217387
FT                   /locus_tag="BH0212"
FT   CDS_pept        216347..217387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16728"
FT                   /protein_id="AAX16728.1"
FT                   /translation="MIKTLKSKIKKLIPQRDKKLVELGKALKNSNVIELKKLESYTSLK
FT                   LIEKEISQLKANLNKAEDDESKLKELYKKEKDYKESKKHILKGYEIKLKKITEIIINKY
FT                   PNNLSAILEYKMNFAKSALQKHKYKITEITKFNEKINFFKKLIINTKLILKNIINKINI
FT                   KKIAKEFEKKILKEHLFSENLENLVDEFVGNKELSKEIIEKYKLMNEIQSEIVKINNAI
FT                   KHKNIKDNINIRNKVERAINVAQINKELILKKIAEEFFEMSKTEKGLNKNGTINSLLET
FT                   IKNINQQISKLNDALIKAIKIEEIAKVRTKMQQLIKNKESIETKLNELNSKIETIQNEI
FT                   DELDNQ"
FT   gene            217484..217557
FT                   /locus_tag="BHT0004"
FT   tRNA            217484..217557
FT                   /locus_tag="BHT0004"
FT                   /product="tRNA-Met"
FT   gene            complement(217560..218216)
FT                   /locus_tag="BH0213"
FT   CDS_pept        complement(217560..218216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16729"
FT                   /protein_id="AAX16729.1"
FT                   /translation="MLRELKNNILLLFFIVFCSCEMNYPDIREIDYVINYYFTKNKLDY
FT                   FMTFDFAVKVLNPSDVIKFVIENMDSKEFIEVVRDKHTSSFIGSVLGGDVLYCKDLRFN
FT                   IADKTFNDFVAQVHLVDSGMRVYSKDIVINLSLSEEELTLIHDYMYKSKDMVKLNEIGG
FT                   NNFYLIKTPKDEIGFLYSIVKIDDLTNIDLDDDNLDVYIGFYYMGKNSNLFFKLK"
FT   gene            complement(218194..218772)
FT                   /locus_tag="BH0214"
FT   CDS_pept        complement(218194..218772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0214"
FT                   /product="protein translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16730"
FT                   /db_xref="GOA:B2RZS4"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZS4"
FT                   /protein_id="AAX16730.1"
FT                   /translation="MGTIKSGEIEKGSFLLFKGMPHIVLEREFSKMGRGGAIVRLKLKN
FT                   LKNKSVVKETLKGADTVEEIEVLEVSSQYLYRDSENLIFMDLETYDQFNVNLREVPNIE
FT                   DKVLFFQEAEVYSLVKWDNEVIDLKLPPKVAFEVVAAEAAVKGDTVTNAMKNVTLHTGL
FT                   VVKAPLFINVGDKILVNSETKEYAERVKE"
FT   gene            218838..219743
FT                   /locus_tag="BH0215"
FT   CDS_pept        218838..219743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0215"
FT                   /product="phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16731"
FT                   /protein_id="AAX16731.1"
FT                   /translation="MTYLGLMILYIVVKGVNLMQAIKILFAISLAFLFINCTNKGKENV
FT                   IAIGGSTSTTSIMDEMILRYQKINDQIKVTYDAQGSSVGIKGLFDGIYKMAISSRNATE
FT                   EEIAQGAKITVIAYDALIFITSPDVKITNIAEEDLVKILNGSIRNWKQVGGPDAKINFI
FT                   NRDSSSGSYSSITELVLEKILKNPEEAQFRKDSIVVKSNGESIEKISLTPHSIGYISFG
FT                   YARGAIEKGLHTLSINSIYPTKETIIKDKYNIKRRLIAITSSISENQNTLDFINFMLSP
FT                   NGQDIVEEQGFIKVHTTENN"
FT   gene            219826..220734
FT                   /locus_tag="BH0216"
FT   CDS_pept        219826..220734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0216"
FT                   /product="phosphate transport system permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16732"
FT                   /protein_id="AAX16732.1"
FT                   /translation="MKLTLNTKRNTVRLAFNCFIFISTTISTLTILLLILFIIKNGLAP
FT                   FLHNRIKILNFLFSTNWDPTSKLQKSYGILSFIINSALTTFFSVLIALPIGLGFAIYLS
FT                   ERTKGIYQKTLQTIIELLAGIPSVVYGFFGSTFIATLVKNTFRREDNLGHNLITSVIVL
FT                   SIMILPTIISVSYTSLKAVPKSYKLASLALAATDWQTIYKVMIPSAGKGILAGVILAIG
FT                   RAIGETIAVLMVGGGSPLFIKNIFSPIRTLTVNIAIDMGYASGTHKEALFSTALVLLLL
FT                   VIIINSIKHFILSSSKRLKIK"
FT   gene            220731..222272
FT                   /locus_tag="BH0217"
FT   CDS_pept        220731..222272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0217"
FT                   /product="phosphate transport system permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16733"
FT                   /protein_id="AAX16733.1"
FT                   /translation="MNTIQINKLFNKISFCIIKFIAYSLITLLFFLISYIVYNSLFFTS
FT                   KKQTLFLDETKHFLPFTLKNKIIKIAFIINKSIKAEEITTQDIYNIYNNKISHWGSISD
FT                   QSIDIIPLANSQSNLASKVILQTFTNDNKFNNRYIKIIESNEETIETVNKTTGAIGYLT
FT                   KEDLEKLDFKKYPNIKSLKIKSMSILIGKKTLQKSENEIINILSLNQIQKLLIGKMDWN
FT                   DLIYKNIKPNIIKYSSYDQNAIKAVEENEGTIAVVPWHSFYKSDAPFLKLYYMKKSMPL
FT                   NLNFILSTPRNSGKYGGISYLILNTFYVILLTAIISISTGIGTGIMLAEYTSNKVLYKT
FT                   VSMSVDILSSIPAIIFGLFGLIFFVPIFGMGILSGAITSSLMILPMIVKTTEESLKSIP
FT                   KSYKYASFALGANKTETIIKILLPASSPGILTGIVLAIGRALGETAVLLFTMGTNLGLA
FT                   SALNEPSRSLTVHLLLLFQEGYLDKGFATASILIMMILLINLTSKFLINRLYRIK"
FT   gene            222273..223037
FT                   /locus_tag="BH0218"
FT   CDS_pept        222273..223037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0218"
FT                   /product="phosphate transport ATP-binding protein PstB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16734"
FT                   /protein_id="AAX16734.1"
FT                   /translation="MSQDKAIIKTENLNLFYTDFKALNNINISILRNSITALIGPSGCG
FT                   KSTFLRTLNRMNDLVEGVKIEGKVIYEGKSIYSNNFDVLELRRKIGMVFQTPNPFLMSV
FT                   YDNISYGPKIHGIKDKKKLDEIVEKSLIKSALWNEVKDKLNRNALSLSGGQQQRLCIAR
FT                   TLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFF
FT                   LNGQIEEESQTDELFFNPKNTKTEEYITGKFG"
FT   gene            complement(223038..223859)
FT                   /locus_tag="BH0219"
FT   CDS_pept        complement(223038..223859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0219"
FT                   /product="zinc uptake transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16735"
FT                   /protein_id="AAX16735.1"
FT                   /translation="MFKHLCDYLLTLHPIFLGFLGSTFTWFTTAFGAAAVFCFRRVNNK
FT                   IMDAMLGFSAGIMIAASFFSLIKPAIEMAEGLGYIAWIPAVFGFLVGAFFIYIVDVFVP
FT                   DLDKLAFIDEDLTRHGKKDFLLFTAVTLHNFPEGLAVGVAFGAMASSPDLHTLVGAMIL
FT                   TLGIGIQNMPEGAAISLPLRRGNVPLWKCFNYGQMSGLVEIVGGLLGAYAVYTFTRILP
FT                   FALSFSAGAMIYVSIEQLIPEAKRKDIDNKIPTIFGVIGFALMMFLDVSLG"
FT   gene            complement(223898..225679)
FT                   /locus_tag="BH0220"
FT   CDS_pept        complement(223898..225679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0220"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BH0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16736"
FT                   /db_xref="GOA:B2RZT0"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZT0"
FT                   /protein_id="AAX16736.1"
FT                   /translation="MKLDELRKKYIDFFKSKGHCEIAGKSLIPDNDSTVLFNTAGMQPL
FT                   VPYLLGEMHPSGDMLVDVQKCLRTGDIDEVGDLSHLTFFEMLGNWSLGAYFKELSVKYS
FT                   FEFLTSPNYLNISKDKLYVSVFEGDESIPRDTETANVWESLGIPKDRIFYLSREHNFWG
FT                   PVGNTGPCGPDTEIFVDTGKEKCSVRCDITCSCGKYFEIWNNVFMQYKRDENGNYEELK
FT                   RKCVDTGMGIERTITFLQGKSSVYDTDAFKPIIDKIEKISGKIYGQNLEDDRSIRIIAD
FT                   HIKASCFILADNFAVLPSNIGQGYVLRRIIRRAIRYAKKLGMESYVLADLVDSVEEIYK
FT                   SFYKELTEKKDFIKAELNVEEEKFFKTLRHGEQEFIKLIQQLSSKSIPGDISFKLYDTY
FT                   GFPYEITEELATEYGFSIDKAGFEEHFKKHQEVSKKGGDKVFKGGLADCTYETTKLHTA
FT                   THLLHKALQLVLGEHVRQKGSNITAERLRFDFNHPYKMTDDEIKQVEDMVNLQIKNKLS
FT                   VKRSVMNLDDALAKGAMALFGEKYEDIVSVYEIDGFSIEVCGGPHVKNTGELGTFKIQK
FT                   EQASSSGVRRIRAILID"
FT   gene            complement(225679..226908)
FT                   /locus_tag="BH0221"
FT   CDS_pept        complement(225679..226908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0221"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:BH0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16737"
FT                   /protein_id="AAX16737.1"
FT                   /translation="MRGFMQDPRLSKYQSAKNLGVKTFKSIEKDKLHDELSDSEIQGSL
FT                   LKSWVNLVKRGGREISSKSSSTNRGVEKPGFIRKESKVSKIAKYFLAIGLEKSAEIMAE
FT                   LDDADIIAITREITNIKYITPDDKKRIIQEFEELVRNEKKYLKIDDKFAYELLNKSLSK
FT                   AKAKEIYKKVTGNDPFLPFDYLSGIENEQLWALIRDENVQTLLVIYNYLTKIQKKYVFS
FT                   MFEKDIKKQFIKELAKPRQINMDMVEVISDRLKSRFEMQGKLKTEKLDGSKILVDILSY
FT                   MDSEDEKNLLSNIDMKALNPVKDSEIKEKIFDINVILRITDNDMHNILREFTDKDIASI
FT                   IKDKNDEIRDKILFNVSRRRKELILEEESFLKKLRKRDIKAITTSFVNYIKELTLKGEL
FT                   VIYRKNEEFV"
FT   gene            complement(226883..227599)
FT                   /locus_tag="BH0222"
FT   CDS_pept        complement(226883..227599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0222"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BH0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16738"
FT                   /protein_id="AAX16738.1"
FT                   /translation="MKGIVMEFLCSNKESDLKEKFFDFFLNNISQDDFTSIGVCGGRNI
FT                   ISFLNVFDEQNYSLKKSHFFLVDERCVELNTSYSNFRFLSEGFFSKMVEKNLICGSNLH
FT                   PFIYSEFDEASSIYNYNVEFNSRFTRLDLIILSVGEDGHVASLFPSKKLLFSEMEGYQY
FT                   EYDSPKLPSKRISLTPKSLLASKAAVLLFIGDEKKGALENFLNSGISLRECPAKIFKDH
FT                   SRLLVLTNIEGVYAGS"
FT   gene            complement(227605..228294)
FT                   /locus_tag="BH0223"
FT   CDS_pept        complement(227605..228294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16739"
FT                   /protein_id="AAX16739.1"
FT                   /translation="MVKRLLILLSSLVFVVASVIISSGIKNIGIKNGNYVTVKGLSEKE
FT                   VLSTSASWNLQYELGGNTVDEINKLNNANFLTIKNFFVSYGFHEDDITMRGMDFNISNH
FT                   RNALYKYNAYVSLGVYTKDVDKMEQASKNIIELYNKGVLFSGNDGPSYYFDKINEVKPE
FT                   MLADSVKNALWAALEFAQNSGAVLGKIKTANQGYFEFLPSDRSSARHERYSKKILRVVT
FT                   TVSYYLD"
FT   gene            228384..229391
FT                   /locus_tag="BH0225"
FT   CDS_pept        228384..229391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0225"
FT                   /product="NIFR3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16740"
FT                   /protein_id="AAX16740.1"
FT                   /translation="MLINRKISVAPMVAITDEHFRYMIRLLSKKVTLYTPMISAKSIIM
FT                   GNLNKVVKQTPTDSPIAIQIATSCENDAAKAIEILENKFNFDEYNLNVGCPSSKVQNAN
FT                   YGACLMQTPTQVGKILKAMKKNTNKPVSIKHRIGIRNNKREYHEENYTELQQFVEKIME
FT                   YEIKNFTVHARIAILNGYSPKDNQNIPKLRHDFVYRLKQEHKNIFIEVNGGIKSSDHIK
FT                   THLSYVDSVMIGRAVAKDPYLIAKISREFLEEKEKIPTREEILLKMVEYIKEYDECLSI
FT                   STILKHIMSIVFAKENACKFRQTLSAPFPKNLKNHEILLSAIEHLREDTLKSNS"
FT   gene            complement(229381..230706)
FT                   /locus_tag="BH0226"
FT   CDS_pept        complement(229381..230706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0226"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BH0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16741"
FT                   /protein_id="AAX16741.1"
FT                   /translation="MFDFNLFLVKSIFGSSVMLDLKFIRDNLELIQKNIKDRGLKLNLD
FT                   LLISFDDERRKLVTKIGELNAARNENANAMKEKMDDSRRNYLIETGKALKSEIAVLEEK
FT                   LNYIASRLLIEHKQIPNIAAPDVPVGEGEDGNVVLKLSGNIPKFDFKPKDHLAIGIDLD
FT                   LFDFERAGEVSGNKFYYLKNEAVFLELALINFALNKLKLKGFDLFITPDVAREFIVDGI
FT                   GFNPRGTESNIYKIEDTDKYLVGTAEITLGGYYYNTILDLKSPLRMAGLSHCFRKEAGA
FT                   AGQFSKGLYRVHQFSKVEMFCLCKSEDSDRIHNEFLALEEEIFTELEIPYRVLNVCSFD
FT                   LGAPAYKKYDIEAWMPGRGDNGEYGEVTSTSNCTDYQSRRLKIRYKDDGQSKFVHMING
FT                   TAIASTRTIIAILENFQDERGGVRIPKNLVKYTGFDYISPKN"
FT   gene            230804..231520
FT                   /locus_tag="BH0227"
FT   CDS_pept        230804..231520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16742"
FT                   /protein_id="AAX16742.1"
FT                   /translation="MVKSSTAQKIFILISLLVIFIGCTKKTKKISFNDIDTLYNEKDEI
FT                   IIQSILAEEENEFFKYKIRIPKVTDGRTENNSIKTFNDEIESYANEIVTNLESATQNTK
FT                   QDSKKPTLNIDYEIYHGYDIYTIIVSATQVINDTSITNHRSYYISNHGDYIYNIDEIIN
FT                   TEEAFPYFTQRIKEQIEKTYPNKLLFDLQQAVIYFENKKIIIKFPLYVFNLDDTKNTEN
FT                   MFEFNEEEVKKYIKQG"
FT   gene            231533..234451
FT                   /locus_tag="BH0228"
FT   CDS_pept        231533..234451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0228"
FT                   /product="metalloprotease, insulinase family"
FT                   /db_xref="EnsemblGenomes-Gn:BH0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16743"
FT                   /protein_id="AAX16743.1"
FT                   /translation="MKKKKFFSLISKTYLEEYDAEGCYFQHESGLEIFELKSSSFKENA
FT                   FGIAFKTIPLNNTGVAHILEHTIFCGSNKYRIKDPFLYLMKGSLNTFLNAMTFPDKTLY
FT                   PAASTIQKDYFNLFKIYADAVFNPLLKKEAFMQEGYNINPNNFKLSGIVLNEMKGNYSN
FT                   KNSLINEIATNSLFCEGTYKYDSGGNPINIIDLTYEEFIEFYNKHYTLENCKIFLFGNI
FT                   ETNKNLNFIEKYIIRPYTKEKLNINYNIDKTARWKQGKTLSFDIPKETENTLGVYVINW
FT                   LCTDIENIKENIGLEILSEILLDSSCQFTINMLKSEIGDVIADVSGINTDIKECVFSFG
FT                   LQNVLPGKIEKFKNMVFNELKNLVKVKIPKELIQGILFGYEFALREEKGQGWPISLMIK
FT                   SFKGWIHGMHPTETLKINYHLDEIKNKLERGEPYFENLIEKYLLNNNHYTLIHFNPSDK
FT                   ILKEMEEKIEKKLMDREIDIKKNPKKLAEFTKDYNQFKDYQKKSDLKSGIAKLPMLKIE
FT                   DLPKEVEKSLNLNETPELKAHTFELKKNNNIFSVHLFFKLDLLQKEDFMHLSLLKRAIQ
FT                   DLSSQNYSYVDLNNKIQNILGQLNIYESYEEDIQGNMINLFNITFKSFNNKIQESFILI
FT                   KEILTNINFHDYDRLKEVVLSLKNDFKSILIPKGHIFATTRSESKLSQSKYLRELQFGI
FT                   TGREYWQKIKIDIESLKELACNLENLKNKIIFKDNLSSLLIGNTNDVIKRLESELFTLR
FT                   ESLSEKTDINNPLTIQPSSNTLKEIIIIPSKISFNSMSFVSYAITDENYPKINFLTHIL
FT                   KSGILWEKIRVLGGAYGAFASITNGIFSFTSYRDPNFVKTYQAFEASLEELANNEIKNE
FT                   ELYTYLVGVIGLSTNVKTKSIEILESYKRKMLNISDQLRQDIRNAYFKITSTDIKNISE
FT                   QVLHQLKQKSSLTSLVSNATYEDEKEKLEALIGKKYRLKKIY"
FT   gene            complement(234480..234728)
FT                   /locus_tag="BH0229"
FT   CDS_pept        complement(234480..234728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0229"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16744"
FT                   /protein_id="AAX16744.1"
FT                   /translation="MKKDIHPVSNLVVFKDGANGTMFLTRSTLTSRETIKYSDNKEYPL
FT                   ITVEITSKSHPFYTGQQKFVDAAGRIDKFNKKYKKLK"
FT   gene            complement(234786..236366)
FT                   /locus_tag="BH0230"
FT   CDS_pept        complement(234786..236366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0230"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:BH0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16745"
FT                   /protein_id="AAX16745.1"
FT                   /translation="MPFLKIYLIEEIMDKKYEEFDLEDEMKRLNSSKELKIDDNAKKKI
FT                   VKVVTKKESVSSGFKNPDIDRSRESNGASSDFDYDISDPDLESSIKTLEQSNIINFLGG
FT                   KDFIVIDSLYDKPITEIRKVVEGLGTNHTIAVTMKKTELIFLLVKILTEHNINVLFTGV
FT                   LDVLSDGYGFLRTASNSYLSGGNDVYVSPSQIRLFNLRTGDILYGQIRSPRDGERFFAM
FT                   IKIKSINDQDPTFAQNRIPFDNLTPLYPSSKLNLEYENCNISTRLINLFSPIGKGQRAL
FT                   IVSPPKAGKTTLLQKIANAITTNYPDIVLMILLIDERPEEVTDMIRGVKGEVIASNFDE
FT                   QASRHVQVAEMVIEKAKRLVENKKDVVILLDSITRLARAYNQTMPTSGKILSGGVDSNA
FT                   LHKPKRFFGSARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKSTGNMELILDRSLADR
FT                   RLFPAINIKKSGTRKEELLLSEEERSKILLIRKILSSVDDYEGVEALVEKMKKSKNNEI
FT                   FLKTMSNGD"
FT   gene            complement(236420..236827)
FT                   /locus_tag="BH0231"
FT   CDS_pept        complement(236420..236827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0231"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16746"
FT                   /protein_id="AAX16746.1"
FT                   /translation="MPVNVKDSYKWDCKLDASLIFRGKLRFEGALYLDSSFEGDIFSKS
FT                   GILFIGKNSKVITDVVICDTLVIEGILKGNVNASNKVYLNSGCKIYGDVKTKKIFINDN
FT                   IVFDGKCEMIKSNESIDLFSFTVSQLKDTFQ"
FT   gene            complement(236831..237157)
FT                   /locus_tag="BH0232"
FT   CDS_pept        complement(236831..237157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0232"
FT                   /product="DNA-binding protein HbbU"
FT                   /db_xref="EnsemblGenomes-Gn:BH0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16747"
FT                   /protein_id="AAX16747.1"
FT                   /translation="MSFSRRPKVTKSDIVDQISLNIKNSNERLEKKYIRLVVDAFFEEL
FT                   KNSLCLNNIIEFRSFGTFELRKRKGRQNARNPQTGEYVNVDDHHVAYFRPGKDLKERVW
FT                   SIKG"
FT   gene            complement(237169..237426)
FT                   /locus_tag="BH0233"
FT   CDS_pept        complement(237169..237426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0233"
FT                   /product="SSU ribosomal protein S20P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16748"
FT                   /db_xref="GOA:B2RZU2"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZU2"
FT                   /protein_id="AAX16748.1"
FT                   /translation="MGNNPSALKRARQNLKRNLRNVSVKSELKTIEKRCMSLIREGKKE
FT                   EALEFFKFVSKKLDTAARKRIIHRNKAARKKSNLSILLLR"
FT   gene            complement(237497..238339)
FT                   /locus_tag="BH0234"
FT   CDS_pept        complement(237497..238339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0234"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16749"
FT                   /protein_id="AAX16749.1"
FT                   /translation="MFKYNINMNGLFFYKIRLIFIFFLNISFSILYVLLYRNIFGTFIL
FT                   FLMLVSLFVMVSCLRYFYEIDCKENKIFYKKFYSGINFDFNDIVWIEKRLLDSMLILSL
FT                   NSGVKIKICYLRKKYLSDFFRKLKSIRSDLFIAKTQEFPIRYYISGVYLLMFLFRVLIS
FT                   IFVFYISFSSIVIFLLILLIGVKVLIDDILVIKDLVIFYEFRKDSVYERKIFSHKEYFY
FT                   KFFDNVFVHYSELGRDDYLSFFYKHEEALKKVYINNEGMSYSMQKVFSYIDKYYNKCA"
FT   gene            complement(238332..239438)
FT                   /locus_tag="BH0235"
FT   CDS_pept        complement(238332..239438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0235"
FT                   /product="GTP-binding protein"
FT                   /note="probable translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:BH0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16750"
FT                   /protein_id="AAX16750.1"
FT                   /translation="MSLNVGIVGLPNVGKSTLFSSLTASKSEIANYPFCTIDPNIGIVE
FT                   IPDFRLSEIASLVMSKKTVPAVMEFVDIAGLVKGASRGEGLGNKFLANIREVSIIVHVI
FT                   RCFEDREVIHVDGDVNPQRDISTINTELCLADLDTVQKSILKNEKNVKSVDKKVSENAK
FT                   IIVSMLKRLEKHLMNVRPAIEFEFDEFGHNFIKSLNLLTIKKVIYVCNVDESSLCGNKY
FT                   TDTVRDIALSEGNNYLILCAKLEAELAEIKDLNDRKELLESMGIKDSGLSNLIRTTYYA
FT                   LGLRTYFTAGEQEVRAWTFIDGMKAPEAAGIIHSDFQRGFIKAEVYSFDDLVEFQGVQG
FT                   VKEKGRLRLEGRDYLVRDGDIIFFKFNV"
FT   gene            complement(239463..241526)
FT                   /locus_tag="BH0236"
FT   CDS_pept        complement(239463..241526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0236"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16751"
FT                   /protein_id="AAX16751.1"
FT                   /translation="MFCITIPNLYSICLSIKKMVLILNVVALFFGSAFVLNSQGIVTNK
FT                   DAQEEFKWALNSYNNGLYDDALLSFKRVLSFDPSNLDYHFWIGNVYYRLGYVEEALMEW
FT                   RNLQSQGYKAAYFRQLISIIEQRIGISLHNELDVERLVQVASLNNSIYKRPNGYQITSL
FT                   KADQYGGYYAVNFVGNEILHFDANNNVNVLIKDGITSLKSPYDVIELGELLYVTLYAND
FT                   EIGIYDKTFGIKRGSIGKKGTEAGKLLAPQYMTVDERDYIYVSEWGNKRISKFDAKGNF
FT                   ILHFGIKTVGYMGLLGPTGVTYLNGNIYVADAPRNSIEVFDTSGNHLYSIPTSLEGIEG
FT                   LSSDVTGNSIIISSKYGVYKYSVLRKTFVKLLKADKIDSKISSSIIDVNNQIIVSDFDN
FT                   AQISIYKSDVSVYDSLNVDVRRVIKAGGPKIYVELNVSSRNGLPVIGLKSENFAIANEE
FT                   YYIVNPKIAYDINTSNDMNIAIVFDKSFAMKNYESEQIMSVNTLIKSRANKKFSFINAT
FT                   SVPLVDNIESLVSTIHKTNSLGTYDLNYVKTDVSLKLAGSELMSKSARRAVLYFSNGDL
FT                   SRSAFNRYSIDTILSYYKNNDIRFYLILFGNNPVETKLQYLVNETGGAIIPFSSYEGVS
FT                   RVYDLMMRQKTGTYLLEYDYPGLQEPNGYYNLSVEVNFNQQIGRGEFAYLVN"
FT   gene            241625..243178
FT                   /locus_tag="BH0237"
FT   CDS_pept        241625..243178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0237"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16752"
FT                   /protein_id="AAX16752.1"
FT                   /translation="MKIRYFCLAAFSGMLTTLAIPNEIKNIGYSSIGLVAYIPLFIALI
FT                   QIKNKKTLISLTIFYFLIANSLQNFWLAFFHSFGLITFLGAVCGYIPYALVLGYLLYYS
FT                   LKTFKNKTLTLAILFTFYDYSKSIGFAAYPWGFSAFMVNNFNDLIQVADIFGVFFVCFI
FT                   VYFFNAGIANFFIKQSKTNTLSLLFSILLVSTSFTYGIMKKQALNPILSKEIDTLKIAA
FT                   IQLNIDPWLPGNHKEGIKTSIKLTKQALRKHPDTELVLWSEGVLTLPFNSYKDYIYYDE
FT                   ELIGLYDSINELIINSKAYFVIGSPSRTDKSSFTYQNSVYAINPNLKIENIYSKIFLVP
FT                   FSEKVPFYEYKFVRDFFRQNFKLIGQINGNKLEIFKLKKFNLGFLICYDDAFPDLARSY
FT                   KKQNANLLLNFSNDSWSHTDSSEWQHFVVAKFRSIENGIKTVRATNSGITAVINEYGEN
FT                   VQSLETFKKGYLISKIKLPPRFTTIYEHIGDLFIYALAIAVVIMTLRFYFIEKSTHLSS
FT                   "
FT   gene            complement(243142..243933)
FT                   /locus_tag="BH0238"
FT   CDS_pept        complement(243142..243933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16753"
FT                   /protein_id="AAX16753.1"
FT                   /translation="MTRFLVEVSMRKLVLLFLPFAFISLFAENSSLVDDRQKELAIFYY
FT                   EVGQRYIDVGKIKKGKIFQKKALEIYPKLKEEVNLKAAVEEIDSKIRLEGEVNFLAFDD
FT                   VKLDDIPGITHDKIEISEMTNSPKIEYIADREREKHKEQAVKFQFSKFVRALLFQDLSL
FT                   LNSVMANEVKVLGKVEPRADFISKLEIVSNDVDKDDMSYLAADDFYDLKSLNVIKNTDV
FT                   SYSIKVKTKKNDFTKNIPFWRDVQTLCFANQDDKWVLFSIK"
FT   gene            complement(243976..244593)
FT                   /locus_tag="BH0239"
FT   CDS_pept        complement(243976..244593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0239"
FT                   /product="deoxyguanosine kinase"
FT                   /EC_number="2.7.1.113"
FT                   /db_xref="EnsemblGenomes-Gn:BH0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16754"
FT                   /protein_id="AAX16754.1"
FT                   /translation="MEAILVIVIEGLIGAGKTTLGHVLSKEFNIPFYSELNNEFTLFML
FT                   DKFYKDKSRWAFSVQINFLNERFKLIKAIFKTKGGILDRSIYGDRVFASLLNESGYISN
FT                   AECRIYFDLLDNMLEHSQRPVLMIYLDCSVDEAERRIKNRNRSFETGIPREYLEGLNEK
FT                   YLSWYDSYNLSPKLKFDYDSMDIFDDEHKSKLIAFIKEKLVI"
FT   gene            245442..246218
FT                   /locus_tag="BH0240"
FT   CDS_pept        245442..246218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0240"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16755"
FT                   /protein_id="AAX16755.1"
FT                   /translation="MIYIRFKEFIAEFLGTFILLALGTGSIAMTTLFPSNPAVAGEIIK
FT                   GGYTNIVLGWGLGVTFGVYTAAKISGAHLNPALSIGLASIGKFPTSKLFHYILAQILGA
FT                   FSGALMTLIVFYPKWIEIDPTFEITQGIMSTFPAVSGFWPGFIDQIFGTFLLMFLVLVV
FT                   GKFVKEETQNPFFPFIIGAIVLAIGISFGGMNGYAINPARDLGPRILLLLAGFKNHGFD
FT                   DMTVFIIPILGPIIGAILGAIVYEFTLEDKNNLKEF"
FT   gene            246280..247767
FT                   /locus_tag="BH0241"
FT   CDS_pept        246280..247767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0241"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BH0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16756"
FT                   /db_xref="GOA:B2RZV0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZV0"
FT                   /protein_id="AAX16756.1"
FT                   /translation="MKYILSLDQGTTSSRAVIFDKNANIKGFAKKEFKQIYPHPSWVEH
FT                   DPNEIWGSLLGVMAEALANARTFPNNIEAIGITNQRETTIIWDRNTGHPIYNAIVWQDR
FT                   RTAQLCDELKSKGKDKIFLQKTGLVLDAYFSGTKIKWILDNVAGARKRAEKGELCFGTI
FT                   DTWIVWNLTKGKIHITDYSNASRTLLLNIKSLKWDCDLLQILDIPKSLLPELKQSSEVY
FT                   GKTDASALGTEIIISGIAGDQFAATFGQACLQKGMAKNTYGTGCFVTVNIGKKPIINEQ
FT                   KILTSIAWGRKNSITYVFEGSVFIGGAVIQWLRDNLELFRKSGDAEAVAASVDNNGGIY
FT                   FVPAFVGLGTPHWDPYARGMIIGLTRSSTKEHITRAALESIALQSFDVLTEMQNSIQEF
FT                   EIKELRVDGGASKNNLLMQFQADILQCNVVRPKITETTALGSAYLAGLAVGYWESAEEI
FT                   TSLWKSDKIFEPSMEKSKREDLIYNWNKAIKRAKAWI"
FT   gene            247857..249242
FT                   /locus_tag="BH0241A"
FT   CDS_pept        247857..249242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0241A"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH0241A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16757"
FT                   /protein_id="AAX16757.1"
FT                   /translation="MEYSIMKKLFNFLKPAPHIKRVHKELEESLYKKYRFQIFMSIFIG
FT                   YAGFYLTRKIFAFAMPALEKDGFSKGQLGTILSGVSIAYGFSKFIMGNVSDRSNPRYFL
FT                   ALGLFLTAIITIIFGLFPWKSIESTIIAAILMFILMFVNGWVQGMGWPACGRTMVHWWS
FT                   RKERGLTVATWNLSHNIGGGAAGIISSWALFYFKEWQAILYVPTGLVIGIAIFVLLALR
FT                   DTPQSVGLPPIEEYKNDYPDNYTEKAEEELNTKDIFVKYVLNNNLLWYIAIANAFIYFV
FT                   RYGVLDWAPSYLLQVKHFSIKNSGWAYSLYEFSAIPGTIACGWISDKIFKGRRSETGII
FT                   FITATLIAIIIYWQLPENNPTLTTVILAIIGFLIYGPVMLIGLHALDLAPKKAAGTAAG
FT                   FTGLFGYIGGSVTASAITGIVLQHFNWDVYFYLLITACIFAIIFMSLTLKKEKKINDTN
FT                   KLQ"
FT   gene            249331..250353
FT                   /locus_tag="BH0241B"
FT   CDS_pept        249331..250353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0241B"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:BH0241B"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16758"
FT                   /protein_id="AAX16758.1"
FT                   /translation="MKSIKAKSLIFIINIFLTISCQGEKMSQNQKSPLVIAHRGASGYL
FT                   PEHTLEAKAYAYALGADYLEQDIVLTKDNIPVIMHDPELDTTTNVAKLFPERARENGRY
FT                   YSVDFTLDELKSLSLSERFDPASRNPIYPNRFPLNEHDFKIPTLEEEIQFIQGLNKSTG
FT                   RNVGIYPEIKKPLWHKQQGKDISKIVIEILNKYGYKSKEDKIYLQTFDFDELKRIREEL
FT                   GYQGKLIMLVGENDWDEAPTDYEYIKSEEGMAEVAKYSDGIGPWIPQIIIEGKITDLTS
FT                   LAHKHNMEVHPYTFRIDALPSYVKDADELLDLLFNKAKVDGIFTDFTDTVVNFITKIKP
FT                   "
FT   gene            250381..251943
FT                   /locus_tag="BH0243"
FT   CDS_pept        250381..251943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0243"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16759"
FT                   /protein_id="AAX16759.1"
FT                   /translation="MSKNGKEELKNIDNQAFDLIIVGGGATGLSIGIDSITRGYKTLLI
FT                   DKFDYAKGTSSRSTKLIHGGVRYLAQFNLSLVKEALHEKALFEKNAPHLVSKRAFITPI
FT                   YNLLSIPYYYFGLSWYHNLLGKYKKSKYKTKLLSKSKTIEKMPNIKTKGLKCSVLYYDN
FT                   SFDDARMAISMLRTFTEKGGIAFNYTELTGFTKRNGKISGAIIKDTINGEQVIINSKCI
FT                   INATGIFADELRKLDDTNATNIIKPSQGTHLIIKKDKLRTKYAMLMPTTSDKRVLFSIP
FT                   WYDGIICGSTDISIDKIEEEPKRLESEIEFIIKNMNNYLDIKITKNDILSVYTGIRPLI
FT                   IDPKKEQNTSKISRNEKIFVSDSNLITIAGGKYTTCRKMAEKVIQKAIDAKLIPDSIPK
FT                   TENLKLHGYIEREEALKIPEHFRVYGSDFKYLSQMKDFNNKIHTDLPLTEAQITFAIEF
FT                   EQAKTIEDILSRRTRSLLLNAKATIEATPKVAEIMMHKLGKSEKWKNEQIKSFKEVATK
FT                   YLA"
FT   gene            complement(252033..252527)
FT                   /locus_tag="BH0244"
FT   CDS_pept        complement(252033..252527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0244"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:BH0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16760"
FT                   /protein_id="AAX16760.1"
FT                   /translation="MKINNLVAGALNLDSKDYKAAKKKTNANRTNIFSAIFKSELVRED
FT                   KHFIVLENGEFNIDLVKDMLDKINDVGEKLLSEPSRQNVIFYKKTIGEFLSIILSFSIS
FT                   LKEQKGGNNGELRRPKYRIIRIINEKLDKLAYSVLQNQVSQIKLLSSLEEIQGLLVNLL
FT                   R"
FT   gene            complement(252517..253068)
FT                   /locus_tag="BH0245"
FT   CDS_pept        complement(252517..253068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0245"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16761"
FT                   /protein_id="AAX16761.1"
FT                   /translation="MLNLLSIKRDKKISSSLLFAEVKTIVGKGDFFKGELISNNFIRID
FT                   GDFLGTINSTKRVIIGETGRIKSNINANEVVVSGIVLGNVHASNKIKVFQSGCIIGNIS
FT                   CKSIEVEEGAIIDGYMNIGIGSLSFSKKDVLIYTDSYKVDEDILIEVNKGMKCDEAVKD
FT                   DRIDENNKYLFNDMSKIDED"
FT   gene            complement(253069..254115)
FT                   /locus_tag="BH0246"
FT   CDS_pept        complement(253069..254115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0246"
FT                   /product="cell wall endopeptidase, family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:BH0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16762"
FT                   /protein_id="AAX16762.1"
FT                   /translation="MCGEGFMMRDRRGFKILSLLKKVDKIFFAIFSSFLKFLSNIYSFF
FT                   RQNVSFMIIPHVKGNVRNIKISFLTLFLFFVFFILIFIGFVLLAVNYVTLKSIVKSTEK
FT                   SYALAESEIEDFRNTVVEINSVASNFSKVLNELSTSLKIKESNINLNRDKLDGDLADFL
FT                   DLQMLEANSLKELNDLKNVKNTIEGSISPLKSIVKLIHSQNKLLNDIPSLWPVIKGDGV
FT                   VSLHFGPAVEPFTRQWYIHKGIDLAGVRIGTAIVAAADGEVVRASYQVTGYGNFVQIKH
FT                   KYGLSTLYAHMSRLNISKGSYVRKGQVIGFLGQTGYSTGPHLHYEVRIGSQVVNPDMYL
FT                   NLATGASR"
FT   gene            254324..254923
FT                   /locus_tag="BH0247"
FT   CDS_pept        254324..254923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0247"
FT                   /product="nucleoside-triphosphatase"
FT                   /EC_number="3.6.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BH0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16763"
FT                   /protein_id="AAX16763.1"
FT                   /translation="MKTLFFATTNINKINEVKQILDIPNIKIEIPKNFDVKETGKTFKE
FT                   NSLIKAKALFESLGRKHPVFSEDSGLCIEALNLEPGIYSKRYDQYKLGKKLGTKEKNHF
FT                   IIDLMKDKENRAAYFICIVSHIAKDGTITNFEGIFNGTIALDIDCCKKNGFGYDPIFLT
FT                   TNNKRLSELNLEEKNKISHRGIAFTKFKKFLMQSLD"
FT   gene            255061..256830
FT                   /locus_tag="BH0248"
FT   CDS_pept        255061..256830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0248"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16764"
FT                   /protein_id="AAX16764.1"
FT                   /translation="MIERSKINENDKWDLSSLFKNNEEYRETVKKIKLKLQDFKKYEKL
FT                   EFDLNIFKQALNDYYEIEEELERTVYYTHIQLETDVSNQTSNELRTINVNLETEASNAT
FT                   SFFIPKILKTDTKQVREWLKDIELKDKKIAIEKILREKEHILSEDEEKILANYTSLYSS
FT                   YNDIFSVLTNADMDFGEIDGKSLSNATYNLFLQNENQEIRRKAFLKFYQEYKKHENTLA
FT                   NTLIADMNKNKFLAKTRKFEDTISMKLFQNNIDKKVYTNLIETVNENLSVLHEYYEFRK
FT                   SILNQEYLNHYDVYVPLTKDIKFKNSFKEACDQILKSLEILGNEYTEVLRKGLLEERWV
FT                   DKYENKGKRAGAFSAGSYNGKPYILMNYKDESIRDMFTLAHEAGHSMHSYFSIKNNPFP
FT                   QYQYSIFEAEIASTVNEQILAEYLLKNENDIEKIKYIKLNQIDDLLATFFRQTMFAEFE
FT                   YIIHGMINKDQPVVKETIKTTYLNLLKKYFGPSLKFDENSSLECLRVPHFYSPFYVYQY
FT                   ATGITAALLIYKNIKDNKKDATKDYIEFLKTGGSKYPLESLKVTGVDLSLKSTIKNTIN
FT                   IFKERLEDVKKLF"
FT   gene            256845..257549
FT                   /locus_tag="BH0249"
FT   CDS_pept        256845..257549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0249"
FT                   /product="phosphatidylcholine synthase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16765"
FT                   /protein_id="AAX16765.1"
FT                   /translation="MGKLNLILAWSVHILTASGLIIGLYSIISIMNTDYNLLLKLTILG
FT                   LLIDGIDGTLARKLKIKEVIPTINGELLDNIVDYINYTFIPTIFFYCGNFIKDEYKTIT
FT                   CIGILLASAYQFSRLDAKTSDDYFRGFPSLWNFLIIFNIIFKLNQTTNLSIILLCIAFS
FT                   FAPIKFIYPSKTKELKYITLPATVITALSVILITFARLPETYLKIGKTLIILYCLYLIL
FT                   MSTYLTYKTRKK"
FT   gene            257559..258167
FT                   /locus_tag="BH0250"
FT   CDS_pept        257559..258167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0250"
FT                   /product="alkaline phosphatase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16766"
FT                   /protein_id="AAX16766.1"
FT                   /translation="MHIILEFIDLNINYSPIVFFGLLILAGFNIPISEDAIVIMGGILS
FT                   SRKNEYTILIFLGIFWGAYIGDVISFYIGRFLANKLLKQKTQTNKLIDKMNYYYKRYGN
FT                   LTLLFGRFIPFGVRNAIFISAGMGNMRISNFLITDFFAAMISITTYFTLSFKIGESFKI
FT                   IFPKIRLILLITLIIITILILISYIIRKKKIQKVDKLFE"
FT   gene            258186..258270
FT                   /locus_tag="BHT0005"
FT   tRNA            258186..258270
FT                   /locus_tag="BHT0005"
FT                   /product="tRNA-Leu"
FT   gene            258405..260933
FT                   /locus_tag="BH0251"
FT   CDS_pept        258405..260933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0251"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BH0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16767"
FT                   /db_xref="GOA:B2RZW1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZW1"
FT                   /protein_id="AAX16767.1"
FT                   /translation="MSEYNFTKIEKKWQDYWDKHKTYKVNEDPNIPKEKRIYILDMFPY
FT                   PSANGLHVGHPEGYTATDILTRYKLLNGFNVLHPIGFDSFGLPAENYAIQTGEHPKKIT
FT                   EKNIKKFKEQIKALGFAYDWDREIRTHDENYYKWTQWIFLKLYKKGLAYTKEMPVWYCP
FT                   DLGTVLSNEEVIQTPDGPRSERGFHKVKRKPLRQWILKITEYAERLIKDLEEIDWPESV
FT                   KEMQKNWIGKSTGAEIEFSVKASKEKIKVFTTRPDTIFGVTYLVLAPEHSIVDKITKDE
FT                   FKPMIVEYRERETLKSDLERTSLEKDKTGVFTGAYAINPITGEEIPIWIGSYILGTYGT
FT                   GAVMSVPAHDARDFEFAKKYNLPIKQVVSQTGNNEILTQPFTENGISINTPEEFNNLKT
FT                   DEIKERVIKWLTENKKGQKKVNYKLRDWIFSRQRYWGEPIPIILDDDLNEIPLEEDELP
FT                   LRLPEIENYKPSGTGESPLSRIQDWVNIKRNGKTYKRETNTMPQWAGSCWYYIRYLDPN
FT                   NDNEFASKEKINYWMPVDLYIGGAEHSVLHLLYARFWHKVLYDLGYVNTKEPFKKLINQ
FT                   GMITSFAYQDENGILIPNDEVEKKDNKFFSKKNNKELKQIVAKMSKSLKNIINPDDIIK
FT                   EYGADSMRIYEMFMGPLTDSKPWNTQGLIGIFRFLNKIWTIKNKELTKESASKEIISEL
FT                   HKTIKKVTEDIENLNFNTAISSLMIFINELLKHDKNYLEIFKPLTIILSPFAPHLGEEL
FT                   WEYMGETPSIFKSAKWPEYDPNLIIDNTREIVLQINGKIKDKIILNKGTNEEALKSIAL
FT                   KNHKIMQNIQNKQIIKIITVKDKLINIVTR"
FT   gene            260944..263229
FT                   /locus_tag="BH0252"
FT   CDS_pept        260944..263229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0252"
FT                   /product="antibiotic transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16768"
FT                   /protein_id="AAX16768.1"
FT                   /translation="MDLETLSIKYRVFILIIFTLITIFLGFFLKNIEFDSNILKLLPKS
FT                   EKNEETIDIDNNNSLLSTIVMFKDKKNIFNKETFGKINKVANDIAKILKVKPNSVTSIF
FT                   TYFPQFKKDVYTDEDMIEIRNKVNSTSFIKKIFINDDETLIYFIVISTADDKANFSRNL
FT                   KSELEAMEATIKSYETDDLKLYLTGDLVIREKILNYMADDFKLLGPFATLVVILSLYLI
FT                   VKNILGAIIPVLIAIFALTWTFGIKSLVMSPITVPETTMIVLLISIGCANGVHIINGIL
FT                   KRIKNEPYTEKTIITTIKTLRTPIILTSLTTAFGFLSLITSSIQAYRTMGIFMSIGVII
FT                   AMLMSLLVLPGILVKIPFKHKNNDNKNAKNAFLEKLSLINQTVTKWILNNKYLSSTMTL
FT                   IILLSSIVGLFNIEINFDEKDYFKENTSVKQTLNLMQREIGGTSIIKIEINGTPGEFKN
FT                   EKNMKNLDLITDELDKFTDKTQSSSINGVIRLMNFKFKKENPKEYRLPENQAVLNKLIL
FT                   LISRSNSIKNMTKMYINDDWSQISIIIRTDQNSTEEIKNFANYASNLIEKYMPGHKYQF
FT                   SGAHDKILIAKTMVTEQITNIITTLSAITILLMLFFKSMKIGIIIVIPVAWSVFLNFAV
FT                   MKLFGITLNPATATIASVSMGIGVDYSIHFFNAFILNYQTTKDYKKALIESIPDVFNGI
FT                   FANSISVGIGFLTLIFSTYKIIATLGAIIAFTMLTTSLASLTLLPLLIYLFKPTIKIRK
FT                   IIKAKITE"
FT   gene            complement(263296..265743)
FT                   /locus_tag="BH0253"
FT   CDS_pept        complement(263296..265743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0253"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:BH0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16769"
FT                   /protein_id="AAX16769.1"
FT                   /translation="MKRKEIEYSMEEVKDTVSKGKKRSKKSGGILPHFDKPVRVPLIAV
FT                   PSHPVFPGMFIPIVIVSDIDMKAVDYVIKGNGIISLFVLRDKFLEKAGSKNDKLIINHK
FT                   KDIYSVGITAKIVKKINLPDGGYNIFVSTIDRVRFVKVVLNEDFPIIEVDYLKQIPIKK
FT                   DDVQSKAIYSSILLRTKEIFSHRKMPEFQLNMVNIEDKGRLCDVVAGMIASSKDAHQEV
FT                   LETLSVKDRLKKVLELIYEELNLIEIQNKIAKGIQEKLEKQQKEFFLKEQLKAIKAELG
FT                   VGDEKSSEFLKLKGKINALALKGEALEAVERELEKFSFLEKHSSEYIVVRNYLELITNL
FT                   PWGESKVNFDGFNLQRAEKILDKTHYGMREVKDRIIEYISVLKLRKSQKGAIMLLVGPP
FT                   GVGKTSIGTAVAEVLKTKFFRFSVGGMRDESEIKGHRRTYVGALPGKIIQGLRITKTNS
FT                   PVFLIDEIDKVSASNYGDPFSALLEVLDPEQNINFRDHYLDLPFDISNVFFILTANSLE
FT                   TIPTPLLNRMEVIQLSGYVDDEKIEIARKYLIPKVLKENGVNKDSLKFQGSALVQIARE
FT                   YARDNGLRNFEKYLKQIVRKIARKLIEDKSVKAYQISKENLEEYIGIPVFRKEEFLHKV
FT                   MSPGMVMGLAWTNYGGSTLVIETVKTESKSPGIKLTGRLGDVMKESANIAFTYVNSISN
FT                   ELKVNKSFFEKYMIHLHIPEGATPKDGPSAGITIASAFISLALNKTVRPHLAMTGELSL
FT                   TGNVMAIGGLRAKIIAAKRSGVGHIIIPKSNKVDLDDIPINIKSGINFHLVDNMREVIK
FT                   LLF"
FT   gene            265812..266498
FT                   /locus_tag="BH0253A"
FT   CDS_pept        265812..266498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0253A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0253A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16770"
FT                   /protein_id="AAX16770.1"
FT                   /translation="MRFNKVNAIITNLYHKKNYSLLNLFHPKGIIHTIIYNSTIKKFKS
FT                   NINNLVRANFEIVKENNLCKIIEVNDEKFIIQDLIHEKLTIIHLWVKLINLSFDDGECF
FT                   KLFTEATEALNISSLEKAHLIDLQYKIRFLIIKGFLYLSKLCFKCNKQIDKYYYYDIHI
FT                   NGFNCINCTNNKNNYINTGSFKYLEYTTQKNINATLNINLTSKSKELIKVMIKNKINTE
FT                   FEQTLL"
FT   gene            266521..268635
FT                   /locus_tag="BH0254"
FT   CDS_pept        266521..268635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0254"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16771"
FT                   /protein_id="AAX16771.1"
FT                   /translation="MKIWKKKEIDIPKENVVNIAKKYNISLLEATLLLRREIKEEDFLF
FT                   FIESSVNLMHNPFLLKNIDKFTYRMNEAIAEKENVLIFGDKDADGITATIIMYETLKDF
FT                   GINVTYKIPSNGEFYGLTKEIIDKAFEDKISIIITVDCGISNIEEANYARSKNIEVIIT
FT                   DHHLPNKEIDIENIIIDPHLKGDPSPFKEIAGCYVSFKACLALYLSTTNLYNKNMVFLF
FT                   LERLNNNITLHAIEINNYMFKKYIALESNNDLQININKLEEFSKSKYVIVFNKNEQNQL
FT                   LNEFFNYKIDIETIDISENFVKKYPKFAKKTLKELMQITKYCKYRKTDTKEKLYYVFYN
FT                   IIFEVNKDLLKNCLKRLKFVAIGTIADNMPIINENRIVVKEGLKEIALRENISINYLLK
FT                   EVNILTKPIITSTDIAFKVAPILNSTGRLEKADITIQFLLAEDTNQIENKFKEIKNINT
FT                   LRKRKEEASWIAHDENTIFKNDKFIVCYDKQTPKGISSRMATRLSAYYQKVAVFLTKQE
FT                   NIIKGSIRSNNKVNSKELISMIPSHLIINSGGHKAAAGFTLYEAVLNEFIKELENALDK
FT                   IEYKEIHEDSILIDAIIPKDFNKRELLKIIDLFEPYGHGFREFILMMEDIYIQDLRTID
FT                   KNGTSKHISMKIKNNKDYYRAIYFNGTQKIQELGIKDGQNIDIIFTVGEDLYNQNDKIL
FT                   KIIDIKKRKN"
FT   gene            268635..269573
FT                   /locus_tag="BH0255"
FT   CDS_pept        268635..269573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0255"
FT                   /product="cell wall endopeptidase, family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:BH0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16772"
FT                   /protein_id="AAX16772.1"
FT                   /translation="MLNIKSLLFILITGLFKINAVNNDIIKIYYKKEAFQGENIYFAST
FT                   KNFKKLSLLGTNQKPILSASPFKFNVGKREYHIAIIGVTPMIKEGKKKIKIEFANKEYI
FT                   KEIEIKKFAFKKTTVKLNKTKSKLIKSQQSPKAKEQALTLWNIIGNIGDTTIYHYDTLV
FT                   HPIKDQYKITSPYGDQRIYMQDNKKISNHKMHNGKDYAPLKREKTPIFAAGRGKVVFAR
FT                   NREITGKTVIIQHLPGVFTIYLHLSKFGVKEHKIVNTGEYIGHVGNTGISTGPHLHFEV
FT                   RINGVAVNPDFFLEQMLIDKNQIINNTKRIE"
FT   gene            269592..269801
FT                   /locus_tag="BH0256"
FT   CDS_pept        269592..269801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0256"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16773"
FT                   /db_xref="GOA:B2RZW7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZW7"
FT                   /protein_id="AAX16773.1"
FT                   /translation="MVTVNVDKNEGLEKALKRFKRMIEKEAIIREWKRREYYEKPSTIR
FT                   VKKEKAFKRKQAKKVRKLKQKIGK"
FT   gene            complement(269840..272182)
FT                   /locus_tag="BH0257"
FT   CDS_pept        complement(269840..272182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0257"
FT                   /product="cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:BH0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16774"
FT                   /protein_id="AAX16774.1"
FT                   /translation="MKNFYHYFQFLFFFMLGVISFSLFVALTPVGNIFIFFVFNLIGHM
FT                   LLNTFSFLSFYLILYPLVNWYVYRTNMLSKRFIFNWNYTVILFFTLTFWLKINSKLEGS
FT                   NFINWFLSNFGIMLGNFFVFLILVLELIVWIYLNYVFFKDTSFILNTFHFIVFKFKILF
FT                   ESVFACFPFLSTLKIKKNIKVYKDCDGNLDTNKTSDREDNIINDEEYQALWSFKAFLRK
FT                   PNKPLDVDLDKTIFGKSKVRDEKLSEEQSFKESQCDLNIEDDSKYKVLTEFEDNKLVSG
FT                   GKIKASDIRHKGIINNIAKSNGGDLLVDKDIGKYLIDISVFDQREPTSEAEDIEYEKEI
FT                   QRQSMILQETFREFNINAKLIDVIKGPVVTMYAVRPDKGIKLSRITSISDNIALRLAAV
FT                   RVRIIAPIPGKEAVGIEIPNKRRKFILISEIINSKEFQNDFKVPFALGKEINGSNVVFD
FT                   LITAPHLLIAGATGAGKSVCVNSLIASIIFSKSPDDVKLVLIDPKVVELKLFNDIPHLL
FT                   TPVITDVNRALEALRWCLDEMERRYVLLDNFLVRDINAYNKKILEEGLNEAPLPYLVII
FT                   IDEFADLILSARKDLENLISRLAAMARAVGMHLVLATQRPSVDVITGVIKANFPSRISF
FT                   MVASSMDSRIILGASGAEKLLGKGDMLYVSPTTPFPQRIQGGFLNEKEVYRLVGEVKKF
FT                   GTPNYIDDEIFIDSAVAADTVVLNPSDEPMFEEAIEIVRSTKKASASYLQRRLKIGYNR
FT                   AARIIELMEEMGYIGPVNGSKPRDVFI"
FT   gene            complement(272195..272989)
FT                   /locus_tag="BH0258"
FT   CDS_pept        complement(272195..272989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0258"
FT                   /product="bacitracin resistance protein"
FT                   /EC_number="2.7.1.66"
FT                   /note="putative undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16775"
FT                   /db_xref="GOA:B2RZW9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RZW9"
FT                   /protein_id="AAX16775.1"
FT                   /translation="MENVLRVVILGFIQGIAEFLPISSSGHLLLLKKFMHIDLPIVFDI
FT                   YLHLATVLVVMIYYCRRILELVAVLVKFVLGKTTECDFAKLRLILLILIITIITAFIGI
FT                   FIEMFKGLFTLNLVLINFIVTSILLFLLESRIVIFDLKRNILLAGCLIGTMQGIGAMPG
FT                   ISRSGITIFASVLLGFSRSESFEISFLSLIPIVFGSLLLKYKELFESDMLFSIFEINLG
FT                   AIIAFLVGLFSISLFVKMLQDSKLYYFSVYLIILVSLVYFLF"
FT   gene            complement(273005..275197)
FT                   /locus_tag="BH0259"
FT   CDS_pept        complement(273005..275197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0259"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16776"
FT                   /protein_id="AAX16776.1"
FT                   /translation="MQFLIILFIRKKKLLNVKKIIMFKQIVCLFLLSLFSCSFGKESLS
FT                   NNIVKRNVNDFDLNHLSWLWNFDYLGQSFDDYFGIDSNSYVYVAYLFKKIGYDEKFREY
FT                   MHKAIKSSNDIASQFAGVKLLEYYNARREYPEAELIGRKLYKRYDNNKFIILGYFKSLY
FT                   WQKKNDEALLVLNKLEKMDFVQSQENENLLFKAVLYFNASDINSSLVYFRKLFEELPAE
FT                   YLHVRAHDYLVLEERSSLLNPSFLNLIKFKALVANGDLKGAINILNDDFKKYYDNFVFL
FT                   NDVYKAFLDSGYISKALSFFSNLNSIYKDYYLGLINLRLKKDVGFLTIVKYLENTSLEN
FT                   EPYRLEMLNEIFSNLVFLENTRNYFSENIARFYTSKDKSDLGFIRALDRYILEAVQLED
FT                   YDNLYALYRNGKDVIDGSVLSRLSFINARLIYHKLISPKSRDEYSELLYSSIKYNRTSY
FT                   SSFMSKYLLDQNINDYFENALDIQYDHSDYESFLEGFLKFNLHSYVSAFVANDFKNGYR
FT                   FSPNFYRNLYDELVKHEYYYESTLAINYLVRQENSALSRDDYKRIYPYLYSALIKYWSK
FT                   RRGLESSLVFSLIKAESSFKRDAVSKPGAIGLMQIMPLTSIDVSREIKYYDYDLKQPKD
FT                   NVIIGTYYLNKRIKMLGEVYKALASYNGGIGNVRKWEKDYGHLPKELFIEAIPFGQTRN
FT                   YIKKILVYCVLYDALYENRGMDFIIEYIMGKFPKSF"
FT   gene            complement(275127..276323)
FT                   /locus_tag="BH0260"
FT   CDS_pept        complement(275127..276323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16777"
FT                   /protein_id="AAX16777.1"
FT                   /translation="MEFLKGFLAIRLSNDEYFSILSLDDTTVKRVVLGKLADETNVKLD
FT                   LYISKYEDFSNPVIIGSFFLDNLRKESSNINVYFKIDSMMLYVYGECDGITNKSKFDLS
FT                   LINLAVGSGEISLEDAKSNDLPIRFSEAKHEEGFAEEFGSVVEQDGSLDVGLDNVDSLF
FT                   DPQSLFTNEKLSSNENNLNLLSDSLSLDNDILVSENLNSESNLNLENFDFELTKDKFEN
FT                   NIDEGNGIEHVLSDKDTVSQDVSDLNNIPVDISDASVVSDSFDTNNVKLVEDDNTNFGD
FT                   INVNASQESYSDDWNIDDIITDIDKELNESEFSDVVLDLSDENFATDFEESRLDVDSEE
FT                   GLIQTSMLYLSLISLFLLIFFSLFLIFSKVLNPRNFAISYYSFYKEEKITKCEKNNYV"
FT   gene            276511..277893
FT                   /locus_tag="BH0261"
FT   CDS_pept        276511..277893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0261"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16778"
FT                   /protein_id="AAX16778.1"
FT                   /translation="MLPLFIILSSIAISAVVFLFFKIAISNSKTRKKGRHNKTLNKTKK
FT                   ITEQAANMLKTNPNDISALQTLNDYYYSNKDFENGIKYARKLCQLAEENPINQEIDSFK
FT                   AFLSYGFYNLERNFNAEALEFLKKAYVIKKNDMDVNYYLGIAFLRNAHYKEALHYLTKI
FT                   YKCDKNNKDALKYIGITLFYTGNYTKAVGIFSGISKYIQNDINALLAYAQSLSQLNQDH
FT                   LALDIANKIKNKDGMIYEALLIESDINSKNNNLAKLEDNVREMMKVKPDLPTKIFLKLF
FT                   YKLGELYIECENYKKATEAFTQVERIDPHYQKIAEKLEFSKRLNENLALRIYLKSPKEK
FT                   FDNLASAIILKIYKNKFQVRDKKINEITSQFIDMNFQLSNNQWEENLIVRFVRTEQKNF
FT                   GELFLKDFISKTKESKLKGLCIAPAIFSEKAKQIIEGRLIDLVEGKKLIQILKTLDISK
FT                   YI"
FT   gene            complement(277897..279150)
FT                   /locus_tag="BH0262"
FT   CDS_pept        complement(277897..279150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0262"
FT                   /product="cell wall endopeptidase, family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:BH0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16779"
FT                   /protein_id="AAX16779.1"
FT                   /translation="MIIPKKDQNILKRNRNFLFDRAIKGDFELRDFGNNRNFRRRKRNN
FT                   FFRFINIPKKLFDVIKLLFLTLVSRMVGIDDSKYRSSYKKIRLSMINAYDVKLTYSFIF
FT                   KFNAIIFVLVLIFYLNIFSYYGSYIFLSKLSFPKDYFIDTFLYYSDQDLTQINNHLFGV
FT                   DTNNYEATVRKPFVLKVVEHKIKPGETLSHIAARYSITSETLISYNNIKDVRSIRPNFV
FT                   INVPNMKGVLYTVEKNDSLSSIANKYKIPKVDILDANNLDNEVLYLGQKLFIPGGKMSK
FT                   ELLRNALGETFLFPTQGIITSGYGYRPDPFTKTISFHNGIDIANAANTPIFATKEGIVV
FT                   TVGFSVGGYGKYIVISHNNGFQTLYAHLGSFAVKVGQRVSRGQIIGRMGSTGYSTGNHL
FT                   HFTIFKDGKTGNPMKYLR"
FT   gene            279225..279728
FT                   /locus_tag="BH0263"
FT   CDS_pept        279225..279728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0263"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:BH0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16780"
FT                   /protein_id="AAX16780.1"
FT                   /translation="MIKFHKQVLIPILLASIVMIAIIKISLSFHLVKGSSMLPIILEKH
FT                   WIINNKLAYGLRLKNRETYIILWGTPKKNEMVLIKDPITKKTSVKKIFAIPGEKFTKLN
FT                   KNVISIHNLTFNINKEHLKKLESIYIPKGYYLVIGENRQVSLDSREYGFININDIIGKI
FT                   IYCL"
FT   gene            complement(279780..281291)
FT                   /locus_tag="BH0264"
FT   CDS_pept        complement(279780..281291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0264"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:BH0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16781"
FT                   /protein_id="AAX16781.1"
FT                   /translation="MMEKWIGIDLGTTNTVASYFDSNSRVILNDRGERMTPSIVSFTDS
FT                   GVVVGSIARHQILVNPDKTFYNFKVDIGTEVTYEVGDNTYRAEDIASYLLLNVKMNAEK
FT                   FLGTEVNDVVITVPAYFSEIQRRGVVEAASLAGLKCRAILNEPTAAALSYAFEKQIDGL
FT                   FLVYDLGGGTFDVTLLEKQNDTYTVLAVKGEKKLGGNNFNEIIEKHVLMHFKEEYPDIN
FT                   LGDIVLLEQIRDRIEEAKKNLSIVDEVGIVLPFLDGKHLNYKLKRDDFNSMIKEFIEKT
FT                   INLTNECIADAGVELESISKIILSGGSTRIPLVKEGLREVFPEIEVLDSLNQDEVVANG
FT                   AAIQAFSLSNNSALIDFKDVTPYSLGIETYNDGFFTLIKRNTLLPVSERKIFTTTNDYQ
FT                   EEIEVHVLQGEYKKASLNYSIGRFFFSNIQKALKGVPKIEILFNLDESGILSISAKDLD
FT                   TNASKSVEIRMTSASFDSNLQREGVLALLEDISSSDELEEKMELL"
FT   gene            complement(281288..281785)
FT                   /locus_tag="BH0265"
FT   CDS_pept        complement(281288..281785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16782"
FT                   /protein_id="AAX16782.1"
FT                   /translation="MFVVFCFILIIFIFIYFHVYISLQMKSNSILRKFRSEVDKTIIEI
FT                   NQATDRNINIIEIKIESLNRIIKEVDERIEILDQRLLGFNAHSISMGNNNFGMKGDSSA
FT                   YKSNLDYSIPTIEKNIIKEGYNIRQQVISLYEQGMSLEVIAKKLKLDLGEIELIVSIHR
FT                   GS"
FT   gene            complement(281807..282118)
FT                   /locus_tag="BH0266"
FT   CDS_pept        complement(281807..282118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16783"
FT                   /protein_id="AAX16783.1"
FT                   /translation="MDINNSSEIVKIITQGAFKVSEILNEDLRKRRIRENKNLSSNQNK
FT                   SYHVDSEINSIYPTDESTDSKLNFITISKVETAKRDLSGIDDIDLHDPKIGRKVDIER"
FT   gene            complement(282143..284041)
FT                   /locus_tag="BH0267"
FT   CDS_pept        complement(282143..284041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16784"
FT                   /protein_id="AAX16784.1"
FT                   /translation="MADISDFTDLRNKIKHYLEKENSVSLIEVEADTLEEALNDASLEL
FT                   SVPYKDLAYEVLVRGNNGLFGYGKRKWKIVAYRNSYSKFGVTDALTSQDGSEEVTSLDG
FT                   RFFIRRTAKGVFLKVTPAQGDGSVVKLKDVMDKFASYSNIKDLDKDFIRSVVENADGKY
FT                   EQVSAFKADLAESVTMMVHISEDSMSVTIEFTVPGPFGAEVLEKDIYNILKKYGVSDRA
FT                   VLKDKIRDFVDYPFYGEPVEMAKGANPVKGKDAYINFIAKSRYSCEYGDVDNELRNVNQ
FT                   GDELAEIIPLSEGIDGYTVFGKILKAENGRDLDLILGENTLMEGNKIIAGCDGYISISN
FT                   GVVSVHDVYIVEGDVGPGTGNIVNNGMVLVRGSVLDGYNIMAKGGIEVNGLVGRCNLST
FT                   DGSMVLRSGVNGKGGSEIYAKQFIKSKFLENVNVRCEGNIEVIRGIVNSFVSCTKKVLC
FT                   IGKKSKIVGSDVHAREEIRAYSIGSEGNAETFIWVGYDPEIKALLSGFAEYLVKIEKRL
FT                   EVLTKDISALKKNIQLTVDKAEKSLKIDSCNELINERDILILEIKMVKDKQESLQRALE
FT                   DSKTDGKIFVEYITYAGVKLHIKDAYYELPRDYHNITFVEDDNIIKMVAYVPFESK"
FT   gene            complement(284044..284535)
FT                   /locus_tag="BH0268"
FT   CDS_pept        complement(284044..284535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16785"
FT                   /protein_id="AAX16785.1"
FT                   /translation="MLFNKINKYVLLFGVFAFILAVMLGIFARVPFITVLFRAFFQFIF
FT                   FFCVGLLLEFVYKKYLYDLFKDDILSDDTDEVNENRHCKPESDNMNLAPKNIPLNENKN
FT                   IDNDNYDRMEKFSEYDEDARESKFDIEFNKKLLDQISYVERTDPKIVAEAIKTLINKKE
FT                   "
FT   gene            complement(284541..285431)
FT                   /locus_tag="BH0269"
FT   CDS_pept        complement(284541..285431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0269"
FT                   /product="flagellar synthesis regulator FleN"
FT                   /db_xref="EnsemblGenomes-Gn:BH0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16786"
FT                   /protein_id="AAX16786.1"
FT                   /translation="MMEDQAQSLRDIMRLNNRASFVIDDKIQNNRTRFIAVTSGKGGVG
FT                   KSNIAVGLALKYASLGKKVLVFDADIGMANINILLGVIPKYSIYHMIMQGRGIKDVITK
FT                   TEYNIDLLAGASGTTELLDLSEAEMNQFIKELLKVYEYDIVIIDTSAGISRQVISFLFS
FT                   SDDVVIITTPEPTSITDAYGIIKVLSHKMENLKNLRLVVNRVANVSEGKVVAKKVIDIS
FT                   SQFLNLNIDYLGYVYEDQNIRNSVFKQRPFILLNPNSKASYCLDSIVAALEEITLDNKR
FT                   RRGVIGFISKFFGME"
FT   gene            complement(285441..286622)
FT                   /locus_tag="BH0270"
FT   CDS_pept        complement(285441..286622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0270"
FT                   /product="flagellar biosynthesis protein FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:BH0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16787"
FT                   /protein_id="AAX16787.1"
FT                   /translation="MKSSIMVQYFTERGPTYNEVIETVKRKYGKNARVMTYKTIAHGGI
FT                   FGLFSRDWIEVSGYVRYDIGQQQINIEEEKRKILQSIKKEESSSIEDVIKEVKSLKNEL
FT                   AHKKEEVNHPTILKIEDILRSNDFSESYIKDINNFIKKEFSLSDLDDYDKIKDSVIIYI
FT                   AKTIKCSGPLIDNLKKRIFILVGPTGVGKTTTIAKLAAIYGINSDDKSLNIKIITIDNY
FT                   RIGAKKQIQTYGDIMGIPVKAIESFKDLKEEITQSKDFDLVLIDTIGKSPKDFMKLAEM
FT                   KELLNACGRDAEFHLAVSSTTKTADIKEIFHQFSPFSYKTVIFTKLDETTCVGNLISLI
FT                   HEMRKEVSYITDGQIVPHNISIAEPLTFIKKINGYRISDDVEFIRRLKSKSYY"
FT   gene            complement(286612..288702)
FT                   /locus_tag="BH0271"
FT   CDS_pept        complement(286612..288702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0271"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16788"
FT                   /protein_id="AAX16788.1"
FT                   /translation="MLDARKNSVLGYFGLNNKADLIVSVGLILVVASFILPLPAFILDA
FT                   LIAVNLVVSLLIILIVLYSKRSLDFSVFPTLLLVMTIFGLVLNISSTRLILIKGISFDG
FT                   QMIRAFGTFVVGGSGTQGLFVGFIIFLIIIAVQFIVITKGATRVAEVAARFALDALPGK
FT                   QMAIDSAYSSGNLTEEEATRQKNDLQAEVNFYGAMDGASKFVSGNVKVGFLITLINILG
FT                   GLIIGVTLQGLTFSDAVNNYVSLTVGDGLVSQLPSLLISTATGLIVTRSISKNSFGGEI
FT                   IEQFTSYSGIYWIVSGFLLFLAFLPGFPTLILILLSLLIAFLAYSLSNLIRSRELAEKQ
FT                   KAEEQILSYADKEIAPVVPLDPLSLEIGYNLVPIVDDSKTSELLDRIVKIRREVALEFG
FT                   IVVPKIRIVDNMRLEPNEYSFKLRGVEIGHGEIKLGKFLVINVGADSGIEGDLTKDPSF
FT                   GLPSLWVNDDGREVAEKLGYTVVDPPSIIATHMTELIKRHACEILTRQDVQNILDIFKK
FT                   DYGAIVEEVLKDFSVGEIQRVLQGLLREQVSIRNLVTIFETIADFTSITKDIFFLIEKC
FT                   RQAIGRQIVSGYLDSNLELNVITINPEFEQKIIDSRFEANNDLVSSLEPSLKTKFIYEL
FT                   FRLVNEVQSQGYYPVILSSESARPVIRVLTSRELPDIVVISVLEVPKNVKVNVLKIVEV
FT                   EE"
FT   gene            complement(288711..289832)
FT                   /locus_tag="BH0272"
FT   CDS_pept        complement(288711..289832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0272"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16789"
FT                   /protein_id="AAX16789.1"
FT                   /translation="MNARNEFLSKNWYIPLNFFASEDEGRTELPTEQKKQKAREDGQVL
FT                   KSTEINSAVTLFILFAVFFFMLSYFAQELMNVFRWQAGKLPEIMSVSIYALSFSYIKPM
FT                   FGYMIVFLLISFIVSFLINVIQVGFLITFKPVVPRWDRVNPNFSKWIKNSFGSFDAFFN
FT                   LFKSLSKIAIISLIYYIMLKSNIGKISRMSEYSLEDGISVILSLAYRICFFSIIVLMGI
FT                   SILDYLFQRTRYIENLKMTKEEVKQERKEMEGDPLLRSRMRERMREILNTNLRVTVPQA
FT                   DVVITNPEHFAVAIKWDSNTMLAPKVLAKGQDEIAFVIKQIARENNIPVMENKPLAREL
FT                   YANVDVNEEIPREYWEIVSKILVKVYSIAKKFN"
FT   gene            complement(289829..290617)
FT                   /locus_tag="BH0273"
FT   CDS_pept        complement(289829..290617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0273"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:BH0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16790"
FT                   /protein_id="AAX16790.1"
FT                   /translation="MNMNDLVLKSFVVLPVFVRIFLFLRFSPFFATIKMGYLNFFFAFI
FT                   LSIIVVDKINVVYPLDNLIAFALILAGEAVLGLIQAFFVSIIFSVFHLLGFFFSNQMGL
FT                   AYANIFDVFAEEDNLVISQIFTYLFLLLFLSNNFLLRFFMIGVHDSVLNVRVENMVNIR
FT                   NYEFIKLIFYSFAVLFEKALVMSLPILGVLLLLYLILGILSKTSPQINLLMISFAVSLG
FT                   LGLIVLYICFPSLVMSIKRVIELALESMRNALNLFSETLE"
FT   gene            complement(290633..290896)
FT                   /locus_tag="BH0274"
FT   CDS_pept        complement(290633..290896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0274"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:BH0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16791"
FT                   /protein_id="AAX16791.1"
FT                   /translation="MTTGQIIYLIRIAVENIIILSAPMLIMALIVGLLVSIFQAVTSIQ
FT                   DQTLSFIPKIIIILLTLVIFGPWILKKLMQFAFIVFSQIQNM"
FT   gene            complement(290905..291669)
FT                   /locus_tag="BH0275"
FT   CDS_pept        complement(290905..291669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0275"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:BH0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16792"
FT                   /protein_id="AAX16792.1"
FT                   /translation="MGKKLSLFLFLGVINLAFAQTKSLQPTTGLNFPFVDLVNSVGGGI
FT                   VFPLQLLLILTVITLSPAFLVLMTSFLRIAIVLDFIRRALSLQQSPPNQVIMGLALFLT
FT                   LFTMWPTFNIIYKDAYLPLKDSKISFNEFYDRGIAPLRNFMYKQMSNSKHEEIKLFMSI
FT                   SNYSRPKNFSEVPTHVLIASFVLHELKVAFKMGILIFLPFIVIDIIVAAVLMAMGMIML
FT                   PPVMISLPFKLILFVMVDGWTLITSGLVKSFM"
FT   gene            complement(291679..292320)
FT                   /locus_tag="BH0276"
FT   CDS_pept        complement(291679..292320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0276"
FT                   /product="flagellar biosynthetic protein FliZ"
FT                   /db_xref="EnsemblGenomes-Gn:BH0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16793"
FT                   /protein_id="AAX16793.1"
FT                   /translation="MSRLTLFKFVFLIFFILISKSLFAQKNEVEDVSTSSLESEVNLPI
FT                   FEDNKADLNNKDIQNISLLNVSDLVTIFLFFLAFLVCIFLLKKMLLNHKKIRNDDKSEL
FT                   IRELAFYEIDNKNSLRVINILGNIYVFLVSSNSSILLREIKRGEELDNWEFEFDKAKSH
FT                   SNVSSFKAIFDKILRKDQKNEPSLDETEFAEVENDIETSLKSKQDRLKKF"
FT   gene            complement(292313..292657)
FT                   /locus_tag="BH0277"
FT   CDS_pept        complement(292313..292657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0277"
FT                   /product="flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:BH0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16794"
FT                   /protein_id="AAX16794.1"
FT                   /translation="MAADDKNDVGEEKPEIKGVKLPDLIDTLPEGVDPSNLGLLMDVSM
FT                   QVTVELGRTERKIKDILGMSEGTIITLDKLAGEPVDILVNGKVVAKGEVVVIDENFGVR
FT                   ITEIIKIKNE"
FT   gene            complement(292708..293766)
FT                   /locus_tag="BH0278"
FT   CDS_pept        complement(292708..293766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0278"
FT                   /product="flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:BH0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16795"
FT                   /protein_id="AAX16795.1"
FT                   /translation="MAGNPGSLSQDDIDSLLESINSSDNLSSDDSLSNVISSSMGKKQK
FT                   VKVYDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFI
FT                   RSIPNPTTLAIINMDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTIKDKSRDLTEIEQSV
FT                   MESVIIRILSNMREAWSQVVDLRPRFGHIEVNPQFAQIVPPTEMVILVTLEVKIGKVEG
FT                   LMNFCLPYITIEPIVSKLSTRYWHSLIGVGTTSENLDVLREKLENTDMLLVAEIGEVKL
FT                   KVREILSLEKGDVINLEDSPIDKDLILKVGTKQKFKCRMGLVGSKISVQITEKVGEVED
FT                   FDLLKELTEEIE"
FT   gene            complement(293786..294319)
FT                   /locus_tag="BH0279"
FT   CDS_pept        complement(293786..294319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0279"
FT                   /product="flagellar protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:BH0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16796"
FT                   /protein_id="AAX16796.1"
FT                   /translation="MSEKDDGSIDVGGADDKRIGLLPDVIIKILQILAIGLFTVVIMII
FT                   VSYFVSKMVVSQSGAPNNFPIFSNEYLGKPPMLIWYESIDEIRGTTQDTPPKTFVIKLA
FT                   LGYAENNVNILSELGRQKVRLKDIIREYFSQRTGQEIKNESQIKAEIKARINSILRNGE
FT                   IKEIALTQIDIFDM"
FT   gene            complement(294362..295150)
FT                   /locus_tag="BH0280"
FT   CDS_pept        complement(294362..295150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0280"
FT                   /product="chemotaxis MotB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16797"
FT                   /protein_id="AAX16797.1"
FT                   /translation="MMALRVRKKRSKCEEGAPDYMLTYGDMVTLLLVFFVTMFSLNDII
FT                   LKENVLKIMSASFTGSGFFKGGKTLDVNKLSYLSNSFMSLPSTEKNKQASQVSKNKSII
FT                   EFVEKIQSNKVIVREHERGVVVSLLADAFFDSASAEVKLDDNRETIQKIASFIGFLDNQ
FT                   SYNFKIEGHTDNVDVNINGIWKSNWELSSARAVNMLEQILNYTDQSKIQSIESKFEVSG
FT                   FAGSKPVATDDTPEGRAYNRRIDILITSDASLSSAKGINE"
FT   gene            complement(295147..295932)
FT                   /locus_tag="BH0281"
FT   CDS_pept        complement(295147..295932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0281"
FT                   /product="chemotaxis MotA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16798"
FT                   /protein_id="AAX16798.1"
FT                   /translation="MNLASIIGWGVGFGAILISMAFTPTGLGVFWDLSSVFITVVGSFS
FT                   ALVASSEIPTVKKIPIYLGFFFKKSSFGRVPIIKTLVELSEKARKEGLLSLDDELEQIN
FT                   DPFFKSGMRLVVDGTDPEIIRTMLYLELDQMQERHKIGADLFGTWAKLAPAFGMTGTLI
FT                   GLIALLGNLEDRSALGSSMAVALITTLYGTIMANLMLFPIQIKLESIDLEEASVRTMIV
FT                   EGILSIQAGDNPRILEQKLVTFLTPKDRSQLGSGILGGE"
FT   gene            complement(295929..296150)
FT                   /locus_tag="BH0282"
FT   CDS_pept        complement(295929..296150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0282"
FT                   /product="motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16799"
FT                   /protein_id="AAX16799.1"
FT                   /translation="MIYVTKLNGDGYYLNPCHIESIETNPDTTILLVNGKRLVVRESVV
FT                   EVVDRIKMYRRDIALLDRITQENKGVGL"
FT   gene            complement(296167..297495)
FT                   /locus_tag="BH0283"
FT   CDS_pept        complement(296167..297495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0283"
FT                   /product="flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:BH0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16800"
FT                   /protein_id="AAX16800.1"
FT                   /translation="MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMI
FT                   SQSISGASRPTDGRGGVNPKQVGLGMSVATIDTIHTQGSFQSTQKASDLGISGNGFFIL
FT                   RDGNNSFYTRAGAFDVDSDRRLVNPANGMKIQGWMAKSIGGEQVINTSADVEDLVIPIG
FT                   DKEGAKSTEYITFACNLDKRLPIVEEGASEVDIARGTWVVNKTIYDSFGNTSVVELRVV
FT                   KDATTPNTWNATVLVNGEANSNFTMGFNNEGALLSLNGQAGQVGDLLEFPITFDVVNAN
FT                   AGEVGEQQTVNLRLGNVGSYTDSITQFADASTTKAIVQDGYGMGYMENYEIDQNGVITG
FT                   VYSNGIRRDIGKIALASFVNPGGLAKAGDTNFSETSNSGQARIGETGFAGLGTIRAGVL
FT                   EMANVDLAEQFTDMIVTQRGFQANAKTITTSDQLLQELVRLKS"
FT   gene            complement(297500..297934)
FT                   /locus_tag="BH0284"
FT   CDS_pept        complement(297500..297934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0284"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /db_xref="EnsemblGenomes-Gn:BH0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16801"
FT                   /protein_id="AAX16801.1"
FT                   /translation="MSIIDKMDNLVSIGRVKDISNSKVQRGVKGSNLGRDDFLKLLITQ
FT                   LKYQDPTDPMKDKEFIAQMAQFSALEQMTNMSKSFESLSSALGANKDLDLLGKIVEFEH
FT                   TDGEIIKGKVTNIKTGVVPQIMIDGKYYVYNNILSVGLEE"
FT   gene            complement(297947..299116)
FT                   /locus_tag="BH0285"
FT   CDS_pept        complement(297947..299116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0285"
FT                   /product="flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16802"
FT                   /protein_id="AAX16802.1"
FT                   /translation="MSNLSKVIANLPSLNKDFNFVNVGGVLSQSKKGVFSNLISSEIQN
FT                   LSKFRESILEFIKFLKSNGLINKNFKDLSLRQPFAFEKLSDNGFISDLKSLIKRVDNVF
FT                   DFQSLKVLNESLSFESELIDKTKIFKNIEKVLSDLNILFGSVTSLFNFDILGIDVDSSH
FT                   RDLNLVKRDREKNVINIDVKNFKKNNSVKEFLNSGSKFRLIAGENYVGRYGLKETFNGF
FT                   SEFIDDLSSSNTKHVKESFVSQIADNLMSEWNLKVNHNIVNKAKIVLKSNDTGEIRLIL
FT                   KPKRLGSIRINLNLDSNNNLLGKIIVDNHNVRTLFEQNMYSISKMLDDNGFNTSLHLSL
FT                   AGSGSGFFSGNFEDDVNRQEVSLNKSEIFKVEDDIEISGDLEKSINFIV"
FT   gene            complement(299120..299734)
FT                   /locus_tag="BH0286"
FT   CDS_pept        complement(299120..299734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0286"
FT                   /product="FlbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16803"
FT                   /protein_id="AAX16803.1"
FT                   /translation="MNSCLSFLLRFFLWLFLVIFFLGLSFFLIDLFGIYKTRDYLPAYI
FT                   RVLLFKEDDRPLEYTHISLDEIRMIKEKEAIYIKSQQVEKLREELKKREDSLNKLEAEL
FT                   NQKQKDLDSKQKVVNDIVNKYKDEDANFAQAALYLINMPPEDAVKRLEELNDEIAISYM
FT                   RKVEDIAKKEGRASIVPYWLSLMDSKKAAVLIRKMSVSSLE"
FT   gene            complement(299727..300158)
FT                   /locus_tag="BH0287"
FT   CDS_pept        complement(299727..300158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0287"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16804"
FT                   /protein_id="AAX16804.1"
FT                   /translation="MNDLIFKKKKFEKIMSVRTYDRKSSENDLMNINNEISKIEEFLKG
FT                   NSKTLNKLNNTNIFLKGNYLDYLTCRKEKELKKLAKLKHEYNKYHDIYLKKYVVEKKVD
FT                   ILIKTLNNTIIKENVKSESLVLDEYVNYKICKKLGTNNE"
FT   gene            complement(300155..301465)
FT                   /locus_tag="BH0288"
FT   CDS_pept        complement(300155..301465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0288"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BH0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16805"
FT                   /protein_id="AAX16805.1"
FT                   /translation="MMDNFFEGYSKILDGVETISLVGRVRKIKGLLIESVGPKCGIGDL
FT                   CFIQQVSGKKIYAEVLGFNGCFVSLMAYEGFDGIEVGDKVYSLNKKPQINLSDELLGRV
FT                   IDSLGRPIDNKGQFLGNHYKELSFSSINPLKRGIFSKQIVTGVRVLDGFLPVAKGQRVG
FT                   IFSGAGVGKSTLLGMIAKNSKADVNVIAFIGERGRELNEFIEYDLGEECFKKSVLIVST
FT                   SDESPISRYKGAYTATLIAEHFRDRGMDVMLLFDSITRFANAKREISLSMGELPATKGY
FT                   PPSVFVEIPILLERLGLNGKGSITGFYTVLVESDDFTEPIADNMKAVLDGHIILDRDLS
FT                   DRGIYPSVNILSSTSRSLHRIVNFEKQKLISKIRNLLSIYKNYEDLIKTGIYMKGSNKE
FT                   VDLAIAKYPKIIDFLSQGMQEEFDFENLDNEMREILA"
FT   gene            complement(301479..302405)
FT                   /locus_tag="BH0289"
FT   CDS_pept        complement(301479..302405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0289"
FT                   /product="flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:BH0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16806"
FT                   /protein_id="AAX16806.1"
FT                   /translation="MYLPKVLYKSKEVVNAVKLDLVEITNPILKSLEIKKKEHEISDID
FT                   NCSIKLRNELEDLMNQKAKLQEEIEHGHELAKKERDAEFSKLLEEAKEQANKIVSLANE
FT                   RAEALQKEAEDKKGAVELESKLIIEKVVKEHEERLKRELEAEIARGRNEGYDAGFKKGC
FT                   EDFDKVLGKLNSMISALVAKRKEIFESSGEHIMNLVMQIAVKVVKKIIDSQKGVVIENV
FT                   NEALKKIKSKTNIIIRVNLDDMDVVSHQKQEFISKFDFIENLEVVEDVNIGKGGCVIET
FT                   DFGEIDARISSQLDRIEEKFKNFSSIF"
FT   gene            complement(302414..303448)
FT                   /locus_tag="BH0290"
FT   CDS_pept        complement(302414..303448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0290"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:BH0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16807"
FT                   /protein_id="AAX16807.1"
FT                   /translation="MEEQKEKEIFGVSALTGKQKAAILLVSIGSDVSSRIFKYLSQEEI
FT                   ESLTFEIARLDVVTSELKDSVLLEFKELMMAQEFIQKGGIDYARELLEKSLGTQKAVDI
FT                   INNLGSALQSRPFEFVRRADPANILNFIQQEHPQTIALILSYLDPQKASFILSSLPTEI
FT                   QTNVARRIALMDRTSPEVVREVERVLEKKLASLSSEDYTSAGGVDNVVEIINMADRKTE
FT                   KFIIESLEEEDPELAEEIKKKMFVFEDIVLLDDKSIQRILREIDGQELAKALKSVDIPV
FT                   QEKIFKNMSKRAAGMLKEDMEFLGPTRRKDVEEAQQKIVSLIRKLEEQGEIVISRGGEE
FT                   DVLI"
FT   gene            complement(303464..305170)
FT                   /locus_tag="BH0291"
FT   CDS_pept        complement(303464..305170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0291"
FT                   /product="flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:BH0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16808"
FT                   /protein_id="AAX16808.1"
FT                   /translation="MNNFITKFFASVNKSFKKASIVQRVAFGVIFLFIILALIFLVGFS
FT                   TRKQGIALFGVGIKDQYLLDKIVQRLDRENVGYTITVDGKIYLSDENTSKKMRAILVRE
FT                   ELVPVHMDPWSLFDIDRWTITDFERNVNLRRSITRAVEQHIVALDDVDAVSINLVMPEK
FT                   ALFKESQEAVKASVRITPKPGSDIVTNRKKVEGLVKLIQYAIEGLESDNIAIVDNKGTI
FT                   LNDFSNVDGIDRIDLAEKERKLKLKYESMLKDEIDSALSKVLSVGRFMIARVNVTLDTS
FT                   RQTTESKEYAPIEIEPQDPKVSYNTRKVSDSTLISSQVHKREYEGQGYSPWGPPGQEGN
FT                   TPPEYRDLSDIIGKSNEFKEIKNVALNEKKSLSEKEPARVAGISLGIFIDGVWDFVYDE
FT                   SGKFVIENGMRKREYKPISDEALKNITDVLQSSFEYKPERGDSITVRNIAFDRVNEFRK
FT                   IDEAYFASEKFNFVVFAVSLIFAFLILIFTIFFIVSRELERKRRLREEEFARQAHLRRQ
FT                   QALMDSDDIGVDDVVGGLREEDELQSNAELLAREKPEDVAKLIRTWIVKNV"
FT   gene            complement(305184..305513)
FT                   /locus_tag="BH0292"
FT   CDS_pept        complement(305184..305513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0292"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:BH0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16809"
FT                   /protein_id="AAX16809.1"
FT                   /translation="MRVDSFFTDNDVYLIRKNPLHFGRSSSGFDVKREEKDKTFKDLFF
FT                   NLMSDVNNSQLDVSKMSQQAILKPNDIDVHDIVISMSKANMNLSITKAIVEKSIKAYQD
FT                   IINIR"
FT   gene            complement(305529..305987)
FT                   /locus_tag="BH0293"
FT   CDS_pept        complement(305529..305987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0293"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16810"
FT                   /protein_id="AAX16810.1"
FT                   /translation="MGLFSSINTASTGLTAQRLRLDVIANNIANVETTRTSEGGSYRRQ
FT                   RVIFAPRVVSPYWKGPFVPDDLDNGVGQGVRVASIEKDKSPLKLKYDPTHPDAIRSGEL
FT                   KGYVEFPNVNAVEEMVDMISASRAYEANSTVINSSKSMFRSALSILQN"
FT   gene            complement(306013..306420)
FT                   /locus_tag="BH0294"
FT   CDS_pept        complement(306013..306420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0294"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16811"
FT                   /protein_id="AAX16811.1"
FT                   /translation="MNIFEMSVDLAHRYLDVLSLRQSVIADNIANVDTPNFKRSKVTFE
FT                   AELERAILNERASNLSLIRGNDKHLNGFKELGYLDVKPSRMLDYLSILKNDGNNVDIDS
FT                   EMKNLIQNQMIYSLFTNIQAHHFKSVNIVIK"
FT   gene            complement(306454..307809)
FT                   /locus_tag="BH0295"
FT   CDS_pept        complement(306454..307809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0295"
FT                   /product="ATP-dependent hsl protease ATP-binding subunit
FT                   HslU"
FT                   /db_xref="EnsemblGenomes-Gn:BH0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16812"
FT                   /protein_id="AAX16812.1"
FT                   /translation="MMGKIENQNIVPKEIVAELDKYIIGQVEAKKLVSIALVNRYIRSK
FT                   LPKEIRDDVMPKNIIMVGSTGVGKTEIARRLSKFIKAPFIKVEATKYTEVGYVGRDVES
FT                   MIRDLMSIAVNMVREEMYDSVREEASKRAEERIIDKLLKASENSENNNASDEENKVREK
FT                   LRDKFRKQLRNGDIDDSLIDVYVSGKMPVSTIEIFSGSNFEEIDMSIGGLINNIFDRKK
FT                   RKELKIKKAREIIISEELEKLVDHENIVEIAKLRVENMGIVFIDEIDKIVTKNRTGNDV
FT                   SREGVQRDILPIVEGSKVNTRYGIIDTSHILFIAAGAFNLSKPSDLIPELQGRFPIKVE
FT                   LKSLSVGDFKNILKHTKNSLIKQYIEMFKVYNLTLTFSEEAIDRIAELAFNMNFEGENL
FT                   GARRLHGVMEKILADLFFEAPGSKLKKIEINLDYVNEKVKINEQKDLNYYII"
FT   gene            complement(307806..308348)
FT                   /locus_tag="BH0296"
FT   CDS_pept        complement(307806..308348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0296"
FT                   /product="ATP-dependent protease HslV"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16813"
FT                   /db_xref="GOA:B2S007"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S007"
FT                   /protein_id="AAX16813.1"
FT                   /translation="MSFKGTTVIAIRRGGKTAVAADGQVTFGYTVLKSNAVKIRKLVNG
FT                   RILAGFAGSTSDAITLFEKFEEKVKAREDGIIDIKRAAVELAKDWRSDKILHKLEAMML
FT                   VADSENILLISGTGDVVEPEEDVISIGSGGNYAYSAALAYMENKKLSAADIAFKSLKVA
FT                   AKVCIYTNSNIVLEEIS"
FT   gene            complement(308358..309302)
FT                   /locus_tag="BH0297"
FT   CDS_pept        complement(308358..309302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0297"
FT                   /product="Smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16814"
FT                   /protein_id="AAX16814.1"
FT                   /translation="MFKLLYVDNLKFLKGEEKLRIFNDFDLSELCKLSLRDISNYLSRY
FT                   FRKTHKLPDIKLIELQQEIINRTGAKVVLLGSKDYPLKLKRIYDPPFAIYYKGNLPDSN
FT                   SLSWAVVGSRKISIPLIGKIKELSSHLAKNHVEVISGFAIGADIAAHLGAINEKKRTYA
FT                   VIATDIDNIYPKQNRKYVTRLLENGGGVLTETLPYENIQSYFFAKRNRIVAGLSDVVFI
FT                   TCAPKKSGALITAELGLDLGLDIYVYNIDYSGDGSRTLYDSGAQEIKSVSDLYKILNVQ
FT                   YNEPEISDDLEACCVGKDTSSMLINELLNEISK"
FT   gene            complement(309308..309997)
FT                   /locus_tag="BH0298"
FT   CDS_pept        complement(309308..309997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16815"
FT                   /protein_id="AAX16815.1"
FT                   /translation="MKRWVSIFLFLVISCGDESKEKVNLGLRIREIELAGGGSLEKIEV
FT                   YKEFIDKEEQNILKIVNSIDKKARFFSLIGLEFIKLGQYGPAIEYFNKNLEHGIDNYLS
FT                   HFYIGVSSYSLAKGMKARDKIKEYFILAENSFLKSISIKDDFKEAIFALSTMYVYDLDK
FT                   QLEAKGYLSRLESMGENYFEFFMLRGANYYSLGDFNNALLFYKKAKDKASTQEQIEGVD
FT                   RIMNDFK"
FT   gene            complement(309998..311239)
FT                   /locus_tag="BH0299"
FT   CDS_pept        complement(309998..311239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0299"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:BH0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16816"
FT                   /protein_id="AAX16816.1"
FT                   /translation="MVFEGVVLTSHGGSLMKDYNIIDSHSKRFDSATNPTVLKVIGAGG
FT                   GGSNAVNRMIEYGVRDVEFIVANTDLQALQTSIAPIKIALGAKVTAGLGAGGRPEIGQA
FT                   AAEEDIDIIKNHLAGADMVFITAGMGGGTGTGAAPVIAQVAKELGILTVGVVTKPFKFE
FT                   GPKKMRLAEQGINNLRKSVDTLIIIPNQKLLTVVDKRTTIKDAFKRADDVLRMGVQGIA
FT                   GLIIEHGEVNIDFADVKSIMQGQGDALMGIGYGKGENRAVDAATSAISNPLLEEVRIEG
FT                   SKGLLVNITGGEDFSLLELEEIMGIITASVDDEATVIYGHAINSNLDDEIYVTVVATGF
FT                   SSKKQKDLSVAVENNTLSSKEFDSLMSGSQDASGGVYGANDNFIAKSKNVNYFEDDIDV
FT                   PTFLRNLNKKNSDN"
FT   gene            complement(311215..312456)
FT                   /locus_tag="BH0300"
FT   CDS_pept        complement(311215..312456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0300"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16817"
FT                   /protein_id="AAX16817.1"
FT                   /translation="MSRDLIVGLDVGTSKICTVVAEVNLNNQLEIVGIGTSVSRGVRKG
FT                   VLINIEAALDSISNSIEAAELISGCDIATLSVSMSGSSIEGTNSRGVVAINSKTREIDN
FT                   EDVERVIEAAKAIVIPMDREILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIITGSS
FT                   SSSQNLVRCVNRAGFSVDEVVLGSLASSYATLSKEEREMGVLFVDMGKGTTDIILYIDG
FT                   SPYYTGVIPIGANRVTLDIAQVWKVPEDVAENIKVTAGVAHISALESQMESVIIPNLGT
FT                   RPPQEKSRKELAIIINSRLSEIFEIIKAEVMKRGLYNKINGGIVLTGGGALFPGISNLT
FT                   EEIFKYPSRIGFPMNISGVGEEYIDPKFSSALGLVLYKHEQQKFNKLKKGNNKSKRQSK
FT                   ISSKLKGWFLKEWF"
FT   gene            complement(312456..313199)
FT                   /locus_tag="BH0301"
FT   CDS_pept        complement(312456..313199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0301"
FT                   /product="DivIB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16818"
FT                   /protein_id="AAX16818.1"
FT                   /translation="MLIYRKFLIIYIYIIISFILLEIIFVIFISPYFLIRYITFNDNIH
FT                   ISKEDILSISGIKPNTYYYDADVSIYERNIKRDLRVQNVRVELKFPNTISINIEKRVPI
FT                   VTAYENVDGSFIYYFIASDGVILEKCKDLIYDLPIISGLNLNGNEVGDCLEDRMLAIIK
FT                   NLNYVKINQDTLYNLISEISFLKLNFYDYKIFLYIKNIYNKILITTDMDLISAMHKVFM
FT                   ISDLLKGRSDTVDLRSGDIILLGED"
FT   gene            complement(313239..314342)
FT                   /locus_tag="BH0302"
FT   CDS_pept        complement(313239..314342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0302"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:BH0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16819"
FT                   /protein_id="AAX16819.1"
FT                   /translation="MVVMFVEKVSLRKCYLLILCSLIAYGLIVFYTSSFFLSLELTGDP
FT                   NFLFLMRLKYLFLSFIVFFVFERISLDFLKKIVSIVLLVTFILVLATFFSPSVSGAQRW
FT                   IFFKGISIQPSEIFKVSFTIYLASYLSKFKLKSDNNISYWLKPMLIFGIFWLLIILQND
FT                   YSTAIYFAILFFIVLFVSGISLGYIFAILFTFIPISMLFLIFEPYRVARIFAFLNPYDD
FT                   PLGKGYQIIASLNALKSGGLGGRGLGMGEIKLGRLPEANSDFIFSVLGEELGFLGICLA
FT                   IMLFFLFFYFGYFVAIFAKTRFRFFIAFISSLTIFLQSIMNILIAIGLLPPTGINLPFF
FT                   SSGGSSIVVTMALSGLIANVSRDIEGK"
FT   gene            complement(314350..315405)
FT                   /locus_tag="BH0303"
FT   CDS_pept        complement(314350..315405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0303"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:BH0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16820"
FT                   /db_xref="GOA:B2S014"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S014"
FT                   /protein_id="AAX16820.1"
FT                   /translation="MFDLLGLRLLHYITFRTAYATIFAFLLALIFGPFIILRLKKLKLD
FT                   QILREDGPKRHLSEKMGIPTMGGILIFFCVLVSLFFWINLWNVYFLIVLFVMISFACLG
FT                   FMDDLLKIKRKNADGLNPRFKIYGQILFSCISVTMLYYFGGEHISIIYFPFFKSLKLDL
FT                   GVLYIPFGMFILISASNSFNLTDGLDGLAIGLSIVVTGALVIIAYLTSRVDFATYLNIP
FT                   NIKGSEELVIFLGALLGGSFGFLWFNAYPAKIMMGDTGSLSIGAVLGMTALILKSEILF
FT                   AILAGVFVLETLSVIIQVAVYKKTKKRVFKMAPLHHHFEELGWSETQVVIRFWIIGLIF
FT                   AIIALSTLKIR"
FT   gene            complement(315423..316817)
FT                   /locus_tag="BH0304"
FT   CDS_pept        complement(315423..316817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0304"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-L-ornithine--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16821"
FT                   /protein_id="AAX16821.1"
FT                   /translation="MVHIKIKDILDSLGDVKFVGYLSSMQRVVSFYSLDSREINDENSG
FT                   ASLYFAYKGDRVDGFSFVEYLIDIGVKCFVCSKDYEHLCVEYLNKDESLVFLLTSNVVM
FT                   CLQNLAAHFIKRTNFKRIAITGSNGKTTTKEMLYSILSERYKTCKTWGNLNSDIGLPLS
FT                   ILRTEGDEEYAVFEVGISYVGEMNLLSEILEPEIVIVTNISYAHMQAFEDLEMIASEKS
FT                   EIITKSTQMVILNESCPYHSRLREIAKSISPEINIFYFDFNSLQIKSFAFLNDKFSYDF
FT                   TYKGFDYSILLPGKHNIFNAISCINLALLLGMSENEIRNGLLNADFQKGRAELLRVKDY
FT                   LVLNDSYNGNLGSFMALKEMILDFEIKGKKFIILGSFKELGKFAYEAHKTAMREVILMN
FT                   FDKVFLIGEEFQEVKRRENLSLNNLCYFSNFEDFIDCFVNNLESGCFIAIKGSRSNRLE
FT                   RVLDYL"
FT   gene            complement(316833..317114)
FT                   /locus_tag="BH0305"
FT   CDS_pept        complement(316833..317114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16822"
FT                   /protein_id="AAX16822.1"
FT                   /translation="MSKIGRIEVRLYCLLILILTIVICLNIYLNFRYVVKLREFDDLND
FT                   EQSNIIDENLRLLTVIYELQSIDRIEELSQNYLNLEKKDNKDINIIKR"
FT   gene            complement(317107..318000)
FT                   /locus_tag="BH0306"
FT   CDS_pept        complement(317107..318000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0306"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16823"
FT                   /db_xref="GOA:B2S017"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S017"
FT                   /protein_id="AAX16823.1"
FT                   /translation="MGNIFHTPVLLDEIINLLEIVYVNDGFIFVDCTLGEGGHSSAVLR
FT                   KYQNISVIGIERDDIILNRAKEFLVEFKGKVSYFNAWFDDFFSEYSLSSKANFILADLG
FT                   ISMFHYKMSGRGFSFFEDERLDMRLNPGAGGLSAYDIVNTFDKVRLENLIYEFGGEHYS
FT                   KRIVSSILEYRKIKKIKTSRELQGIISKAYPRIKLKINPATKTFQALRIYVNDELFRLK
FT                   RSLPLWVGSLSRNGILAIITFHSLEDKIVKEFFKGLSKEQYCILTKKPIIASFEEKRCN
FT                   NASRSAKLRAIRKLYE"
FT   gene            complement(317993..318814)
FT                   /locus_tag="BH0307"
FT   CDS_pept        complement(317993..318814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16824"
FT                   /protein_id="AAX16824.1"
FT                   /translation="MIIAFLFFFSFSNLYAFLEFGKDEKFDLVSDFGESKDDTLNIGIK
FT                   LRALDTHFSIFSNNYKILYSRNKTNEYDGSILILFDKDLGLNLEFFGDFVYKNEKVFLN
FT                   DNKVFDVVVVDRYSGQIVNPLFVIKNKNNLNINSSFFLSNIFLKGKDDTMFELKGDVDL
FT                   ELGNYGLVLNFSKKDVNASKALNGIYYFEVFLNNNSIFRADFQSISLDDNSYVVSGDKN
FT                   YNLDIFNIKRNSGNIEINNLEFTSGHNEIKIKYGDVYNTENSLTYRFTLNG"
FT   gene            complement(318820..319887)
FT                   /locus_tag="BH0308"
FT   CDS_pept        complement(318820..319887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16825"
FT                   /protein_id="AAX16825.1"
FT                   /translation="MDFYKENLTKFRKIKFFLLVIFLLMFIVLVDSLLRSTIDISTFYK
FT                   FSHFKRSYSLVDIIPRNNVFIKDQILNLDQNKHYYHVISDRLVSFSDYYYVLNRFKNNY
FT                   SVFSKETNKFLFSLAYKDFVFTKNNVIFALNNLYRALEVYGADGSKILSLKFIASILSI
FT                   DYNDDILALGLSDGKTYVYKRGKMVYSGDLLGIGLPVICVKLSLDNKYLCILRENEEYS
FT                   LEVINLEDGYNQVFYLNNLKIKDFNPFFKIDKFYNLFVETVDSFLIFNIESGKTFRVYN
FT                   KNSVLKASYDSFSRVYRIYFYDLNGSIINIRTYSVDSYKLFDNIFFKDRINSYVEFDEG
FT                   ILYFNNDSDLKYLGL"
FT   gene            complement(319915..320673)
FT                   /locus_tag="BH0309"
FT   CDS_pept        complement(319915..320673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16826"
FT                   /protein_id="AAX16826.1"
FT                   /translation="MDLVHNENYQKILFIDNLILQTLNDIKNIKESGRLARDSSVTVNF
FT                   INLNLNVLSYIVSLNYFYTRPRLKVNYDFRTNLFNFISSFSSFVSPVLLISVGELMAAK
FT                   SVINLNPEERFLIIKKLGYLIDLGMYFSKGDSKSIHFLEDIYLKFIVLAKNFIDFKNFS
FT                   KNLVIESPFYKVQLAHLIKSLELLEEGAFLLRSRYEASGAYGLSEQILNYIQAGKILAT
FT                   VTSQKEIAEKFAKFHEVWSVKFQSDLGKNK"
FT   gene            complement(320697..322355)
FT                   /locus_tag="BH0309A"
FT   CDS_pept        complement(320697..322355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0309A"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:BH0309A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16827"
FT                   /protein_id="AAX16827.1"
FT                   /translation="MLVELFIRNFVLIKEVSIKLSASLVALTGESGSGKSLLLSSIYYL
FT                   FGGKIKNDIIVDGEQECVLLAKFRVNDDVRDYLSFKGILALGFIVIKRIIIFKSSDILV
FT                   SNYYINNEPISSAVLKSIFSMLIEVHSQNQQYLILKNPSNNLKILDNYANLNTQLEEYK
FT                   LAYEAYIKCLKIFDDFASKEKLHKDSREECDKIIDEIDFLSPKIGEEEILKIKLDELKY
FT                   HESLCNALLSLKDVLSLNDSGSALSEIKKVICDAEYLSRMNNSYFELEDRLKNSYYELE
FT                   DIGQAYSRYLFDQIYDEKEIESLESRLYDLSRLKKRYGPSLEDVMALRKRCDEIINSSL
FT                   NFETERLGKEQKLKDLFERVKKLAFDISGIRQTVALSFASEVTKILHKLNMGDAKFFVS
FT                   VSEGEIKLTGMDEVEFLISSNIGLKVQPIYRIASGGELSRIMLAIKSVQNVGEDKLIIF
FT                   DEIDSGIGGEFGVDLGKYLKELSENMQIIVVTHLANIASLSDYHILVKKECIKDKTFVQ
FT                   ASLLLGNDRALAVARMLSGSINDISFRHAEELLKR"
FT   gene            complement(322393..323271)
FT                   /locus_tag="BH0311"
FT   CDS_pept        complement(322393..323271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0311"
FT                   /product="ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:BH0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16828"
FT                   /protein_id="AAX16828.1"
FT                   /translation="MTRVNLKGFHIRRAMKSKVLIYVNYSNSDAEVLACEIQKYLEHKY
FT                   GVLSLFAGINKSSEVLTEADLIFAITLGGDGTVLLASGLLLKNDIDIPIISINLGKVGF
FT                   LADIKPRDFKEVIDKFFNNSLFIHKKYLLSISAYENGNNIFTKYALNDVIIRSSALNKL
FT                   IYVSLRVNSEDFLSYRSDGIIFATPTGSTGYSFSAGGAILESDLRAFILTPISPHSVYN
FT                   RSFIFSSGSKLSLSFQKGYALNSASIFVDGVNIGTFGVDIVFELGLDNKSLRFASFCTD
FT                   TFVRRLKNKLL"
FT   gene            complement(323219..323749)
FT                   /locus_tag="BH0312"
FT   CDS_pept        complement(323219..323749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0312"
FT                   /product="chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:BH0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16829"
FT                   /protein_id="AAX16829.1"
FT                   /translation="MFIKEKAIEKKSHLQVACFKIGKESYGVAIEHIREVIKVPLEGIY
FT                   AIPNVPNYITGIYNLRGNVIPLINLNIRFKIPSVYATEEDKLLTGYLIVNIKDKLLGIF
FT                   VDKVLKVISFDVSRVQEPPATLQTLDRKYISGVIRIENEENFESEYLILIDIERIFDKS
FT                   EFERIPYKESNEE"
FT   gene            complement(323772..324389)
FT                   /locus_tag="BH0313"
FT   CDS_pept        complement(323772..324389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0313"
FT                   /product="23S rRNA Um2552 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16830"
FT                   /protein_id="AAX16830.1"
FT                   /translation="MSVLKRINMYNVVDKYSQKAKKEGYLARSVYKLIEIDQRFSLFSS
FT                   GNILDIGASPGSFSQYAYNKLKNGVLVAVDLNDINLNFTNNFYFIKGNIYIDEVFEKIK
FT                   TFAPYSLIISDAAFKTTGNRLVDTSNSFNLNMRIVELASQILIRGGNLLLKVFQGGEEE
FT                   QLFYKLKRCFKLVKKIRPKAVRKNSFEIYFLSKDFIKLDTNI"
FT   gene            324419..325465
FT                   /locus_tag="BH0314"
FT   CDS_pept        324419..325465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0314"
FT                   /product="dimethylallyltransferase"
FT                   /EC_number="2.5.1.1"
FT                   /EC_number="2.5.1.10"
FT                   /EC_number="2.5.1.29"
FT                   /note="geranyltranstransferase; geranylgeranyl
FT                   pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16831"
FT                   /protein_id="AAX16831.1"
FT                   /translation="MQNKSFLDKIEKNINYIFSKDHFLNLFKDKDLKLKLNIQESTIKT
FT                   IKAPAIEIINRGGKRIRPMLMILLAYALGYNNSNTKNLYKLSMLLELPHSGSLIIDDIE
FT                   DGAIKRRGKPAIHLIYGLDNSINTANLIYFLPAKLIQTANLKTSQQLLIYENFFTTLSN
FT                   LHLGQGIDIAFHNGTYIPNVEEYISLVELKTSSLFGMAGFLAGILTNNENKAKNLYNTF
FT                   MKLGTCFQIIDDIKNIKDGINGKEFGDDLIEGKKSLPIIYFLKEKQFDRQIIQELSKIK
FT                   NKPIDESREEILKFSNMINSSSAIQAASTLAISYLNKFIEEFNSYALINKYKDMIMDIV
FT                   EKIKEENL"
FT   gene            325462..326145
FT                   /locus_tag="BH0315"
FT   CDS_pept        325462..326145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16832"
FT                   /protein_id="AAX16832.1"
FT                   /translation="MKKYAIILVWMNIIAPIYATIPTEDINSNKIIDELYTKSILLKEL
FT                   KKYNQSKSLLMQIINKDPKQVDAYLLIAELEYLMNNWLQAIEQTKTYLQIIDFKDTKNY
FT                   LDISWAYFLIGESRNSMDYIIQFIQDNKELLNTNIYILIDTILKKGFYHFIQDEDLMFN
FT                   LIITTIFQIETYDDTIFTIFLNNLAIIKQIPFYEFNKIKIKDLELQIKTLKKIKNSING
FT                   ITKIT"
FT   gene            complement(326132..326938)
FT                   /locus_tag="BH0316"
FT   CDS_pept        complement(326132..326938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0316"
FT                   /product="nucleoside transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16833"
FT                   /protein_id="AAX16833.1"
FT                   /translation="MFAIFVHSIIFAYLALGALYTERVGLLNISIEGISFLAVFLTSLF
FT                   IYLGYGIFVAVVMTIFISLIFGVFLSFLVRNGYNIFITGIGINILCYFLVRLLMKANFN
FT                   FIPGFSLNISNNFAVTFFIIFFFVFLSFSIYAINYSRVRVVFEFIRSSDYENILGEQTS
FT                   NYFRSFAIFISVISASIAGSFLAINFNVYSYDLGLNNGWLAICILYIAFANPWLIFPSA
FT                   FLMIFIEYKFFNFQDYVNSYFALSLPFYMAILINIFVALFRKTKLF"
FT   gene            complement(326939..327871)
FT                   /locus_tag="BH0317"
FT   CDS_pept        complement(326939..327871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0317"
FT                   /product="nucleoside transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16834"
FT                   /protein_id="AAX16834.1"
FT                   /translation="MRAFKREYILLIFSLSVLGISYFFDGFFSFSYMKVMLWNFILLLL
FT                   IATGISTCAKSNSLTLGDEGQVYFGAFLSYVFCEFCGLTYFNFVLIMILSSFLVGIIGI
FT                   MPFLLTFFCGVNGMLTGLLMSYGNQRLVDGFISKLLGSNGLLNQTKSIDKIFALDTAFP
FT                   YLFLFSILVWGCYVFIHKRTILGLKLEILSDRKPLSKFFSINEFKYKFFTVFTSAFLNG
FT                   LVGSIFLIFFKNYLFLGLTSGLGWNGFVIAVVSGFNYVYVLWFSLFFAMLNEFNNYLKI
FT                   NYSFKFEFIGLYQALSIFISLFLINSGRK"
FT   gene            complement(327868..329325)
FT                   /locus_tag="BH0318"
FT   CDS_pept        complement(327868..329325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0318"
FT                   /product="nucleoside transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16835"
FT                   /protein_id="AAX16835.1"
FT                   /translation="MVEFKNIVKSFPDVERPILDSVNLRIEEAKILTVIGRNGEGKSTL
FT                   SKIIAGFIHFDSGDVFVNNNRQKNWNVDVAKSNGIYIVSQIPKLNMNLKVWEYLSIYWF
FT                   DSQFFMPMNKSKTYGYYKWLRQFYNIAFELETRIQDLNIKEIYFLLIISSLKKNAKIII
FT                   FDESVAYFSQKEAQEFIKLLQDLKIAGITSLFITHRELGDAIKFSDEFIILKDGKCFRT
FT                   TNKEVMLSKLEIPVDKFISTSIRRGEPNEDLIKFNLFFEDFWKYDISFSLKKRGVLGII
FT                   AEEAAIKTWEKLFLGKIPFVGCIKMNGHRYEYINFYELKAGFLPLGIGNLFSDNTTILD
FT                   SFLAKIMSFENEVLIKQSTINKLKKFFKNDMEYCESKILKTFYSKSLAFSGGTLKKLAL
FT                   FREKYITKSFLICFSPLSNLDYRAYSEISNFIRHFSNEKPVLLITPNLDELLLLSDDIL
FT                   AIKAGEVVLRLKREYINKAILKEMLFI"
FT   gene            complement(329329..330393)
FT                   /locus_tag="BH0319"
FT   CDS_pept        complement(329329..330393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0319"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16836"
FT                   /protein_id="AAX16836.1"
FT                   /translation="MRKRCFIAVRRVLFFRIFWIFISLICLFLFVYINFFKIKELKSSS
FT                   NIKIALFIPGVISGSPSYKVMYDFLIEFKKNRSDIEIKLFEAGFNQHEWIELLEKLLNS
FT                   KNYDFLITANNVMQGIIDKVSQNYPYTKFLLFDSLVKNTNPQVYSLSYNVAEEAYILGY
FT                   YVGLFLKGSNLSNKNVALIAGQEYPVMNNYIFPYFKNGIREILDSEVFFRTLGNWHDSN
FT                   RVKVLSDSLILDSGVSVILPIVGTAIKGVLSSVREHGVFAVLFDDEDYLDNKDNVIGSG
FT                   ITNQRFYLEKVLDKALKGEIRYGTYKVLGFKERGVLFNLLNKFYVEKTDLKLKERLEEK
FT                   MREMNDTEIEIDLE"
FT   gene            complement(330846..331937)
FT                   /locus_tag="BH0322"
FT   CDS_pept        complement(330846..331937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16837"
FT                   /protein_id="AAX16837.1"
FT                   /translation="MILKSYIIILVLLFLQVALFSQVASIKEIEGQINVVRNAVPVKLN
FT                   LGDEIFEYDFIEVGDNSKLKIGLYGINGITSDLTLYSNTHSLVCYSSLKDMQDAKIYLF
FT                   KGSLEVAIYEVVQGSSFSVDVNNYFFMTVAPAKFYVNCEYFNNYFVSVFDGVLKHYNKD
FT                   EYWISAGTSILLWDDNSFLYKTSDSVSQNVIQNLREMSRKNFISLNNRRSTYIFSKYVE
FT                   DSFRFDFVYDSLVRDPKFNAIYSKWSLEDKNYTLGNRVDMINYVNYLRGRIGILFNNFI
FT                   YLANVFFFIENIVKHSSDVFDRLSSHGFILKFLEDYKKNRSALIKKFFKTIHSFKMYLV
FT                   RTNGDIPSNLRVNEFYLLKPREF"
FT   gene            332418..333572
FT                   /locus_tag="BH0323"
FT   CDS_pept        332418..333572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0323"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16838"
FT                   /protein_id="AAX16838.1"
FT                   /translation="MQSISHKKDVFMIKKSKLLFLMLSVFALSLISCETPPEDTKSANS
FT                   KILIKETGDIKKDIEEMKNGVIRERGNLFYSKEFNEAEKIERDMKAKFAKGMIKQGNEV
FT                   ALKALERYRNIVRDVTEKKEKINYLKENIEKYLNDAEVNEAYIWIPLEIDEVNNLYFEA
FT                   TRKYKMYDIESSLGMYSKTFNKAQQTAKKAKEARALKETEERMYKQLKALEAASELPIY
FT                   SNNRLIKPSPWNGRALLKDKGERINLLDSQGKPYLLGQMDALVLAYEEKAENVEKSDSN
FT                   KFKTLQLIEKARQLWEQGLEAKSLNNLRLANELFLDSARYLKAYQSHSSKELYIVKIGN
FT                   TLWGISKKLYNDPYLWPKIWFANRQKIQNPDLIHANWKIIIPSK"
FT   gene            333667..334023
FT                   /locus_tag="BH0324"
FT   CDS_pept        333667..334023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16839"
FT                   /protein_id="AAX16839.1"
FT                   /translation="MKKLVLTSILFFSCYTAAHLDKQLTKETPYSIYLRKAQQATNVND
FT                   YQSALKIYEKMIENYKENKSIVAIGKYEIAFIYYINNKKETAKKLFEELIQSNVQTPKW
FT                   IIPLSQRIMEKIEI"
FT   gene            complement(334063..335184)
FT                   /locus_tag="BH0325"
FT   CDS_pept        complement(334063..335184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0325"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16840"
FT                   /protein_id="AAX16840.1"
FT                   /translation="MKKVYFIISLFIVFNLFSSMNDHLSINIDDVYVEAHEDGFHLFIR
FT                   KKPDIKSVILTESFEVPDRSKDVSTYSFRTLEYNSVNGDEIRILNGRVIQNRRLLSLTS
FT                   STPIQNRRFGQAFHILIPKKLRYGFPNFSTRSGDIDLEVLKRQKEPFWFSIRTFERKYN
FT                   DYLGQYKDNAYELFFGDIQLEGTGPIENNGLREEFARFADDVIVAKKGLDIVDKIKDIL
FT                   KKSEEPLADLDLVFVIDVTDSMKNHIEILREHLLDMIEPQLNQFRSYRVGFVFYKDYLE
FT                   DFLTRSFDFNSREYLSNVFEGINVGGGGDYPEAVFEGINSAVTQFDWRADSRFIIVLGN
FT                   APPHEYPRGPIVYEDVIRAAKEKDIIIYGILLN"
FT   gene            complement(335236..338094)
FT                   /locus_tag="BH0326"
FT   CDS_pept        complement(335236..338094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16841"
FT                   /protein_id="AAX16841.1"
FT                   /translation="MPDIEEINKFKREILDNISDERTKKESLGIKMDIEPPKDGELIVP
FT                   WENQEEVFDLEEEHDDELDLDAILGALDSEEGQKNESSEDDIAILKDSKKVDIDPEFND
FT                   LDNDFDILSSNLEDNIETVLDDNSISLDDAINFDLNNADNLQNLDVENDLNSDLLNSDK
FT                   FIDNEIDANNLNQESLNDNNDDFDFENMITSLNKSDGTSNRLEIPYSNESVSNENSEKL
FT                   SDDEENNWSNLSDDFQFLEDEPKKFSTKNDFKINYPLFFKHLDSYPRNLRIAIAEALML
FT                   DNVSRYKIEALIDLVEQNKKGLKFIAKFVGDIVGRSVKLPVMYYKAEEFSKLEKRFSYR
FT                   LSKALTPILKIASLFVVLTFISFYFLVDVMFFYIASDKKYKEGISYIYENKRELAKATF
FT                   RDAYYMRPSKGWFLVYAKAFEDVRDFDSAEEKYEELFTIDPFSVDASTRKRKNFDKDGY
FT                   ISYAFMKMRLGEHADADSILDEVISYDIYDYEALMAKGDNYFQWAQREPVYYKDSINNY
FT                   TILLSKYGHKKEILFKLFNAYIEAGAEREAENVNAFIKANEGLDIDEVVYTKYAKRLID
FT                   KYIEFTVYNQRINALSRNLKYLSAQMNLLNKEFSSFKAGNGRSVSDTLNDINLNSEIEY
FT                   ILRRILFKNPDYNKALFESGRYFYYMGDLKKAEGYLLTALNSFRQEDLIENSSEKIIAY
FT                   RILSDIYEKGNDSLKASNIVSLALNEYDFYKRNGLVKGSRELALIYEKQGDILRTFNGF
FT                   KSAISSYKMAINEGVNSPNVYYKLALLNYKENNYKDALVYFFKVEDMSGFANSNKVLNS
FT                   IASVLYKMGNFEAARSYYLRVLQNLESEKSSILGFKPKGNDHHRALLIKKIEIYNNLGV
FT                   VEIRASFGDRVESGIVRDNDLFDSGIANLTESSRMFDLLNRDDDMVKNVKRDLASLNLR
FT                   SIFKNDFIGSKVLFYDNLADNL"
FT   gene            complement(338111..339004)
FT                   /locus_tag="BH0327"
FT   CDS_pept        complement(338111..339004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0327"
FT                   /product="glycerol-3-phosphate O-acyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BH0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16842"
FT                   /protein_id="AAX16842.1"
FT                   /translation="MFTQNESFNKYFKGIENEFLSRFKSIEKINCLSNSYHEADSVSRS
FT                   LVDTMIKRLLKDNSTIVGIQNILKLYEKTKSGKSSIILMEHYSNFDFPCFQFLLNEMNY
FT                   KEVAEHIIPIAGVKLFKDDLLIKSLSLGYSVIFIYPPHAFIGVDHETIRERRVFNANSM
FT                   RCVVDKKSSGYMILIFPTATRYRKDKPETKKIISEIASYFKLFDYFIMVGINGNILEVS
FT                   PNGDMSCDLFKEDTLVYNATEIFDIFEYKNLILEKLNQEGLEPTKEILGSRIADDLEKR
FT                   FEVLHEEGANIYNGLI"
FT   gene            339202..340803
FT                   /locus_tag="BH0328"
FT   CDS_pept        339202..340803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0328"
FT                   /product="oligopeptide-binding protein OppA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16843"
FT                   /protein_id="AAX16843.1"
FT                   /translation="MKYKILIILSFLIVWLTSCSGDEHKNKITFRVTNEVEPDSLDPQL
FT                   ATSVQSFNIIMNIFSGLTTRETQTGGYKPGLAKSWDISADGLVYTLHLREDLVWSDGVP
FT                   ITAEGIRKSYLRVLNKETASQYVDIVKSAIKNAHDYFEGKIPESELGIKAIDNSTLEIT
FT                   LIAPKPYFLDMLVHQTFIPVPVHVIEKHGRNWTNPENIVTSGAYKLKTRIPNEKIVLEK
FT                   NDKYYNASNVEIDEVIFYQVQGNTAYNMYVNDELDFLMNVASEYLDEARIRNDYYSHPI
FT                   NRVVYTAFNTTIKPLDNAKVREALTLAIDREALNKITLKGQSKPTRNLTPPFKNYSYDK
FT                   KLKLFDPQRAKQLMAEAGYPDGAGFPTLKFKTSQRNGMAISAEFLQEQLKKILNINIDI
FT                   EIEEWNTFLSSRSTGNYQMSYMGWTGDYLDPLTFLESLFTTENQGFGAYGYSNKQYDNL
FT                   IKQSNFAKDPLQRQEILRQAEAIITEKDFPVAPLSILQSYYLFRHDKWTGWTPNVAEAY
FT                   LYEEIKYKRENTNNKI"
FT   gene            341237..342823
FT                   /locus_tag="BH0329"
FT   CDS_pept        341237..342823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0329"
FT                   /product="oligopeptide-binding protein OppA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16844"
FT                   /protein_id="AAX16844.1"
FT                   /translation="MKIKRHTFMIFFFIAILSCGKESSKENLAFKISLGGEPKSIDPQL
FT                   SEDKMGAHVISQMFTGIVDGDSQTGGYKPGLAQSWDISADGTIYTFHLRKGLVWSDGVP
FT                   ITAEGLRKSYLRILNKETASNYVGTIKSTIKNAEDYFEGKIPESELGIKAIDESTLEIS
FT                   IITPKPYFLDMLVHQSFTPVPVHVIEKHGQEWTKPENMVVSGAYKLKERQPNEKISLIK
FT                   NDKYFNAKNVELQELIFYTINDASTAYRMYENNEIDMLTSASIPPDLIKEIKLRNDYYS
FT                   SAINGLYYFSFNTHIKPLDNVKVREALTIAIDRETLTKKVIDNGSIPTRNISPNFNNYS
FT                   YGKPLSLFDPQRAQQLMAEAGYPDGINFPQLKIKYNTSEGHKKISEFLQNQWSKILHIN
FT                   VELENEEWASFLASKQKGDYEISRAGWLGDYSDPLTFLSLFQKEFSHFSSYKYFNEEYE
FT                   NLITQSDLEQDPSKRQDILRKAESIIIEKDFPVAPIYIYAGNYLFRNDKWTGWAPNVAE
FT                   RFHLSELKRIK"
FT   gene            343558..344478
FT                   /locus_tag="BH0332"
FT   CDS_pept        343558..344478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0332"
FT                   /product="oligopeptide transport system permease protein
FT                   OppB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16845"
FT                   /protein_id="AAX16845.1"
FT                   /translation="MLKFTIQKLLETIPTLIAITFLCFLIMRLAPGNPFDSEKPIDPQV
FT                   KEKLMQKYHLDKPFYMQAYYYITNILKGDFGPSLVKKDLNVSQYIKLGFPKSFTIGIIS
FT                   LIISLTLGILLGSLAAIKKNTRIDYIIRVAAIFGISVPTFVTGPILQYFLSVKLKLFYT
FT                   SGWISERGGLANLVMPILTMSLPWIAIFTRIIRGSMLEILKSDFVRTAKAKGLSFNVII
FT                   RKHVLIGSMLPLISYVGPAFAGIISGSMVIEQIFRIAGMGIFTVEASLNRDYPLLMGSL
FT                   LVYSTILLISILASDIVYKKLDPRT"
FT   gene            344479..345540
FT                   /locus_tag="BH0333"
FT   CDS_pept        344479..345540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0333"
FT                   /product="oligopeptide transport system permease protein
FT                   OppC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16846"
FT                   /protein_id="AAX16846.1"
FT                   /translation="MNRMNEYEKQDTCVEIQTANKRAWLRFKENKLAFISIFIIGFYIL
FT                   IAILRPILPTYKYYTQIVEHADLPPSLKYAGELWYEKELNFIKRLAAKEKREINEEEKA
FT                   KLEEIKRKIETDVQKIDGKEIKIHKRIYLLGTDSLGRDLLARIIQGSQISISVGFIGAF
FT                   ISMIIGTIIGAVAGFFGGIIDRIITKIIEILYVLPTLLVIITLMTIMERNVIGLFIAIS
FT                   IISWLTIARIVRGQVKSLATSEFIQVARTLGATNSRMIFKHLIPNSFGMIVIITTMNVP
FT                   SFIMLESFLSFLGLGISAPMTSWGELIKNGIPTFIEYPWKIFIPATVMTIFLLFMNFLG
FT                   DGLRDAFDPKDNL"
FT   gene            345550..346422
FT                   /locus_tag="BH0334"
FT   CDS_pept        345550..346422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0334"
FT                   /product="oligopeptide transport ATP-binding protein OppD"
FT                   /db_xref="EnsemblGenomes-Gn:BH0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16847"
FT                   /protein_id="AAX16847.1"
FT                   /translation="MREDYILDIRNLSIEFKLKHTTIHPVNNINLKMKKGEIRAIVGES
FT                   GSGKSVTSMAILKLLPETTTVYKTGEILFEGQDLLKLNEKELQSIRGNKIAMIFQDPMT
FT                   SLNPYLKISTQIEETIMLHQKLDKKAAKQKTIEMLKTVGIINAEERIKHYPHQFSGGMR
FT                   QRVMIAMALSCRPSLLIADEPTTALDVTIQEQILLLIKNLSKKFNTSTILITHDLGVVA
FT                   EICDTVSVMYQGKFVEEGTVQEIFKNPKHPYTIGLLKSILTLDKDPNEKLYSIKDHPIE
FT                   PTTNKIEVI"
FT   gene            346423..347415
FT                   /locus_tag="BH0335"
FT   CDS_pept        346423..347415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0335"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16848"
FT                   /protein_id="AAX16848.1"
FT                   /translation="MKNEKDIILKVENLVQTFTIGEDFLFWKNKRKVNAVNGISFEVER
FT                   NKTLGLVGESGCGKSTTLRTIMQLYTPTSGSIYFNGKDITKLSKKELLKTKKDMQMVFQ
FT                   DPHTSLNPRMTIKEIIAEPLVIYNENKIFPRTKKEIEKRVNELIDITGLAKNMLSRYPH
FT                   EFSGGQRQRIGIARALALNPKLLLLDEAVSALDVSIRAQILNLLKDLQKELSLSYLFIS
FT                   HDLAVVKYMSDKIAVMYLGVILEIAPREILFSNPKHPYTKTLIASIPDINPDKTQNKTI
FT                   KLLDEPSLINMQNTSLTPENASLEEVEKDHFVSKYLFDEMNRLLNKNNT"
FT   gene            complement(347579..348334)
FT                   /locus_tag="BH0336"
FT   CDS_pept        complement(347579..348334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16849"
FT                   /protein_id="AAX16849.1"
FT                   /translation="MERTLKWLFYFIFFFFNIANVCSQGYIIENFDLSLNEFLEVSTRK
FT                   DNLLPIVDSKRVIMFYPPSKGIRKVFAAFDFDSYAKKYLFKKNKYGLFFVKINLPHGVG
FT                   RIKYRLVVDGIWTNDEYNKNVVFNKDLIPFSIIDIGVDHSYVSLRNPIDSSDGREVEIF
FT                   YIGRPGQIITIAGNFNNFNPFLNRLVEQEPHKGVYTIKLKDLPKGRIYYYFVDSGNKVI
FT                   DKNNVNRINLYSVEGLDNKIDFEVSYFDN"
FT   gene            348454..349755
FT                   /locus_tag="BH0337"
FT   CDS_pept        348454..349755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0337"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BH0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16850"
FT                   /db_xref="GOA:B2S044"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S044"
FT                   /protein_id="AAX16850.1"
FT                   /translation="MGFRIYEIKARQIIDSRGNPTVEADVILEDGSLGRAAVPSGASTG
FT                   INEAVELRDGDKSVYMGKGVLKAVENIINIISPELEGMSALNQVEIDRKMLALDGTPNK
FT                   SKLGANAILAVSMATARAAAEYLGLKVYQYLGAYKANILPTPMCNIINGGAHSDNCVDF
FT                   QEFMIMPIGAKTFNDAIRMSAEVFHTLKGILSKRGYATSVGDEGGFAPNLKSNEEACEV
FT                   IMEAIKNAGYTPGTDIAIALDPATSELYDPETKKYVLRWSTKEELTSEEMVEYWAKWVE
FT                   KYPIISIEDGMAEEDWDGWKKLTDKIGDKVQLVGDDLFVTNTSFLKKGIEMKVANAILI
FT                   KVNQIGTLTETFEAVEMAKKAGYTAIVSHRSGETEDTTIADLVVALGTGQIKTGSLSRT
FT                   DRIAKYNQLLRIEEELGSIAEYHGRDVFYSIKKQ"
FT   gene            complement(349819..350229)
FT                   /locus_tag="BH0338"
FT   CDS_pept        complement(349819..350229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0338"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16851"
FT                   /db_xref="GOA:B2S045"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S045"
FT                   /protein_id="AAX16851.1"
FT                   /translation="MAKSDVKGINLGMGTGRRKSSVARVYIREGKGDIKINSRDFDSYM
FT                   QLEKLKTIALSPLVLTNTLGKYDLYINIYGGGISGQAGAIRHGIARALFNLDEEHKMIL
FT                   KSNGFLTRDPRKVERKKFGKKKARKSFQFSKR"
FT   gene            complement(350240..350689)
FT                   /locus_tag="BH0339"
FT   CDS_pept        complement(350240..350689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0339"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16852"
FT                   /db_xref="GOA:B2S046"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S046"
FT                   /protein_id="AAX16852.1"
FT                   /translation="MNRITNNKTIWIKPKYVEKKWYVIDASDKVLGRIATEAVKILRGK
FT                   HKPYYTPHQDLGDNVIIVNASKIRLTGKKYSQKIYYRHSRYPGGLYSDTFRTLSERKPT
FT                   APLEIAIKGMLPKGPLGRELFRNLKVFADSNHTLKAQNLYKLEAN"
FT   gene            complement(350769..351554)
FT                   /locus_tag="BH0340"
FT   CDS_pept        complement(350769..351554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0340"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:BH0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16853"
FT                   /protein_id="AAX16853.1"
FT                   /translation="MCSKSLLSCFPIIKRARFFYLYDIRGNRYLDLYLNGGLNFLGHRV
FT                   QGLNLILKQTFSRGLTASYPSVFRKQFENILFSFFKEAGFVCIFKFERDAREFLLSLTG
FT                   QHCFSKPWEEQLGIYEFRAGFNNFRYPMLVDIPMPGCMSISIAIVDNLSRKIEFRDPLD
FT                   ALTLAVARHMLAKILSYEKSSKINFDIFATPMFKLIGRYMFPIYKSEHHNEVFNEYLKN
FT                   GYLISPSFDIPSLIPLKFSKGDLDGFRKVALRLQDKFGC"
FT   gene            complement(351547..353004)
FT                   /locus_tag="BH0341"
FT   CDS_pept        complement(351547..353004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0341"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16854"
FT                   /db_xref="GOA:B2S048"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S048"
FT                   /protein_id="AAX16854.1"
FT                   /translation="MEYRLLVGLEVHVQLGLKTKAFCGCKNDFGGIPNSRTCPTCLGLP
FT                   GALPSVNKELINSAILAGHATNSKIRNIVKFDRKHYVYPDLPKGYQISQNDAPICNNGF
FT                   IFIETSSGLKKINIVRIHMEEDSGKSLHLLESENRSYIDFNRAGAPLLEIVSEPDINSG
FT                   EEAVAYLNSLREIFRYLDLSDCSMENGSFRCDVNVNLLINENDVEYKTPISEIKNLNSF
FT                   KSIKLAIDYEESRQKEEWILHRKTFESIGKHTMGFDDKRGITVFQRSKETVADYRYIKD
FT                   PDLPLIKLDDVYIESIKSNKMVELPLDTRIRLKEQYGLSNFDVVTLTSDKNLVKYFEEA
FT                   AMTSSDPKRVSNWILSEVLSVLNDREISILDFNLPPSYISELVEFIVSGKVSGKIAKEI
FT                   FLEMLKRNVSPAIIINEKNLEQISDKSFIESVVLEVLNENPKSIELYKKGKSHAIKFMM
FT                   GQIMLKTSGRVNPAFANEILMNKLRDV"
FT   gene            complement(353005..354438)
FT                   /locus_tag="BH0342"
FT   CDS_pept        complement(353005..354438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0342"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16855"
FT                   /protein_id="AAX16855.1"
FT                   /translation="MDFRGLSLIKIRELILTRKCKIYDIVLFYKELYEANKDINGYIEF
FT                   FDDALELAKEYDELLSRGEGQDLPLIGMPIAVKDNISVKNKGLTCASELLQGYISPYDA
FT                   TVIKRLKDNGAILIGRTNMDEFAMGSSCEFSYYGVTLNPLNKEYVVGGSSGGSGAVVAD
FT                   NQAPFALGSDTGGSVRLPASFSGLIGFKPSYGGLSRYGLASYASSLDQIGFFANSIDDV
FT                   ALILKYTCGIDKMDATSIDIIQEPYPLLSNPLAGTKLAVIKELSEDLMEPEIAREFSKF
FT                   KSGLLNRGVEIHEVSIEVVNCILSLYYSVSPVEAASNLARYTCLHYGKRLNDELSLNDF
FT                   YYKHRSLFLKEEVKRRIVLGNYLLSEGYDLQYYAKACKIIENVLVPKFSEIFNNCSYII
FT                   TPTSFVKPFKIGENFDDPMKMYYSDLCTVIANLVGAPALSIPFAQDYRGLPIGMQIIGQ
FT                   VKRDFELLNFAKNVIEELD"
FT   gene            complement(354450..354725)
FT                   /locus_tag="BH0343"
FT   CDS_pept        complement(354450..354725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0343"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16856"
FT                   /protein_id="AAX16856.1"
FT                   /translation="MRDIHLEDSLKLSLLRFSKSEELKFVVKFEKIVGMLNKISEFEIK
FT                   DVIQKKTCDFSDLRNDEVLPSLTIESIKNFSNVFVDGYFSSPKVLE"
FT   gene            complement(354735..356828)
FT                   /locus_tag="BH0344"
FT   CDS_pept        complement(354735..356828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0344"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16857"
FT                   /protein_id="AAX16857.1"
FT                   /translation="MDRIEKFLFSLNSTQKQIVLDDTKNPILVLAGPGSGKTRVITAKI
FT                   THLIKEMKLRPEEILALTFTNKAANEMNFRLNYLFNLNKALHIQTFHSFGAWLLRLYFK
FT                   EFDKNYDSNFTIWDTNDVVRFVKQIGLASTIELAKHVASFILKYKENCFLNNYCDLDEK
FT                   SYADIEFYEQEKSRNNALDFADLILKTVLMLRNCEDIKMRVQRKFKAIFVDEYQDTNYA
FT                   QFLFLKELYCENMHFMVVGDEDQSIYSFRGARVENILEFEKVFNNVSKYYLVQNYRSSL
FT                   SIVNVSNDVISKNRNRYEKVIFTENKMGKKIKFFVFRSPAEEAEYFSNFLLEDELETAV
FT                   LYRFNYQSLQFEKAFLKHNIPHKILGSIRFYERGEIKDVISLLRLFVNKKDKISFLRVI
FT                   NKPARGIGKTTTDKIIAMLNDRDVNFDLILASKRAVENLKGKARDSLVAFLSLYDDLEK
FT                   NIRRDVYINLSEFIKDVAIRAGFWDFYQKFDKDDKFKNIDELISSGVEYSGSFEGLVIF
FT                   LENSSLSPLIHGDSKSSVLLSSIHGVKGLEFDRVIISGLEKGLLPAEIEELTEERIEEE
FT                   RRLFYVAITRAKFELIVTINLQRFFGGMLRNTAMSVFFQDINKDNYDIVFVPEYLKDNF
FT                   KYFFSKSGNKSFNIGDYITYNGEHGLIVDKWYQNGESFIKINLRNGKKAILSPSHIKGL
FT                   SKI"
FT   gene            complement(356828..358027)
FT                   /locus_tag="BH0345"
FT   CDS_pept        complement(356828..358027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0345"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16858"
FT                   /protein_id="AAX16858.1"
FT                   /translation="MERNNFIRFGDFLKKTRIDKGLTLEMISDDIRISVKYLKALEDSN
FT                   IESFPNEVLAVGFLRTYSEYLGVDIWYVSSLFKEYKRRLNSSYIGIKTDDQNGNSNFVN
FT                   EGRLGSKYFDILKIDFSRVIKILVGVMSAILLILLISNFSGFKQFLGRIFKVNHATRRA
FT                   PEMHEVFFDKESFWNVALGDGDFLSLVHGNSIAKYKVSFVNDDLVITNDFQNGRYVFSL
FT                   GKSREIDLNDNIKVKIVYDNCSQGKVRKAHVSLESFMFNVEYVLETNLSSRFNVLNWGF
FT                   EVNGPKSRVINEYPTVYSSQDISNIDLVIRFLNDTFLRYADDDNLYGKSLFVSKGVPLG
FT                   LNFKRSLILFLSRLSDVNIVLQGKDITSILRNYKREIMAVQFFWLKTPGGFDLKVSEVY
FT                   "
FT   gene            complement(358039..358695)
FT                   /locus_tag="BH0346"
FT   CDS_pept        complement(358039..358695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0346"
FT                   /product="periplasmic lipoprotein chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16859"
FT                   /protein_id="AAX16859.1"
FT                   /translation="MKKIILILFPCLIFAQVSANQYFENVYLKYQNVEDIQAKISLNIK
FT                   GLKQTGTLLYKFPDKFIVNLDSNNQVFVSDGEVLTVYVPSLGTSFRQQLTMGKAGSGFM
FT                   NILSTEYSVSYTNSPNLEPLDESGGGGSTENFIKLTFSRRLYRGAATIDSFMIAFTQSG
FT                   AIRRVIAYPTGGGREIIIDFLSVKFNVGIPDSRFKYDLPKTSNKVDNFLYDVKKT"
FT   gene            358858..360273
FT                   /locus_tag="BH0347"
FT   CDS_pept        358858..360273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0347"
FT                   /product="fibronectin-binding protein"
FT                   /note="fibrinogen-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16860"
FT                   /protein_id="AAX16860.1"
FT                   /translation="MSLNYNEINVLLQELPFKNSFLRKIKQPNHKTLVMELYNKEINEK
FT                   NFNVLIALEPKKTRIHKTNKKFANIKPSLRFFEFLKSKVQNGKISEAYQIKNERIILIK
FT                   VLKDKITIFIFIKLWPSSPNIIVTDANFKILDAYYRRPNSKEITGEIFTKVKEIIENND
FT                   ITDKNEVNLKDGYNNELSYSEFIENYYDDLEIKETQAQNIELLKKKYEKEKINLEKKIS
FT                   FLEKQIKSIETIGAQREKGELILLNINKIKKGMDTIILKNHNGEQIKIMLDKALLPQDN
FT                   ALKYFKEYKKNKNALKIIQEQLEHAKTQYDALILNTTCIDSQNCITLANERIKKQKIIQ
FT                   KPSIGLNFISYGFEIVVGRNAKENDELLRSWAKGNDYWLHTRDYPGAYVFIRNKKDKTP
FT                   PLEVLIDAGNLCVFYTKPARQSGEADLYYTNVKHLRRIKGGKKGLVIPNREKNLNIKLD
FT                   PKILNKLKQNLSS"
FT   gene            360376..361809
FT                   /locus_tag="BH0348"
FT   CDS_pept        360376..361809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0348"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:BH0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16861"
FT                   /protein_id="AAX16861.1"
FT                   /translation="MIQKLTKIVATISDLRCDPEHIKELYEAGVNVIRLNTAHQSHDDA
FT                   IKVINNVRQVSNKIALMIDTKGPEVRTANIENPITVKIGDKIIISTSPINESNSLQTNY
FT                   EGFVNEVPNGSKILIDDGELEMIVIEKLADRLICEVKNDGHIKNKKSINTPGIPLKLQS
FT                   VTEKDKGFIELAAKQNIDFIAHSFVRHAKDIQDVKDILNTAGNPDVKIIAKVENQEGID
FT                   NIEEIAKASYGIMVARGDMGVEIPAEDVPLAQIKITKTCIKYGIPVITATQMLHTMIEN
FT                   PRPTRAEVSDVANAILNGTDAIMLSGETAYGKYPLEAVKMMTKIAIEVEKYREKTLFKD
FT                   EIFCSKKIIRNYIIKCAIDATKIMPVKAIIVDSLKGRTARIMATYRASVPLFITTNNER
FT                   IARELSLSYGVYSNLVDHNFKGTTEFVVTSLEMLKTQGIVKDSDIVVIISGNPNRATNK
FT                   GTEFMEINTVEDAIKERNL"
FT   gene            361827..362567
FT                   /locus_tag="BH0349"
FT   CDS_pept        361827..362567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16862"
FT                   /protein_id="AAX16862.1"
FT                   /translation="MVDNIFYSTNTCNPELFNLNKRKTHKALLTSYGAYEFFLSNINLF
FT                   QKVIAHNTKNVFIFSQTKENSQINISDHKSWKFFNKIIDVNLDIINLIKNFEFTSIENK
FT                   IIENDHKIEIVLNFIKDITQDIKIIPIILGKLKNQTLREFSTFLKPFTTKKENSFIFLS
FT                   HFISRSTNLNKAIQLATTLKELLNRPNLNPSTLLEYYNARKILPENIDAIILICKLFQK
FT                   FEFTNHNIVNNNNEHSIIENVLIN"
FT   gene            complement(362587..362865)
FT                   /locus_tag="BH0350"
FT   CDS_pept        complement(362587..362865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0350"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16863"
FT                   /db_xref="GOA:B2S057"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S057"
FT                   /protein_id="AAX16863.1"
FT                   /translation="MGRECEITGKRTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVN
FT                   LINKKFFIPELGKSVNIKISASALRSISKVGLSVFLKKNCKKIEDFI"
FT   gene            complement(362876..364435)
FT                   /locus_tag="BH0351"
FT   CDS_pept        complement(362876..364435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16864"
FT                   /protein_id="AAX16864.1"
FT                   /translation="MGLVDFLVSIFSRELTPEQVKQRRLREVKNNLSKVSSFFNASKIQ
FT                   ALPQFAKFIYNLYKTFIPFKFFVQRYRSSNKIIHFVVEKYLSDSQRQALEYIWSFSAND
FT                   VVNFTPDIPKNLDNNLNYLLKNITQEQIRLIDETCGALDIFFDLVSFQYYSIIKNFDSL
FT                   FPEGDFVYKPRFSAVSCGVILDDIKDFLECIYSIRDISIWRNLYDILLEVYGDRDNFPL
FT                   KPNVWLKTLTSIIEINKTKEILYLIKYVSGDPDYLPISGVKKSKIKAKVFFNDLSKHVS
FT                   NEIAKIEIFQKNSKSKLLAEKLFHGITLVSLDNYNECMNTKITSNIVNTTGYVYSDLLG
FT                   YLKTHAVNFVKKDLSDIINILIIKGQWKDMEVSRDISNDIHSLVGTYSNLIDFDNNLGE
FT                   QGTYGNRVNALLHRASVGDKSSEKLLLSIIADINKKALVILNEYYSKVSSLRRRLNDCL
FT                   EDYVKPSSEKELVYNWKELDIDLVKSYGNNVNFGNIIKNVVDSLNLFLKLMDLYLEKKS
FT                   TV"
FT   gene            364560..365675
FT                   /locus_tag="BH0352"
FT   CDS_pept        364560..365675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16865"
FT                   /protein_id="AAX16865.1"
FT                   /translation="MCIKNPILIIVFTLIFSCSKNDTITILTDNKIIPFYINQFNIQNK
FT                   ASFIIKYKEHINIQTANEENAQVIISKNIDNINITKNFKNIKKYYYSDYPILNNISEKF
FT                   AHKIVPLSFDVPILIYKNEYNIQKYIDIQNIKEIHKSFQKEKKIFISPYISENLFYTLS
FT                   EINDINFYFGNNKPEYDDTKMSDMINHFKSFIDTNALVLHKNFAEKYKYLDLEKILLQK
FT                   KTILIAGLTNLTYYNSLNKDTRDKINFSYLTNKGKKTSVCNINFMGVKEISKPIEKFIQ
FT                   WILNQEIQKSLIKFKDKTKFNEHFGFANGFTPYKSLNLKLKHIIKEIPSFIIDENYINK
FT                   ESYILNKKQIEKENHMLNELFLSHINNTEPK"
FT   gene            complement(365679..367481)
FT                   /locus_tag="BH0353"
FT   CDS_pept        complement(365679..367481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16866"
FT                   /protein_id="AAX16866.1"
FT                   /translation="MLDMKRELYTFLSNFFIFLFLFIGLIFCYTYFFGANYLEKHTLIA
FT                   TFFDTVLSVYHYFNGFFIFFVLVYFIFLAKHETRLYLREYKGYLFKKLYPFMFLFFVIG
FT                   LIFMFIFNSIMSYILAQRSEYNYNYERYNLLAGQTNTIVNELKSIDMNLFSNKTLDVNE
FT                   LIEVLKQKKKYLEELLRMYEKMRLISDNDELSINYYLARSEYDRMPIYDVDLEKVRKTV
FT                   KMYLIKNLTKKDFQDIVNGFIDKGDYSTANYFAYVGFVSTKDDEFSALLDLTFKAINEY
FT                   KNIESEKKSSVFEEKQKNFLYLNTEKFKPAYYGFLKLHNLFPNDSEILSYKNKSLEKLK
FT                   DEYFFFDEIEKYYEHYGINDVFLFQPNSSNETYDYIYMQKVVNTVSSYIKMIKNFELIR
FT                   FNGSGNVILHIKVPFATLKGNRVYQNVLDKKNENSDITATKIIVSLTDFDLSNTNIIDI
FT                   NKNVNNLRLFANSGKGGVFLPIQVLLSAFNQVGMFNLRLISVFSSSLFLMMSPILLVFL
FT                   GVLFIAVASRANFEFDSKFMVFLISLIIAIFSGIISLFINYLLLILIALFIQLFVNIYV
FT                   SFILIFSILFFIVLHVMRVTYKEV"
FT   gene            complement(367488..368429)
FT                   /locus_tag="BH0354"
FT   CDS_pept        complement(367488..368429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16867"
FT                   /protein_id="AAX16867.1"
FT                   /translation="MLSVLRFIFLISCRFISVFFMFSLIFICTSYLKYKFLHANLSIVS
FT                   FELYYDAYLYAFPLSLVATFMRIAYPFNIKTFRIKRILYGVVFIFILLLSYFGFLASAN
FT                   FNSVFLDFHSKNEKMIKDGVVHFFDDKIVFYGNDVKSFGFKGVLKVEDNGFDDGDFKTF
FT                   SYDLDFSKSDIMNFNTSAFFIQKLYNNLISNVFNDLDTLNNFLLSLESFSLILNIFGFA
FT                   LLLFSFSYVFNLIFSSGLSLFLYPVFIILFFKLHNIYAIKFPESLDLIMGENVVSNYVP
FT                   FIFCVLTFFSTYFISFISEYIRISKGFDNSLH"
FT   gene            complement(368457..368942)
FT                   /locus_tag="BH0355"
FT   CDS_pept        complement(368457..368942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0355"
FT                   /product="CarD-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16868"
FT                   /protein_id="AAX16868.1"
FT                   /translation="MTFVLDQAVVYPMQGVGKIKNIQNKEFNGEFIDYYEIYFPFNEMT
FT                   FMVPVSRADDLGIRALVSREKVEEVFDIMKDFEGQIDQKKIKDGSHDFYKQSDILSTAK
FT                   LYKFLYTKSMQKELPFYEKRILNDFELILQHEISLALQISFEEAKQKIKEVLSTGKS"
FT   gene            complement(368990..369583)
FT                   /locus_tag="BH0356"
FT   CDS_pept        complement(368990..369583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16869"
FT                   /protein_id="AAX16869.1"
FT                   /translation="MANLKDIYSKPDRIYFLGVPIDVFKSSDKLISRFEYLVSHPYHSM
FT                   VIFIDCKSLLKFLIFKRFRNLVKSASLVFSNSKLLRSLCKFFKRVDIGYYDSNSILLVS
FT                   MSVLENTYKTCYIIDKDKIISKRNFLRLKESHKEINFIGYYDLKAVKRNKEMFFANINK
FT                   LTPSMIISFCSNTYLENLFYVNKFGIRTNLSVFL"
FT   gene            complement(369576..370304)
FT                   /locus_tag="BH0358"
FT   CDS_pept        complement(369576..370304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0358"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16870"
FT                   /protein_id="AAX16870.1"
FT                   /translation="MKQIVLDDSCLFDNDIIIDDVKIYHYLVDVRRVKLGDTLNVLLRG
FT                   REIRFAEIIGINNNLIRLSTLKIEKLKTRDFEISMFISNLKGRKLDLSLRQIVEIGVDQ
FT                   INIVNADNSVARIEMDDLKFKSSRFAKLIDEALKQSGNTQVPSINFYRNFFSIPYSPSV
FT                   SYYVAHKDGVLLSCGNDISASGKIGILIGPEGCFSKSEIDFFKKLNFQFVRFNTPILRA
FT                   DTAIVYSLVHFKLLLEGNNG"
FT   gene            complement(370308..371738)
FT                   /locus_tag="BH0359"
FT   CDS_pept        complement(370308..371738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0359"
FT                   /product="carboxy-terminal processing protease precursor"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:BH0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16871"
FT                   /protein_id="AAX16871.1"
FT                   /translation="MRKKFLVFAYFVLALSISSSVIVESIFAQSDSSKGKMSASSYGQM
FT                   MMEAFNFIKRNYVEPVDDEAIFEGALKGMFKALNDPYSQYLTKEDLVEISKTTEGNYVG
FT                   IGVSIVKKNVPVKSDSSISDASYVMIVTAFEEGPAYKAGVKSGDYITAIDGKSTTLMTI
FT                   EQVGDLLRGKAGTKVKISVLRDKDLKLEFELVREKVDIQTVKHDVINRDVGYIKILSFN
FT                   PNTNLFFKKAFEKLQSQNIKSLILDLRFNTGGYLQDAIEIADDILAEGIIVSTRARDSK
FT                   VPMEYKASSSHIVPLDMPIVVLIDKHSASASEVLVGALKDNERVYVIGEKSYGKGVIQR
FT                   ILPFYTGGFKITNSKYYTPSGNSIHNIGIKPDLEIGEREFSETEVLAYRQIFDKKLVEN
FT                   FLNGRKNKKSITEEEIDAFVDKVIKEHSIQNIDKDILGHHVFLQFYQDTHSEMPIYNLH
FT                   YDKPLRAAYEYLVKETKN"
FT   gene            371799..372230
FT                   /locus_tag="BH0360"
FT   CDS_pept        371799..372230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16872"
FT                   /protein_id="AAX16872.1"
FT                   /translation="MLKTNNSKTKGIITGLVLILQTIASTLILSALYGFAENTMIVNNS
FT                   SIKFMIAFIIFSPELCVLILTTHYMLYDQFKILHNLITITKTFQIAMSILLIILGLGLD
FT                   LLYVYQPWLLILLGTIIITYTIFNAVILILIRAKDKITG"
FT   gene            372235..373368
FT                   /locus_tag="BH0361"
FT   CDS_pept        372235..373368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0361"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16873"
FT                   /protein_id="AAX16873.1"
FT                   /translation="MIIIPVASGKGGVGKSLFSTNIAICLANEGKKVLLVDLDLGGSNL
FT                   HSMLNIIPKKSIGTFLKTKISFKDIIIESGIKNLSFIAGDSDIPELANIAIFQKKKIIN
FT                   NLKHLNYDYLIIDLGAGTTFNTIDFFLMSNRGVIVTIPTVTATMNAYLFLKNAIFRLMS
FT                   KVFTKETKAYKLISDIKKDSSDLQKIYIPNLLLKIETYAPEDYEKFMKIFSQFSPFIIF
FT                   NMLNKPDDIKKTERILKSAKNYLNINLQSIGSIYKDELIDKALNHKIPITVYKPTSLAS
FT                   KSIKKIAKKLIELESVINDVELLSEDDLNESYHFVIKEAQDEYLEKYAYLESLLMNKTI
FT                   DDNAIIDIIKSQQKEIATLRKQNMMLKKKLFAQLKKD"
FT   gene            373379..374338
FT                   /locus_tag="BH0362"
FT   CDS_pept        373379..374338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0362"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16874"
FT                   /protein_id="AAX16874.1"
FT                   /translation="MPNYINYPSWLHPEIIKGIPITWYSLSYIIVIIICYKFIWYQIKA
FT                   DKLDIKQSDYEKLMFSIVMGAIIGARLTSTLIYDRSGIYYTHPWLIFLPFDRNWNFTGF
FT                   RGMAIHGGFFGVIIAPLIMTNTKLKNTNIKKYFRKITDYGSLAFSSGYILGRFANFANA
FT                   ELYGRPMKGGIIFPNAEPFKVNQSGVKEFAESVGLEIAPHDLFVNLPRIPSQLIEGLFE
FT                   GTVTFLLLWFIFRKIKKYDGFLFGVYIILYGLFRFLIEYLREPDKEIGFVITYKKPESI
FT                   LDFSFLNISMGQIFSLILILSGIIWLAWARTRPEKLKK"
FT   gene            374390..376381
FT                   /locus_tag="BH0363"
FT   CDS_pept        374390..376381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0363"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16875"
FT                   /protein_id="AAX16875.1"
FT                   /translation="MKNPNAIVISEGAISNDDITKIKSIFKILQIIKSRKNISKEYIKQ
FT                   SNIKFAIIYNHKRPIDFSINIANDLKSINNVHSIIINNKSIDKAMYRPNYIEILNNISE
FT                   LSDKHKLIQQKKLYYDNNNANLDFFLNLSELIQEIVIITNTDNDIIYINEKGSKELELP
FT                   IKIRGKTNKISDINIIDLEKETKIDLSYNINNIPEFKNILITDCLLKVKNNKKLIVDLF
FT                   ISTIAQNNIDKLITIKDISDLKSKNNIQDLEIIDQQTDLYNIKGLEKLLINQIESSHKK
FT                   IYLFDLDLHINTEYEYKGNKDNLDSKILKKITSRIMSFYSEYIFRLKDNNLIVIISTSG
FT                   GEQRIISIAEEIKKTISRELSKEGIIIFKLNIGIIEVNLKEDIETKISKLKIATKISDE
FT                   YKDSTPILYKDELPETILIKNQNKIFEYIVKAIKNDFFSLYYQKITPLKKDLKPKIEIL
FT                   TRLFDYTGTPIPNDNVFSLIDKYNLTVEVDKLVVTKTLREYTNFVAKNGVHIFSINISP
FT                   YSLKSKNFRMFLKETLLKSHVPLQNICLEITETGILENFELIKTYFNELKTFGVKLALD
FT                   DFGSGYTSLSYIKILPIDIIKIDGSFIQVINSSQIDLVIIKSIKDIADTKNIKIIAEFV
FT                   SNEEILKKINEIGIDYGQGFLWHKPEPI"
FT   gene            376542..377918
FT                   /locus_tag="BH0366"
FT   CDS_pept        376542..377918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0366"
FT                   /product="probable M18-family aminopeptidase 1"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16876"
FT                   /protein_id="AAX16876.1"
FT                   /translation="MTKQNPWVSLNEKERNNVLEFAQKYKKFLSTVKTEREATNYAIQK
FT                   AKEKGFINACEKQEFKAGDKIFYTCRNKNIALIFIGREPIENGMNFIVSHTDSPRLDAK
FT                   PSPIAEENEFTMMKTNYYGGIKKYQWLSLPLSIRGVIFLQNGEKVEINIGDDNNDPVFV
FT                   IPDILPHLDRKVQRDKKADDIIEGENLKIIIGSLPIDTKEKEKVKFATLKLIKEKYKIE
FT                   EEDFVSAEIEIVPAGEAKDVGFDRALIGAYGQDDRVCVYTSLEAILNLEETPSKTAVCF
FT                   LVDKEEIGSTGSTGLNSRYLEYFVSDIIFKLKEDKYNNLLVQKVLWNSKSISADVCGAI
FT                   NPLFKSVHDEQNAPKLGYGIPIMKYTGHGGKIMASDSDAELVSYIRNLLNKNNIAWQVA
FT                   TLGKVDEGGGGTVAKFLAHYGIRTIDMGPGVISMHSPFEITSKFDIYTSYMAYKAFFEG
FT                   "
FT   gene            377923..378186
FT                   /locus_tag="BH0367"
FT   CDS_pept        377923..378186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16877"
FT                   /protein_id="AAX16877.1"
FT                   /translation="MNKETIKTSEHILECFGGIANIKQVNKDLTRIKILVDSNSLVKRE
FT                   NLTDDRNIIGAIKSNEFTEIVMNFEIIDDVYSNIIYMMNKQT"
FT   gene            complement(378205..379257)
FT                   /locus_tag="BH0368"
FT   CDS_pept        complement(378205..379257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0368"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:BH0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16878"
FT                   /protein_id="AAX16878.1"
FT                   /translation="MKISIVGAGAWGTAISKVLADKFKDNVFIWSFEEDVRDSINNDHE
FT                   NVKYLKDIKLPDNLIASSDLLDVVSQSDYVFVATPSLYTLNVFNKLKSMYATKKFNLAI
FT                   LTKGFITIDGKPCPIVEVAESVLREYKDEITYIAGPSHAEEVGLGVITGLVAASKNRAN
FT                   AFEFIDLFSATSISMFYSDDVLGVQIASALKNIFAIAFGILDEIKIKDPNLIGNNTESF
FT                   LFSVSLNDMRNIAFKLGACNEGTFLFLAGSGDLDVTCRSIFGRNRRFGREIISKNILEG
FT                   LTDIDDLINNIHKIGYLPEGIVASKEVSVLLKYLGNNSNEHNLVNIVYKILNKELKPEA
FT                   VVDYIRNFKF"
FT   gene            complement(379282..381567)
FT                   /locus_tag="BH0369"
FT   CDS_pept        complement(379282..381567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0369"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16879"
FT                   /protein_id="AAX16879.1"
FT                   /translation="MYNRRALNNLFFKSFLFFMERKHLVFTEEHIFYSLISSEKIKELL
FT                   SLCTLDFYNFNKILEGFFKQLPLRESDISDYLFKMNDLYQEIIDTICYYKKPYRLQEKD
FT                   LLWVLVRKRKNTILDALLKSGFNLTIFDKIIEVYDYLGSDLDLSSLENEKLVESDLFNK
FT                   GIDRDGGLSIFEEDYFKLEQSDDSLDDNNVEDFLVNVIDSLDPNLEKNPLIGRKKELCK
FT                   LIQVMLRKHKSNPIVFGEPGVGKTILLQGLAYMIKAGQVPQELAGYEVYSLDIGRLISG
FT                   TRYRGDLEDRVNKLLDFLYFKKKVILFIDEIHMIVGAGATSFSNIDVSNLLKPILTLGE
FT                   VKFIGATTKYEYQKFFLKDKALIRRFHSIELREPSFEDTYIILKGAKEQYEKHHNVEYT
FT                   DEAIWASITMSKYMKDRFLPDKAFDLLDGLGAKFKLEGNRKVITADDVRDFVKSMIGTN
FT                   IFNFDAYDQDLMINLEHKIRESMIIDEEILSDLILHIKLLRIKFLFKNNTLGIFILMGS
FT                   SDVDKNKLSGILSEELKIPKLTLGVSEYGDFDGINRLIGPVYGSESYDEFTTFFKFLSK
FT                   SSSSIIFLSDFDKSSKRVIEFFFEGFNTGRLFDSLGRSVSLSDSIILIDINIEYRELAS
FT                   IGFKNETLNGRSLLEKRFSSQFLDLVDHIFFFRPVGESDFEKAIIEEMNNFVKILKNEK
FT                   IDVFFEENIVDYFQNKTYGSGLGIKSVSKIVVKEIGSLLVNDMISKKFKENDKIRVYID
FT                   ETMKYELL"
FT   gene            complement(381578..382798)
FT                   /locus_tag="BH0370"
FT   CDS_pept        complement(381578..382798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0370"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16880"
FT                   /db_xref="GOA:B2S074"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S074"
FT                   /protein_id="AAX16880.1"
FT                   /translation="MNLALGILEKRGFLKQCTNLEALSVLMDREKMVFYVGVDATSTSL
FT                   HIGHLIPFMAMAHLQRQGHIPIALVGGGTTKIGDPSGKDVMRKILPKEDIEANVKAIKE
FT                   QLLRIIDFSHGYIIDNSEWLDNINYIEFLRDIGVYFSVNRMLGFETYKRRLKDGLSFIE
FT                   FNYQLLQSYDFYMLNKLKNCKLQIGGDDQWGNIVSGVDLVKRKLGTEVFGLTLPLITRS
FT                   DGKKMGKSEKGAVYLDSKLYSVYDFYQYFRNVPDLDVKKFLYLFTFLEDDEIEHISSFQ
FT                   GYLLNKAKETLAFEITKIVHGESAALKASSAASAAFKGGEGDKSDIPFFKLALTSLEGT
FT                   ILLVDLMVSSKIVSSKSEARRLISSGGVYVDKVRIGDQNYCLNKDSFANGAIELRIGKK
FT                   KILRIIL"
FT   gene            complement(382795..384132)
FT                   /locus_tag="BH0371"
FT   CDS_pept        complement(382795..384132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0371"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:BH0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16881"
FT                   /db_xref="GOA:B2S075"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S075"
FT                   /protein_id="AAX16881.1"
FT                   /translation="MIRIEDIISLAKRKGFVFQSSEVYGGLSGVWDYGPLGIELKQNIQ
FT                   KEWWKNMVYSHENVVGLDSSILMRSEVWTASGHVESFAELLVDCKNCKNRFKIDSIDFS
FT                   KGCPNCNSMGTFTDPRSFDLMFKTNIGAVEDSSNEIYLRPETAQGIFVNFRNVLDSTRL
FT                   KVPFGIAQVGKAFRNEIVAKNFIFRTCEFEQMEMQFFVHPNQMDDWYYYWQQKRLNFFI
FT                   EILGIKSDNLRFKEHKGDELAHYAKAAIDIEYKFPFGFQEIEGIHNRGNYDLSQHAKFC
FT                   GKPKLFEYHDLISGDRYIPYVIETSLGLTRSVLMTLCDAYAHEELEGGDKRIVLRLHPK
FT                   IAPYKVAILPLVKKDGLPELARKVFMQFSDDFYMFYDDNGTIGKRYRRQDEIGTPYCVT
FT                   VDYDSIENKTVTLRHRDTMTQVRIPINDLYSYVRTEILNYKGVSDR"
FT   gene            complement(384156..385631)
FT                   /locus_tag="BH0372"
FT   CDS_pept        complement(384156..385631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0372"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BH0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16882"
FT                   /db_xref="GOA:B2S076"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S076"
FT                   /protein_id="AAX16882.1"
FT                   /translation="MNIRVRYAPSPTGLQHIGGIRTALFNYFFARSCGGKFLLRIEDTD
FT                   QSRYFQEAEEDLYQSLKWLGIDFDEGPTCGGPYEPYVQSKRTAIYQKYAKQLIELGNAY
FT                   YCYCKPDRLERIRKIQTVNKMAPGYDRHCRNLSESEIKDVLSLGITPVIRFKIPLDGET
FT                   CFNDILLDKVTWANKDISPDPVILKSDGLPTYHLANVVDDHLMEISHVLRAQEWVSSGP
FT                   LHVLLYNAFGWKPPIYCHLPMVMGSDGQKLSKRHGATALKQFIADGYLPEAIINYITLL
FT                   GWSYDDKSEFFTKNELQRLFSIERVNKSPAVFDYNKLDFFNSHYIREKGDDELAKLLIP
FT                   FLQKAGYIKEDINSCDEQKLMLLIPLIKPRIRKLSEAVTMLKFFYEDIKTWNLDEFLGK
FT                   KKTASDIYLLLEKIKPVLEDFETRMLPDNEKIFYNFAKENNLKIGEVLLPIRIAVLGSK
FT                   VSPPLFDSLQLLGKVKVFDRISQAQQFLKRHEL"
FT   gene            complement(385644..386579)
FT                   /locus_tag="BH0373"
FT   CDS_pept        complement(385644..386579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16884"
FT                   /protein_id="AAX16884.1"
FT                   /translation="MIGYQSFAFCSLGSKLSNKRVLAYYLLIVYLFSIILHVYINFKIE
FT                   LYYKRFLMVDRILFIFNIVFFGIFLCFIYLLEILKFSNFLDFIVLHAQVLLTFIIFIFI
FT                   FNIVYSKLLYSRLYFILNGVEHTYTFLKLKMIRKTLKSVFDISLLLKIILIKQDKKSLD
FT                   EIYFYLKDTKMSNKTIIELYSICISFREKEKASSLIVNHAGSENKWIRYCVALNTISDK
FT                   EYGKLIDEINFLKKYFLRGDPIFTLYFYYVLRKSNLEYQLIEKNRLEIRGKYFKYKDRL
FT                   NVKHTKLLNSNLFFIVFYYIYDISKKDIFY"
FT   gene            386555..387694
FT                   /locus_tag="BH0374"
FT   CDS_pept        386555..387694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0374"
FT                   /product="sensory transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16883"
FT                   /protein_id="AAX16883.1"
FT                   /translation="MQSFDNLSKDIKNFSYIIDKDFLVWPKNSLLNPINTELIEKWGLK
FT                   NALKLQRTFFDETLIRETKKLINIEYDEESIANYHILISNLEEVYETCKKNKKIYYQDV
FT                   LPTIKKVMEFYKKNQQTFIKYMKVPKLLSDYHVVHSINTAILTVALGNEMNLNNHKTVE
FT                   LCTIALLHKIGFLFIPLRISEKKEKLSDEEFQVIKKYPILGYKILSTTNFSQSICLAIL
FT                   THKENLDGSGYPNKLKSEKINIESNIIGAASAYSAILLEKTYKGALNSGASLIELIQDA
FT                   DRKFDKRVLKLIIKVLSQCPLDFIVELNDNSIAKIIKINEINVNVPYIKYIIKDGKIVP
FT                   PSENQNYVKSIPKTETGVKKILRQDEIEFILKKYGLKEM"
FT   gene            387707..388420
FT                   /locus_tag="BH0375"
FT   CDS_pept        387707..388420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0375"
FT                   /product="5'-methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16885"
FT                   /protein_id="AAX16885.1"
FT                   /translation="MILITSAMDEESTEINKIIENKEEVILDEYSGGKKIYKGEIAGHK
FT                   VISLTTGIGKVNAAMWNSYIISRYKITHIINSGTAGGIKESTNLKITDIIVSSETAFHD
FT                   FNLTKFGHKIGQVPGFPQKFKADENLLSKIINITQDKFKNINVHIGLILTGDQFIGDEK
FT                   QLEEIKNNFADALAVEMESAAVAQVAYTFKIPFIIIRSISDLLNIKDNHIDFNKFLQDA
FT                   SMNSAKMVRELIKLI"
FT   gene            388442..389611
FT                   /locus_tag="BH0376"
FT   CDS_pept        388442..389611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0376"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BH0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16886"
FT                   /protein_id="AAX16886.1"
FT                   /translation="MLNNNLTSTSEAVSEGHPDKIADQISDAILDEILKRDKMAKVACE
FT                   TLVSQNLVVIAGEINSKAKKDIDIKEIAKQTIKNIGYTNIEYGLDYKSATIIDAIGSQS
FT                   IDITNAVDKKDTKDIGAGDQGIIFGYACNETENFLPIAYELSNLILQKASELRKSGEIK
FT                   WLRPDAKSQVTIEYDSNKNPIRINNIVVSHQHDPDIPQDFLRQTIIEKIIKPTLQSKSM
FT                   LDENIKYYINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSA
FT                   AYISRYIAKNMVAAGISKEFEMQLAYAIGIPNPVSIKITTGINDHEYEKKILSFIINNF
FT                   DLTPNGIIKKLKLREPIYSKTCIYGHFGKNELEWEKLDFVDIIKKEFKI"
FT   gene            389608..390081
FT                   /locus_tag="BH0377"
FT   CDS_pept        389608..390081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0377"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /EC_number="3.13.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16887"
FT                   /protein_id="AAX16887.1"
FT                   /translation="MNKISSFTIDHTKLKPGIYISRKDIFENLTCTTVDIRMKAPNREP
FT                   VINNAEMHTIEHIGATLLRNNKVWGDKILYFGPMGCRTGFYLILLGNYESKDLIDLISW
FT                   LFHEITNFQGNVTGATEKECGNYQDHNLNMAKYESNRYLTTLTNIKEENLTYP"
FT   gene            complement(390240..390671)
FT                   /locus_tag="BH0379"
FT   CDS_pept        complement(390240..390671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0379"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /EC_number="3.6.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BH0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16888"
FT                   /protein_id="AAX16888.1"
FT                   /translation="MEKILSDCIFCKIVKNEMSCYKVYEDELVLAFLDINPLNIGHTLV
FT                   IPKQHSNDALGMSDEINGQILKVCKRIALSLKKLDLNICKGVNIYSAIGSDAGQVIFHT
FT                   HFHVIPRFRGDNLGFKRGSNIELSGDELLDLSEKISQNI"
FT   gene            complement(390720..392081)
FT                   /locus_tag="BH0380"
FT   CDS_pept        complement(390720..392081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0380"
FT                   /product="Mg2+ transporter MgtE"
FT                   /db_xref="EnsemblGenomes-Gn:BH0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16889"
FT                   /protein_id="AAX16889.1"
FT                   /translation="MIDVVFLKTLLEEKKYSDIKEELLRYDAFDISEALKKLNGSDLIL
FT                   LYRFLPKKVAVEAFSNFDQVTKNKLANSFTNREIREMIDELNLDDVIDLLEEVPANVVQ
FT                   RFLASSTEENREIINKFLSYSDDSAGSIVTIEYIELKDYFRVGEALDYIRKVAKTKEDI
FT                   YTYYITDEEKRLKGVVKIEDLMLSSDDVIISAIMKNSGFYIVKVSDEKEDVALLFQNHD
FT                   ISSVPVVDNEGRMIGVIIIDDILEVIQNLNTEDFQIMAAVTPLGKSYLDTSIFDMTKNR
FT                   IIWLLVLMISSTLTATIITNYQNLVLSLVILTSFIPLLMDTSGNAGSQASALIIRELAL
FT                   GTLKVRDFLKVLLKEVCVSVLVGSILASINFLRIIFFVIPEHNERFRIAFVVSACLMIG
FT                   LMVAKILGGLLPILAKFVKIDPALMAGPLITTIADVITLIAYFNIAKLVLANYF"
FT   gene            complement(392136..393560)
FT                   /locus_tag="BH0381"
FT   CDS_pept        complement(392136..393560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0381"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16890"
FT                   /protein_id="AAX16890.1"
FT                   /translation="MNKNVFPKIYYYDQDFIDIYNKSLSWIRDKIVFSQALEKGRKDKN
FT                   YYSENLEFIDQLQACLSSFFLVYSNGEYSPTSTIDKFYELQEASGAIRARYDHNNNVVH
FT                   MEGNDDGIGLPIFAWVEYNLYHKTGNKRRICDVLPVLSKYYKWIEKKFLKSNGLYSIDM
FT                   NKIFYKNSPRKDAYYPIDFNSFQVHSAYCIAKLADILNDKNLSLEYKKRYFSLKAKINS
FT                   LMWDEKDGFYYDLDINENIVRCKTIVGFLPLLSEIPSEDRIERMIFYLKSHEHFGTPNP
FT                   FPTLSANDPGFNSDGNGYYGSVYTYMNFFVIKGLEYCGRANIAREFTIRHLYYILDTLL
FT                   PDSKVKGHIWEAYKPMKEGPAYLDVEQKLLPEKDVICYLALFSISLMIENIIGLTISLP
FT                   DKTVYWNIPALEVMGIESLSLKKNRTTIICNKGKRGWEIKMESEKLYYFTINILNKKEK
FT                   TLPIPSGRCSMLLDKL"
FT   gene            complement(393841..394851)
FT                   /locus_tag="BH0382"
FT   CDS_pept        complement(393841..394851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0382"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16891"
FT                   /protein_id="AAX16891.1"
FT                   /translation="MKNLFLILCILCFSCSGSKAGSGLTKIAILVDGTFDDESFNGSAW
FT                   KGAKKVEKEFGLEIMMKESNANSYLADLESLKNNGSNFLWLIGYKFSDFAIIAALENPE
FT                   SKYVIIDPVYESDLVIPENLSAITFRTEEGAFLVGYIAAKMSKTGKIGFLGGFDDVVVN
FT                   TFRYGYEAGAIYANKHINIDNKYIGNFVNTETGKNMANAMYAEGVDIIYHVAGLAGLGV
FT                   IESARDLGDGHYVIGVDQDQSHLAPDNVITSSIKDIGRVLNIMISNYLKTNAFEGGQVL
FT                   SYGLKEGFLDFVKNPKMISFELEKELDDLSEGIINGKIIVPNNERTYNQFMRKIL"
FT   gene            complement(394886..395956)
FT                   /locus_tag="BH0383"
FT   CDS_pept        complement(394886..395956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0383"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16892"
FT                   /protein_id="AAX16892.1"
FT                   /translation="MSKNLCFIILFSLLFVSCFSSKKSSSVAVDSRIVMGIMAPGDFND
FT                   KGYLQNALDGAVNIRNEFKIKLIPKVLTPYPVEGKRLMTADEVLAEDVYALQKDGVNFI
FT                   WFISAHFSEPALRFAYENPNIFYGIIDPFNYVNVQLPKNLLAINFKSEEGAFLAGYLAA
FT                   KMSKSNRIGFLTGVDVGYVERFVIGFRAGAFYANPKTKVILKRILDELSNDTGKEVAEH
FT                   MYVAEGIDIIFPVMGPALLGVFTVAKELGPGHYVIGVNKDMAHLAPGHVITSVIKDVGK
FT                   AIYNFSLDAVKSNRFNGGRMIERGMKEGVIDIIKDPNIIDNDLIDVITKIQTAIVNGEL
FT                   IIPSTEHEFDLFKARL"
FT   gene            complement(396112..397146)
FT                   /locus_tag="BH0384"
FT   CDS_pept        complement(396112..397146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0384"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16893"
FT                   /protein_id="AAX16893.1"
FT                   /translation="MNKYIVFIFVVLAFLGCNKKSSVSKSLENPVISLIVDGTFDDKSF
FT                   GEDAWKGAQILEKDFGVEIVGKTSTISAYASDLDSLKDKSSSIIWGVGFKLQDAIERAA
FT                   ALNRDINYGVIDVIYEDNVSLPDNLLGLSFKVEEASFLAGYLAAKTSKTGKIGFIGGMN
FT                   GVVVNSFKCGYEAGAKYANKNIELNSQYVGSFSDLSLGRSMASKMYASGIDIIFAAAGL
FT                   AGLGAIEVAKELGAGHYIIGVDQDQSYLAPDNVLTSVVKNVGNSLYEITKNYLNTNDFD
FT                   GGKILKFGLKDGAVGIVKHDSKIKDYIKVEIETIEDKIVRDDILVPSNLDEYNKFLDMN
FT                   NLLN"
FT   gene            complement(397171..398190)
FT                   /locus_tag="BH0385"
FT   CDS_pept        complement(397171..398190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0385"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16894"
FT                   /protein_id="AAX16894.1"
FT                   /translation="MLKKVVLLFLILGCSGSQDKIPVSNTISVIVDGTFDDRGFNENSS
FT                   KAMTQLKEESRVNIIQKESKASDYLSDIGGLEESGASLIWGVGFRFTDAFLQKSLENSD
FT                   VNYGIIEGSYAEDIELPKNLVNVNFRSEEGAFLAGYLAAKISKTGKIGFLGGIEGVVLS
FT                   SFRYGYEAGAKYANKDIELNSQYVGSFSDLSLGRSMASKMYASGIDIIFAAAGLAGLGA
FT                   IEVAKELGAGHYIIGVDQDQSYLAPDNILVSYVKRIDIVMLDLTSSYLEIGKWNGGYNL
FT                   EFGLKDGALDLIFNKSINLIKDYDFLSEIKDKIMNNEIEVPKDEKSYGNFIVNLLHKS"
FT   gene            complement(398276..398749)
FT                   /locus_tag="BH0386"
FT   CDS_pept        complement(398276..398749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0386"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16895"
FT                   /db_xref="GOA:B2S089"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S089"
FT                   /protein_id="AAX16895.1"
FT                   /translation="MSRKSKKIKKKVFKDSKYNSQVIAKFVNRMMFDGKKSISETIVYN
FT                   SIDMLAEKIEEVDKIAAFNKALDNVKPLVEVRSRRVGGATYQVPVEVREERREALAMKW
FT                   IISAARKASGKSMQEKLANEFVNSYNSTGAAFKKREDTHRMAEANRAFTHYRW"
FT   gene            complement(398764..399138)
FT                   /locus_tag="BH0387"
FT   CDS_pept        complement(398764..399138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0387"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16896"
FT                   /db_xref="GOA:B2S090"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S090"
FT                   /protein_id="AAX16896.1"
FT                   /translation="MPTINQLIKKPRKSQKEKTASPALQNCPQRRGICTRVMTVTPKKP
FT                   NSALRKVARVRLSNGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGAKDT
FT                   LGVNNRKQGRSKYGTKKPKA"
FT   gene            complement(399201..403334)
FT                   /locus_tag="BH0388"
FT   CDS_pept        complement(399201..403334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0388"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BH0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16897"
FT                   /db_xref="GOA:B2S091"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S091"
FT                   /protein_id="AAX16897.1"
FT                   /translation="MKEIKDFEKIRIKIASRDQIRSWSYGEVKKSETINYRTLRPEKDG
FT                   LFCERIFGTTKEWECYCGKFKSIRYKGIICDRCNVEVTHFKVRRERMGHIELSAPVAHI
FT                   WYYKYIPSRIGLLLDITASNLNSILYYEKYIVIEPGDTDLKKMQLLNEDEYSEAKERYG
FT                   MSFSASMGAEAIKTLLENLDLDELSSKLRLQMIDKDDKTDKKLLRRLEIIENFKVSGNK
FT                   PEWMIMDVLPVIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLRKLLLLNAPEIIV
FT                   RNEKRMLQESVDSLFDNSHKRKVVKGTSNRPLKSLSDALKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELKLHQCGIPAKMALELFKPFVIRKLIESESVFNIKRAKSLIEQEVDEVWQ
FT                   ILDNVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCHAYNADFDGDQMAVH
FT                   VPLTPAAQAESWALMLSTNNLLNPANGHPIVFPSQDIVLGLYYLTMERKNVVGEGRKFA
FT                   NFNHVLLAINNKSLDYNAQIYVKIDGEYIATTAGRVVFNEALPGKITFVNKTLSDYELQ
FT                   SLISEVYVIYGSSIVIEMLDIIKELGFRYATKFGCTISMSDIIVPEEKKIYVDKANREI
FT                   AKIQNDYTKGVITGEERYNNVVSVWSKTNEELTNKMMEILKKDRDGFNVIYMMADSGAR
FT                   GSRNQIRQLAGMRGLMAKTSGDIIELPIISNFKEGLSVIEFFISTNGARKGLADTALKT
FT                   ADAGYLTRRLVDIAQDVVVRIEDCGTINGIKVEALKNGEEIVEPLREKAVGSYSIERIK
FT                   SPITGEIILDVNEEVTEDKIKLLETVGIDKLVIRSVLTCEAEHGVCQKCYGRDFSNNKP
FT                   VNIGEAVGIIAAQSIGQPGTQLTMRTFHIGGVAQAGSEDDKIALKNAFILNGLEGFNVQ
FT                   VDDGLLFTRKGTLKVINVIYEENIKEIKELKVLDSQKVIKGMPLFINKNGIDVLSTHIG
FT                   YVKIKDDKLMIVSEEQEISLKAGTRLEINVGDYVEAGRVIGTFDPFAEPIIAEFKGKVK
FT                   FKDIILGTTLKEEINLETGNIEKRITDQVFESLDPRILIINDRGVEITSYVLPGDAYLQ
FT                   VEDGQDINIGDVIAKLSKGSEKTQDITGGLPRVNDLFETRIPKNLTEMAKVSGIVQFKA
FT                   IQKGKRLINVLDEYGVEHKHYIPAGKHLLVRDGDVVKAGDMLCDGRINPHDVLEILGGI
FT                   SLQEFLLAEIQDVYRKQGVSINDKHIGVIIKQMMKKVKIVSVGDTNFVYNQKVDKHAFY
FT                   EQNKRVIEQGGEPAVASPILIGITKASLNIDSFISAASFQETTKVLTDASIAGSVDDLK
FT                   GLKENVVIGHLIPTGTGMNLYKRVKVRENSSSEV"
FT   gene            complement(403349..406816)
FT                   /locus_tag="BH0389"
FT   CDS_pept        complement(403349..406816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0389"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BH0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16898"
FT                   /db_xref="GOA:B2S092"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S092"
FT                   /protein_id="AAX16898.1"
FT                   /translation="MIKRVHLGQGKAEEILDLPNLIEIQLNSYEKFLQLERLKTNRPLL
FT                   NEGLESVFRDVFPMKSSNGEVALEYEKYYIEYNSLSFTEKECKRKGQSYEAVLKIRLNL
FT                   QFLTTGEIRQKDVYMGTIPLMTDRGTFIVNGAERVIVSQIHRSPGVVFYKEKDLYYARI
FT                   IPYRGSWLEFEIDSKKDYLYVKIDRKKRILVTLFLRALGLNTRERIIETFYKIRKIEVN
FT                   EDTKREITGQYLATNIIIKENMTYRAGDKITLQDIEDFLQNGVKEIDLIDFDGYDSVPG
FT                   KHFISSDVILNCFEKEDAYFSLKDGFKELSRESVMLAVYSVLLPGEPISIDNAESDLRN
FT                   VFFSEKRYDLGHVGRYKLSKKFGLDDLTTSVLTMTDIVNTISHLLRIYDGHDVLDDIDH
FT                   LGNRRVRSVGELLTNIYKGAMSRVEKIAKDRMSNKEVFNLKPQELISVKPIVSAVKEFF
FT                   ATSQLSQFMDQVNPLAELTHKRRLNALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPE
FT                   GPNIGLIVSLATYAKVNDYGFLETPYRKVVDGKVTDEIEYLSAIDEEKKCIAQANAAVN
FT                   AEGNYIDDLISVRVSGDYTTMIPKNIDYMDVSPRQLISVSSALIPFLEHNDANRALMGS
FT                   NMQRQAVPLLFPQPPIVGTGMERIVAKDSGVVVKAKRSGIVVLATSKKIVIRPEDAADD
FT                   HDLDEYELAKYERTNQDTSFNHSVLVKEGQVVNKGEIIADGPATRYGEVALGNNLLVGF
FT                   IPWNGFNYEDAILISERIIKEDLYTSIHIKEFSIEVRETKLGPEKVTADIPNVSGKILN
FT                   KLDENGIVRIGTYVKPGDILIGKVTPKSEGDITPEFKLLTSIFGEKAKDVKNNSLKVPH
FT                   GTEGTVIDVQRITKDDVSNLPPGVDEILKVYIAKKRKLKEGDKMAGRHGNKGVVAKILP
FT                   VEDMPYLADGTPLDICLNPLGVPSRMNIGQLMESQLGLAGKYLGEYYDVPVFESATNEC
FT                   IQEKLKKAGFNETSKAVLYDGYTGEPFENEVMVGIIYMLKLHHLVDDKMHARSTGPYSL
FT                   VSQQPLGGKAQFGGQRLGEMEVWALEAYGAAHTLQELLTVKSDDMSGRVKIYENIVKGI
FT                   PTNVSGIPESFNVLMQELRGLGFDLSIYDDKGNQIPLTEKEEELINKT"
FT   gene            complement(406902..407270)
FT                   /locus_tag="BH0390"
FT   CDS_pept        complement(406902..407270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0390"
FT                   /product="LSU ribosomal protein L12P (L7/L12)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16899"
FT                   /db_xref="GOA:B2S093"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S093"
FT                   /protein_id="AAX16899.1"
FT                   /translation="MALSKEDILKWLEEAKTAEVVELITAIEEKFGVTAAAVAVAAGPG
FT                   PAAGAEEQTEFDVMLVSFGDSKINVIKEVRAITGLGLGEAKALVEAVPKAVKEGVSKAD
FT                   AEEIKKKLEAVGAKVEIK"
FT   gene            complement(407339..407833)
FT                   /locus_tag="BH0391"
FT   CDS_pept        complement(407339..407833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0391"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16900"
FT                   /db_xref="GOA:B2S094"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S094"
FT                   /protein_id="AAX16900.1"
FT                   /translation="MHTKINPKKVEMFNSLKEFLDGKDNIFFLDYRGLTVAKLTELRNK
FT                   VENEKGELKVVKNNIMKRVLKDRHMEGLDSYLLGPTAVVTAVDEANVIAKIFYEFVKTS
FT                   TLKVKGGFVLGEVYDEAKLNAYSQLPTKKEAISLFMSVLKAPMSKLARTLKALSDVKVE
FT                   S"
FT   gene            complement(407844..408518)
FT                   /locus_tag="BH0392"
FT   CDS_pept        complement(407844..408518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0392"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16901"
FT                   /db_xref="GOA:B2S095"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S095"
FT                   /protein_id="AAX16901.1"
FT                   /translation="MAKSGKKYMQAISKIDKLKSYSIDDAISLLKEIKFVKFDETIDVS
FT                   INLNLKKNHTVRDTVVLPNQFMKEKRILVFAKGDRAQEAKEAGAAYVGDDDLINKVKGG
FT                   FSDFDIVVATPDMMKDVGKLGPILGKRGLMPNPKTQTITNDLKGTIAGLKKGRTEFRAN
FT                   KNGVLNFSVGKSSMDNKKIKENYDEFIKELLKRRPSDLKGTFVDSVYISSTMGPSVKID
FT                   FV"
FT   gene            complement(408518..408952)
FT                   /locus_tag="BH0393"
FT   CDS_pept        complement(408518..408952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0393"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16902"
FT                   /protein_id="AAX16902.1"
FT                   /translation="MSKKKREVAWIKLQVPAAQAAPGAKIGQALGPHGVSGPQFVKEFN
FT                   ERTAKMEPGIVVPVIITVYSDKSFSFIIKTPPASILIKKAVGIETGSKKSNTEKVGTIS
FT                   KEKVMEIARIKMPDLNAKTELAAFNIIAGSARSMGVEVEK"
FT   gene            complement(409007..409561)
FT                   /locus_tag="BH0394"
FT   CDS_pept        complement(409007..409561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0394"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BH0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16903"
FT                   /protein_id="AAX16903.1"
FT                   /translation="MSRAWYVLQTFSQYEKKIEQEIKLLISEGIFGANVLDVKAPIERV
FT                   EEIKNGKKRIRERKIWPGYILIELDLPEQDWKSTVANIIKIPGVVNFVGTNKEQKPLPI
FT                   SDEEVKSVFMLAGEIKADKSIFILYDFEEGERVRIKGGPFDSFEGIIGSIDYEKKKLKV
FT                   AVQIFGRSTPVEVDFQHIEKI"
FT   gene            complement(409571..409741)
FT                   /locus_tag="BH0395"
FT   CDS_pept        complement(409571..409741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0395"
FT                   /product="protein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BH0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16904"
FT                   /protein_id="AAX16904.1"
FT                   /translation="MFKFVKESVLELKKITWPKYGEVIGSGKQVFWLVVFISIFLGIVD
FT                   YIMYLAIAYVF"
FT   gene            complement(409772..409843)
FT                   /locus_tag="BHT0006"
FT   tRNA            complement(409772..409843)
FT                   /locus_tag="BHT0006"
FT                   /product="tRNA-Trp"
FT   gene            complement(409854..410033)
FT                   /locus_tag="BH0396"
FT   CDS_pept        complement(409854..410033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0396"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16905"
FT                   /db_xref="GOA:B2S099"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S099"
FT                   /protein_id="AAX16905.1"
FT                   /translation="MGKKKGKGAVELIALVCEETGIRNYTTTKNRRNKQEKLELMKYCP
FT                   ILRKHTLHKEGKIK"
FT   gene            complement(410055..410127)
FT                   /locus_tag="BHT0007"
FT   tRNA            complement(410055..410127)
FT                   /locus_tag="BHT0007"
FT                   /product="tRNA-Thr"
FT   gene            complement(410213..411112)
FT                   /locus_tag="BH0397"
FT   CDS_pept        complement(410213..411112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0397"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16906"
FT                   /protein_id="AAX16906.1"
FT                   /translation="MGLDRCLFGEKVGRFDVNLLSSLLSFLFLFYSNVSIINDSLSKSS
FT                   IKRTIDWDAKVVYFDIIKPVDEDRFGRVGLDSTSRLVFSVNDFKDTLIRQSLFEITIDA
FT                   DNTFKDYFDSDPHLILYFSGLDSILKRGYTKYSEDLKNITVRYELSLFPDFMNLFLSHS
FT                   KPYRAFYPLTSTSADQFIYTGIIIYAGDDYKSSSGGVVKLTDAFFIKIYDESIKLYFDK
FT                   RMVDPDTLRKWGMLEYTDDISYKNKNRVGNYPLRLIAKGVYGKNHSDIILDEYSINKIF
FT                   SNKNNVNLLREGKLVIIK"
FT   gene            complement(411076..412140)
FT                   /locus_tag="BH0398"
FT   CDS_pept        complement(411076..412140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16907"
FT                   /protein_id="AAX16907.1"
FT                   /translation="MCFVMHDLYYIIKIMKLLIQAFGLMLVFSCCRIKQSEIQSLLGLL
FT                   EESNKKGLDRFLIVDRIVDIHMRNKDYKDALRVVNQVIANDESGEYYPLYFYLMGNIYS
FT                   SIKEDLVAFTYYRYVVDNFDDYIYENSSVKLDIAKRVINLNIEAGDKIRYYKLLLNDNA
FT                   ESLINADRGNYYYNLALSLESIQNYDEAYFYYKKLLSIPRSDLRIDSIDYSGVITKINY
FT                   YNNPDFVIYRNLNDLIQDVKRYIFSGNTAKLLSIRDKHNFFIQSWDQRGGKSNSINTNS
FT                   FLTTMIKLGSRRKNGIQFASSFEADSSDDISYLGSSGWEHIWEWYFVFKKISYPKDPEI
FT                   NNGWAWIGVYLGKK"
FT   gene            412173..413480
FT                   /locus_tag="BH0398A"
FT   CDS_pept        412173..413480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0398A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0398A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16908"
FT                   /protein_id="AAX16908.1"
FT                   /translation="MNKKLIYILSIILFLSCFNKNNKYGIVLDSNNREKLPNGSLVKIE
FT                   NTDQEKQIITINYNETKFIVHKFTIEEFQTKKEAEKFKLSIQPYVNKYAISKKDLLPLR
FT                   TSPDSYRENIIYRIPKEAILKIIHIGEETEAGSLKGRWLHALTKDGYKGYVFNYSLEIF
FT                   DNIPGTILTSPLDQASQNDIINTFKNIKYLRPLYYEKMIANNTYNTNLLREDYGLFFTP
FT                   KNEIKINMPELNLHCKFNIVEEVKPNGFLFRSETSDEDFIILERETQNYYKSIVKVKEH
FT                   NFESKFVIIEQNIEKIILEAEKQNQNLINRLISYGTLINTQYGNIEFKSDKTFVWETDK
FT                   KIYNLPSSGTFEIIGLSPNLQISYKNAVKLMTTEGKEYFCLLDYTNNALQLIFISPESV
FT                   EDDLIIINDKDKIAIILFNSAQPSQDILTKQSQKTT"
FT   gene            413493..414149
FT                   /locus_tag="BH0399"
FT   CDS_pept        413493..414149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16909"
FT                   /protein_id="AAX16909.1"
FT                   /translation="MKIMRILLLTQLITFLNANENTTIIKELSKTIYNPSNKEYETNKE
FT                   RLDNFIESIDLNNNNILKELQKIKNDLLITSVYFQNIKGTLIALNISAEINFQHKISPL
FT                   SISIINNDFNTTKTLIDYGIKINRIDETEYPSVFWAIYLNNETMFNLLKEKGADLSLTL
FT                   KNGKTPMQAAIEIENTDLIELLLKKNAYIKDEYKKEIKNLKNKNIRNIFKKYKII"
FT   gene            complement(414155..415696)
FT                   /locus_tag="BH0400"
FT   CDS_pept        complement(414155..415696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16910"
FT                   /protein_id="AAX16910.1"
FT                   /translation="MERKFLYKYPDLVNTDLNLRLPEINVLEEHDKNFFTDDYYKNLIS
FT                   SDKDIGIRLHKALLDYLSPQSVQEGERAANYRQIINIYWKFLKSIAKNVLNLTIEQKVL
FT                   LRFAALLPNALSSELKSLISKTIWDNNYNEPFIYFDEWIYGVNELKLRRLAIDEPMANI
FT                   KDDDVKKILFNKQEKLLANIDFAKSSLKKSDKARIEAITNLKSMFKFLFVETSYNHEIL
FT                   TDEFEVRTIYSDDILKPLNFASHYIDSLVKTNKEIVSLIAQIKEANKELLEIKDRIQEI
FT                   DMPNSSAIAVEEVGSLMEANKLTIGPRGNHFPILLKSNVVTNSQFFGSRERIIQLVREI
FT                   ESIQPRIFYKNYRGDLLRIVPYFILIPSYGERGICWEPVDIKNRVNGRGKILIPMYSKD
FT                   LRKAIIFGVGDFIWELAKDQASFRWMETGLTGQYYEYYSKFIKKGNIKNFFLDDYFLWL
FT                   DKESKGVQKIERMVRGIMWRNTPFSKDLKEELSKKSFVYKDLFEKDKNIEMSDGY"
FT   gene            415819..417009
FT                   /locus_tag="BH0401"
FT   CDS_pept        415819..417009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0401"
FT                   /product="sodium:dicarboxylate symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16911"
FT                   /protein_id="AAX16911.1"
FT                   /translation="MNTKIKFYLTIFAGILLGLFLPSEAYNTLSHIFIRLAYLSLIPFL
FT                   IFSIPLGIENIIENKKFKKLFVKTIYYGMLINIVGVIISIAVATIYLPQRIPILDKNIQ
FT                   NLYMFDKTELLETFFPKNIFTILTNNNPNLLSIYIISIIIGTSFYYAKQKGRIARELIL
FT                   SISNLFYNANGIVVEILHFGIIFITAAYTTNLKNFKNYQYYIDSIIFLSLWTIIIILII
FT                   IPMISYRLTKNFKLSYKNILISIQNIIFAGLTMDTYVPYSVLIEDIKNERINIKKSIIT
FT                   NIPIINFISKSGTIFISTISFFIILKSYSSLPISIYEISYMSILAFLFIFAFPHIPNSL
FT                   IYIITMLCSTYTKGIELSYSNIIPILPILTSLALMIDFTSNIAIMQIVDFNELQDT"
FT   gene            complement(417033..418508)
FT                   /locus_tag="BH0402"
FT   CDS_pept        complement(417033..418508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0402"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BH0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16912"
FT                   /protein_id="AAX16912.1"
FT                   /translation="MKFMGDFISSKEEEFSKWYLDIVQKAKLIDYSPVKGCMVIMPYGY
FT                   AIWERIKSILDDKFKETGHENAYFPLLIPYEFLEREKEHVKGFSPELAVITTAGGEELA
FT                   EPLVLRPTSETIIWNMYSKWIKSYRDLPVKINQWANIIRWEKRTRPFLRTTEFLWQEGH
FT                   TAHETAKEALEETLFILNLYKRFVEDYLAIPVFCGQKTEREKFAGAVSTYTIEALMQDK
FT                   KALQAGTSHYLGLNFAKAFDVKFQNKKGEMDYVFATSWGVSTRLIGALIMVHSDNKGLI
FT                   LPPKIAPIEIIIVPIFKRDGDANQKILEYSIIIFNLLKEAKFRVELDRDVKNSPGFRFA
FT                   AAELKGIPIRIEIGSNDIFMNCVTVARRDKDKNSKYQVSVEELSSKIRHELDIMQCELF
FT                   NRALEFRNLHTKEIIGFKENDYDIFKTCINEHLGFVLSSWCGSEVCEESIKNDTKATIR
FT                   CIPEDFQNRPLNGLTCIYCNAAAKHLVLFARSY"
FT   gene            419298..419897
FT                   /locus_tag="BH0405"
FT   CDS_pept        419298..419897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16913"
FT                   /protein_id="AAX16913.1"
FT                   /translation="MKTLLKLIMIFLTSLSVATTLDPTALNRILNKQQAQQSTFGIGFG
FT                   IGNPIVNIIINFPYVEINLGYGGFNGLHPNNFIPYIIFGTDALFKEEIYENTMIAGGIG
FT                   IGVDLSQIKSNEQDASNIAGKNNTTKQEEFSITSSNNRLGIVLRLPIILEYSFFKKIVI
FT                   GFKAVTTIGGTMIFNPTSTEGIRFAFFGFGFIKIYM"
FT   gene            419908..420675
FT                   /locus_tag="BH0406"
FT   CDS_pept        419908..420675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16914"
FT                   /protein_id="AAX16914.1"
FT                   /translation="MEKNAQKIFILLLIFGLYHFAFSQSNETYSIKCQQEDDGIICTTN
FT                   DKPIPPKPQPAPPKPQPQPQPAPPKPQPQPAPPKPQPQPTPPKSQPNITTNPHAMKIKK
FT                   HPYSFAAGTGIGNPLINLLISVPYVDIDLGYGSFLYFNSTNFKPYNLIAIDLIFRQQIG
FT                   KSFIVGGGFGVGADWSQANLTSPGSKQPAPYDRIAIATRLPLSIEYKIIKNLSLGFKIY
FT                   PTLGPTIFLTKPKIVFEGMRFKFFSIGFIKVLI"
FT   gene            complement(420714..421829)
FT                   /locus_tag="BH0407"
FT   CDS_pept        complement(420714..421829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0407"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BH0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16915"
FT                   /protein_id="AAX16915.1"
FT                   /translation="MSVDNIFLMRNEIKKYDWGGISFIPSLLGQREDGLPKAEMWLGAH
FT                   KTFSSKIVVDGQYIPLCDFLESHKDLLGCESELSFLFKVLSAQRPLSIQIHPSKNIALK
FT                   GFKLENDRGIDINDFKRIYKDENPKIELVYALSDFYALKGFLPFLEIESIYKKLKLDFH
FT                   FTTHKEFIKTIFSLQKFAIEDAINKVKENLGSIDDFRAYWFNEIYKIYGADIGLLVFLG
FT                   MHIFKLNPGEVIYTESQEVHAYLKGECLELMTNSDNVIRAGLTTKYIDKDEMLKVGKFE
FT                   EGMFSLLRGENINDFNVFKLPGTNLSLFQRDINGRICFKRDGVMILLVLNGAIQINNKF
FT                   CLKRGESVFIGNCGKELLICGNGVIFIALSL"
FT   gene            complement(421826..423694)
FT                   /locus_tag="BH0408"
FT   CDS_pept        complement(421826..423694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0408"
FT                   /product="PTS system, mannose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BH0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16916"
FT                   /protein_id="AAX16916.1"
FT                   /translation="MFLNYLKKELIFVSNEISSKAEAINFLVDQVSKRGYTHDRARFLQ
FT                   GLLDRENIGDTSWENGVAIPHFIGDVVSSSFISLLYIKGDGIKWSDDNPPVNLIFLICM
FT                   SKSQQGGAHIKSIAFIAKLFENDDFKNMLKVINSPDEIYSYIENVDKTFTDDTSNASKL
FT                   EKVVAVCACPVGVAHTYIAAKKLEVEVKRQGYNIKVETQGSIGIDNPLTETDIKDADVV
FT                   ILAVDKDIDEERFDGKRVYKVSTAKTINNVGNVIKEAFSAPVLHYKNIHTLKDKSGKGK
FT                   SGFYKYLMSGVSPMVPIVASGGILIALGISFAGIGSDGPNFDEYPFYKTITDIGAVAFG
FT                   MMLPVLSGFIAMAIADKPGLAPGLVGGVLARDVKAGFLGAILVGFMAGFVARWIARRKI
FT                   PEWLRPVMPIFVIPLISTVIIGLFMIYGGIYIGQFMELLENGLKSLQNNSETYGIVGKL
FT                   FLGLILGAMVAIDMGGPFNKVAFLFGVGMIPQVPQIMGMVASAIPVPPMAMGLATLLMP
FT                   KLFEEEERESGKISFLISFIGISEGAIPFAASDPARVLPSIVLGGAVASIIAAFLGVAD
FT                   HAPHGGPIVLPVVDNKLGFIIAIAVGVAVATSLVIFLKSLKVKASK"
FT   gene            423804..424442
FT                   /locus_tag="BH0409"
FT   CDS_pept        423804..424442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16917"
FT                   /protein_id="AAX16917.1"
FT                   /translation="MMKKIIEFYFLLLCASLYSSNNEVQKIDETNNKESLQSTNLENNF
FT                   FSVERGFIYSTGTGLGTGFFLNSKINHILFRPYYIFAINNIDFLATCMILMIEDYNISK
FT                   KVKYSSSYIGIGINWHIINLSKKIKYLSSTMGIGGRFYLSTNLIGDLKFYSKLPYVIEP
FT                   YIFFEFSTKKAISYLNIYSKIECLFIDTFNISFDFGIRYNLKSSKGAKS"
FT   gene            424439..425320
FT                   /locus_tag="BH0411"
FT   CDS_pept        424439..425320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0411"
FT                   /product="endonuclease"
FT                   /EC_number="3.1.30.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16918"
FT                   /protein_id="AAX16918.1"
FT                   /translation="MKKKLKILLCFYILILLGFLFLYQNPKILNNIKEIASNYLEKLKD
FT                   KIYGPEIPTELKEEYLLPKGYLTTQVLHKKYYSLGYAESARQSEWVAYQLKREMVELAL
FT                   TLLREKKITRSKKFFEDKDIKGISPKLSDYIRSGYDRGHIVSSADMSFSKDAMLDTYFL
FT                   SNISPQQREFNSGIWLKLERLVRKWAILKEKIYIVSAGILTENKGFIGKNKILIPKNFY
FT                   KIVLSLNNNNSYDILAFIIPNEKAQDLELRNYVVNVNLIEDKTKIDFFAKLDAGIKKVI
FT                   KMKKDLYSWEFK"
FT   gene            425317..426081
FT                   /locus_tag="BH0412"
FT   CDS_pept        425317..426081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16919"
FT                   /protein_id="AAX16919.1"
FT                   /translation="MKTIFAKLNIFLLITFTLGIIVISIFMYHINFNIKFYTYLIKIYN
FT                   KNLLILINTFFIFSIGIIGSTWTYINYKRTNNIQFVFFYCFICSFILEPISIFKYYLLN
FT                   NILSLEFYHFMKFYHLITVFSLLNLFFLSLYICDFQIKSITYTIYLIFTFSMIYSSLVP
FT                   INAYDHTYDFLSSTKNNKFYVYLFLLLIPINFLVACLKKKNLSYLLLFVSILLIVLGIY
FT                   LNSIEIPYAFIPILIGVPMYLKESGKLFFYWL"
FT   gene            complement(426085..426681)
FT                   /locus_tag="BH0413"
FT   CDS_pept        complement(426085..426681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0413"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16920"
FT                   /protein_id="AAX16920.1"
FT                   /translation="MFNQVFCNENIKYEIYRKFFHISTLIFLLFYKVSFWIGLASSLFF
FT                   LFAYLILEIFRIMEINLFFLKGISEIIVKSREVSSCRISLSPIFLVVSMFCTYFLIAEP
FT                   FSYIGIFSACLGDGLASLFGKLIPSFKLVNNKTFSGSVVVFLVAFIVCYYFFPNFILAS
FT                   VIGMGAVLVELFDFEKYDNLFLPVGVSTLSFVLIS"
FT   gene            complement(426681..427700)
FT                   /locus_tag="BH0413A"
FT   CDS_pept        complement(426681..427700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0413A"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BH0413A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16921"
FT                   /protein_id="AAX16921.1"
FT                   /translation="MSRYLLYFLLILMLVACGSKRTGLMERDGIFALIETNKGTIEVEL
FT                   YYKIVPLTVMNFIGLSEGAIKNSVTNRPYFENIVFHRVIDNFVIQTGDPTGTGTGGPGY
FT                   VFPDEFNKDLSHNEPGIVSMANAGPDTNGSQFFITLKDNLTYLDFRHSIFGKVISGMDT
FT                   VRSISQGDKIERVEIIRVGEDAKAFKVDNEGFLELKKSYEAKKIEEAEKYMASQLAIID
FT                   QDYKDFQRDKSGILYKINKKGNGKHVKNGNVLKVDYEGFLLSGVKFDSSIDRGEPIELV
FT                   VGSGQVIEGWDIMLSDMCEGEDRVIIIPPSLAYGDKIVNEIIKANSFLKFNIILRKIN"
FT   gene            427846..428706
FT                   /locus_tag="BH0414"
FT   CDS_pept        427846..428706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0414"
FT                   /product="pili chemotaxis protein methyltransferase
FT                   CheR-like PilK"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:BH0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16922"
FT                   /protein_id="AAX16922.1"
FT                   /translation="MLNISNELLMKFCNFIYENSGIRFDEKNKVVLKGRINDAIHELEN
FT                   INTPKQLYDLISSDKLKKEYFLDLVTTNLTRFFRNEAHFSTFEKFIIPNLIKIKTQEGK
FT                   NRIVIWSAGCSTGEEPYSLAFVLKYHLPKSFDFIIIASDLSLKSLMIAKEGYYSVQKCE
FT                   HIPMQYKQYIKSHIDGYRVIENIKKHIRFDYHNLNFENGFSNIDVIFCRNVLIYFDEKS
FT                   KIKVLKKFYSSMAMKSYLFIGHSESLFGLNLPFKFLRTPWAVIYEKNDNGIPERKFQFK
FT                   SRYKL"
FT   gene            428742..429890
FT                   /locus_tag="BH0415"
FT   CDS_pept        428742..429890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0415"
FT                   /product="protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BH0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16923"
FT                   /protein_id="AAX16923.1"
FT                   /translation="MQKKIYVLVIEASSVNRKVISDIINSSLKLEVIATAANTDFALKK
FT                   LKKHPDVILLSLETETIQEIAFIKKKQNINNNLPVIILSSNKDIAKNAILKGADDLIIK
FT                   TNDKLESIKDKIIDLLSVYGNKTIKNKIITNINSTFKTITNNRIEEDNLSTTEATDNNL
FT                   IITKNKNETNNLHEEIIDEKALKKLKNRKFEIVVIGISTGGPAALKEILPEIPKNFPVP
FT                   IIVVQHMPKEFTAEFARNLNNICNLAVKETSNKEILQKGFIYISSGGYHTRINKINENY
FT                   QIEVFDAANVNGHKPSIGVLFKSISENVKEKAIALIMTGMGSDGSREIGDIKKAGGLTI
FT                   AQDEQSSVVFGMPKIAIEENNVDYIVSISHVVKLLKAILIDG"
FT   gene            429914..431122
FT                   /locus_tag="BH0416"
FT   CDS_pept        429914..431122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0416"
FT                   /product="pheromone shutdown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16924"
FT                   /protein_id="AAX16924.1"
FT                   /translation="MDIKKENTEDCFSHVSTLDVDHYKIYILGTAHVSKKSSQDTATLI
FT                   ETLKPNFIAVELDEARYHAILKTDENEKWRNLDIYKVIKQGKAFLLIVQIILSNFQKKL
FT                   AKEQGINPGEEMKTAILKAKEHNIPLILVDRKVETTLKRAWNCVPIFEKVKIISSLFSF
FT                   SDVKVTQDEIEKLKEQDVLSNMMGELAKEIPTVKKVLIDERDEFIASKILEGSGTILAV
FT                   VGAGHVKGIIANLKEIKENKKIININELNTIPKNTFSISKLISYFIAISIVILMASSFY
FT                   FKGFDLAYKNLKFWIICNSLFAGLAALLLRANIITILTASIGAPIFSLIPFIGTGMVAG
FT                   LVEAYINKPKIKDFENLQEDLNNIKGYFKNKVTKILLIVFFVNIGSAIGTIVGFQFLLN
FT                   IFS"
FT   gene            431162..431794
FT                   /locus_tag="BH0417"
FT   CDS_pept        431162..431794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0417"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16925"
FT                   /protein_id="AAX16925.1"
FT                   /translation="MKLVFLGPPGSGKGTIAKILSNKLNYYHISTGDLFRENISNATPL
FT                   GKEIKQIVENGQLVPDSITIKIVEDKINTLENKDNFILDGFPRNINQAKALDKFLKNIQ
FT                   IINFLLDEEILIKRLSGRRICKSCGGIFNIYTLPTKEKEICDLCKGILYQRKDDTEGSL
FT                   KVRLQEYHLQTKPLTDFYSKSNRLNNINASKDIDEVEKSLMEIISKS"
FT   gene            431860..432909
FT                   /locus_tag="BH0418"
FT   CDS_pept        431860..432909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16926"
FT                   /protein_id="AAX16926.1"
FT                   /translation="MEGDFITARIYIIRRSFIVLIFLQTVLIYSKENQDKMEYFYANFQ
FT                   TAYYPPHALGTRESKFSPSFITPQFKSVAPEKRISPSSWGSVKLISYLGYYKFFKLLDN
FT                   PDSPLLQNNGIDVDLNIGLSPVVALLKGKISFTPVAFINLYTGIELGIGWQGFGFKGIG
FT                   VHIGNGQYSSNAEFYSEITMGGRLQFDLNALIDGDWTHVITVVGNNILHINNPHANDNQ
FT                   LWKYKSDGGKNINGFTINPYALLAYKMPIPLNIIGFLYEGQTYIGHARNVSTAQNKGWG
FT                   SDFFYHNFSLISKVEIIENLTLDMQFKFSTAPIYTANTMGMADISKRISTNNSYIYYDS
FT                   IGFSLTYKI"
FT   gene            complement(432912..433844)
FT                   /locus_tag="BH0419"
FT   CDS_pept        complement(432912..433844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0419"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16927"
FT                   /protein_id="AAX16927.1"
FT                   /translation="MMKGVILDNFEDISVKSQKLLLVDDTPTNLDLLIDILQYNYEIRV
FT                   AVNGFDALKQVEIASPDLILLDVLLPDISGYEVCKRLKNDPETRDIPVIFISSRDSTDA
FT                   QLEGFNVGGVDYILKPFNGRIIDARIKTHLELKRLRDYFKNLARIDGLTQIPNRRFFTD
FT                   KFAKSWMQALEHKRNVIVGMLDIDYFKKYNDNYGHTNGDECLKLIARSLNKIAIKYNID
FT                   TARYGGEEFILFSVNKSLEEMINIVSILIEDIRNLEIVHEHSSISKFVTVSVGLAEQIP
FT                   HDSNFTNIIKLADDKLYEAKISGRNQFKY"
FT   gene            complement(433844..438316)
FT                   /locus_tag="BH0420"
FT   CDS_pept        complement(433844..438316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0420"
FT                   /product="sensory transduction protein kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16928"
FT                   /protein_id="AAX16928.1"
FT                   /translation="MYKYITWLMRGLSVFLFLFFLSHISLPAKQILKFKLVDQYYPLYY
FT                   KNQKGKMRGTIFYLLDKWAQDHDYDISVESIDYLDKDKIEDDVVYLGLTYNSGLNEYLY
FT                   FKNEIGKCVTTLICNSEKEKKLTNLFLSNELRVGVVENTIYEDILRFHGHGDNVFLFTD
FT                   TEKLLLALRDNKIDLVYGSYKSLSCVWYSLFSPSLMRIFNSEYFYSFGVRAAISKNAVN
FT                   QLKDLDINLLSYMQSLSKEEYASFKELDFLLKLDVGMYNDYPPLSFINAKSQFSGILVD
FT                   LWNTLAREYGFSVEFIGFPKESIKRSLDDKDISVWGGILEDDNILNSKKYKAISPICSL
FT                   NFNLYFTNAKNSNKVINSQVIDFSLNGMQLDKNTDIVSNFADIVNHSYGFVENSITTSY
FT                   LLRMHGYNNILKFKSLSLNKSKFLVLAVNSKRLQVFAYMLDALTANILFDTLLQIEKNW
FT                   IGQDEVEDYQNNYYGDINRSSFNIEEKIWLQSNRKLNLAVKDWYPIDYFDSGNYKGVNE
FT                   WLIKRIRRLTNLDFNIVNVHEREVEELIKLGKVDILSTNLDDTNSNSVFNIKAVSGIPL
FT                   HLFSNQTRLFTPKSSDRIAVLKFLYTKKLETQIGTQLVQVDSFKEALDLLYRGKVDGII
FT                   SDEYTATINFEDLNIRDIKKVFTVLDLTFNLNIAVHNQDYILRRIIQKVLFRTNVNNKS
FT                   HFDDWVFNVHESSKDMRLKKSGIAVLTIGMFVFTIFVFFLLNFWKEIGFRKKMYSSAVS
FT                   EKKVIENAIAAKTIFLASMSHDIRTPINGIIAATELLENTDLLGIQKEYVQMINYSSIS
FT                   LLSLIDEILYISKIDMNGIYIENNEIDLEHEIESVLKGFQSQSAKQNLDLIFYSKSDLD
FT                   SYLIGDRARLKKVLINLIGNAFKFTTDGIIVLNYEMICSTEDNNGNKIITIEFKVTDTG
FT                   KGIKESNIPVIFELFKQEDDSDSKKYEGTGLGLAISRKLVSLMGGPGITVESEVGKGTT
FT                   FSFMLPFVLGNKIKDKELKKLQLVKDKKILSLFSSKKTVEVLSEISEIFDYKDNIHYFC
FT                   SYEDAYKTFYRYPYYDFIFINVDDFGLQEGIKFADRIENLNSNVRIVFVFYYLKSDESI
FT                   DFKYEYMQKPFKRWDFYSDWIRNGPVVDIPIVSESSTLKLKNNVGILIADDNEINQKVL
FT                   KNILIVIGVREDSIDIVDDGVKAIEFLKTNRYDIAFVDIRMPSCDGFTVSREIRKFESQ
FT                   NNLNPCVLIAVTAHALREYKDRCLDNGMNDYLAKPIHISSIKCILKRYLHIEVEDSNII
FT                   SDKKLYGFSDIPNLDVNNALRDLNISYEMYVDLCRGFVDMSDNMIRDLDEAFNLNNVEL
FT                   VKGLAHSIAGALGNMRSNLFEHFRQIEINTGSIYELKMLYSKARKDLIVLVGNIRERIL
FT                   DVTKTEYQEKLKFKSNDEFLSLMQKLLSGIENRNPKEYKEVIEVLKGYSLDDDNITLFD
FT                   SLVKYLRIYNFKESANIVKRMMNASNIEK"
FT   gene            complement(438480..441420)
FT                   /locus_tag="BHR0001"
FT   rRNA            complement(438480..441420)
FT                   /locus_tag="BHR0001"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            complement(441717..442559)
FT                   /locus_tag="BH0421"
FT   CDS_pept        complement(441717..442559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0421"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16929"
FT                   /protein_id="AAX16929.1"
FT                   /translation="MNANYKKYKMLVFDLDGTLLNNDHEITPLTLKVLLKLKNDFHIII
FT                   ATGRRFDEITDILVQLKEVQIDESYIVTANGAEVFFKNNLILRYKIDYDVVREILKVKR
FT                   GDIDINLYTFNNWYSDREIRSPIMNYFIENLGIKPIITDLSKFEIDSCSKIVYYAQDLF
FT                   KLEEFANKIREKNFKDISMFYSANDLLEITHIDASKYNAIKSIALFECIAIDAILAFGD
FT                   NGNDYGMLKNVGKGIVMKNANDLVRNNLPNNEVTKFNNDEDGVAKFLIEFFNLDIDVK"
FT   gene            442692..443216
FT                   /locus_tag="BH0421A"
FT   CDS_pept        442692..443216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0421A"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BH0421A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16930"
FT                   /protein_id="AAX16930.1"
FT                   /translation="MDEEISTLFTEEKIKSKIKELAQKIRNYYKDKSNVVFISLLKGSF
FT                   MFFADITREIGLNVKIDFLQVSSYKNKTHSSLNVLIKKDIDIDIKDSYVIIFDDIIDTG
FT                   LTYDKIITYLKTKNPKEIKICTLFNKPSRRLIELKIDYAGFEIENDFIVGYGIDFNEKH
FT                   RTLKDVAKINK"
FT   gene            443226..444509
FT                   /locus_tag="BH0421B"
FT   CDS_pept        443226..444509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0421B"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:BH0421B"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16931"
FT                   /protein_id="AAX16931.1"
FT                   /translation="MSIYAVIGTQWGDEGKGKIIDFLSSKADYVVRFNGGNNAGHTIVV
FT                   NNKKFIFNLLPSGVLQGAKCILGPGIVIDPLILIKELETLKHNNIKTEIFISDKAHIIM
FT                   PYHIKLDELSEQKKGTYKIGTTKRGIGPCYADKINRTGIRATDLLNMETFERKLKINLD
FT                   EKNEIIEKIYNDKPFNYDDILSKYKEYIAILQSAITNTEAILNHAINSGKTILIEGAQG
FT                   TMLDIEHGTFPFVTSSNTLITAATGCGIPISKIKQKIGIIKAFSSRVGSGPFVTEILEP
FT                   IGDKIREKGQEYGSTTKRPRRIGWLDLLTIKKSINLNELNHLVLTKLDILNDIEELKIC
FT                   TAYEFQGKIYDYIPASCEILEKAKPIYKVFKGFKQDIRNISYYDDLPIEAREYIEFIER
FT                   EVGVQISMLSLGAEREKTIFRNKEWINI"
FT   gene            444494..445888
FT                   /locus_tag="BH0421C"
FT   CDS_pept        444494..445888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0421C"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BH0421C"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16932"
FT                   /protein_id="AAX16932.1"
FT                   /translation="MDQYINPLKSRYASKAMLYIFSPKFKYTTWRKLWYNLALVQKELG
FT                   IDISNNQLNNLSKHIEDIDFELVEKYEAKFKHEVMAHLYAYADLAGDDARKILHLGVTS
FT                   AYLMDNTDLIQIKEALLLIESKLIKLIKTLREFSIKHKDLATLAYTHLQEAQLTTLGKR
FT                   SSLWLQSLIFDFQELKFIMSNMCFRGVKGTIGNQNSFKELFASNFEKAKALDINLAKKM
FT                   GFDKVYKMTSQTYDRKFDSSILNFLSNLAQSAHKITNDIRFMQHLKELEEHFAEHQIGS
FT                   SAMPYKKNPIYSERVASLAKFTMSLQSSGGFIAATQWLERTLDDSACKRLNIPQAFLAT
FT                   DAALILLDKIFNNIRVNKKIIENHVKTEMPFILTEDILMKATKNGGDRQILHEKIRIYS
FT                   MQVRENLYSGATENGLIKLILNDKSFRLTSKDIDEILNPNENIGFASYQVEDFIKEIID
FT                   PILKNK"
FT   gene            complement(445895..446491)
FT                   /locus_tag="BH0422"
FT   CDS_pept        complement(445895..446491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0422"
FT                   /product="putative 3-methyladenine DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16933"
FT                   /protein_id="AAX16933.1"
FT                   /translation="MSIYGLFFYDKIVLMNREFFMQDAIVVAESLLGHLLVRKIDGKEI
FT                   ISRIVETEAYMGVIDKACHAYGGRRTNRTIAMYNIGGYAYVYMIYGMYYMLNIVTSNKH
FT                   NPHAVLIRAIEPISPKVDGLLTNGPGKLTKFLNIDLKFNNRDLLNNCELFLRKDLSFDF
FT                   EVACSKRINVDYAGEEYANKLWRFYIRGNRFVSKY"
FT   gene            446536..446609
FT                   /locus_tag="BHT0008"
FT   tRNA            446536..446609
FT                   /locus_tag="BHT0008"
FT                   /product="tRNA-Ile"
FT   gene            complement(447121..447195)
FT                   /locus_tag="BHT0009"
FT   tRNA            complement(447121..447195)
FT                   /locus_tag="BHT0009"
FT                   /product="tRNA-Ala"
FT   gene            complement(447274..448503)
FT                   /locus_tag="BHR0002"
FT   rRNA            complement(447274..448503)
FT                   /locus_tag="BHR0002"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            complement(448960..450360)
FT                   /locus_tag="BH0422A"
FT   CDS_pept        complement(448960..450360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0422A"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0422A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16934"
FT                   /protein_id="AAX16934.1"
FT                   /translation="MAKKKDKEIYKCLNCGYKSLKWLGKCPECFSWESLEHYVEPKSSY
FT                   GANLSKSKSEIFSLKDFKQVDNVRYLTGIEEFDRVLGAGIVIGSAILISGEPGIGKSTF
FT                   LLQISSILSLDGKNVLYLAGEESIPQIKLRANRLKISSDILITNEIDVDALIEMLANIE
FT                   LDFMVVDSIQTLNSREVQGSLGGVAQLKHCVYKLVEWAKGKNITLCLVGHVTKDGILAG
FT                   PKIIEHMVDSVFYFEEAKKSLRMLRATKNRFGTINEIGIFEMTSLGLVEIKDPSSIFLE
FT                   RKEEISSGIAIGIINEGSRVLFVEIQALITRTGMNISRIFSEKIDSKKISRILAVISKY
FT                   LNLNFNNDDIYVNVSGGLRIDDVEIELAVLVALFSAKTNVIISQELIFTGEISLSGEIK
FT                   VSSNIESKVIAALKAGFKSVFGANLRDNHYNGYESIGSVLGVVRRLVQDSRIKDHENNL
FT                   FKNSNIKK"
FT   gene            complement(450367..450666)
FT                   /locus_tag="BH0422B"
FT   CDS_pept        complement(450367..450666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0422B"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0422B"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16935"
FT                   /protein_id="AAX16935.1"
FT                   /translation="MQEGFCFYKKILSMDLLNTNKSLICIINKYILMLCVLCKFNELGE
FT                   SILTFNEFRLENFRLNLRMIMKILKIFLAIKDSSYMVSLKDSFIICPDEEKFTY"
FT   gene            complement(450742..451416)
FT                   /locus_tag="BH0427"
FT   CDS_pept        complement(450742..451416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0427"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16936"
FT                   /protein_id="AAX16936.1"
FT                   /translation="MLYIVGTPIGNLGDITYRAIDILKLVDVIFAEDTRVTKRLLSHYG
FT                   IVKKLISCNAVIEHKRIGLLLDYLSSGRSVAFVSDAGTPCLSDPGGLLVDAAFKNGYKV
FT                   CPIPGISSFNAVISVSPFKDKVIVFEGFLPNKGIKRIKRIEELYNRGDAFILLESSHRI
FT                   LKLLSEISLVNLDANVLVGREMTKLYEEYKIGKPLELKKYFEENNKNKGEFTVLVSRKS
FT                   KG"
FT   gene            451678..451998
FT                   /locus_tag="BH0428"
FT   CDS_pept        451678..451998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16937"
FT                   /protein_id="AAX16937.1"
FT                   /translation="MFKLIKKIFTIYFLCITLTGLVMVFIDSKFSERQTTQNSKSQIIK
FT                   HTIDPNLMMLTSAIGGFLGIYSGIWFFDHEKDNFYLSWGSLAILIYNIGLIISVYSKAK
FT                   NK"
FT   gene            complement(452008..452397)
FT                   /locus_tag="BH0429"
FT   CDS_pept        complement(452008..452397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16938"
FT                   /protein_id="AAX16938.1"
FT                   /translation="MISGLNPTLRLFKEHRILYSNMERGLKPLLEVDNFINKYIQNKEG
FT                   LEIYDKVVGKAAAVIIYNIGLQNVQAGVISQPAKDFLESRGIRVSFKRLVEKINDKTEN
FT                   LIESLENPGEVYKYMIKRGIIVSNY"
FT   gene            452510..453088
FT                   /locus_tag="BH0430"
FT   CDS_pept        452510..453088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0430"
FT                   /product="proline dipeptidase PepQ"
FT                   /db_xref="EnsemblGenomes-Gn:BH0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16939"
FT                   /protein_id="AAX16939.1"
FT                   /translation="MILIPQENTYSKIEVKKSIFLSYIFHVKGKEEINKILKEYKLKFK
FT                   NATHVVYGFRIGNSNSFISGMNDDKEPRSTAGKPTLEAILNKNLTDTLIITVRYFGGTL
FT                   LGKQGLTKAYSKAAQEVINKSNLIEKEEMETLCLNLNYNQYNLLIRIKNKMGIKIIDAN
FT                   FLDKINTTIKFNTKNKKNIMTFLQENSLI"
FT   gene            453253..454005
FT                   /locus_tag="BH0431"
FT   CDS_pept        453253..454005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0431"
FT                   /product="Soj protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16940"
FT                   /protein_id="AAX16940.1"
FT                   /translation="MKIISIINQKGGVGKTTSAINIAYSITLLNKKALLIDIDSQGNTS
FT                   SGVNILKKEDTNSSYELIYKKQKIKPIKNFNLDIIPSSLKLALLEKELIHEIARENFLK
FT                   NALEKYKQDGYDFIILDCPPTLSILTINALVASKYLLIPIETEFFAFEGINQLLDTITV
FT                   VKRINKDLEIAGVFINKYDIRNKSKEKYIDYLKKVFKDKFLNTKIRKNISISKSQEKNI
FT                   PVHMYNKESNAAKDFLELTKEIMMKIKG"
FT   gene            454008..454712
FT                   /locus_tag="BH0432"
FT   CDS_pept        454008..454712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16941"
FT                   /protein_id="AAX16941.1"
FT                   /translation="MSDNLDTLMALMGQKLKKNETDDNTLTKQELIVIQNKSFKYEKLD
FT                   KEIADFLKIKQYEILNIFNNAYTEIGRILKEAQEKLRGSNQHDGLFYKWFTSMGFKKDK
FT                   VYSLISRYELLVENSDKQLIIKNLPLSLSYEISKKSCPTHLKMEVLNGKIKSLKEFRSR
FT                   YQKDAHNKKNLKINFNKTQLKREETIKLIELLLQELENIKNINLDKIKNKTELLIILKE
FT                   IRQKINHIKKIT"
FT   gene            complement(454705..455517)
FT                   /locus_tag="BH0434"
FT   CDS_pept        complement(454705..455517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0434"
FT                   /product="probable chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16942"
FT                   /protein_id="AAX16942.1"
FT                   /translation="MYYYKEGFDKMNETFKMVDINLLDVDKSQPRKSINLAELEELSIS
FT                   IKENGILQPIVVFHDNGRYNLVIGERRFRAAKLAGMNQIPVIEIETTRENKDFMSLIEN
FT                   IQRENLTPVEEAYAYKNLMDKHSLTQKALSEKIGKNRSYVANLVRILELEQEILNSLHK
FT                   KEISLGHAKVLLSLKDNQDRYGLYLLIIKKKLSVRDAENYVKNFYRPINDKSEILRDPF
FT                   LNSVKEFLISRIQTKISIKGSKEKGKIEISYFTSSDLKRIISIFESIK"
FT   gene            complement(455622..458054)
FT                   /locus_tag="BH0435"
FT   CDS_pept        complement(455622..458054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0435"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16943"
FT                   /db_xref="GOA:B2S0D7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0D7"
FT                   /protein_id="AAX16943.1"
FT                   /translation="MVTEEDKEQILNIKIEDEVKTSYLNYAMSVIVSRALPDVRDGLKP
FT                   VHRRILYSMHEMGLRADKAFKKAGRIVGDVLGKYHPHGDQSIYEALVRLAQDFSLRYPI
FT                   VIGQGNFGSIDGDPPAAMRYTEARMARVAEELVRDIDKQTVDFRANYDDSLLEPEVLPA
FT                   AFPFLLVNGSSGIAVGMATNMAPHNLKEICDAIVYMLDHDSVSVYDLIEIVKGPDFPTY
FT                   AEIIYNESLIKAYTTGKGSVVIRARYHIEEKFEDHIAIIITQIPYAVNKSSLLMKIAFL
FT                   IKEEKLEGVSDIRDESDREGIRIVLEIKKGFDPHVVMNLLYEYTELRKNFSINNLALVN
FT                   GIPKQLNLKELISAFIEHRKEIVRRRVEFDLKRAREKAHILEGLNIALRNIDRVIEIIR
FT                   FARLVKDAKECIIKEFNLSEIQANSILDMKLQKLTSIETEKLEEEFKILLALIKDYEDI
FT                   LNSPERVVNIVREEIINLSLKFGDERRTKIIYDEEVLKTSMSDLMQRENVIVILTKQGF
FT                   IKRILQDEYKLQGIGGKGLGSFDLQDRDQVNITLCVNTHDFLFMISNEGKLYVINAYGI
FT                   KDTSRTSKGQNVRELINLGETEEILAIKNCNELSVDNYLLITTANGKIARIETEGFKTV
FT                   KARGVIVIKLDDNDFVTSAEIVSKNEKIICISKKGNAFAFNSDNIRLTHRGTQGVSGMK
FT                   VREGDVLIKALAVKQGSHLLVVSENGYGKRLEISKVTDLKRGATGYTCYKKSDEKAGEV
FT                   VDAITVVQDDEILLVSKGAKVLRTLVDKISEQGKDARGMQVLSLDEDKLISVSKFIK"
FT   gene            complement(458066..459985)
FT                   /locus_tag="BH0436"
FT   CDS_pept        complement(458066..459985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0436"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16944"
FT                   /protein_id="AAX16944.1"
FT                   /translation="MCGRFMSYVASNIQVLKGLEAVRKRPGMYIGSVSINGLHHLVYEV
FT                   VDNSIDEALAGFCDKIEVVINSDNSVTVNDNGRGIPTDVHEEEGISALELVLTKLHSGG
FT                   KFNKGTYKVSGGLHGVGISVVNALSSFLAVIVSRDGKLFKQTYSRGIPTSEVDIIGVSS
FT                   ARGTKVTFLADSEIFETLEYDFETLSKRLRELAFLNDKIRISIEDRRSGKEKFLEFYFE
FT                   GGIKAFVDYITNNSKNIQNEPYFIEGSCDDVIVSVGLKWTEGYSDHILSFVNNINTREG
FT                   GTHVAGFKSGFLKAMSEAFRDSKISKKDVPSLTLDDFKEGLTAVISIKIPEPQFEGQTK
FT                   GKLGNSYVKKIVETIVHDGLLKVIDDNLLEVDIILNKAIRAARAREAARKARESERKKS
FT                   AFESLALPGKLADCASKNPAEREIYIVEGDSAGGSAKMGRDRFSQAILPLWGKMLNVEK
FT                   TREDKVITNDKLIPIIASLGAGVGKTFYIEKLRYHKIIIMADADVDGSHIRTLLLTFFF
FT                   RYMRELIENGHVYIAMPPLYKLKYENREHYFYDDLEKEAFLGSIETGKRDKVSLQRYKG
FT                   LGEMNPTQLWETTMNPATRKMKLIKINDAIQAEKIFVTLMGDDVEPRREFIEQNALDVV
FT                   NLDV"
FT   gene            460217..461671
FT                   /locus_tag="BH0437"
FT   CDS_pept        460217..461671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0437"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16945"
FT                   /db_xref="GOA:B2S0D9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0D9"
FT                   /protein_id="AAX16945.1"
FT                   /translation="MQEGKNIWSLILAAIRKELSEEEFYIWFENLYFIDATDENIKISA
FT                   PNSFHKNQVEKRFAKRIKEILIEKGHNTINVEFINSPNDSKTHNMESKNISLKDISTQQ
FT                   DSPEKRTTFKIHTKNIIESTKQYTTKEEIHTKYRNPFLKKKYTFENFITGPNNKLAYNA
FT                   SLSIAKNPGKKYNPCLIYGGVGLGKTHLLQSIGNKTEELHKEFKILYVTAENFLNEFVE
FT                   SIKTNETKRFKKKYRYLDMLLLDDIHDLQKKEGIQEELFHTFNALYEDNKQMVFTCDRQ
FT                   PSELINFTDRLKSRFTRGLNVDISKPNFELRVAIIEKKAEEDGIKVPKSILNLVAKKVT
FT                   TNIRDLEAAVTKLKAHIDLEDIEIDTSTVDKIIKEIIVYENDNTNTHNKINIESIKKVI
FT                   LRELKLTNKDIEGNSKKPEITKARHIYAYLLRNFTELSTIEIGKIIGGKTHSTVLYSIN
FT                   KIDKERNNDLEINNLIIELMNKINKK"
FT   gene            461913..463073
FT                   /locus_tag="BH0438"
FT   CDS_pept        461913..463073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0438"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BH0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16946"
FT                   /protein_id="AAX16946.1"
FT                   /translation="MSEKFILCDTEQISDEIEKAKSIILNRNINDIWSAMLLEVENSNL
FT                   TIKATDRNIFFESTIPIVSTENFKVLINASNFSDAVKALNLYNELKIKFREDENRLNII
FT                   GESENKSENCTNDHLSEPTFSNEDIESYNYDINGETYNFTVDLNQKEFKKIINKISFSA
FT                   SHDESKNVLNGIYFTKNKDSTLTLVSTNSHRMSVYKTELVFEEDINFIVPVKMFNLLKQ
FT                   MMIGEGMIKLKVSDKKFYVEFNNYKIACSLINGNYPDYESIIPNEQQNRSLVEISVLKD
FT                   RLARVNSYTDKRSKKVILNFSSKQLRLMAEDPITGRKGEFFIQDPNYDYEGSEEAIAIN
FT                   SAYLTEAMGVFDTSKLEIKFSGGGILKLNEPDNFDFIHLIMPMILN"
FT   gene            463093..464160
FT                   /locus_tag="BH0438A"
FT   CDS_pept        463093..464160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0438A"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BH0438A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16947"
FT                   /protein_id="AAX16947.1"
FT                   /translation="MIKKIEFFNFKNIKNQVINFDFNNIYFYGENGSGKTNILDAIYCL
FT                   AFASSFLVNTDRELITYGKTEFYLKCFYKTREKDAEISLSFRNGKKEIKVNNSLIKDRK
FT                   DLILNIPAIVFSNYDTDFIIGEPAKKRWFFDQAISLVSLSYLDSLRKYRRILKQRNLIL
FT                   KQGNRDLLKVYNEAFVDYALEIIRMRENFIKHFYEFFKYYYSLIFDVSYNLEIKYLPSV
FT                   AYCGRDEFLHLLFLKEKDEFLNESTLIGPHRDLYEILSGERVFTHHSSTGETRALALIY
FT                   RLVQVIIFNKRFGIAPILLFDDVFLELDSTRRKRVFDILPKDSQCFFTFVDECYDIKQK
FT                   SNFIVYKVKNGKIEL"
FT   gene            464141..464440
FT                   /locus_tag="BH0439"
FT   CDS_pept        464141..464440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16948"
FT                   /protein_id="AAX16948.1"
FT                   /translation="MERLSFKKAADVLKEYLDSDICANENLNASFILSQSWQIIFKDLA
FT                   DRVKLLNLKDNKILFVTVGNSSVLYSISLNRSKIIKLIKESTGLEILDIKVLIR"
FT   gene            464531..464686
FT                   /locus_tag="BH0440"
FT   CDS_pept        464531..464686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0440"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16949"
FT                   /db_xref="GOA:B2S0E3"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0E3"
FT                   /protein_id="AAX16949.1"
FT                   /translation="MKRTYQPSRVKRNRKFGFRARMKTKGGRLILARRRAKGRSKLTVS
FT                   DERKKY"
FT   gene            464667..465011
FT                   /locus_tag="BH0441"
FT   CDS_pept        464667..465011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0441"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:BH0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16950"
FT                   /db_xref="GOA:B2S0E4"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0E4"
FT                   /protein_id="AAX16950.1"
FT                   /translation="MKERNISIKSKVEIQELFKKGRFIRIEGINVFYEFTCLAISRILV
FT                   TFPRIFKGAVKRNRVRRIFKECFRKQFALLKDRYVDFIFVVYPQKADVNYHEVETILKN
FT                   IVVYIMKRNM"
FT   gene            465008..466645
FT                   /locus_tag="BH0442"
FT   CDS_pept        465008..466645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0442"
FT                   /product="60 kDa inner membrane protein YidC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16951"
FT                   /db_xref="GOA:B2S0E5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0E5"
FT                   /protein_id="AAX16951.1"
FT                   /translation="MSQSKRILRAIYLSLFFIGIFMIIDDIFFSHKSPSVMDKEIGFNL
FT                   DKDFDIDNSSIDEDYALNLSANSKDIDVETGIYYATFSTFRGDLISLKLKDHLNLEKEP
FT                   TEMVKVNMDRESLFYVTLDNLTRDLFSYDRVDDYTHDFKTNFEYNGKFYEYIKRYTFSN
FT                   KGEYLIKLEIFLNNIDANDNSDIDSYKFVLSSDIEKLSERGKLQYNNYLSQAVYFDTKL
FT                   RYGKDGLSVISPKWVGSGTKYFEVLVSKENMNVEFKQESKILKAFILNKVGNKNISDTF
FT                   YIYAGPKDNGYLDLFNKEDLNSFGLSNVEFGMSVEKSLLYFIQVPMQLIMQIFYNVIPN
FT                   WGLSIMFLTIVVRILIFPLTFKSFRATAELSKLQPKMKEIQVKFKNDPKRLNEEMGKLY
FT                   REEGVNPLGGCFPILLQLPVFFALYGLVNNFFLLRGASFIPGWIDDLSIGDSIYYFGYK
FT                   VFMWTDIRILPFIMMVTQLISTIISSNVSFKSLGSQQKILYFGMPIMFFFILYDMPSGL
FT                   LIYWITTNIFTILQQYYIKMNVSERRNR"
FT   gene            466642..467364
FT                   /locus_tag="BH0443"
FT   CDS_pept        466642..467364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0443"
FT                   /product="Jag protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16952"
FT                   /protein_id="AAX16952.1"
FT                   /translation="MSYEFYGKTEQEAIKKAMRDLDLKEGEFDVEILDKEKVGFLFKKE
FT                   MIKIKVSPHVREDSLKSEVQVNEDVYNKALDFIQEMINKMGYYVDLKIESREGEYIKIS
FT                   IKTDSPNILIGREGRNLDALQLLANVYVSRLIGDNGNFNRIILDIEDYRERFKSRFINL
FT                   AINSLHKVKRSRRSILLPTMNPFERRIIHTTLNRYNDIKTESEGDGNLKRVRISYVRSS
FT                   KYNNNFRSYQKRDANVRK"
FT   gene            467517..468575
FT                   /locus_tag="BH0444"
FT   CDS_pept        467517..468575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0444"
FT                   /product="UDP-glucuronate 4-epimerase"
FT                   /EC_number="5.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:BH0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16953"
FT                   /protein_id="AAX16953.1"
FT                   /translation="MRVFLTGIAGFIGFHVAKRLADNGHEVLGVDVINDYYEPNLKYER
FT                   LKALGFDRENICGKKILQSNKYDNLSFICLDILNKEQVLSLFSRYKFTHVCHLAAQAGI
FT                   RDSIENPDSYISVNIVGFFNVLDACRIHKSHIEHFVYASTSAVYGINEKMPSDEDSITD
FT                   HPLNLYAASKKSNEVIAHAYSSSFNIPTTGLRFFTVYGPYGRPDMALYLFADGITKQTP
FT                   INVFNNGNMARDFTYVDDVVDGVYSVLKKPAESDRNFNTQNPNSSSSLAPYKIYNIGTG
FT                   HAIKLMEFIDELETNLGNKACKNFLPMQKADVVESCCSISKLKNDFAYEALTSIKEGIK
FT                   KFAHWYKSKIVK"
FT   gene            468727..469806
FT                   /locus_tag="BH0445"
FT   CDS_pept        468727..469806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0445"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:BH0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16954"
FT                   /protein_id="AAX16954.1"
FT                   /translation="MGVLDKIKPGVVYGKDLHTLYEICKSEGFAIPAINCVGTNSINAV
FT                   LEAAKEINSPIMIQFSNSGSAFVCGKGLKVEKPQGTSILGAISGAMHVHLLAEYYGVPV
FT                   VLHTDHCAKKLIPWVEGLLEYGEKYYQEHKRPLFSSHMLDLSEEPIKENIEISKKFLER
FT                   MSKIEMFLEIELGITGGEEDGVDNSDRAQHELFSTPEDIYYGYSELMKVSPNFQIAAAF
FT                   GNVHGVYKPGNVQLTPKVLRDGQNYVISKINSSNPKPVSYVFHGGSGSTMEEIHEALSY
FT                   GVVKMNIDTDAQWAAWEGLLNYYKKNENRLQGQLGDGSDADVPNKKFYDPRVWLRESEI
FT                   SMKERVKLACKNLNNINRN"
FT   gene            470034..470444
FT                   /locus_tag="BH0445A"
FT   CDS_pept        470034..470444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0445A"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0445A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16955"
FT                   /protein_id="AAX16955.1"
FT                   /translation="MWLTNYKKSFIDFLNDDFDFMRSGGVQNVPVNIKDKGKSFALEAY
FT                   LPGIKRDDISIVIKNDYLTISYESKDEAEEQNDQYLRVERRDISFSRSFRLSGNIDQNK
FT                   IKSELKNGVLLINLPKKPEVVEKTQEKKIVIE"
FT   gene            complement(470492..472249)
FT                   /locus_tag="BH0446"
FT   CDS_pept        complement(470492..472249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0446"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BH0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16956"
FT                   /db_xref="GOA:B2S0F0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0F0"
FT                   /protein_id="AAX16956.1"
FT                   /translation="MFKTIRCNQINDKLVNQRIEINAWVKKIRHHGKVTFINLRDRYDE
FT                   AQVLVSDENLLKITSQIKMEYCIKVQGTLELRPLELANKEMKTGAFEILAENIDIISRC
FT                   NELPFMIEDNNNANDNAKLEYRYLDLRREEQKQKIILRSKVTHIIRNYLTKKDFLELET
FT                   PTFVKSTPEGARDFLVPSRIHKGHFYALPQSPQIYKQLTMVAGLDKYFQIARCYRDEDS
FT                   RGDRQPEFTQLDLEMSFIKKENIFKLMENLMFTIFKNTLNIALPKKFKKMTYKHAMNTY
FT                   GSDKPDTRYELLIQDMSKHFKKSSFNVFQDMLQNKGTIKALIIKNQAHNFSRSKINNLE
FT                   EHAKIYKARGLYFAKIENNEFSGGIAKFLNEIKQTLIEAYSLANNDIIFFIADSWETAC
FT                   KAMGQVRIKIATELNLINKNIFEFLWIYDFPLFEYDEDTKSYQAAHHMFSLPKQKYIHT
FT                   LESNPSKVLGEVYDLVLNGMELGSGSIRVHTRELQQRIFNIVGFKNEIAEERFGFFLKA
FT                   LEYGAPIHGGIAIGIDRLLMLMTHSSSIKDVILFPKNSFAASPLDKSPSRISNEQLREL
FT                   NLTIENYKN"
FT   gene            complement(472253..474373)
FT                   /locus_tag="BH0447"
FT   CDS_pept        complement(472253..474373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0447"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16957"
FT                   /protein_id="AAX16957.1"
FT                   /translation="MNKKILYKTLFIINPILSFGMADYMKDTSNNIDAKISSFIMSLAI
FT                   IVISSSLLGNLVSKFGIPKVIGQITAGILLSPTFLGKIKMPLLFPLGIISVGENHLINE
FT                   EIFAISTIASIILLFMAGLETNLKLFLKFLPRGGLIGITEVIGTFTSFALISTILFDVQ
FT                   FISPTALFIGIIATPSSAGIAASILSAKKKMSTSEGVTIISTSIIDDVLSMIMLTSVIT
FT                   ITRSLSDLDIAISITATIKNILIWFCLTFILILLSEPISKLLKSFNSVTLATVITITFT
FT                   FIIASFFQNIGMSFVIGAYIFGLAMSKTDIVCVIQDKLTIFERFFIPVFFTSIGLMADI
FT                   NVILSKEVLILGTLLSLIAIATKLVYCFIPSYFLGFNKLGALRIAFGMVPRGEISLIIA
FT                   NVALSSEFISQKIFGMIIIIVFLPTIIATPIINILFQINKNGLKKEIKTEKNTQITVSF
FT                   KYDNLTKILVWDLKNELRNEGFFTQQIKNDFSQYINARRNDIALSIKREGSKITFECPN
FT                   KHLIIIQDLFRETILNLERITEEVKTVSVKAQKLDYSINYDKIRSNITLNKRIKKENII
FT                   LDLKATNKIEVLRELLSVIKVEIDKETILQDLMEREKLITTALKEGFAIPHLKTNLIKK
FT                   MHIAIGISHDGIDFNAIDNNLSHIFILILYPAKEHVNYPRILSSIVGKVGSNKKAMLKA
FT                   KTDKEIYNIIVG"
FT   gene            complement(474370..474651)
FT                   /locus_tag="BH0448"
FT   CDS_pept        complement(474370..474651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0448"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BH0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16958"
FT                   /protein_id="AAX16958.1"
FT                   /translation="MQTIIIEITNKEGLHARPSSMIAEFASKYPSCNIKLVTEDGREAD
FT                   AKSTVEIMILGVIYKEKIKIIANGKEATEIIDKLSKLLESNFKKEMKE"
FT   gene            complement(474666..474977)
FT                   /locus_tag="BH0449"
FT   CDS_pept        complement(474666..474977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0449"
FT                   /product="ribosome-associated factor Y"
FT                   /db_xref="EnsemblGenomes-Gn:BH0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16959"
FT                   /protein_id="AAX16959.1"
FT                   /translation="MKEKFMEPKIQAINYHLSNSTKDFIIKKLEKLGTHIKQNSESLKI
FT                   TIKKENDIFDIDAHLHFNWGKIIHIKEEGKELYHSIENLIERLQNTANKEKNKKDTVK"
FT   gene            complement(476190..476777)
FT                   /locus_tag="BH0451"
FT   CDS_pept        complement(476190..476777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0451"
FT                   /product="chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16960"
FT                   /protein_id="AAX16960.1"
FT                   /translation="MFGNIYSKEKIFPEKGTNLILINLFITFFKIGILNFGGGNGITTI
FT                   INKEIIANKEWITKEDFINIITISRITPGPVATNIATYVGAKVAGITGAIIATIGLITA
FT                   PILIITLITLILHKINFLNYYLENLKPVIIALWIMTIVILFESIFLKVSHNNIEILKSF
FT                   TLAGLNLIILLLYKNITPAILIISSGIIYIII"
FT   gene            complement(476720..477304)
FT                   /locus_tag="BH0452"
FT   CDS_pept        complement(476720..477304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0452"
FT                   /product="chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16961"
FT                   /protein_id="AAX16961.1"
FT                   /translation="MNKTKETSYELLTLFYLVLKTTTTTLGGGLLIISELRKTIVNKRK
FT                   LISEQDFNEILATSNVIPGVTAINFAFLVGKKLKGFKGAIILTIAGILPSIFVITIMAL
FT                   YINLNSNNIYFQKFLEGAKISSIIIMSMTILEFSKKMLKQSITKWTTCLLITYTLYKLH
FT                   IDLSYILLVFLFICLVTYTVKKRFSQKKAQI"
FT   gene            477478..478344
FT                   /locus_tag="BH0453"
FT   CDS_pept        477478..478344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0453"
FT                   /product="mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:BH0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16962"
FT                   /protein_id="AAX16962.1"
FT                   /translation="MNEQLGTLNLFKEISIFQDYINTIFETVLGYGLKVLVALLVWYIL
FT                   RFVIKRMGKFFFKAFEKSKLETKLDSTVLNFFKSFFAVMTDMVLILVILPYLGVPTTSV
FT                   FAIFGSLGLAVGLAAQGILSNFVSGFIVLNSNFFKIGDHISCDDVEGEVNDIQIFFTTL
FT                   KTVDGKIIKIPNSKFTSTSVTNFSANPKRRIAFSFQVPYDTDIDVLKSKIENLAFSVNR
FT                   EQYGVKDPSVIVKEYTPYYVVMQVRCFVKTEFFWDFQYFIAENIKGILSDMGIKFPIHI
FT                   VDFSKLH"
FT   gene            complement(478341..479492)
FT                   /locus_tag="BH0454"
FT   CDS_pept        complement(478341..479492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0454"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase"
FT                   /EC_number="2.4.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:BH0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16963"
FT                   /protein_id="AAX16963.1"
FT                   /translation="MKIAIFTDTYLPNKNGVATSIKQIKEGFERKGHTVYIFCPQSQKS
FT                   DLREEHIYRCFSIKLNRTLDANLAFPNEIKIKNIIQEYKPEIIHTHSEFTMGKIGKKLA
FT                   LQYNIPIVHTNHTMWDYYLHYLGILKYLIKPDKMMKQFYDQIHHFIYPSTKAHDKYFHL
FT                   AKNADYKIIPNGVDRNLFIKNLSQEKRQEILNKYGISTNDKIIISVGRINKEKNICLLM
FT                   EHLKKLLIENKNCKLILIGRGKEETKVRQFKKQYGLEKQIILIGTIPWEEMYYYYKISD
FT                   VFASLSKSEVYPMTIIEALTAGIPAVLINDIIYKDVIHQGKNGFLINNYEDIYKYMKEI
FT                   IENDEKLQTLKRTTEETSMMFSSSLFIEKIEQYYSEIINNSRY"
FT   gene            479552..480535
FT                   /locus_tag="BH0455"
FT   CDS_pept        479552..480535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0455"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16964"
FT                   /protein_id="AAX16964.1"
FT                   /translation="MQEIYLLLGKEQGLKEAYLNDIFNKLNADDICITKLFMSELSSYE
FT                   LSERLLTNSLFSKGEVFIIYESENLKNKKDLELIYSTILKPLNKIIIFISNENSISFDP
FT                   KGSLNIVKKTFYELSDTDKFVFVKKSFFKLGIKITDKAINLMLFMLDADTRILQFYINS
FT                   FALMIKNKTIDEHDINSWLSFVRIENSFSLFESILKKDMECALVKVKSILEQGEDLINI
FT                   LMSLGWQFKKFLKVKIDYESSNNISSVFKKHKIFVSLEKIYKIGLKNYSILDIKFILKI
FT                   LHKFDLYARIYGKNMHLNLSYFMISILLTKDDTILNNFSFKSECTF"
FT   gene            complement(480629..482437)
FT                   /locus_tag="BH0457"
FT   CDS_pept        complement(480629..482437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0457"
FT                   /product="excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:BH0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16965"
FT                   /db_xref="GOA:B2S0F9"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0F9"
FT                   /protein_id="AAX16965.1"
FT                   /translation="MREHLNHLHKKVQELPTTSGCYKMYSQNNKILYIGKAKNLRARVK
FT                   NYFLKRISHKTKILMRNVANIEVITTNSEYEALLLECNLIKEYKPDYNIKLKDDKGYPM
FT                   IRITCEKYPRIFKTRKIINDGSEYFGPYVNAKNLDLVLDLINKTFKTRKCKKKSKTPCL
FT                   YFHMGQCLGVCYREDLEEQYKKEVDKIRHILNGKISKLLDETEIKMKEAIKKEDFEAAI
FT                   KLKETKRSLIEISQTQIITRMNKLSADYIYIHQTDSLNAIVILKYKDGKLVEKDINFDE
FT                   SIYEEDELTAKFITQYYTALNMIVPNKIYIFKKIETENITKLINELKNTKTEIICEETK
FT                   ETIKIMEMAISNAKIALREYDNEKNRALESLKNILEMTKLPKTIEGFDISHLNGHKTVA
FT                   SLVSFKMGKPFKDGYRVYKINSLNNGEIDDLKAIKEVISRRYSKLINEQLALPDLILID
FT                   GGKGQLSAAYSILKGLKIENEVIVCALAKKEEIIFLPNKTQGIKLSKGNPALQILQNVR
FT                   DEAHRRANSFNRTLRRNIKLNYSKIKGIGEEKAKNILKTLGTYKDILLLNEDEIAKKMK
FT                   INIKMAKKIKKFSEDQNLKNTYSIKS"
FT   gene            482557..484074
FT                   /locus_tag="BH0458"
FT   CDS_pept        482557..484074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16966"
FT                   /protein_id="AAX16966.1"
FT                   /translation="MRLIFIFALFCSCISSVFSQELKLILDSKDGFKFIQEAHNVSFTK
FT                   GNRDVLGIYLGRYKGALDFNSVDFRLEIEKDNIVKDAALNYFVDSSNAKISNSFYNIAG
FT                   NSLIFYSSRNTIKFKPLTKKAFFYSGNVISDFTIQFWAYRSTSVTGEVIVSWNGYKNIK
FT                   GVWLDQAIRLESEGGTFVWNFNNVFLNNNGEPIKIKLKSDDDFIPKEWHLHTVRYRQKD
FT                   GLLEYLIDSKPQAIEYVTADKREGFGYLLNIGNFIDFALGQYFTGAIENFEIHKSFEDV
FT                   NSAFFSRDKGYIITEPIKLSKDYSQILSIEFDSVKPKDTDIFYYYRLDNKVFYETGKNG
FT                   EIKKNLTGDWIHFDPKNGFPKFDVSKYIQIKVEFYPSGDPVESPVLYGMIVTYIPEAAP
FT                   FPPLITKAVPGSGEILIEWFPVINSNIGGYYIYIGVSPGNYHGKAGSIFTSPIDVGNQT
FT                   SFRITGLENGRLYYVSVASYNLDKSVNEASFSKEISVRPMEFFEQYE"
FT   gene            484010..485374
FT                   /locus_tag="BH0459"
FT   CDS_pept        484010..485374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0459"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16967"
FT                   /protein_id="AAX16967.1"
FT                   /translation="MKRLFQKRFLSDLWSFLSNMNSINFEQALELYKKGDFKNALLNLD
FT                   VFDDSFDSLSLKSLIYFKLKDYKALLYVLDTYPVLNEYNFLIKLLHYGKFEGQEDELSY
FT                   FQNYNLGVFYFGLKDYEKSLSCFLKANKQHPSLIQAINNAAILFEILGRKDEAIQMIVK
FT                   AVDVDKNNALVKLNAWFLKNNCIFKDAKPFEIDESFKEANLSLIVNYLMYYLYFIGEIS
FT                   GAIKLSEKFLTDSSYSKYIWHNRATILHKIGNMTQATKSYVKAILSFPNIYTIYNMHIA
FT                   TIELLNFSPKRAIDRMLLDYPNMDLVYFYAFLFFLRNRELEDAHFYLKKLCEIKPDIYS
FT                   AFLNLLESREDILIEELLDEFAVFLKGKWTLEYLFFIDNSLNLKDPVFVFDYNTRLCPY
FT                   IWKIRDEHIELRASNNEVELAEKIFLDELTRIKLDVAIKEIRDLIDAYRDFRINY"
FT   gene            485443..485532
FT                   /locus_tag="BHT0010"
FT   tRNA            485443..485532
FT                   /locus_tag="BHT0010"
FT                   /product="tRNA-Ser"
FT   gene            485599..485685
FT                   /locus_tag="BHT0011"
FT   tRNA            485599..485685
FT                   /locus_tag="BHT0011"
FT                   /product="tRNA-Ser"
FT   gene            complement(485694..486404)
FT                   /locus_tag="BH0460"
FT   CDS_pept        complement(485694..486404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16968"
FT                   /protein_id="AAX16968.1"
FT                   /translation="MAIKLIIAIFLLMMSCTKHEEKIESTEINIETKIIKETITDENNN
FT                   IFHIDAQIPTIEGLELGFEEFIQEWKIYKTELLKTNKSKEYAYEFSYNSDFEIFKNPDL
FT                   KITSVLYSQYTIDKYDANGLTTYHPINLRGKAKIKLKDIISKDQLDSLMQVLREQVEKD
FT                   FRKFGIYSDNQSEFEKEFEKTFKQYKYYFKNNNVVIFYDPIVIRPHVDGKVEFIFPIDN
FT                   NTENQETDCPICSK"
FT   gene            486533..486606
FT                   /locus_tag="BHT0012"
FT   tRNA            486533..486606
FT                   /locus_tag="BHT0012"
FT                   /product="tRNA-Arg"
FT   gene            486622..486708
FT                   /locus_tag="BHT0013"
FT   tRNA            486622..486708
FT                   /locus_tag="BHT0013"
FT                   /product="tRNA-Ser"
FT   gene            486982..488634
FT                   /locus_tag="BH0461"
FT   CDS_pept        486982..488634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0461"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BH0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16969"
FT                   /protein_id="AAX16969.1"
FT                   /translation="MISARGTAIKRRPRDFNSLEGQDFVVETLKHSIENNRIANAYIFS
FT                   GPRGVGKTSSARAFARCLNCQAGPTIMPCGVCFSCKSIDNDNSLDIIEIDGASNTSVQD
FT                   VRQIKEEIMFPPASSKYRVYIIDEVHMLSNSAFNALLKTIEEPPSYIVFIFATTEVHKL
FT                   PDTIKSRCQHFNFRLLPLEKIYEMLKHVCLEDNIKYEDEALRWIAYKSGGSVRDAYTLF
FT                   DQIVSLSNSDINFEQIKSKMGLTSDEFLEKLALSILNDDLKELLCVLDAVFLTGISCEQ
FT                   FLLDAIEFFREILFLKLDIKNLMFIGIKLKSLKEKLSSFDLNHVERSISVLLETYRNLQ
FT                   FSVSPKYELEISFIKILRLKDYVPSHFLIKQIQDIEAKVLDEVSFDVNDVDVDTDLKSE
FT                   LGNIPSVDPVKLGLSKIDTALKTEVKDSRRIDFADGDDIDEIFIETKDSFDKVDDNDKI
FT                   KESFIYLVSKYVQTLVYSGEVLIDNGVLYYKIFSGFEYNQLQAYQNEIRAEFCKEFPRL
FT                   NVIFQKQFKDNDDEFDNEVLKIKNIFGASEVKD"
FT   gene            488638..488937
FT                   /locus_tag="BH0462"
FT   CDS_pept        488638..488937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16970"
FT                   /db_xref="GOA:B2S0G4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0G4"
FT                   /protein_id="AAX16970.1"
FT                   /translation="MAVNPLDFLKNMTSFKDNIDNLKKEMSQIVVCGRAGSDVIVVEMN
FT                   GEFLVKKVSIKEEFFSDLDNEALEHMIKSAFNDAISKVKEEIKSKTMGSMPFGI"
FT   gene            488941..489525
FT                   /locus_tag="BH0462A"
FT   CDS_pept        488941..489525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0462A"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BH0462A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16971"
FT                   /protein_id="AAX16971.1"
FT                   /translation="MIIQDLIVLVSKLPGIGKKTASRMVYDILYKGEEYAKNLGQILSN
FT                   LHSSIRKCKNCYNFAEEEFCDICMDLSRNKNVICVVEMPQDLEVIESTGEYDGFYFVLH
FT                   GHLDPLKDIGPNRLNLDKLEGYVGALEAQEVIIATEFSIEGDVTANYISSILKNLDINV
FT                   TRIASGLPVGGSISNADKMTTLRALRLRFNM"
FT   gene            489744..490253
FT                   /locus_tag="BH0463"
FT   CDS_pept        489744..490253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0463"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:BH0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16972"
FT                   /protein_id="AAX16972.1"
FT                   /translation="MSTLIQKTLCIIKPDGVRRGLIGNVISRFEKAGLKIVAAKMTLVN
FT                   RAMAEIHYLYDDIAVRHGEFVWRSLIDFIISSPVFVFVIEGVEAVEVVRKFCGSTEPKV
FT                   AALGTIRGDFAYHSFNYANEKKFAVYNVIHASASVDDALREIPIWFKEDEILTYKRNDE
FT                   LEHYYG"
FT   gene            490263..491081
FT                   /locus_tag="BH0463A"
FT   CDS_pept        490263..491081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0463A"
FT                   /product="modification methylase LlaDCHIA"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:BH0463A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16973"
FT                   /protein_id="AAX16973.1"
FT                   /translation="MSVAIRPVLKWAGGKKNLLKVILNNIPLSFNNYIEPFVGGGALFF
FT                   ALNLKNSIINDINSNLINFYREIAYNLDNFLLEVEKYNNAPLTKEHYVHIRNSFNNEDL
FT                   TNLEKACIFLYLNKTCYNGLYRENGDGRFNTPFGKYKKISLYEIKNLQLASKLLREVKV
FT                   LSLDFFCLLDFIKKDDFVYLDPPYIPYSKTSNFTNYSRYGFDVRMHEKLLHFCEEIDKK
FT                   GAKFLLSNSNTAFSLGLYKNYNVAFVDSKRFINANPGGRGSIREILVKNF"
FT   gene            491316..491852
FT                   /locus_tag="BH0464"
FT   CDS_pept        491316..491852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16974"
FT                   /protein_id="AAX16974.1"
FT                   /translation="MMRFALFYFLPLLFILNCTFDYDEHSGRAETAKETPSIQILGISY
FT                   HNVVGGKKQTVLEALSFNYFNYYKIYKVDNGRFLYHSLENRISGKFSSLEGSHVTKDLD
FT                   MKDSVELKIEDMNNYYLINTNRLLWKDNEKKLLSPPNESVFIRFDESNITGKGFSYFLK
FT                   NNNFYFYSGIEGLVK"
FT   gene            491849..492559
FT                   /locus_tag="BH0465"
FT   CDS_pept        491849..492559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16975"
FT                   /protein_id="AAX16975.1"
FT                   /translation="MRNLIICLVYITFLSGYAQDQKSFDKSEKLAEKLKTEDGTQKKGE
FT                   FTFRADFSYGIMSPLYRRIILKGNPEVISSDFKLRADEIEIYGEGSAYIEARGNVYYED
FT                   YVNKMNVKSQFLFVNRKLDSFYLQKGVELEDLENELVVKAERIEGSRKTSVYIMQYSVK
FT                   IYKGDIFARAENGIYNKEEKEIVLEGVPVIYQDDNYYSASRIVLNTETKKYNLEGDVEG
FT                   KFTQVEGDVPQQKK"
FT   gene            492495..493328
FT                   /locus_tag="BH0466"
FT   CDS_pept        492495..493328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0466"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16976"
FT                   /protein_id="AAX16976.1"
FT                   /translation="MRVMLKVNLLKWREMFPNRKNRIKSIKEKLSLGTVTDIVLKADNI
FT                   VKKYGEKLAVNGVTIDVHRGEVVGLLGPNGAGKTTTFYTIVGFIRANSGHVLINSHDIS
FT                   GLNMYERARLGIVYLPQEPSIFRELTVEDNILVALERREDLSQAERKMELVNLLNDFEI
FT                   KRIQHQKAYTLSGGERRRTEIARALAVSPYFLLLDEPFAGIDPIAIGDIKDIIRILKSK
FT                   NIGVLITDHNVRDAFDIIDRAYIIYQGQVLDEGNVDYVINSEKAKKLYLGEEFRL"
FT   gene            493325..494014
FT                   /locus_tag="BH0467"
FT   CDS_pept        493325..494014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0467"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16977"
FT                   /protein_id="AAX16977.1"
FT                   /translation="MRVVERKFYYEFELDSSIKLIYTKKPFDLDIRDINSDNLSFIPKD
FT                   KKIKYLKQLHTNVVYKVSDDFVNFQEGDGLVSSSCNVALLAYYADCLPIYMFDKSKKYI
FT                   GLAHSGYKGSFKLIILKMLLMFESMGSNFEDLKVIFGPYNRSCCYEVSSEFLSEVNLKF
FT                   SKKLLDISFCKKDDKIYFDNANFNLGLISNFNLDVEDSGLCTYCNYNLYSHRKFRGKRS
FT                   YASIWRI"
FT   gene            493914..494762
FT                   /locus_tag="BH0468"
FT   CDS_pept        493914..494762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0468"
FT                   /product="NIF3-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16978"
FT                   /protein_id="AAX16978.1"
FT                   /translation="MLRIQVCVLTVITIFILIESLGAREVTLRFGEFNLTVKELSSNLD
FT                   EIFKVKDYRNIDKSLNGLQVGNLELEVKRVALAVDASMATLRESKDYDFLITHHGIFWS
FT                   KSEKIVSGMYERVKWLIDNDLALYCVHLPMDAHSVYSHSKVFSDFLGFHSPIPFANYKG
FT                   FNLGIISIAGFNFSEILKRIETHNKHVLYYKKFKEYVEKVAIVSGSGYSFFEEALEHGV
FT                   DLFITGDTSHQIYPLAEEYGVNLIFAGHYFTETFGLIKLMEYFKIQKELEVNFILKDTN
FT                   L"
FT   gene            494772..495284
FT                   /locus_tag="BH0469"
FT   CDS_pept        494772..495284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0469"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:BH0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16979"
FT                   /db_xref="GOA:B2S0H3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0H3"
FT                   /protein_id="AAX16979.1"
FT                   /translation="MNIDRNRLIGSVIFIFILVFIDQWSKYLVVKYISIGTEYLSFFGD
FT                   FFKIIHVRNTGILFSIGANINSSLKNLFFLVIPIIILVFVFCFILKETNKIARIALILI
FT                   LSGGIGNIIDRLFRPLGVVDFLDVKFFGIFGLQRWPTFNFADSYVVIGITLFIIYDLFA
FT                   KNKSTDL"
FT   gene            495281..495508
FT                   /locus_tag="BH0469A"
FT   CDS_pept        495281..495508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0469A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0469A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16980"
FT                   /protein_id="AAX16980.1"
FT                   /translation="MNILYFILCSLINLALMFLVFFIEFLVIAKLNIIVSSVFQFILVF
FT                   FMIIISIVVSYFVSNIFFKNIISKFFNLDK"
FT   gene            495520..496341
FT                   /locus_tag="BH0471"
FT   CDS_pept        495520..496341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16981"
FT                   /protein_id="AAX16981.1"
FT                   /translation="MVSLRILVAGEVIGKPGIIVMKNFLSSFKQRNGIDFVISGNNFTT
FT                   GFRGLCKRHAFLLKKYGIDVLTLGENAFVRAGLSDELDKYNFILKPLNCPAKLKGYSYF
FT                   IYNVNGSKVAVIRLVGQTGITKYNFNNPFFAFDYFYEKIKLHTNNIIVLFDSNTTAEVN
FT                   AMFFYLKSRVSACLGIGKRILTADLRIFDHTAVITDLGRVGSLNSVIGYAPKFEIDKFL
FT                   RGFLNNRFTESWDGLGFNGVIVEINDGKAVMVEVVREYIDFDASLENSNNV"
FT   gene            496375..497688
FT                   /locus_tag="BH0472"
FT   CDS_pept        496375..497688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0472"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BH0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16982"
FT                   /protein_id="AAX16982.1"
FT                   /translation="MMQALFSLEVIMYSYLLEGGFKIGGKITASGNKNAALPCIVAALL
FT                   TDEEVILDNVPDIKDVEVILQILKDIGVEALREGNILKIKALNIMKTELDSSLTDLIRA
FT                   SILLVGPILARCGRIDIAPPGGDVIGKRRLDTHFYGLGKLGAKLIENKRIVLEIDKLVG
FT                   AEMFLDEASVTATENIIMAAVLAVGETVIMNAACEPHVQDLCSMLNAMGADISGIGSNM
FT                   LRIKGVKKLSGTRFRIGADFMQVGSLISLSALTGGELEINKADPKNFILIRHVYSRLGI
FT                   NFEYDNENIYVKEKQSLKVKLDFGGHIPKIDDGPWPAFPTDLMSIMIVTATQVQGTVLI
FT                   FEKMFESRMFFVDKLIKMGAQIVLCDPHRVVVTGKTILKGSNVSSPDVRAGMSLLIAAL
FT                   CAKGESRIQNVYQIERGYEDVVTKLSSLGAKIKRVKEQ"
FT   gene            497907..499253
FT                   /locus_tag="BH0473"
FT   CDS_pept        497907..499253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0473"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BH0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16983"
FT                   /protein_id="AAX16983.1"
FT                   /translation="MSISRTKIRKLILEDNLYRVLLVISFPIVATNVFQAFYEFADMFY
FT                   VGKLGAMPLAALSLTGPINFLIMVFAMGMATGSVSLMSRCIGEETFAKFSKYAGQLIFL
FT                   NFVLSLFVTVLVLIFIDLILDVMGVSGELKELAKSYFYVVIYAIPIMFLSIAVVYILNA
FT                   QGETVISMMLILVANIINFILDPILMFTCNLGIAGAAWSTLFAKLMTVFSYLFFTYRLN
FT                   CGLKVRLKDIVPDIAIIKNIINLGLPAAFGHVMASLSFLIFNYIVIQIGSKFLAAYGMA
FT                   NNIISFLLLPGMSIGTGIVSIVGQNLGAKNISRVEDTLKKGFLVTLIIMITVASFIISF
FT                   REIIIKIFTDDLEVFDYANRYLLLASIGTVGFGLQQVFFGGLIGVGLTKIVMIVSCIRL
FT                   WIVRLPVVFIFQYFGVIEDSLGYAFIISNYVALIIVLCLTFTRYWMKIQ"
FT   gene            complement(499497..499886)
FT                   /locus_tag="BH0475"
FT   CDS_pept        complement(499497..499886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16984"
FT                   /protein_id="AAX16984.1"
FT                   /translation="MSRHNLKHRLLNSITILIVSITISCIKNNSVKSKEISRDITHIIS
FT                   IKKNTEKIEIIRFHTNNKNELIITLKNNRKTDIKQNSLAIFKKGNKTGHLIKEGIKAEE
FT                   EKTFKLNININKKQKNIFYIFLKQD"
FT   gene            500276..501460
FT                   /locus_tag="BH0476"
FT   CDS_pept        500276..501460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0476"
FT                   /product="protein translation elongation factor Tu (EF-TU)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16985"
FT                   /db_xref="GOA:B2S0H9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0H9"
FT                   /protein_id="AAX16985.1"
FT                   /translation="MAKEVFQRTKPHMNVGTIGHVDHGKTTLTAAISIYCSKVNKDAKA
FT                   LKYEDIDNAPEEKARGITINARHIEYETAGRHYAHVDCPGHADYIKNMITGAAQMDAAI
FT                   LLVAADSGAEPQTKEHLLLAQRMGIKKIIVFLNKLDLADPELVELVEVEVLELVEKYGF
FT                   PGDTPIVKGSAFGAMSNPDDPEATKCIKELLETMDSYFDLPERDIDKPFLLAIEDVFSI
FT                   SGRGTVATGRIERGIIKVGQEVEIVGIRETRKTTVTGVEMFQKILEQGEAGDNVGLLLR
FT                   GVDKKDVERGQVIAAIGTITPHKKFKASIYCLTKEEGGRHKPFFSGYRPQFFFRTTDVT
FT                   GMVSLEGKEMVMPGDNVDIVVELISLIAMDKNVEFAVREGGRTVASGRILEILE"
FT   gene            501507..501818
FT                   /locus_tag="BH0477"
FT   CDS_pept        501507..501818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0477"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16986"
FT                   /db_xref="GOA:B2S0I0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0I0"
FT                   /protein_id="AAX16986.1"
FT                   /translation="MITKDKIRVRLFSFDVKILDQSAESIVRAVQKSKAQIKGPIPLPT
FT                   KIKKYTVLRSPHVNKKSREQFEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIKQ"
FT   gene            501854..502483
FT                   /locus_tag="BH0478"
FT   CDS_pept        501854..502483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0478"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16987"
FT                   /db_xref="GOA:B2S0I1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0I1"
FT                   /protein_id="AAX16987.1"
FT                   /translation="MLGLIGKKVGMTQVFQGNGVVVPVTVIEFEPNYIIGKKTVERDGY
FT                   DALIMGSVDLKSSKISKPIKGQYKNLENVEPKKYVIEFKGLKGYDAGDEVGLDAFKEIK
FT                   YVDITGTTKGKGFQGAMKRHNFSGGPSSHGSKFHRHLGSTGQAATPSRTFKGTKMAGRM
FT                   GGEQQTIQNLEVVFIDEEKRAILVKGAVPGVKGSFVIVKKAKKVGV"
FT   gene            502446..503114
FT                   /locus_tag="BH0479"
FT   CDS_pept        502446..503114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0479"
FT                   /product="LSU ribosomal protein L1E"
FT                   /note="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16988"
FT                   /protein_id="AAX16988.1"
FT                   /translation="MLLLKRQKKWVFSMERKVFSKDGQELRTIDLEDRVFNIDISYGSI
FT                   YNAINNELANLRVGTASTKTRSEVRGSSKKPWKQKGTGRARVGTKRNPIWVGGGIALGP
FT                   KPRDYSYKLPRKVKRLAFRSVLSLCASAEDRLKIVENFTIESGKTRELASIMKHFVKIN
FT                   GKTVILLGNDDQMVKRAGRNIRDLKILSFNRLRVVDLFYAKNLIALESAVNGLNELYVK
FT                   "
FT   gene            503136..503432
FT                   /locus_tag="BH0480"
FT   CDS_pept        503136..503432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0480"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16989"
FT                   /protein_id="AAX16989.1"
FT                   /translation="MKAYDIIISPMLTEKTNIQRENMNVYAFKVKKQANKKEIGAAIKE
FT                   LFNVTPMSCNLLNVKSKVKTVVSRKGYPIGKGKTSSWKKAYVYLKKEDKIDIF"
FT   gene            503438..504283
FT                   /locus_tag="BH0481"
FT   CDS_pept        503438..504283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0481"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16990"
FT                   /protein_id="AAX16990.1"
FT                   /translation="MEKNMGIKTYRPKTSSLRYKTTLSFDELSKGNNPLKSLTRGKVSR
FT                   AGRDSSGRISVRRRGGGHKRRYREIDFGRRDKFGIPARVVSIEYDPNRSSNIALLVYKD
FT                   GDKRYIIAPKGIKVGDILESGPNSPIRIGNALPLENIPVGKTVHNIELNIGKGGQLVRG
FT                   AGGYAMVLASEGDYVTVKLPSGEMRMIFKKCMATLGEVGNEDYVNVSIGKAGKSRWLGR
FT                   RPKVRGVAMNPVDHPHGGGEGKTSGGRHPVSPWGQPTKGYKTRKKKKYSDKFIIKRRNK
FT                   "
FT   gene            504293..504571
FT                   /locus_tag="BH0482"
FT   CDS_pept        504293..504571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0482"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16991"
FT                   /db_xref="GOA:B2S0I5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0I5"
FT                   /protein_id="AAX16991.1"
FT                   /translation="MARSIKKGPFIEKSLYQKVLASSGREKRVVIKTYSRASTIIPEMV
FT                   SLTISVYNGKSFIPVYITEDLVGHKLGEFSPTRIFRGHAKSDKKGRK"
FT   gene            504577..504939
FT                   /locus_tag="BH0483"
FT   CDS_pept        504577..504939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0483"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16992"
FT                   /db_xref="GOA:B2S0I6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0I6"
FT                   /protein_id="AAX16992.1"
FT                   /translation="MFVNRRYTARGKNLPSSPKKVRPIADNIRGKPYTEAVAILYSMPN
FT                   KGAKLLGKVVKSAASNAMYHNRNLSEDMIFVKTVMVDDGRKRRSIWPRARGRADRLVNR
FT                   SCHIFVEVYEKMYGGE"
FT   gene            504943..505773
FT                   /locus_tag="BH0484"
FT   CDS_pept        504943..505773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0484"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16993"
FT                   /db_xref="GOA:B2S0I7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0I7"
FT                   /protein_id="AAX16993.1"
FT                   /translation="MGQKVHPYSLRIKINRDWKSKWYFDKKLYSEILHEDFLIRRETMK
FT                   FFKGIRFDISDIEIIRNNLQRVTVVVSTPRPGSVIGVKGANLEKIGQLLTRKISKKINI
FT                   KIKEIKKPEFDAQIVANGIAKQLENRASYRKLLKSSLLSSISKGVQGVKIKVSGRLGGA
FT                   EIARSFEVKEGRVPLHTLRANIDYGFAEAQTTYGVIGVKVWLFKGEVLGKQTNSDAGQV
FT                   INRKSSREKSEHFDRSRVDDRGRKVLNDDKFSKEKLELGSKSNNDFKKKNGSDV"
FT   gene            505793..506209
FT                   /locus_tag="BH0485"
FT   CDS_pept        505793..506209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0485"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16994"
FT                   /db_xref="GOA:B2S0I8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0I8"
FT                   /protein_id="AAX16994.1"
FT                   /translation="MLSPKKVKYRKKQRGRLSGEAHKGNKISFGEYGLVSLDTYFITAR
FT                   QIEAARVAMTRRVKRGGKVWIRIFPDVPYTKKPAETRMGKGKGGVDHWNAPVKIGTVMF
FT                   EMAGVPRELAEAAMMLASSKLPVKTTFVVRRDLR"
FT   gene            506213..506413
FT                   /locus_tag="BH0486"
FT   CDS_pept        506213..506413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0486"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16995"
FT                   /db_xref="GOA:B2S0I9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0I9"
FT                   /protein_id="AAX16995.1"
FT                   /translation="MLKKFKDLTLEDMKARRLALRKEYMDLRFKAVVGHVENPLKKREL
FT                   RRDIARLNTIIHEYAIGIRKV"
FT   gene            506419..506673
FT                   /locus_tag="BH0487"
FT   CDS_pept        506419..506673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0487"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16996"
FT                   /db_xref="GOA:B2S0J0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0J0"
FT                   /protein_id="AAX16996.1"
FT                   /translation="MARENKKDLIGKVVSDKMSKTIVVEIVQRKMHPIYHKYLKVSRRV
FT                   KAHDEREESRLGDKVRIIESRPISKEKRWMLVEILERSK"
FT   gene            506698..507072
FT                   /locus_tag="BH0488"
FT   CDS_pept        506698..507072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0488"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16997"
FT                   /db_xref="GOA:B2S0J1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0J1"
FT                   /protein_id="AAX16997.1"
FT                   /translation="MIMVQIQTYLTVADNTGGKIAQCIKVLGGSKKRYARVGDIIVVAV
FT                   KQAIPNSPVKKGDVHKAVVVRTSKEIRRKNGTYVRFDDNACVILDANLNPRGKRVFGPV
FT                   ARELRDANFMKVVSLASEVI"
FT   gene            507083..507388
FT                   /locus_tag="BH0489"
FT   CDS_pept        507083..507388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0489"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16998"
FT                   /db_xref="GOA:B2S0J2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0J2"
FT                   /protein_id="AAX16998.1"
FT                   /translation="MKTKLKVGDNVKILCGKDRGKTGEIVSIDRKNLKVVVKSCNMVKK
FT                   VIKARTPQEKSKIIDKEAPVDISNVMLFSNGITSRVGIKFENKEKKRYLKKNGENV"
FT   gene            507392..507940
FT                   /locus_tag="BH0490"
FT   CDS_pept        507392..507940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0490"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAX16999"
FT                   /db_xref="GOA:B2S0J3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0J3"
FT                   /protein_id="AAX16999.1"
FT                   /translation="MSYVPELKRHYKDNVIKELVSEFQYKSIMQAPKIEKIVVSMGVGD
FT                   AVKNKKLLDSAISELSQITGQRAVKTKAKKAIAGFKIRQGQDIGAKVTLRGNIMYEFLY
FT                   KLINLALPRVKDFRGVDGNAFDGNGNYSFGIAEQIIFSEIDYDKIERISGLNVTIVTTA
FT                   LNDKEGKALLSKFGMPFSN"
FT   gene            507955..508140
FT                   /locus_tag="BH0491"
FT   CDS_pept        507955..508140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0491"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17000"
FT                   /db_xref="GOA:B2S0J4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0J4"
FT                   /protein_id="AAX17000.1"
FT                   /translation="MAKKSMIVKALRKPKYKTRQKNRCKLCGRPKGYMRDFGMCRICFR
FT                   NHASAGLIPGVSKSSW"
FT   gene            508150..508548
FT                   /locus_tag="BH0492"
FT   CDS_pept        508150..508548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0492"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17001"
FT                   /db_xref="GOA:B2S0J5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0J5"
FT                   /protein_id="AAX17001.1"
FT                   /translation="MAVTHSVGDMLTKIRNASRVKHESVDLKMSKINKSILDILREEGY
FT                   IKGYNIFDNKGISFIKAILNYDSKRNPAINRIDAISTPGRKVYSSYKNMPRIKNGYGIL
FT                   IVSSSKGVITGKQAKDNKVGGELICSVW"
FT   gene            508570..509112
FT                   /locus_tag="BH0493"
FT   CDS_pept        508570..509112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0493"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17002"
FT                   /db_xref="GOA:B2S0J6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0J6"
FT                   /protein_id="AAX17002.1"
FT                   /translation="MSRIGKLPIKIVDSVKVDINDNIVTVEGKRGKLSQEINSRIRVRV
FT                   EDSNIIVERSLDDKQTRAFHGLYRSLIFNMVKGVSDGFSKSLTINGIGYRVEQQGTSLF
FT                   FNLGYSTQFEYVIPEGVNIRLEGNTKIAVEGIDKCRVGQVAAEIRSLRVPEPYKGKGIR
FT                   YDNEVSRRKVGKSGVKK"
FT   gene            509130..509489
FT                   /locus_tag="BH0494"
FT   CDS_pept        509130..509489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0494"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17003"
FT                   /db_xref="GOA:B2S0J7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0J7"
FT                   /protein_id="AAX17003.1"
FT                   /translation="MKKVKEAEKRNIKRKKRIRDRIGFGVADRPRVTVFKSNKYFYVQV
FT                   IDDMAGHTLASVSTIEKDLKLNKNIDDVKKLGEVLAKRLKDKNISRLIFDRNGYKYHGL
FT                   IASFATSLREAGIDV"
FT   gene            509501..509995
FT                   /locus_tag="BH0495"
FT   CDS_pept        509501..509995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0495"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17004"
FT                   /protein_id="AAX17004.1"
FT                   /translation="MEAQVHKKQIEKLISLNRVTKVVKGGRRFSFSAFMVVGDGEGHVG
FT                   WGFGKANDASDAIKKSLTNARKNLRSVPIKRGTLPNMVIGDFKKAKVLIKPATQGTGII
FT                   AGGPVRAVMEALGVHDILSKSLGSNNSMNVVKATFKAFDLVLDARKVAAIRGKTLRTLW
FT                   S"
FT   gene            509999..510310
FT                   /locus_tag="BH0496"
FT   CDS_pept        509999..510310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0496"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17005"
FT                   /db_xref="GOA:B2S0J9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0J9"
FT                   /protein_id="AAX17005.1"
FT                   /translation="MIKRKLRLQLKKIRFKASRSRAKNRAFIQKMAINREILAKSDIKV
FT                   EVELKRSLIGKLDSKVKTLKALGLKRIGDRKIHVLNKSLQGMLNSVISMVLLSEVKNG"
FT   gene            510303..510740
FT                   /locus_tag="BH0497"
FT   CDS_pept        510303..510740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0497"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17006"
FT                   /protein_id="AAX17006.1"
FT                   /translation="MVKLRRPSGANKSRKIVGRGPGSGLGKTSGRGQKGQKARNSSPRI
FT                   GFEGGQTPLYRRLPRRGFSNHDYKVKYEIVGLGDIDRKFETGDLVNYSTLLEKGLVGKN
FT                   KKKIKILANGGLTKKVNFEVTRISKSAEELATKIGCSIKLL"
FT   gene            510753..512057
FT                   /locus_tag="BH0498"
FT   CDS_pept        510753..512057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0498"
FT                   /product="protein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BH0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17007"
FT                   /protein_id="AAX17007.1"
FT                   /translation="MKGLFFNLFSIKDLRSKFLFTLFILFIFRVGSYLPIPGVDPVALR
FT                   SYFKSQSDFSITNYFDFFSGGAFSNFSIFMLSIGPYISASIIIQLLVYSFPSLKKMQEG
FT                   DNGRKKIKKYTKYLTIVAAVAQGYATSLYAKSIPGALNIPFYRYIFIAILTVTTGTFVL
FT                   LWLGEQINQRGIGNGVSLIIFSGIVVRLQAALFNLFQSMRDPLQNINPVFVILVLGVFI
FT                   LVVILIIYEYKAQRRIAIHYARANSRNTVSSYLPIKLNPSGVLPVIFASVLITLPLQIL
FT                   SGFAGTSALSRQILSYLRPNGLYYTLLNVVLIIGFTYFYSKIQLSPKDISNNIRKNGGT
FT                   IPGIKADEMEGYLDKIMNRTLFSGSIFLSIIAIIPFLVQNIFRFPYDVSRIMGSSSLLI
FT                   MVGVALDTLIQIDAYLKTQGLSRGTGKKYAFLQKI"
FT   gene            512067..512180
FT                   /locus_tag="BH0499"
FT   CDS_pept        512067..512180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0499"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17008"
FT                   /db_xref="GOA:B2S0K2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0K2"
FT                   /protein_id="AAX17008.1"
FT                   /translation="MKVRVSVKPICEKCKVIKRKGVLRIICDNLKHKQRQK"
FT   gene            512190..512567
FT                   /locus_tag="BH0500"
FT   CDS_pept        512190..512567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0500"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17009"
FT                   /db_xref="GOA:B2S0K3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0K3"
FT                   /protein_id="AAX17009.1"
FT                   /translation="MARIAGIDLPNNKQLQIALTSIYGIGRARALEICEKTGVLPDKRA
FT                   KELDNDEVNKLRKIIESDYVVEGKLRSELAMSIKRLMDIACYRGLRHRKGLPLRGQRTK
FT                   TNARTRKGKRKTVANKKMASK"
FT   gene            512598..512987
FT                   /locus_tag="BH0501"
FT   CDS_pept        512598..512987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0501"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17010"
FT                   /protein_id="AAX17010.1"
FT                   /translation="MSAKVSTNKKKVKRSIGEGNVYIQATFNNTIVTVSDIRGNTLAWA
FT                   SAGGMGFKGAKKSTPYAAQMTAEAALGKVKDFGINYVHVFVKGPGIGRESAIRAVGSTG
FT                   IIVKSISDVTPIPHNGCRPKKTRRV"
FT   gene            513000..514034
FT                   /locus_tag="BH0502"
FT   CDS_pept        513000..514034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0502"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BH0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17011"
FT                   /protein_id="AAX17011.1"
FT                   /translation="MMSLGKLLKDFTIPDRIEFLRGEDDGSYGKFIIYPFEKGFGVTIG
FT                   NTLRRVLLSSIEGYAISAMRIQSNQGGSLKIVSSEFDLIPGVVEDTLEVIANIKNIHLK
FT                   LDEGVKSATISVSVNGKDTNVLKAVHLEREGVEVCNKDLVIATLSSEANLDFEFQVDYG
FT                   RGYVSSEHNAKYLEEVNTIALDSIFSPIEKVTYSVEDTRVGQRSDYDKLVMEIWTTGVI
FT                   SAKDAIKKAASIVREFLLPLVNFEDKVVHSVDDSEFRDSDILNMNIEKLNLSVRSLNCL
FT                   TKENVKTLGELISKSAEELSKARNFGKKSLEEIVEKLSVYGLFLGMSKTEALKILNKND
FT                   KISH"
FT   gene            514053..514424
FT                   /locus_tag="BH0503"
FT   CDS_pept        514053..514424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0503"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17012"
FT                   /db_xref="GOA:B2S0K6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0K6"
FT                   /protein_id="AAX17012.1"
FT                   /translation="MKTKVGFNRLNRKSSHRKALLKNMVISLFKHEKITSTKAKLSEVK
FT                   RFAEKLITRAKIDSVHNRREVSKFIHDKFILNKLFTKISPIFKERKGGYVRVIKLGRRY
FT                   GDAAEMAILELVDKTLEEK"
FT   gene            514502..516043
FT                   /locus_tag="BH0504"
FT   CDS_pept        514502..516043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0504"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17013"
FT                   /protein_id="AAX17013.1"
FT                   /translation="MSYITFSSILAGILGIVLGFVIRIILGRFSLLNLDKKLKKVQEEA
FT                   ILEIENERKRVISHTKAQMLKEKNQQDREIRERKNEVFNLERRLLQREETLDKRISALD
FT                   KQQSRIDFKLKEFEQKEKIIRDKELSLVKKLENIAGLTKEEARKIVIERVENESKRDAQ
FT                   IIINKSEQEAQLLADKVAKDILVSTMQRIVTEVSSEFTVTAVELPNDEMKGRIIGKEGR
FT                   NIRVLETLIGADIIIDDTPEAVVISCFDPVRKEIAKRTLERLVADGRIHPARIEEIVYS
FT                   VTNEINNIILEEGEKAVFDLNIHGFDKRLIRGLGRLYFRSSYGQNVLSHSKETAIIGEI
FT                   LAKEMKLDPVVVKRACLLHDIGKGMESISENSEGHAITGAELAQSCGESDIVVNAIAAH
FT                   HNEIKPESFEAIIVQIADAISASRPGARRESLNNYISRLKRLEEIAYGFEGVQKCYAIQ
FT                   AGREVRIIVDNLLVNDEKATMLARDIAKKIEVEMRYPGKIKVTIIRETRVIEYAR"
FT   gene            516012..516824
FT                   /locus_tag="BH0505"
FT   CDS_pept        516012..516824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17014"
FT                   /protein_id="AAX17014.1"
FT                   /translation="MRLELLSMQDNDVIRALIIGDIIGDGGLKKIFFNLKSLKEKYNID
FT                   LAIVNGENSSGGFGITPEIAENLFKAGVNVITTGNHVYAESSIREYLDKQEYILRPNNF
FT                   SDLLEGHGYCILNVKNEKVAVINIQGFLGMTFIVKNPFENIKKVVNMIRNKVKTIFVDF
FT                   HAESNYEKESFGYFLNGLVTGVVGTHTHIMTQDERILDKGTAYISDLGMTGSLNSVIGF
FT                   NPEISLKGLLEYVALRTETVEDDVIIQGVVITSHLKTGRALKIERIQK"
FT   gene            516805..517596
FT                   /locus_tag="BH0506"
FT   CDS_pept        516805..517596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0506"
FT                   /product="putative cell adhesion protein"
FT                   /note="contact hemolysin TlyA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17015"
FT                   /protein_id="AAX17015.1"
FT                   /translation="MKEYRNSLLNVLCKTYPSLTREELRVLILTGRVYVNSHKERNPKV
FT                   LLLRNSKIDLVENKSRQFVSRGGFKLFESLETFKITLKDKICIDVGASTGGFTDCLLQE
FT                   GAKLVYAVDVGFNQLSYKLRVDPRVRVFEKTNIFDIQQFDMQPNLAVIDVSFRSVVSIC
FT                   ADLIDRLSDRLIVALVKPQFELKGLDLDIKDFNGVVENRYLSEILEKVIRKFYDNNLQI
FT                   KNILKLTIKGRKGNQEFMFLVVKDSSINLAQSLALIGDINF"
FT   gene            complement(517593..518351)
FT                   /locus_tag="BH0507"
FT   CDS_pept        complement(517593..518351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0507"
FT                   /product="germination protein GerM"
FT                   /db_xref="EnsemblGenomes-Gn:BH0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17016"
FT                   /protein_id="AAX17016.1"
FT                   /translation="MIRKKRNSKRKKSSFNQIDIFLILFAIFLTGLCLLLIIQNSLIKN
FT                   IFNEQIDNNDNFEFSQSKPNKIEARLDNTKNETIKILSNENFLIKPPEIQKIEEEFKYQ
FT                   EQKHLKNKKEVKLYFIKVTAEGHFLKQGIKRTIQYDKNILKETLKALINGPNEYELKNN
FT                   FLSLIPINTKVLNLSISDGIAHINLSKEFYENSFGVEGTINQIKQIISTCLEIQGINGI
FT                   TLKIENNPIILEDLNLNFSGILDNTKLAKY"
FT   gene            518438..519754
FT                   /locus_tag="BH0508"
FT   CDS_pept        518438..519754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0508"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17017"
FT                   /protein_id="AAX17017.1"
FT                   /translation="MINSKVQNYKSVLIAGRPNVGKSTLFNKLLSSNRSITDEVYGVTR
FT                   DLVKEVCTVDSYKFYLIDAGGFTLLRDELSRIVVNKVISLLDSIDLILLVLDVNEMLLE
FT                   DYELIEKLRKYSDKIVLVLNKIDSNHKEVLTYEFQKLGFKKSFLVSATHGKGINSLRIF
FT                   LKNSVGKLASEDNTDVKIGIIGKPNSGKSTLINFLAGDEVSIVSPIAGTTRDFIKARFQ
FT                   RNGKIFELIDTAGIRRRARVNELVEHYSVSRALRVIDMVDIVFLLVDVKEELTAQDKKI
FT                   AHYATKRGKGIIIVFTKWDLVDSKSGYFEALKSRVKFFFPVLSFSPILKISVHKKVGLD
FT                   NLFKEAIKLKKQLELKMNTSDLNKMLSLWIKDYHLNASHKVKYMTQISVNPVKFILFAN
FT                   KITNFPNSYYNYLVNNIRKIGYYNIPILIELREKTRDLK"
FT   gene            519751..521004
FT                   /locus_tag="BH0509"
FT   CDS_pept        519751..521004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17018"
FT                   /protein_id="AAX17018.1"
FT                   /translation="MRYIFLFLIVGNLNLFAFENFLYDFSVRANYAKYFNSSNTFFKIK
FT                   SQKYYIEDNYYVEVSNSILGDYAYYSFFNRKNGVSYIFPGSYVIKVGRYGIEQVKIFFL
FT                   NRADTFIRIKAGDVHSSADFYLINTLIYKDIKLPFKISDIATGSFLEIARYISDFIDFE
FT                   LFNPKYLEAYDNIYNIVESLRAFLKSSPLMIEMHDGAMNELGEMVYIKTGEPQREPVGF
FT                   NCSGFGKWVADSIYRAMTGKLLKIEDLKVKHIGIRGNSFTKYYEFSRDPFFGLDWTRNI
FT                   AYKLKNIHAALDLSRVKESDVNSVGFIKYVENRGYEIDNLEFILYYLAVKEPGHMYFGS
FT                   INTTIKGFPGKVFHKHVVVLFPFIDRESIFRVSLMEINDETSIKSLRGRYPNSYIHLVK
FT                   VKVPKNVSIVSIPGRINN"
FT   gene            521010..521696
FT                   /locus_tag="BH0511"
FT   CDS_pept        521010..521696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0511"
FT                   /product="phosphocarrier protein HPr-phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17019"
FT                   /protein_id="AAX17019.1"
FT                   /translation="MIKAVVFDLDGTLYPEMGINLVMFPEFLKNIKFFLAFKKVRKEIR
FT                   VLQSGRSVPSSRDELISMQVEMLANYLGFNKNRCEFLLNKIYYGESFSNKFRNLKPYFG
FT                   VRDLIYSLKSKGIKLGVMSDFPIATRVSNLLRIEDSFWDVLYSSEDTGYLKPNKIAFLR
FT                   IIDELGIDSNHILYVGNSYEYDILGASGVRMRTAYLSKRRLLEDMKCDFIFSNYKDLQR
FT                   YILLNI"
FT   gene            521700..528899
FT                   /locus_tag="BH0512"
FT   CDS_pept        521700..528899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0512"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17020"
FT                   /protein_id="AAX17020.1"
FT                   /translation="MGKIFMIDFVTILVNLLLVFVILFIYRQYDRRSRALEKIKKFIDL
FT                   AKDNLEDFIDEKTKEISNLAVDMEAYQRSSIEIIKKIDEVQQKIKNKSNDFAEVEKKIA
FT                   YHDSMLKDLDDMALKVQDNIQRLQVDGKIVDKLSKTLKNFNTQIDSIDSRLNTVFEKFD
FT                   KANKENLEAIKIESWDKFDNTIKDFSVRMDNLDRDLMSYQESLVMIEEKKREILDKGNE
FT                   KLENEFKEFLFKIESSIDNYDKSMEDSFNIYATKYKSIENSLDLIVEQAKTKINDKEDF
FT                   ILTRLNEELQIKFDEVFMYVDERSNQIRDKLEGKLVLIDNEISSLGSVFKDNTYSRLNS
FT                   LEETIRQEMRQYEEQFADILEQFRVQIESNVGDIYREYDSRINQFDKGIRERIESSLKD
FT                   ANSKIEGVQGSVKTLLDDLEDDSNRIYVEFKEKVKGDINSFSENVFSRMSDIGNELELR
FT                   LSHISTDIHDRISKLDGNLYSQLKEMNERFVNDYSCLDGSISSKYETLLEALNLKSSEL
FT                   ETQLESKYKNVADKFESDIDNFAIKCDEKFSKISEKSDYDYQNFEITSKKIKEGIGSLN
FT                   DLLVQDFETLRRDFESKLSGISADINDEVSNLKSHYGEDIGKFIRQMEANKLQHEHWQR
FT                   EVGLNLEDIKFHLNKTNEEFLNLIETQRTKGKELSENIFNELSGHIQKKAMDMHTNWKD
FT                   ELIVLNKSLLDIKISSEELLLSASSKIESFEKDINERLEYVSSKTEDFESSVLDKYKEL
FT                   RDMSYKNSEETLSGIKEFIDDQAEIIHDKIIMMLNGLNDDFSNKEELIKGKVEELDYRL
FT                   KDFKVECEDVLNNLRSDLDGFIESRMQKVSEIKVDNQRQIDTFLSRISEDILSKRDMLN
FT                   SEIDNKLNDWQGKLSEISVNIENILSSGKIDINAIDSEMTLKIKDLKTTFEGLESYYLE
FT                   KIDEFRNQGNVYADELLKNIMNHFDADTKELEESLSKKFATVLERSEEFVKEVDSLLKD
FT                   KRTDISSFQASIDITIDSLNSRFSDLNREINEKYSKVISDSRGYSETLANKLESEIGYE
FT                   IENVNRRLTDKIDILNRNMDENLEKFKSSFDVSKYQVENFEIKIKNIIEHEELRIGEFF
FT                   REIEHQYKIRREEAIDYKKTIDSDILQLREQFIGVINELKNNIEDKSEFLNELYKERFK
FT                   IIENNFEERYSTFFIESEGAISKIRDEIYKILTDNDEHLRAKISEMDRNFEIIEERSKE
FT                   ILELEEGLRQKIQEDSNNIYNQFDAIKSGIEKEMKSQFDMYMMRATAAIDEEIEKYEHG
FT                   INEKISAIKSIENHFEMIEKDLKDKISGYHNELDKTLALKYAELEDKYDEKYLFVEKKI
FT                   DDKTTSIDGLIASKYAELEDKYDEKYLLVEKKIDDKTTSIDGLIASKYAALEDKYDEKY
FT                   LLVEKKIDDKTTSIDSLIASKYAALEDKYDEKCLLVEKKIDDKTNAVDGLIASKYVELE
FT                   DKYDEKYLFVEKKIDDKTTSIDGLIASKYAALEDKYDEKCLLVEKKIDDKTTSIDGLIA
FT                   SKYAELEDKYDEKYLFVEKKIDDKTTSIDGLIASKYAELEDKYDEKYLLVEKKIDDKTT
FT                   SIDGLIASKYADLDIKYSDMYLDMENRLNTCISALTAKLSSSGERMEREINEQLQNLGK
FT                   LKLSLSNVEEDVLKLKEDSYHNVSSHLKLLEEDFFKDLRERSDNLKSSLENFVASSDQR
FT                   IENLERDIIKSLEEKEILMKNFKVEFERELLLNKENFYLEFNKEFDIRKRDAESKIVSM
FT                   ETNVTNRIDEFIQLVDNRQDNVDSWFLKVKDDMTNWQEHTYKEFEERAGITAKSLNEIK
FT                   SDVLVIENGLEVIKDSVNQRTKEIFDRLHVDIKEFENRSYLNLKNISDEVQGRVLNIEN
FT                   SMDSKISSINEKINSHVEELATQVEIRFLSQQKDIEDKILEANEKLEYEFNLMASRLEE
FT                   EKQDIVNSFLNDKGGVESQVKLMQDDVLKLSDKVNEYRANIEKTIRENYDSFTSSIREE
FT                   YVSFENELKHSLSYSEEEIRTLRDGLKVQVNSIESEFKDKYNFMIEGIDENVSQLKLKV
FT                   LNYDSELNHFIDEVKDNLIVYKADLKEELDSRYAVISSKLENFKRLEVELEKNNVLIKE
FT                   VYYFKDKLEELREALANEINLVQGYKGDFEGIIREIGDIKAKSSDIIEIFDDLKMHQMD
FT                   IEGIKKDLSQFLEFYTSFKERYKKFTESYDEMQLYKTKFKEIKEEQNNILDNYDRISNK
FT                   DSLLKSTLESVDKNFDLINEIESRMHVLFKESSGFQQSLGELKGIMSELLVNKDLSQEV
FT                   LDNAQTLKEMLGEIDRKLEHTRNIREKVAKSETRLENLNIAAEERIKTLGILVKTESKY
FT                   KDNVGLNNETVRDSVIKLMRQGWSALEISRATKLSVGEVELILELGIISKSDD"
FT   gene            528911..530458
FT                   /locus_tag="BH0513"
FT   CDS_pept        528911..530458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0513"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BH0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17021"
FT                   /protein_id="AAX17021.1"
FT                   /translation="MENKFEVVKTLHPLEIKVILNYKEGDDIFALRLAADLLYNEGQSN
FT                   KTIEWLVSKGILRETFRKLNVFYRLTEKGIDALDNGLIEEKIISLVSRKTVFVANLSSE
FT                   LEIDARDAGKAFGNLSKEGVLSLGLGKEIIVKDLNRANYKIVKELLVKAKDGDLLEDDL
FT                   SQDELLVISNYSKKKGASDVLFKVIEKLDLKFEFSKFGLEVKSELRESNLTGDEIVKLT
FT                   PELLKNKAYENKNFRAYNIHVSSSKTFIGRANPYSEYIAKVKDKLVSLGFEEFDGPLVE
FT                   SEFFNNDALFMPQFHPARDVRDVYYIKDPSSLLSLPEPYFSNVKAVHENGYTTGSRGWR
FT                   YDFSESISKRLVLRTQGTVLSAKQLINAKNPGKYFGIVRCFRYDQVDATHGADFYQTEG
FT                   IVIGDVNIKILLGLLEIFAKELAGATEVKYVPAYFPFTEPSIEVHVKHPVLGWFELGGS
FT                   GIFRPEVTKPFGIDVPVIAWGIGIDRMALMHLGLSDLRELFTHDIGDVVLRRGKVNA"
FT   gene            530451..532145
FT                   /locus_tag="BH0514"
FT   CDS_pept        530451..532145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0514"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BH0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17022"
FT                   /db_xref="GOA:B2S0L6"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0L6"
FT                   /protein_id="AAX17022.1"
FT                   /translation="MPKVEVYRSILLGKIGKDLTDCELVSILEMAKAEICEFYTGNDKI
FT                   KIEFNDTNRPDLWSYTGLARQIKTYLFGQLPSFEFFSTADNLQKFYGEILVSPEAFSIR
FT                   PFIFGFLAKGMICNEQMLETLIQLQEKLCHNYGQKRKRVAMGMYSSASIEFPVSYVTCN
FT                   SDYRFIPLGMDIEMSIKEINKRHPKGIEYASILEHFTEYPLLLDYNDKVLSYPPVINSH
FT                   DIGALKVGDTDLFIEVTGTNLEATLLSLSVVACDLHDMGFEILPVKTVFPKETPFGKEI
FT                   ICPYYFQNTLEVSVESVNRMFGSNFTVNDMCLDLKKLGISAYFKELDKFYIIPPVYRND
FT                   FLHEVDVIEEIMIGRGLDSFKPELPKDFTLGKLSQIEEFSRKIKNLMIGMGFQEMIYNY
FT                   LGSRTDFIEKMNIKSDEFLSVANPMTEGYEYVRGSIVPDLLKSESISSNFPYPHKIFEI
FT                   GKVALKDLSSVDGTMTYDNLAFLMADKEFSFNEINSLVSSLFYYLNIEFKLRESSQTLY
FT                   INGRGADILINDIILGSFGEVSPYILSNFGIMVPCCVLEINLNKILH"
FT   gene            532247..533224
FT                   /locus_tag="BH0515"
FT   CDS_pept        532247..533224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0515"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17023"
FT                   /protein_id="AAX17023.1"
FT                   /translation="MLKFETLDIKKSNKRIVRTEMGSVEDVVIVGSGPAGLTAGIYTVM
FT                   SGYKTVVLEGPEPGGQLTTTTEVYNYPGFKNGVNGRELMLNMKEQVINLGATTYLETVR
FT                   FIEKRDNIFYIFTDNYIYKSRAVIIAAGSVPKKLDTLKNSDLFWNKGISVCAICDGHLF
FT                   KGKTAAVIGGGNTAISEAIYLSKLLKNVYVIVRRDCLKAIAMLRRDVEKLPNVEILYNC
FT                   EAIEVNGDNVVSGMQIMNSKDNSTFKLSVDGIFIAIGYKPNTDFLKGFLELDEDGYIST
FT                   QALVKTSVKGVFSCGDVSNKLYAQAITAAAEGFLASVEVRNFLG"
FT   gene            complement(533252..533986)
FT                   /locus_tag="BH0516"
FT   CDS_pept        complement(533252..533986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0516"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17024"
FT                   /protein_id="AAX17024.1"
FT                   /translation="MYITHANSIIESIKNNKGLRLYISKTSPKSINIEKLAKEHKIQII
FT                   KVNDLAKIIGNNDHRGFALKLKTLKSNNTKKQDKNLEEFLEEFQHQNNVFILILDGIED
FT                   PQNFGAILRTSEQFNIDLVITSQRRSAKDNATILRTSSGASQYVNKLVVPNINNVIKYL
FT                   KKNGFWIYASDIKGKAINTTPINDTKIALIMGNEGKGIHKLIKENSDFLVRIPTKGKID
FT                   SLNVSVSTGILIFEIKRQLNLL"
FT   gene            complement(533988..535091)
FT                   /locus_tag="BH0517"
FT   CDS_pept        complement(533988..535091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0517"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:BH0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17025"
FT                   /protein_id="AAX17025.1"
FT                   /translation="MKRDYYEILGLSKGASRDEIKKAYRKIAIKYHPDKNKDNKEAESI
FT                   FKEATEAYEVLGDDNKRAQYDRFGHTAFEGGGTSGFNGFSSGFSGFSDIFEDFGDIFDS
FT                   FFTGKRGQDKNRQHEKGQDITYQIEISLEDAYLGYNNNINIARNMLCESCLGKKSEKGT
FT                   SPSICNVCNGSGRVMQGGGFFRVTTTCPKCYGNGKIISNPCKSCKGTGSLKYKETIELK
FT                   IPAGIDDSQQIKIRGKGSVNPDNQQYGDLYIRVSIKPHKIFKRNGKDLYATLPISFTQA
FT                   ALGKEIKIQTIAAKKIAIKIPKGTENDEQIIIKNEGMPILHTEKFGNLILIIKIKTPKN
FT                   LSHNATCLLEDLSKEIKDIDEITLNKV"
FT   gene            complement(535091..536989)
FT                   /locus_tag="BH0518"
FT   CDS_pept        complement(535091..536989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0518"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:BH0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17026"
FT                   /db_xref="GOA:B2S0M0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0M0"
FT                   /protein_id="AAX17026.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMEHGKPVVIQNSEGGRTTPSIVAYTNK
FT                   GERLVGQVAKNQMVTNPENTIYSIKRFMGRRFEEVASEIKMVPYKVEKGQNGDARVNIS
FT                   NIKKQMSPPEISAATLTKMKETAEAYLGETVTEAVITVPAYFNDAQRQATKDAGKIAGL
FT                   DVKRIVNEPTAAALAYGIEKKNEEIVAVYDLGGGTFDISILELGDGVFEVKSTNGDTHL
FT                   GGDNFDDEIIKHLITEFKKDSAIDLSNDKMALQRLKEAAEKAKIELSSAQEASINLPFI
FT                   TADANGPKHLQYTLTRAKFEQMVDHLVQKTKEPCLNAIKDAGLKASDINEVILVGGSTR
FT                   IPAIQKIVKEIFAQEPNKGVNPDEAVAIGAAIQGGILTGETKDMVLLDVTPLSLGIETL
FT                   GGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMASQNRVLGNFILDGIP
FT                   AAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSEEEIERMVRDAEAH
FT                   AEEDKKLKESIETKNIANSLIYQTEKSLKEYGDKITSEDKEAIENKIKELKDALEGSDV
FT                   SSIKSKTEELQQASYKIAEMMYKDAQASSSNQDNAQNNAGSESKEADYEVVDEDKK"
FT   gene            complement(537030..537578)
FT                   /locus_tag="BH0519"
FT   CDS_pept        complement(537030..537578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0519"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17027"
FT                   /db_xref="GOA:B2S0M1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0M1"
FT                   /protein_id="AAX17027.1"
FT                   /translation="MEEKKRCEESEKIKEQENETLPNEDSPSMGKKVAELENEISNLKD
FT                   LYLRKQAEFENFRKRLEKDKENFIKFANENIMKDIINFLDNLERAIDSSKQSKDFDTLL
FT                   SGISMIESEVLSSFDKKYNLKKFGKPGEDFDPSQHEAISIEEKEGVKTPEIVEVYQKGY
FT                   CYNNRVLRTAKVKVAQSKN"
FT   gene            537850..538332
FT                   /locus_tag="BH0519A"
FT   CDS_pept        537850..538332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0519A"
FT                   /product="glutathione peroxidase-like BsaA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0519A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17028"
FT                   /protein_id="AAX17028.1"
FT                   /translation="MSVYGFRARLASGPEISLSDYIRKVLLIVNVASDCSYTNQYQDLE
FT                   VLYKIYKRRGFLILGFPCNQFGFQEPGSNNEILKFCRTVYNVSFPIFSKIDVNGENAHP
FT                   LYRYLREKSPEEFKGDIRWNFTKFLINREGNVVGRYTPKIAPIKMKDDIEKWLSVI"
FT   gene            538358..539926
FT                   /locus_tag="BH0522"
FT   CDS_pept        538358..539926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0522"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17029"
FT                   /protein_id="AAX17029.1"
FT                   /translation="MLIIYFVKICIAQTKCRLFKFKQILSEFKENYEYAIQNKVDILVF
FT                   PFIFIGGIEYKNLFDRAEYLSKILYCLDFIKEQVDDRLCVVFGHYSFYEGKLLDCISVV
FT                   NNHRFVLTSREVNVPVLFDYKGKSIAVLNLGDELLFQGFDEKFSASFSNIDYLLIPSKS
FT                   YFTGDKNNLRLEFFKKIAVKNNLEVAYANLYGTYDSIVFDGLSFFINKYGKIKQAREFK
FT                   DDILFNERFHDLELDCESKIFDRLIEALISSLKEYVKLSGFDKVHLGVSGGIDSALVAY
FT                   IACVALGAHRVVGVSMPSRFSSKGSVFDAKELARELGFKLIDMPIESMFQSALEFFDGY
FT                   FDTKGVTEENLQARLRGIFLMSYSNANKSLLLNTGNKSEIAVGYCTLYGDSCGGIALIG
FT                   DLFKRDVYSLAKYINLKEGRSVIPVDILLKEPSAELRPGQKDSDSLPRYEILDEILSQY
FT                   LLKNESLELLYESFGKEVVTKVLDLYSRSEYKRRKGPMIVKVSRKAFGNDILLPISRVA
FT                   LTEDE"
FT   gene            539919..541502
FT                   /locus_tag="BH0522A"
FT   CDS_pept        539919..541502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0522A"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0522A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17030"
FT                   /protein_id="AAX17030.1"
FT                   /translation="MNSNNVISILNEFSLKLEEIFLLINTDSSELYKETPRYFYNDITN
FT                   YLELTLEIANKFQGEFEDPQDLNLGKFLIRSMKCDLISYLYLSLELIDNAMRYSEIKDA
FT                   GIAFFKAIAFKISSIISYIEIELENVVLSSAIASRQALNKDGHKILIFSCDSMYSKKLK
FT                   DHLILKDYAVLSTNTVDLFNQLLCNDFYDLIIFDLSSDKDIQLILNLLKNVKNNSFYEM
FT                   IPVIVISQINRKDIIQTFIEEQVDDYFLRNLDFLVLDLRISSFLEKKKVIEQGQKYLDL
FT                   ILHNREYFESELIEAGNYIETLLPMKMQNEFFSSNWIFVPSKRIGGDFFNYYFVNDDNL
FT                   IIYLIDISGHGVGSALLSLSVSSVINSYIMNNNDISPSKVLRYVNSYFVKFKSDMLITL
FT                   WYGVLNVKTRHLRFASAGAPPAVVLSAEDNIYLQTRGAILGIEEMYSCEENEYSLSKFS
FT                   HLVLFSDGVYEIENKQDIIMSIDDFYKILKKNSYDLNDFILVSLYEKMLNLSKYNAFRD
FT                   DFSILEFILN"
FT   gene            complement(541658..542083)
FT                   /locus_tag="BH0525"
FT   CDS_pept        complement(541658..542083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17031"
FT                   /protein_id="AAX17031.1"
FT                   /translation="MKIPKNYIPGTNPYKSLPKKPIIESKKISKKQEQINAEIMNSQEK
FT                   ILKLYMRRLQKKDQVMLQNFIMEGHKVGSKIFNNLPKTLQEIITIMNIESLRVLLKNTK
FT                   NPIKKLYIKFSTWTLNKLLKSINNSNIPQNKKTSKKM"
FT   gene            542192..544003
FT                   /locus_tag="BH0526"
FT   CDS_pept        542192..544003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17032"
FT                   /protein_id="AAX17032.1"
FT                   /translation="MNDMNKYLSLSFLYLLIGILFLFLVVFMQFRDLSLNVFLLKDLKF
FT                   LVNNKVEDNQYVLDNLTLSVRGIKINLSKTKPLIIPENGLHLYPLSYKVQDNAIYVYFE
FT                   NNIFLLFSFDSNNNFNVSSNLSKKLLMSYEIESDYKILFDDNIIIKATDSHFEVSLGKH
FT                   SQMNEREISVSPQEVFQIGDLVEGAKTSDELISSKSDIPLDVNSPVVYSSIKKVGKEDF
FT                   DSALVRFRDKAYAAWSNKSRFSVEKGGWRKGNVYSFDEDIFIYFLAESLTRPDYEALFL
FT                   KLKSLISLNEEHLTYLSASYYVDADKLDKFFRYLSVNKTFINSLESDKLLKYLKEDAYL
FT                   LEKIFLSENVSILNVALKILREPEVILTSGFNLIQAYNVLSNYIIFLQFDNDRFVLGKL
FT                   KEELTKFVSTLFSVTSNGEAYVPGNRSNVSWDFEYTLKIAGLLKRLASQLGNDLILEFV
FT                   CNAIYYSLLKPDIEKIPYENYYADIVDNDYIPRFRLLSNLGVGHWIYGATKIINFNLSN
FT                   AFYSIDFDRVLNSPGYFFFKGISNPTLVRFRNINWFTDPQFYMYSDGWRYYSDNKILVL
FT                   KITPKKSDDTKILLRFDDIKAFENIDE"
FT   gene            543984..544781
FT                   /locus_tag="BH0527"
FT   CDS_pept        543984..544781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0527"
FT                   /product="Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:BH0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17033"
FT                   /db_xref="GOA:B2S0M7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0M7"
FT                   /protein_id="AAX17033.1"
FT                   /translation="MRILMNKFVGAVQLIIDIGNTSISFALYRLDKMQIYCKLGTKRDL
FT                   SFKELYKFLKVKFDYKVDQVFVSSVVPVIDTVLINAIVSLYKVNPLFIRFDLSYDLSFN
FT                   LYNNNRFVLGSDVFANLVGAIEYYNINDALVVDLGTACTIFAISRREGILGGLINGGPF
FT                   TDLNALIQNAYLLNDFNLAVPKKLLGLSTIDSVNSGVIYQYKYLIEGVYHELRHNYDKE
FT                   FRLIITGGNSYLVLPLISVDFIANLYLTLEGIRILGNAFKGDY"
FT   gene            complement(544879..545697)
FT                   /locus_tag="BH0530"
FT   CDS_pept        complement(544879..545697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17034"
FT                   /protein_id="AAX17034.1"
FT                   /translation="MMKQKNKDTILDILEIIYSKYNKREFVHPDPLEFLYKYTEKEDIE
FT                   LAGLISSSLALGRVEQILKAIDCVLKPLGSKPSKTLKTLTKEDLKTTYKDFTYRFFKTE
FT                   DIIRLLIPLKKIQEKYLTIENLLYNIYKKNKNFISSLNELITQMENINEHSFSIILPKP
FT                   SKGSACKRLFLFLRWMIRKDDVDLGIWNKFSPSDLIIPMDTHMRDISSKLFNLQNNKNV
FT                   SLKRAIEVTKHFSKKNKDDPVKYDFSLTRFGINRTFNKEELFTNIFKFKY"
FT   gene            complement(545678..546289)
FT                   /locus_tag="BH0531"
FT   CDS_pept        complement(545678..546289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0531"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BH0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17035"
FT                   /protein_id="AAX17035.1"
FT                   /translation="MQKKFILLAISLILLTVKSYCIEEIIEINTEIQKEKYIPFLLSKG
FT                   KSQVEDLIRYTLKMNPHLEAEYVKTIAQTYIDEAIIEGINYDIAYAQMLLETGILKFNG
FT                   IVSKEQHNFSGIGATDNFTKGNSFSNIKEGIRAHIQHLKAYASRQNINSNMVDPRFYLV
FT                   KRGSAPTIYDLTGKWAKDKLYDKKLKKILLGLLEFDEAKK"
FT   gene            complement(546292..547578)
FT                   /locus_tag="BH0532"
FT   CDS_pept        complement(546292..547578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17036"
FT                   /protein_id="AAX17036.1"
FT                   /translation="MHEQSYETIFLLSFSIFLIINLFNFKREFSYEDYFIVFPGIFFII
FT                   TLYLIEIRPLMFYAGSIFLFFLITTTMKIIKTIILRRRTKRKDNKLKRIIFTIPFKIMI
FT                   VLPSIMVVLIATIFSYLGFFTDYPKDVNSSYKVGFTKIKDHKNNLNLSVWYPINFTLGL
FT                   KRQNPFFHYDFNPFFINEMNYLPKYENVYKDAPISNNQKLYDSILIILPFYSHDSMFKS
FT                   FVNRLVKKGNIVYLYAPQYNHMNASNFITNNNTSLLTYISNATIKYLIEPIKIFSDRKD
FT                   KTSEVIEIQNVLELIKSTQKLKFLDPRVELNQLILITMGNQANIANAIISKNKQIKKYI
FT                   NIGGKPQNFKIKTLQLLIKQDENEWQKTNTDPSYIKVINMNNIGEISDFIFSRSYLESF
FT                   NFFKDKKLMLPRFDFVINEINKFIEDRGS"
FT   gene            547980..548738
FT                   /locus_tag="BH0533"
FT   CDS_pept        547980..548738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0533"
FT                   /product="metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17037"
FT                   /protein_id="AAX17037.1"
FT                   /translation="MLGIFLGTGASSGVPMLNCSCRVCSLNFGKNKRLRSAFFLSLYGM
FT                   NLLIDTGPDIRAQLLRENIVKLDLVLYTHEHYDHIMGLDDIKFYTRTAPLPIYARESTM
FT                   QHIKNAFPHNFSSKVSISGKANIIPGLAVDLQQIFFRGIKIMPIPLLHGDIISLGYRID
FT                   NLAYLTDVKSIPEISYNYLKGLDVLVIDALRIKPHPGHLNFDDAINEVKKINPKIAYFT
FT                   HISHDILHEEFDYLKRDDIYLAYDGLQIHV"
FT   gene            548758..549519
FT                   /locus_tag="BH0534"
FT   CDS_pept        548758..549519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0534"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:BH0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17038"
FT                   /protein_id="AAX17038.1"
FT                   /translation="MNLISWNVNGIRAVFGKGFFEFIEKYNPDILCLQETKACKEQLPK
FT                   ELISIEGYYSYFSKSIIKGYSGVALYSKIEPIKLENMRMEIFDREGRCLIAHYRDFILI
FT                   NAYFPNSQALRKRLNYKLEFLMSLESIANSFVTAGKNVVICGDFNIAHTEIDLSNPKSS
FT                   RESAGFYIEETTWMDNFLNGGYVDTFRMFNGEPGNYTWWDYRTRARERNIGWRIDYFLV
FT                   NKVFKSEVRDALILNEVMGSDHCPVFLELKQ"
FT   gene            549521..550288
FT                   /locus_tag="BH0535"
FT   CDS_pept        549521..550288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17039"
FT                   /protein_id="AAX17039.1"
FT                   /translation="MCVWKMYMSRYFITILFFFIHGFIFGINLESVDFYRSLDKEELLF
FT                   VIHLLEREKNLTQKNEFFTYIDLAKRVLTERGVQVLSGGNELDGMHHINILQRPENYNS
FT                   SKFVLKASKDLNIFVYFDGSDRFLKTLDGRNVGVQDGNFVILEPVSFKGYDNVSSEHTT
FT                   IEIYETSILSPDFSKFVLDKLKPFVYVRELNKRVYLDDISKLSKGELLFLFYELFPISR
FT                   LKGLQDWYDFGFSSILREIKKVYDIRINARKRE"
FT   gene            550285..553116
FT                   /locus_tag="BH0536"
FT   CDS_pept        550285..553116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0536"
FT                   /product="zinc protease"
FT                   /db_xref="EnsemblGenomes-Gn:BH0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17040"
FT                   /protein_id="AAX17040.1"
FT                   /translation="MKYEHIHINNISILKFVFLILVFLFLSCSSAKLKVDKNLVSGQLE
FT                   NGLKYYIYGNQLPSKAVHMGVLFNVGSLNEEENERGLAHYLEHMAFKGTADYPGGEGVF
FT                   EVLKKFGMKFGADINAYTSFDKTYYHLDLPDGGNESEIDEALNVLRNWAFQIEFDETEI
FT                   DKERNVVLEEKKRGDNYSGRVAEKMFGVILGDSKYAVRFPIGLEERILSFKSEDFKKFY
FT                   KKWYRPDLTSIIVVGDIAPDKIENKIRERFASLEKPVSEPEKVKINLGTSIDEKFISIE
FT                   DIEIPFPSLNFVIKKRIKNNSFDTVDYVARMVEKTLLDELFVNRFYELKIAGTNYFMSF
FT                   DKFDSEFKSDDNYVLINEISFKINPEHFKEAIEGFFYEIERIKRFGFTKGEIDKIKSKL
FT                   ISSAKLSKDNINKRYSSSIARTLVDSISQDSLMFDMNEYFDIIIEHLNKISLREISNFA
FT                   KREASIDDMAIIYSYSKKFHPNLTFEEMKELRDLALEREIKPYDDISIQGEFFKKSLES
FT                   KNIIDEKELSDGISSFMLENGVEVYFKQNDQKKNVVNFRASSWGGLLSEDAELVPVLSL
FT                   APGVVSNSGYGDYSQLQVEKYLSDKVVSLTPTVGDQMSIINGSADTKDIETLFKLIYFT
FT                   FNEPKIDDVVLQSTIDDVKATIKSKENSSKYLFNSAVRRFYNNDDYRLRDIKESDLKNV
FT                   SKGVLLDFYKRRFTYANNFKFVFVGDVDLETIKNLSSKYLGNLSSKKLDEFRDLDYSYK
FT                   KSTDRIVIKKGEDSTSTVCILYPFKFNYTPEDLINYEALASLLTEGLVKTIRRKQSSVY
FT                   SIGASFDYLLRKHSNSDGFLTVYFTVEPKVLDNVLKAVNEYILEKQKVAFVDEDFNYIK
FT                   KNIIKNHNISSESNGYWISKILYTVIWYGALRDTFSAKFIENNLSKDTINMLFKKIDVK
FT                   QGVEIVLSPEKGN"
FT   gene            complement(553113..554591)
FT                   /locus_tag="BH0536A"
FT   CDS_pept        complement(553113..554591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0536A"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0536A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17041"
FT                   /protein_id="AAX17041.1"
FT                   /translation="MIMKNILATVVLLTSLYAIYANKNEKKSPISNNNHKIIRYDKKKV
FT                   SHIVLNLRINENASIEIKTQDKNYLYNIPKIINQDKELTIEIKMNNIKSIKLNNIEIKN
FT                   SKIKTTRSSLQKFKILISQNKYSIKFNLNKNMFPIVGFKAKKIILNPMLTNLYSEKESQ
FT                   KIVLSNFIKYTSLDNNNDEIKSTKNSNMLQISKIGYIDMNAYYDINKPINSDLKFIFNY
FT                   KKENYRRDSFELFKLIAEPNIYVLKFKNLNDQSLMLKRMAFFIEKKEFRGTLLPNNELE
FT                   NKVGWKGHNYRLKDIILFFNAAQKSNIKLNKEETILKNLIIINKLAYIENNTIKIKDKS
FT                   RNTAFATYSEDATTSKIAQMIIFMHEILHMYFFIDNNFNKAISNFWNKNILSKDKKAWI
FT                   KFLDNKGYDVKSKYLVINEFYTYTTQIPKEDIANYLTNTKYFSKLGLERYKAWAIKLEE
FT                   LLWKAKGLIAGELLILFKDKIIKKKNIYANKIAN"
FT   gene            complement(554645..554717)
FT                   /locus_tag="BHT0014"
FT   tRNA            complement(554645..554717)
FT                   /locus_tag="BHT0014"
FT                   /product="tRNA-Glu"
FT   gene            complement(554725..554797)
FT                   /locus_tag="BHT0015"
FT   tRNA            complement(554725..554797)
FT                   /locus_tag="BHT0015"
FT                   /product="tRNA-Lys"
FT   gene            complement(554894..554967)
FT                   /locus_tag="BHT0016"
FT   tRNA            complement(554894..554967)
FT                   /locus_tag="BHT0016"
FT                   /product="tRNA-Lys"
FT   gene            complement(555017..555652)
FT                   /locus_tag="BH0537"
FT   CDS_pept        complement(555017..555652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0537"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17042"
FT                   /protein_id="AAX17042.1"
FT                   /translation="MTNKSFFLKIILMLFSCLSLLKAQEKEDSLLLYRQGKFQEAIINT
FT                   QNEIKHKPNNLDARVILIWSLIATGEYKRAELESIKGLEINNHDSRIIQTLGEAYFFQG
FT                   QYKNALKHFQKYISLGSNGARIAKVYILTADSFYKLERYNEADFAYENALRFLPNNQNI
FT                   LLKLAKARLNAKNKILAKETLTKLLTLNPNHLEAKNLLKKIEKNNHNP"
FT   gene            complement(555649..555999)
FT                   /locus_tag="BH0538"
FT   CDS_pept        complement(555649..555999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0538"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17043"
FT                   /protein_id="AAX17043.1"
FT                   /translation="MSIDSLEFEESNTQNVIKNNFEFEGYIESNKPIIIEGTLKGFINS
FT                   TSSIYLREKANVEAEIKCNNFLNHGTIKGNVEALETIKIYKTGKLIGNIKTKELFIDSG
FT                   ALFNGNCEMEEK"
FT   gene            complement(556078..556773)
FT                   /locus_tag="BH0539"
FT   CDS_pept        complement(556078..556773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0539"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17044"
FT                   /protein_id="AAX17044.1"
FT                   /translation="MFELTQDKQEVRIKNKFLAQVFGLMAIGLLISAIFAYTTSENQIM
FT                   KAIIFTNPMSYIAMLLVQFGLVYAISGAIEKISSSTATALFLGYSALTGVTLSSVFMIY
FT                   TQGSIFYTFGITSLTFLAMSFYGYTTSTDLTKMGSYFIMGLWGIIIASIFNIFFRSSGL
FT                   NFLISILGVILFTGLTAYDVQNISKMNRMLEDGTEIKNRMAVVASLKLYLDFINLFLYL
FT                   LRFLGQRRD"
FT   gene            complement(556786..558864)
FT                   /locus_tag="BH0540"
FT   CDS_pept        complement(556786..558864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0540"
FT                   /product="protein translation elongation factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17045"
FT                   /protein_id="AAX17045.1"
FT                   /translation="MDYKKLRNIGISAHIDSGKTTLTERILFYCNKIHAIHEVKGKDGV
FT                   GATMDSMELERERGITIASAATHVEWKNHPINIIDTPGHVDFTIEVERSLRVLDGAILV
FT                   LDSVAGVQSQSITVDRQLKRYNVPRLAFVNKCDKTGANPNNVKDQLKDKLGLNSVLMQI
FT                   PIGLEDKHIGIVDLIVMKAYYFEGRDGTEIIEKEIPAELLNEAEEKRKIMLDALSDFND
FT                   ELMELHMEGQDVAVETIYDAIRTGTLALKLCPVFMGSAYKNKGVQLLLDAVNRFLPSPH
FT                   DIKNVALDLNANEKETELKTDENLPTVALAFKLEDGQYGQLTYVRIYQGVLKKGQELIN
FT                   SRTSKKFKVGRLIRMHANNTEDIEFGSSGDIVALFGIECASGDTFCDPSINYSMTSMYV
FT                   PEPVISLSIKPKDKKSADNMAKALGRFTKEDPTFKTYVDAESKETIIQGMGELHLEVYI
FT                   ERMKREFKAEVETGMPQVAYRETITDKAEFNYTHKKQSGGAGQFGRVAGFMEPLDEEGQ
FT                   TYEFVNLIKGGVIPTEYIPSCDKGFQKAMEKGTLIGFPIVGIKVTINDGQYHIVDSSDI
FT                   AFQLAAIGAFREAYNKAKPTILEPIMRVTLEGPTEFQGNMFGLLNQRRGIILGSVEEGN
FT                   FSKVEAEVPLSEMFGFSTVLRSSTQGKAEFSMEFLRYGKVPSATFNELCKKFNEQNK"
FT   gene            559375..559617
FT                   /locus_tag="BH0541"
FT   CDS_pept        559375..559617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17046"
FT                   /protein_id="AAX17046.1"
FT                   /translation="MEDISLNTLTISHELSKICQVDYDSALSELSVFFKDGRAYKYFKI
FT                   EPRHFNIISKLVQEKRSVGKYLTEHIFNKYDQEKL"
FT   gene            559803..560882
FT                   /locus_tag="BH0541A"
FT   CDS_pept        559803..560882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0541A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0541A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17047"
FT                   /protein_id="AAX17047.1"
FT                   /translation="MKKFLIVIILFLFFSTSYAKVLYFSAGFSTQISLESLSLFNRKTG
FT                   TVFDKLLSSELFPILQNFRNNFFPRWSAFEDSASDLYVSFKKNLGIFKTLYRGRKNKDS
FT                   QLSKMEESDLDELGALLNSSHDLRKFLTELKKLDKRSTLKKLDEAGLNMKKLLATLGET
FT                   TERAIELQEVLFGQLSEFGIDSHDDFMRLWKEVFIPGSVLNNALRQKLSPLFSAGFQGY
FT                   FQIGLPIASSNFYYGFELGFGVNLGRMIAPNLNLLKASYPVNLGLGIMPRLFMKYDIYY
FT                   LAATLFSGFGDRSLVVDPIYVGNLSDNAVVTNPFSVIETGLRLRLAFINLESSVLFSIN
FT                   DFKYRDLRVGLGFEIPIII"
FT   gene            560948..561487
FT                   /locus_tag="BH0542"
FT   CDS_pept        560948..561487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0542"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17048"
FT                   /protein_id="AAX17048.1"
FT                   /translation="MYKELFLFLFYFVLSCKTFSQDYQAISDEYYKLAKLNEELGNNQA
FT                   SVLLYEQAIKFNPNANDASSYNFILAYINLKKYDEAELKLESLLKNDPNNILLINLKAY
FT                   LSFRKDKLEEALKFYLSTLEVVPANQEALFNVFYIYHLKKDIENAKKYILKYKEFKYSV
FT                   PSNASEIVSSVLKDQS"
FT   gene            561575..562207
FT                   /locus_tag="BH0543"
FT   CDS_pept        561575..562207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17049"
FT                   /protein_id="AAX17049.1"
FT                   /translation="MQIKILFLSLLIFVTSNAFTDVKFELNLGFGLDFPVSTISNFYNT
FT                   ALDVGERLENSMSDLEREKIIKDFADMVNISKTGLTYGGHAQMGARFDDFCSLGFELGF
FT                   NFNVFRCVNRKGRLNDIHSFIAAIESRFYTRLDFFIGSVALFTGPRANMATAIVDSILN
FT                   EFDMFGWDLGARATFAFLALEGYYCWNIHNNKFSDFKVGIGFEFEVI"
FT   gene            562375..563595
FT                   /locus_tag="BH0544"
FT   CDS_pept        562375..563595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0544"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17050"
FT                   /protein_id="AAX17050.1"
FT                   /translation="MSLLIKKSIGIIACPGGRVFADKIMEELKKIFLDTESKVIEKISQ
FT                   TSHCLKEDVLKLEGILSPFLEGFGFSNSRFDEAMEIPVSFVKFANGEFKAEILKTIRNK
FT                   DIFIVQDVSNTYPVNVNNNEKVVMTINDHLMNLMTTIDACKQAKANSVSVIVPSYPYSR
FT                   QDKKHSREGLTASLVGRFLEELGVKHILTLDIHSKAIENVFRKTYFENLNASYEIFDAL
FT                   AELIDIRDSNLVVVSPDTGAVNRNKFFASSLKRPLALLYKERDYSKVTHNVNDSNISVT
FT                   KLLGDVEGKNVFMSDDMLATGGTFIKAVKLLKSMGAKKIICAISLPFFNGNAIRYFDKA
FT                   YEEGYFYKIIGTNAVYHDDRLISKPWYYEANVAHLFAGAIFAIHNRVSLQKILDRSHDI
FT                   QALISKS"
FT   gene            563597..564964
FT                   /locus_tag="BH0545"
FT   CDS_pept        563597..564964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0545"
FT                   /product="xylulose kinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BH0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17051"
FT                   /protein_id="AAX17051.1"
FT                   /translation="MMDVLSIDIGTSTLKSALVNSHHGVLESFDVNYFEYFSVDFENFD
FT                   YKIWLFALKRVISNFRHKKIDCISISGISPCLIALDSDLVPLEVLHWNSSKVVDNFKGK
FT                   SAFLPLVLSTLERGIYGKVRYFVSCFEYFIYLLTGNLITSYPSLSYIPFIWNNLEIREY
FT                   NLDTNKFPPFLKMGEIAGRVTNGASIEFGIDSGIEVINAGIDYLSVLVGSGAFFSGIVS
FT                   NRTGTSEGFNFVSDAYLSGFSLEYPYFLDNLFVIGRIVPSGYLLQLLKDRLFKNKKSFE
FT                   EFLEDIAKAYDLGDVYFYLSKRELFSDHVLIDLQVRDDLSKGIFGKVDNPLQIGAAMLE
FT                   FSYFSFYNKILQLKSFKRDVLDIFVSGSNSDNLFLNELKANIIGRDLKIFEFKHSEIIG
FT                   NAILAFCCLGEFDSLDKAFKKLAKFKQVISFNASMHDIYLEKYHKYVSNFNLFINS"
FT   gene            complement(564947..565651)
FT                   /locus_tag="BH0546"
FT   CDS_pept        complement(564947..565651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17052"
FT                   /protein_id="AAX17052.1"
FT                   /translation="MKDFNENNNKGFLVALTSIVIVCTIIFLGIIIFFPNKNLASDIAS
FT                   KNIILQETKDEKVIEHENNKKALSITEKPNEIIIDLTQNPTQDKNLSSSINQNNKKIIT
FT                   KKEPQVINKHEPTKTHIKKNTSQKTQTIAKTDQETKKEQNYNKFENKYDPRKEYYIQFA
FT                   SLSDPISADNNIQELMKYKIHAKIYSATVNDKDTYRVRSGPYKTISEAKLDLKKISGSS
FT                   EFKDAYILTINK"
FT   gene            complement(565652..566248)
FT                   /locus_tag="BH0547"
FT   CDS_pept        complement(565652..566248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0547"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:BH0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17053"
FT                   /protein_id="AAX17053.1"
FT                   /translation="MGRNSSIIGITGRISTGKDTASKIICSRYGFHEINVDKIGHIVLQ
FT                   AKQDRVVKIFGKKILNNKNEIERVKLRNIVFNDREKLEKLEAITHPAIYKEIEQIILKN
FT                   EFDKIIINAALLFKLNIAKFCGHIFIIKANDEIIKKRLRASRNLDENLVINILKWQDDI
FT                   FLNKNILNSKIINIINSKSYEHLEKEIRAKMKEVT"
FT   gene            complement(566227..568944)
FT                   /locus_tag="BH0548"
FT   CDS_pept        complement(566227..568944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0548"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BH0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17054"
FT                   /protein_id="AAX17054.1"
FT                   /translation="MKEIYLIDALNIIFRNYHAMKNNPLTNSKGENVNAFIGFFKTLFF
FT                   IIKEKNPENLIVAFDSETQTFRQQKYPSYKATRDAPPDNLIPQIHWIKEGLLKANIPFF
FT                   ERQGYEADDLIASFAKKAERNNYLTYIISPDKDLLQLMSDQTKILKIENSSFVKMDNDY
FT                   VMQKFGVNTSQIKDYLSIVGDRSDNIPGIKGIGGKGAVKLLNEFQTLKGIYENIDSINN
FT                   RYKEILLREIKNAFLSYELISLVEDLELPALEEFKLENLKEDVLSLFEEYSATTLIKSY
FT                   KAILKKRHVTNQTQGTLQTTSYLNTLKTIQEENIKYETILTKEQLDLLIEKLKKTSYVS
FT                   IDTETTSTNVYEAQILGISVSFKEFESYYIPIETKEKKSIEREYITQKFNEFFKTKPKL
FT                   IGQNYKFDYKIFTRHGFNAIPPYFDTMIAAYVIDPNTKVSLDFLSEKYLMHKNIKYQEI
FT                   VSQNGTLKDIPLETVSNYAAEDADITFRLFKIFAKKLKEDNLESLMIDVEMPFSNVITE
FT                   MEENGIYLDKDYLRQYSQELTKELKLIENEIIQSIGIKFNLNSSKQLYRVLFDELKLVL
FT                   PPNVKKHSTSIKVLEAIKDQHESIPKIIQYRKISKLKNTYTDNLIKFINAKTNKIHTNF
FT                   IQAKAATGRILSTAPNLQNIPIKDEKGRKIREAFKPKEGNLFISADYSQIELVILAHFS
FT                   EDGALIEAFKNKEDIHIKTASQLFKVDTDKVTPSMRRVAKSINFGIIYNMSAHGLSQEL
FT                   SIKREEAQKFIDSYFNLYSKIKIFIQNRIDFARKNGYSETLLKRRRYIKEINSQNHSER
FT                   SGAERIAINSTIQGSASDIMKIAMVRVYNEFKSKNLKSKILLQVHDEILIESPKQECEE
FT                   AKTIIKEMMENAYPLKLPLRINIETGKSWGEIHR"
FT   gene            complement(568941..569339)
FT                   /locus_tag="BH0549"
FT   CDS_pept        complement(568941..569339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17055"
FT                   /protein_id="AAX17055.1"
FT                   /translation="MSANRILKIYLKDLILELKKLKAILEFENEEINKGILDTLNITNP
FT                   AKDLILNSIKNYYVSINSWLKGQEQIQEDVRKSIEDTCLLKEKICIQYQNTCKTLKELF
FT                   VQKTTIPKTQFSKSLFNYNNPIIVDVKI"
FT   gene            complement(569329..569748)
FT                   /locus_tag="BH0550"
FT   CDS_pept        complement(569329..569748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0550"
FT                   /product="flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:BH0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17056"
FT                   /protein_id="AAX17056.1"
FT                   /translation="MITKEEIYKKTQINTSSPISILVMLYEKAIQDLEIAKEFYKSEDP
FT                   NSTAKADEKVYHAQDIIIELMSTLNFEDGGEISNNLFSIYSFLSKTLESVTLEKNRDNI
FT                   QEVLKHLKNLHTAWKTLLKKDNNITNKKLGINIVS"
FT   gene            complement(569759..570139)
FT                   /locus_tag="BH0551"
FT   CDS_pept        complement(569759..570139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0551"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:BH0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17057"
FT                   /protein_id="AAX17057.1"
FT                   /translation="MEENRKALVVDDSIFMRKNLIKILKKLGFSEFFEAEDGIQAIKEF
FT                   EKQEEIHLITLDITMMGMDGITTLEKINEINKSLARKINVLMVTALGKQELIAKALELG
FT                   AKGYITKPFGEDQIAGQIKKLY"
FT   gene            570356..572365
FT                   /locus_tag="BH0552"
FT   CDS_pept        570356..572365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0552"
FT                   /product="NAD-dependent DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BH0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17058"
FT                   /db_xref="GOA:B2S0Q2"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0Q2"
FT                   /protein_id="AAX17058.1"
FT                   /translation="MIEDVEDEILRLKNIIKRWNREYYVDSSPSVGDLTYDKALLRLQD
FT                   LESKYPEYKTLDSPTFRFGSDLLNDFEEVKHSFPILSLDKTYDIKGLSLWIEKMVLESA
FT                   ISGLHTGISVEPKIDGCSIVLHYKDGILEKALTRGDGRVGNDVTENVKTIRNVPLRIDE
FT                   KIELVLRGEIYITKENFLKINRTLKNPYVNARNLASGILRRISSKEVANFPLDIFVYDI
FT                   LYSSLKLNTSHDAFDKLKQFGFKVNPFCEFFGGKNLEAGIIAHVKKIEALRDSFEYEID
FT                   GVVLKIDSFILRKILGSTSHHPKWSIAYKFESCTGMSKVVDIVVQVGRSGKITPVAHVE
FT                   KVLVAGASITNASLHNQDYIDFVGLNVGDIVVISRRGDVIPAVDLVIEKLAVGSFKIPS
FT                   NCPSCKMTLIKEGAHLFCVNRHCSCRIIEQVKYFCSKKCMNIVGLSEKTIEFLFEKKFI
FT                   SSEVELYTFNCDRLINLKGFNLKRINNLKRSIEDSKSRPFRKLLLGMGIKDLGENTILV
FT                   LINNNLNSFDTISTLCKNKEAALAKLLKIKGIGERIALNIIEAFNDKTILDKFNFFKEL
FT                   GLKMEEDNTNDAVYDSFLFGKKFCITGSFKGYSRDVLIEKLTKKGAVFSRSVTKCLDFL
FT                   LVGEKFGLKVQKANNLGIKTFSLFDIKDFVDLDD"
FT   gene            complement(572368..574650)
FT                   /locus_tag="BH0553"
FT   CDS_pept        complement(572368..574650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0553"
FT                   /product="myosin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17059"
FT                   /protein_id="AAX17059.1"
FT                   /translation="MSNNINRVFMGKGKKILPILSRILMLFSCTLLFGEPKKNASDYII
FT                   NHSKIYIPKEDLNEDFNNEEGMIYHKKNKILKDNKSNASNKKSNKLKFKDSEQIQISDN
FT                   RQAINSILTNEELQYQQNLNTNDFYSEQDNINDWFIENIDNLKLRIENYEKKIENLENL
FT                   LRQKNIKSIEKKNEEYEILTKNLKEEIKKIKKLINEKENLLNHALQSTNNTYNKAQEYE
FT                   ENQNEYISNEEYNYPSEENRYDMYAQEQEYFNSETQALNELNDKINNNKDALNNNIHRL
FT                   NELNDKINNNKDALNNNIHRLNELNNKINNNKETLKDALHKNTHKLSELDNKINNNKET
FT                   LKDALHKNTHKLSELDNKINNNKETLKDALLKNTHKLSELDDKINNNKETLNNNIQRLS
FT                   DLDDKINNNKETLNNNIQRLSNLDDKINNNKETLNNNIQRLSDLDDKINNNKETLNNNI
FT                   QRLSDLDDKINNNKETLNNNIQRLSDLDDKINNNKETLNNNIQRLSDLDDKINNNKETL
FT                   NNNIQRLSDLDDKINNNEDTLLAFQKELIDLKNNHGTSLKNIENNLSSIEKVINILKDK
FT                   IDKNEELYKENKDIIQQKQDKINTLDKKLTDNENTILTLKEEFAKHKNKDLLTRENKKS
FT                   QYKKNEFYPNNEKTTHKNVVIKTAEFQIYPDTHLNNYNFKDQSSEFDFKKSNGYYIEVE
FT                   PTKNLYRAKEIYRLIPKYNVKTHFINPSLKHKEKFFRNLIKVEHTNEIITLYKNLASEF
FT                   KNIRIIK"
FT   gene            574854..576725
FT                   /locus_tag="BH0554"
FT   CDS_pept        574854..576725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17060"
FT                   /protein_id="AAX17060.1"
FT                   /translation="MFMKLENMDEVWALPVCCNINNSIIDDFRLSDKYKDQVFYISYKD
FT                   DIILKFIDIVDSNEFDLKLFDNKIDFEGQIPVVLYSESLDSLLGAEESIDFELKDIEQN
FT                   DVYFDSRVKESGEFKIHNSYYEFSDYLNYCSDILLVRVCFKGDSLIIDADLDNIALVKQ
FT                   IISNNFCIAFDKIIINPINNDCLNGLFPVSFNAVLQGIIIAKKLGQKVNVIYYKRHFLM
FT                   AQSLSLKFSAVNYLSVENRLAKIMLDLEIDRPLNFLYKFYFDCLRHIFSNLFFDVCVHI
FT                   NFISTKSNAIFFYDNYFFFESSVYNFIYSNFYNLAVSLSIEPLSYLLSYVKGEYNIFLK
FT                   LFKEMDLKNSIMRKSSSISLNNEYNIFDVRRKGIGFAFLNLDPNLDSAFLSGNQTVSMS
FT                   LHKDKLDVSIPYRVIDVNLINYLRNTLARTFSLSYDNVNFIVSDAFGEDVEPYSALIKE
FT                   SYLIEREVLAMKDELVVMIGEDFKGEYPVVVGQNFVVDIGKRFNVACSLEIDVGISSFN
FT                   IIFSNVNFFVENGKFDKLRINNKRAFSIFSLAVDYVFGNITYDIVDSVELEFIEDGEFV
FT                   FSFRVLFVASVSAIRTALIQAFDFNICKTPIDLKDILNSWSVRIDTN"
FT   gene            576712..577173
FT                   /locus_tag="BH0555"
FT   CDS_pept        576712..577173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17061"
FT                   /protein_id="AAX17061.1"
FT                   /translation="MILISFNLNGESLSKSIELPLSTKELLISIFYSGDRNFIENMNKK
FT                   FSLVLLDLKPVYSSLVPAFMLNGRSIITVEGLQNTTFYETLVKVLLENDFGFCANCFSS
FT                   NVLLFHYFLKRKVIIRTDILGYYNTLKCNCLDVNTFLDLYLRLEELERK"
FT   gene            577170..578033
FT                   /locus_tag="BH0556"
FT   CDS_pept        577170..578033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17062"
FT                   /protein_id="AAX17062.1"
FT                   /translation="MSGVKVYYPENFNALVSLFKEDSNSYIVYNEIDFHKNAAIFMKND
FT                   ISDNFFIINNFERFNKVSLKSNFLEMGPCVTYDAILQFGERNIPRLFYEFISRLNDRIY
FT                   LNSINIANGFYYKNTVFDLYPLLLSLDAQLEFKNILTKKTYTYNAYSINRDDYIQSRHT
FT                   LFLNKLKFPITNLWNKSFYSKIFVDTFSSDILEEVNIIFICVLLNVKRDIISDFLMKIF
FT                   YNDKVITLRDSQVLLLNKSLPLSLVEIEDSLKMLDRNMRDVKNFNFGERSLRLIKNFYF
FT                   DILFNF"
FT   gene            578213..578473
FT                   /locus_tag="BH0557"
FT   CDS_pept        578213..578473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0557"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BH0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17063"
FT                   /protein_id="AAX17063.1"
FT                   /translation="MVKREATIKAVNGLHVRPASTFVKKAKEYTSDITIEADGKSVSGK
FT                   SLFRLQTLELSSGKKLMVCAQGDDEEKAVTELVELIESFKE"
FT   gene            578474..580210
FT                   /locus_tag="BH0558"
FT   CDS_pept        578474..580210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0558"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17064"
FT                   /protein_id="AAX17064.1"
FT                   /translation="MWKVDMTLSGKRISKGIGIGEALFIKKDFDKFIDKSKIASFQIDS
FT                   EIKKFNDAKSKAIAVLKDLTKKVVAQLGADKEGIFEGQMLVIEDDELSDSVISFIKNKN
FT                   YGAAYAVYLSFKELIASVEEYTDAYLKERVSDFKDIRNRLIANILDQVTDLAEVKRDVV
FT                   LITEELTPSDTMQVDLNYVKGFVTAVGGETSHAAILARTMGLPALVMTPLDIAKIKEGD
FT                   HLIIDGLSSIIISSPSSSELDKYTHKILEHNEHEKQLFELKNQDAKTKDGIKISLKANI
FT                   GTPTDISYVNKYGLDGIGLFRTEFLYMESVKPPTEDEQFEAYKRVLETIEKKGVVTIRT
FT                   LDIGGDKEIPYFNFPKEDNPFLGYRALRMYMDYEDLIQSQFNAIFRASHYGKIRIMVPM
FT                   LTRYEEIDIINYFVDKAKENLKSRNLPFDENLEVGCMIEVPSAALVASEFADKLDFFSI
FT                   GTNDLTQYTLAVDRGNQKISNLYDKYNPAVLRLIKNVLDAGNSSGIDVSVCGELGGDEA
FT                   GALILIGLGFRSLSMVPSASLRIKYLLRQYTISDLSELANKVLNSKSESETLKFLDKYI
FT                   GD"
FT   gene            580214..580783
FT                   /locus_tag="BH0559"
FT   CDS_pept        580214..580783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0559"
FT                   /product="PTS system, glucose-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BH0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17065"
FT                   /protein_id="AAX17065.1"
FT                   /translation="MGFLGFFKKSATLDLIAPVSGKVVSIDKVPDEAFAEKIVGDGIAI
FT                   IPTGSELVAPCDGNIGKIFKTNHAFSLETKEGVEIFVHFGINTLNLNGKGFTRVAEEGM
FT                   SVKQGDVIIRLDLEYLKAHAESVVTPVVIANSDEVSSIEYVFGKLEDGSEYIVPSSTTL
FT                   TEEVKTKISQTKPVEAGKDLVLRVKK"
FT   gene            complement(580817..582664)
FT                   /locus_tag="BH0560"
FT   CDS_pept        complement(580817..582664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0560"
FT                   /product="chaperone protein HtpG"
FT                   /db_xref="EnsemblGenomes-Gn:BH0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17066"
FT                   /protein_id="AAX17066.1"
FT                   /translation="MKKQFDTEVNDLLYLIIHSLYSHKEIFLRELISNASDSIDKLKFL
FT                   SLTNEKFKDIKLEPKIEISFDEKLIKIKDNGIGMNREDLINHLGTIAKSGTKEFINNLK
FT                   KDEKKTASLIGQFGVGFYSAFIVSDKVEVVTKKALEDVAYIWSSDGKTGYEIDKAKKDE
FT                   NGTEITLYLNEEGIEYTNKWKIQEIIKKYSNHISYPIFIKYKEPLMKDGKQEGFEDKEE
FT                   KLNDTTAIWIKNKNEITDEEYNEFYKNLTFDYENPLIHIHTKAEGSIEYINLFYVPSKA
FT                   PYDLYYPNTKPGVKLFINRIFITDSADSLLPNYLRFIKGIIDCQDLPLNVSREILQQNK
FT                   ILAKIKASSVKKILSELEKLSETDHSKFNEFSKEFGRCLKEGVYSDFDNRNKLISLIRF
FT                   KSSHIDGLVSLKEYKERMPEGQKSIYYITGGRENILKINPIVNAYKERGYETLIMDDEL
FT                   DEAILNFITEYDGMKLKAINKNETSDELKDENFKHMEEEFKDTLLRVKEILKEHVKDVS
FT                   LSATLKQEPSAIIIDSSDPTYQMQRIMISMGQEVKETKPILELNPNNKIIQNLKNLDDE
FT                   NLEKISILLLEEAMLTSGLPSKNPSQFINIINEILEQNI"
FT   gene            582784..584178
FT                   /locus_tag="BH0561"
FT   CDS_pept        582784..584178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0561"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:BH0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17067"
FT                   /protein_id="AAX17067.1"
FT                   /translation="MDVGIYGLGVMGSNLALNIADSGFNVSVYNRDSDKTEIFLVNNAH
FT                   KKIHGFKDIETFIGSLKKPRKIILMILSSAVDEVIEQILPLVEKFDIIIDGGNSHYKDT
FT                   VRREQGLSSKDIYFVGLGISGGEKGARFGPSLMYGGSKKAYGLIEPILNKIAAKTSVGD
FT                   ICSAYVGENGAGHYVKMIHNGIEYADMQLISEAYFFMKRAFNLDNLRISEVFDKWGEGD
FT                   LSSYLIEITSNILKYKENNEYLLDKILDVANQKGTGKWVSIEALQLNVPANLIFESVFA
FT                   RFLSGLKHERVIASDILKMDVDSAEFDLSDWILDLYYALLVSKILAYVQGFMMLKSASV
FT                   NYSWDLNLGKISLIWREGCIIKSVFLDKIKLAYDKNPHLINLLFDDYFLDIIRNHQKSL
FT                   RRIVSKASEIGIPLPAFYASLSFLDSYSTNYLPANLIQAQRDFFGAHSFERIDSKRGEF
FT                   FHSTWR"
FT   gene            complement(584194..584733)
FT                   /locus_tag="BH0562"
FT   CDS_pept        complement(584194..584733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17068"
FT                   /protein_id="AAX17068.1"
FT                   /translation="MQKLMLRIILILSIWVNAFGRSSYSDRKIGFGGSIGNPIFNYIMS
FT                   FPFIDLEIGYGGTNGINLSKDKLKSKIYDFNIFVLSALDLIFTIPLIEKLSIGTGIGSN
FT                   IHISSPQSNFINMEIGFGFRIPIAILYDLTEQIELGLKIAPSIEFVSNAKSIAYHYFYA
FT                   GLKTNIMGGIFVKYYI"
FT   gene            complement(584873..585391)
FT                   /locus_tag="BH0562A"
FT   CDS_pept        complement(584873..585391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0562A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0562A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17069"
FT                   /protein_id="AAX17069.1"
FT                   /translation="MKKIILILLLINYFNISAKDSYINKKGYFGIGVLGPLSNSFQLIL
FT                   GKNIEIEIGIYNGLRNLFTNFNILFASLEFAVLSSNVPEQSNTIDASLGIGIYGLWWLS
FT                   EWQKTHKVYDSTNIGIRISLTLNIPIIKKNFDMFLKSGPGVNIWGIGGGNPKQKWELFA
FT                   GIGMRLWLA"
FT   gene            complement(585669..586184)
FT                   /locus_tag="BH0563"
FT   CDS_pept        complement(585669..586184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17070"
FT                   /protein_id="AAX17070.1"
FT                   /translation="MKKKNILALMFMLLSTSAFANPTSATRSKFGLGILLPFPIALEIN
FT                   IKNFDIDLGVYNGTNNIFKDWQTLFLAIDYIFYTHAFKNIDNILDFAIGGGGYGTIWFS
FT                   RLGNGQANSGPMSLGARLPLILNLAITRKKFDIFLKVAPGLGLNIWSSGVGLRWEIFAG
FT                   IGMRFWVA"
FT   gene            586730..587266
FT                   /locus_tag="BH0565"
FT   CDS_pept        586730..587266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0565"
FT                   /product="chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:BH0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17071"
FT                   /protein_id="AAX17071.1"
FT                   /translation="MELETDVQGTLSQYLLFSLDELYAIEIKYVVEVLEYTKISKIPRT
FT                   PDYMAGIINNRGKIVPIIDIRKQFGMQERKVSDDGIKKKDVDISNIIILTLVYEGDELN
FT                   LGILVDYVNEVLELNSSDIDDAPKIGTGFNSRFISGIGKRNNKFIIILDIENLFDIKEL
FT                   SKFKNTTVSDQDDEQ"
FT   gene            587281..587592
FT                   /locus_tag="BH0566"
FT   CDS_pept        587281..587592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17072"
FT                   /protein_id="AAX17072.1"
FT                   /translation="MIYNPEGELVVNSIFKVKEDLLNILKDMKEKETLVINLSNVEKID
FT                   ITFIQILYASNKYAKDRNLLVKIEYPSDEVLSSLMYGGFLNDIEDIDNLDLSLSLIEF"
FT   gene            587616..589760
FT                   /locus_tag="BH0567"
FT   CDS_pept        587616..589760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0567"
FT                   /product="chemotaxis protein CheA"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17073"
FT                   /protein_id="AAX17073.1"
FT                   /translation="MNSSDMIDKFKDSFKEESIENISDIEHALLNIEFESGEEVINSIF
FT                   RNFHTIKGSAGMFGFNLTASLVHEIETVLDPIKEGSDKFNQDTVDATLMAVDFIRELIE
FT                   GDEAIDESAYKAREKDLIDTIKKGRGVGFNNTVLSSTNEEQTSVSNDLDSQKSVLDASL
FT                   EQGKFDDEALNIETKVYRILFSPSKGILFHGHKPINFLKKLLNLGNGQVRARVRNIPDL
FT                   ELISPDNVYVEWEVKLETEESKSSIEDIFMFLDGQSKIVVEEVDASYEIPEAFELDFLA
FT                   DNLDKGVNEVFFEENQSPSESKEISNNKMSLGSVGANFNDDTAKSKVNIASIKVDSKKL
FT                   DHLVNLVGELVTIQSKLAKEAESSNNNILNSISAEFSLLINELRDYTTGLRTVPIEILF
FT                   VKFQRIVKDLSAQLGKSIRYYAQGGDTVLDKSIIERLNEPLVHLIRNSIDHGIESAEER
FT                   IKAGKEPQGIIKLSAHQSGDSVIVIIEDDGRGLNKLKILRRAVEKNIISENVSKTLSDV
FT                   DVYNLIFEPGFSTADVVTNISGRGVGMDVVRKQVESLRGSVILESEFGKYTRIKLVFPL
FT                   TLAIIEGWLVRVENEYFIVPLSSVESCLEADKLISKVCVLENNNNVMNYRGSMISFIRL
FT                   REFFEISDEKSDSEHVVVVNTNSGKIGIVVDEVLGQHQTVIKTLGKLYSKVEGVSGATI
FT                   LGDGSLALVIDIDTITKIIR"
FT   gene            589822..590973
FT                   /locus_tag="BH0568"
FT   CDS_pept        589822..590973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0568"
FT                   /product="protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BH0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17074"
FT                   /protein_id="AAX17074.1"
FT                   /translation="MKILVIDIQGLIRQVFVRAFAKDMDIEVLNPGSNSLNLINIFLQK
FT                   FPDLVIIVENTAKSHFGLALNNVLNNISLPVVFIAEDEVYPKFGFLEPKKDKIKLIINK
FT                   LNFKLTVNLFRSDYLNLIKSEIKKLADNKFIASCETKRIKAPDFFAKSESEKSEGDIVG
FT                   ITKSYKVSDVINVAPKNDPDVVLRYQGVINKNKTGKVIFVGSSTGGTEALRVFLKSFKK
FT                   DSPPIVIVQHMPGGFTTSFAKSLNNELEVDVKEAEDGDILRPGLVIIANGNYHLIVKYA
FT                   SGSYFVNLLDGPLVSRHKPSVNVLFRSAAMYAGENAIGVMLTGMGDDGACCMLEMKRSG
FT                   AYNIAQDQVTSVVFGMPMEAIKIGAVDKVLPLNKISEYILRRS"
FT   gene            590973..592745
FT                   /locus_tag="BH0569"
FT   CDS_pept        590973..592745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17075"
FT                   /protein_id="AAX17075.1"
FT                   /translation="MENDDKFLDIDPHINKIFAELEAFDSRSRQVYASLSKSIPKLIEK
FT                   LSKDIKDLSFNIGFISNLDIDNDYSLNIFISKVIRVLNDFVSYFNSSTELLESQFGVIR
FT                   DKVKDIEILEDVIEKMKKSSIDMEIMSINTLTVAMRVGRAGGAFSYITNEIKTLTQSMI
FT                   KQADQLTSRGRDIKVGLDRAKDQVLENNTAENKILEEFKDHLMKNIDEFSGGIGEVIAF
FT                   YDNILGILNEFKFKFVNAVSYLQFQDRLTQSLYHLNIMYSSIDVFKFRDTSELQKLKVL
FT                   SVFTDSSKMIVKDVIAKLDENLMAFEGFIDTSISSIQVINDLKSDNSLYIDISRAVESF
FT                   SVILSNLLKRIDDVEKNNSNFLNLYYEQIKLVKSLELMFSNISAISSRFQNINIASKIE
FT                   VVKRVELEDMEGNISEMSKIISNIESNITKGREFLSQIIFFFEKVVKDCDNRFYLERNY
FT                   FNKFKKLFMEIKNNIFEIKKIALDHVLSYEIFPVDFLEIFEEIKLDIHNIKNLRKDLSN
FT                   LEKTLIEMGNDINIALESELLKNGLKYVEIEDKEFVRRIANRFTLFVHKKYLLSLIEDE
FT                   KDVHSFDEGSVILF"
FT   gene            592783..593157
FT                   /locus_tag="BH0570"
FT   CDS_pept        592783..593157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0570"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:BH0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17076"
FT                   /protein_id="AAX17076.1"
FT                   /translation="MQKRILVIDDNRAIRQSVAYILEQNGFGVSEAQDGLEGVSKFKEA
FT                   VGQSDKDFDLIITDINMPNLDGIGVIKEIREFGSFIPILVLTTESEQSKVDEGRKAGAT
FT                   GWLVKPFNPDTLMQTISKIF"
FT   gene            593182..594546
FT                   /locus_tag="BH0570A"
FT   CDS_pept        593182..594546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0570A"
FT                   /product="Xaa-His dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0570A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17077"
FT                   /protein_id="AAX17077.1"
FT                   /translation="MYLRFSLMGFKLKEQFYFHLGELIKFNSVNASALKGKPFGEQIDL
FT                   CLDKVLEIAKDIGFKVYKDRDGYYGFADIGQGDELIGILAHIDIVDAGNVSNWHSNPFK
FT                   LEFRDGKVYARGVLDDKGPLMAVLYAFKLLALEGIFFKKRFRVIFGTDEETAWRCIEKY
FT                   KIREEIPDFSFTPDGDFPVVNAEKGLLQFDVISDERFCMNFELGTGYNVIPDECSFELG
FT                   DSNKDDFRILLDSFGSKIRYKFFESNVLIHGTSAHASLPELGVNVAPYALNIIKSLGVK
FT                   ANFINFFEDKIGFTINGEKLFGRALEDSQSGQLTLCLTKVKLSKTSKQILSFDMRYPVS
FT                   CQREELVALIKQTLNLYALDYHEVSFLDPLYVDSGSNFIESLIEVYENFTGESDVSPIA
FT                   IGGATYSRAFKNCVAFGPLFKDSDNTAHKTNEYIDESELMNLISIYKNAIKKLNA"
FT   gene            complement(594682..594765)
FT                   /locus_tag="BHT0017"
FT   tRNA            complement(594682..594765)
FT                   /locus_tag="BHT0017"
FT                   /product="tRNA-Leu"
FT   gene            complement(594774..595463)
FT                   /locus_tag="BH0571"
FT   CDS_pept        complement(594774..595463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0571"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17078"
FT                   /protein_id="AAX17078.1"
FT                   /translation="MIKIISLGGGIINPDKINIEYIKNLRSFIFKWVQGNDKRKIILIT
FT                   GGGKTAREYQDAYKQINPNFKNHELDEIGIMATKLNAKLISKVMQPLCIDNIVSDPTQD
FT                   FHFKGQILIASGWKAGFSTDYITVKFAEKFKSDEIINLTNVDQIYDKDPKKFDDAKGLK
FT                   NITWNELQDIVGKNWEPGSNLPFDPIATKLALKLNLKAYVLNGTDLQNLKKVFDKNDDF
FT                   LGTIVVK"
FT   gene            595685..596749
FT                   /locus_tag="BH0572"
FT   CDS_pept        595685..596749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0572"
FT                   /product="SS-1,4-galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17079"
FT                   /protein_id="AAX17079.1"
FT                   /translation="MYKYKVSVIICFFNSDSTLEVIIKNAVNQTLRDKEIILVNDGSYD
FT                   NSLKIAQKYADKYDFVKIINQKNMGIAASRNNGLEKSEGEYIVYWDSDDSVENTMLEVL
FT                   YNRAKADNSDIVCSQFYIYFLAKNIKRRSALPFPNYPITGEEAFRNLLLTVFASFCKRN
FT                   FVVGTLWDKMIRRDLIIKNNIRVNDVILEDIVFMIHAFLKADKVSFVNNYFYTNFQRMG
FT                   RASSSISVISKINSSLKVVENFLKEEGLFEKYFEYYKKFYLQLYYYISFKQIYIINWHI
FT                   KDRLIYKAHKEKLISVLNEVQNSKEFQSYYASLKGSRFSELQILPKIMLKIWNFSSGLY
FT                   VNFSIFIYRSFLKN"
FT   gene            596810..597628
FT                   /locus_tag="BH0573"
FT   CDS_pept        596810..597628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0573"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17080"
FT                   /protein_id="AAX17080.1"
FT                   /translation="MKIEFRDVSFSYRKTKVYLDLHLNFSKPQTYLILGKNGIGKTTLL
FT                   KLISGLLNPLKGEVLFNSLKVFPRDPLNLVNLFFVPEEFDLPNVSLNDYYRSLCRFYPN
FT                   FREKDFKEYLLKFEIDIDLKFASSSYGQKKKSIIAFSIATDVPILIFDEPTNGLDIASK
FT                   NVFRDIISGLENKIVFVTGHNVRDLVDIVEHLTIIGNNNILFSNSISYINNNYKVKIVD
FT                   KLRGEELYYEKIKDGFKAIYLESGSCDNDVDLEFFFLYITNNKLKDLVDV"
FT   gene            597618..598481
FT                   /locus_tag="BH0574"
FT   CDS_pept        597618..598481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0574"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17081"
FT                   /protein_id="AAX17081.1"
FT                   /translation="MMFSLKRFFGLFNVDFAYNRKLYLYFIISIFLVFPLVHIFFKIYG
FT                   FVNLIDLLLIDNNRLFFFVLFCVVYIVSIYNMFDHYKPIHDSLRNVFYLSLPVSTIDRY
FT                   LFVLVKFLFILPLFLGVCCYIGLNLTVLLDKNFFIGSKIGYPSLYLLFLFFKETYVIYL
FT                   IGFPIFLLSRIIFKNYPFFKAIVIGSLSFTLLVVFFYFVIFFVNSYLFKVVYDFGIWGE
FT                   YYFIKSICILFAGFIYFCAYFILKNLGNVNTKINFSIYVGIISFFAALFFLLLAFLAIF
FT                   VYVFNS"
FT   gene            598705..600369
FT                   /locus_tag="BH0575"
FT   CDS_pept        598705..600369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0575"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:BH0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17082"
FT                   /protein_id="AAX17082.1"
FT                   /translation="MFLSIDIGCLNLFFWRVLMIDNLKILVVTGGVISGIGKGVTSASI
FT                   ARLFKDNLRITPIKCDGYLNTDPGTINPVEHGEVFVLDDGGEVDMDFGHYERFLNLNSK
FT                   SNWNITMGKIYKNILENERHGKYLGRTVQLIPHVTDEIRDTIFKIAKEECSELLVIEIG
FT                   GTVGDMENILFIETMRQIRYEIGSDNIAFVHLTYIPNPAGINEQKSKPTQQSVKTLNKA
FT                   GIFPDLIIARSSQLLTKQIRQKIAMFCNVDAESIVDNTDVSTIYEIPISFYKQGLHEIL
FT                   GSKLKINVKPKVDGLERLVGIIKRNFASPRKVVNIAICGKYTELGDSYASIFESLTHVS
FT                   ANLDLLVKTIVIDSTNFDEGMLKGIDGIVVPGGFGGRGYEGKMRAIKYARENNIPFLGI
FT                   CLGMQLAVIEFARNVCGILDADTEETLFEGNSAFSSISPVIHLLPEQKELKDKGATMRL
FT                   GGYPVLLKKDTLAFKLYGSEMIVERFRHRYEVNNDYLDLFNKHGFVVSGFSEDSRIVKI
FT                   MEIPKNKFFVACQFHPELITRLESPSKLFVGLVKACL"
FT   gene            600360..601049
FT                   /locus_tag="BH0577"
FT   CDS_pept        600360..601049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17083"
FT                   /protein_id="AAX17083.1"
FT                   /translation="MSLILLSHLLIGLFNVFHRFKSRYILFGFIKGDKMKENDVKKAIA
FT                   MKRLVKYFFDELKYRMKIPCLRPSNKDMSKKYILLNLLRKIANLPFNKQYEIEEQFHID
FT                   VLGKGMLTDAVLIKRLDYERCVITGIVEVRADHVDLEYELNRFLIRRGKVNVLFWQPKK
FT                   AILKQNEDLIILDMDDIFKLDNDFYLPVVKEKLEDFINLFMKFFSYEDILFEYNKIHGK
FT                   YSLVKNN"
FT   gene            601159..602337
FT                   /locus_tag="BH0578"
FT   CDS_pept        601159..602337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0578"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17084"
FT                   /protein_id="AAX17084.1"
FT                   /translation="MYKFLFFGKAKSNISNLSKDEPLKGIEDKKDLNECKYTIPIKEII
FT                   KGFYHTKSSISNVLVHIEFLYNNLFSNFENIDEVFESLINKTNNARMQMSVIFEDIEKT
FT                   NEEKLKRVSDVIVGVQGSLETINSFLGATNMISLNAKLEAARAKEYGKGFSVVADEIKR
FT                   LSDQAKGVMSMISVKEIEQVSKDLVSKNIKELQLDIDNFFSSLVKELTSLEELFKHFVS
FT                   QQNEFSTLISELENVEANISYLARNCDSCSSSETFIYSNDEFLKELEFIISEQMSWMSI
FT                   VRLIVENQKSMAIQTDPMKHGFGLFYKGLAPKAREVREVWENIYSCYLNVHKLVVKIIK
FT                   VFAQDGSDDINLNQARDFLMQAESLSDEIISKLESVKKIVVESEDQGINVFA"
FT   gene            602478..605921
FT                   /locus_tag="BH0579"
FT   CDS_pept        602478..605921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0579"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BH0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17085"
FT                   /protein_id="AAX17085.1"
FT                   /translation="MDLKVDFVHLHVHSDYSLLDGAAKITDIVAKAKKCNMSHIALTDH
FT                   GNLFGAVRFYREAKRVGIKPIIGIEAYMSSISKHIKKNDEFGKPYYHLILLAKNELGYK
FT                   NLLKLTSISYLEGFYYRPRMDKGDIEKYSEGLICTSACIGGIIPQLILANRFDDAKNEI
FT                   LWFKSIFGDDFYLELQRHGIKQQDIVNEKLISYSRELNVPLTVSNDSHYVNRGDATAQD
FT                   IIVCIGTGAKRSDPNRLKMETDEFYIKSQEEMCELFRDLPEALANTLKIAEKCNDFEIK
FT                   FPGPIFPEYQVPSEFDTLGQYLEYLTLEGLKFRYASITDSIKERAFYELSTIIKMGFEA
FT                   YFLIVWDFIKFAHDNGIPVGPGRGSGAGSIVAYALRITDIDPLKYNLLFERFLNPERVS
FT                   MPDFDIDFCFEGRDEVIKYVTRKYGEDKVAQIITFGTLKPKAVFKDVGRVLDIPFAESN
FT                   ELTKLIPDGPKVSLREVFEDGSLKEYLNKGAVYNELMEAALVLEGMNRHVSTHAAGIVI
FT                   ARTPLTDYVPLYKDYKQDTVSTQYTMDLLEDCGLVKMDFLGLKTLTLIKNAENLIKITN
FT                   PDFSIANISDSDAKTFKMLSEGRSASVFQFESEGMQQVLREAKPDSIEDLIALNALYRP
FT                   GPMQFIPQFIAAKTGTKRIKYPHPDLKEVLRPTYGVIVYQEQVMEVAKIIAGFSLGKAD
FT                   ILRRAMGKKKEDEMNKMKVDFIKGALSKGYDETLANDIFELLKPFAGYGFNKSHAAAYS
FT                   LIAYQTAYLKANYPENFMAANLTNEINNTEKLSYYIDEAKSMGIDVLKPDINQSFKEFR
FT                   IVGHNISYGLNGIKNIGGLIVDLIIAERQENGEYKSFEDFIRRVDDKVINKKFLEAAIK
FT                   SGLFDSLGQNRKTLFENLDKLIAFVAKDKNDKKLGQNSLFSSLESQDVIVESFSYHVFE
FT                   EYSYPELLKFEKDLLGFYVSGHPLDPYKSELKRFTNFNILEDLAVRKNTIVKFAGSLST
FT                   VKVIHTKKNNARMAFGVIEDFKGVIDIVVFTESYEKYRHLLIEGDVIGVIGKLTFNRDK
FT                   FSIVVEKVLSIKGNAVNKINNLHIKFSNEGLNDSHLLYSLKDKIFALEDNTGFSHVYLY
FT                   LKNDDKSLKLKMDLTLSFKPDESKLNELRCHKIVEDIWFD"
FT   gene            605933..606505
FT                   /locus_tag="BH0580"
FT   CDS_pept        605933..606505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0580"
FT                   /product="integral membrane protein, YggT family"
FT                   /db_xref="EnsemblGenomes-Gn:BH0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17086"
FT                   /protein_id="AAX17086.1"
FT                   /translation="MIIETLIVFLNIYRILILVRILLSWLVSSGINTSAFFRFIYNSTE
FT                   PFLSIFRRIRFFRIGIYDFSPIAALITITIVERMLSYGDYKLSTFVILFIIEVWGILRS
FT                   VFFALIFFFVLRLIFLVLHLFDDTDFMKSVDSLLMPLSVKINNIVTDKHMSYAISLIVA
FT                   GALLLAFIIICEQAIWAISILGFYLPF"
FT   gene            606514..608577
FT                   /locus_tag="BH0581"
FT   CDS_pept        606514..608577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0581"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17087"
FT                   /protein_id="AAX17087.1"
FT                   /translation="MFLHEFKYDLQGISGLGKKGLERLNSLHITNIRELIEYFPKKYED
FT                   RKNIKTFPDSLEVRNCELMTVFTVLEHRDFGNNFKRNLKLIAQSENNEIFEILLFNRGF
FT                   LEGVFKVGQKFYIYSKFNYNDYTQMWSCSNFDSEVFSCNPERFKKIIPVYSLSEGLTSK
FT                   KISSYVKEALVYFLKFGQSDVPEFLINKYSLLPFHEALNEIHFPSSFEMLEKAKKTLIY
FT                   REIFLLQFFSRGKSSVFFLRKERNLPRNLLDQIILKLPFKLTKDQRVAIDEIINDLESN
FT                   KPMNRLLQGDVGSGKTIVAFLSSIPLIEAGYQVALMVPTDLLARQHYNNLANILKDFNV
FT                   SIAFLTGSLKKRDRDEVLEKIQSGTYSLVIGTHAIFSQGTKFKRLAYIIIDEQHKFGVE
FT                   QREELKNKGEEVDVLLISATPIPRSLALTLFGDLEISLIRRGPAGRIPVTTYLAKHGNE
FT                   EKVYEFLKNELAKGHQVYFVYPLISSSQRFNLKDATSMCLNLKNIFVEYSVEMIHSKLE
FT                   SHVKEEIMHDFYLKRIDILVATSVIEVGIDCPNATCMVVEHAERFGLSTLHQIRGRVGR
FT                   GSLKSFLFLLYKEPLTESGKFRLKTIKENIDGFKIAEEDLKLRGPGNLFGLEQTGYLKL
FT                   KIADFIEDREVVRLIREELNMFSLNKAYYNKSDIELLDSLLLSYLRSVAKES"
FT   gene            complement(608580..609374)
FT                   /locus_tag="BH0582"
FT   CDS_pept        complement(608580..609374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0582"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BH0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17088"
FT                   /protein_id="AAX17088.1"
FT                   /translation="MRSLNILSLILLVNNLTLKANSISKQDLKIVLQTIQTLDKSYQKQ
FT                   IKDNPIQFIKELNPLLEAEKNDLLILVNKKIPIPKEYNPTDLVYLKDFKELKNIGKENL
FT                   RIRKILIDDLISLVEAGKKNGLQIKIVSAYRTREYQKFLFEYNVKTYGLKIATIQSATP
FT                   DHSQHQLGTTIDFIKIDDNLLNTKAGKWLYENSLKHGFSLSYPKNHERETGYKPEPWHY
FT                   MYIGKQACILQKKYFNNLQYKLLKFWHENKKELSRLIQKYTN"
FT   gene            610688..612031
FT                   /locus_tag="BH0584"
FT   CDS_pept        610688..612031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0584"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BH0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17089"
FT                   /protein_id="AAX17089.1"
FT                   /translation="MYSLSKFKKSSVYQDILNIAIPTTIEFFLFNVVAFTDNIMVSYLG
FT                   DYPVVGVSLANKFFELFSTIAFAVMGAYNILATRQYAQGNIAGFKNTFFISILILLFFS
FT                   FLFIVISLFYSYFFLGLLSDDLLAISYGVSYLNIAVYSFIFAVVKGIIANSLKVVKITK
FT                   IQIATSVISVILNVVFNYLFIFVLNMGVVGAAIATTLVRLIELIFYLIYTVFNTNSHFY
FT                   LKLENLKINPVIFSELIKVFVPIFLNDFIWYLGYFGLIAIFSRIDTAKYAAYSITFSIY
FT                   FIGFNIIHAFCFAVNIVMGHEMNNDKEEIMSVAIYLSKIGFVLAVLTSFIMFALSFIAP
FT                   HIFYKLEYADLMGVMLRYYSISVFFTSLAFQYLFGFFRAGASPNFGAIMEGSVTFIYTI
FT                   PIAYFLAKYTQTPFELIVFIPTLEDVIKLGISLPYFYSTKWIKSIKTG"
FT   gene            612056..613411
FT                   /locus_tag="BH0585"
FT   CDS_pept        612056..613411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0585"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17090"
FT                   /protein_id="AAX17090.1"
FT                   /translation="MYLNDIRGKNFLIMGLGLHGGGLAAAKFLLKHGGNLVITDLKSEL
FT                   ELSPSIKSLKQFKDKVRYVLGYHDEDDFKSADIVIKNPGVSFDNKYLKLAKRVETDISL
FT                   FLMFNQNPIIAITGTKGKSTLASLLHKVLVAKYPNSKLGGNIGISPLSFLDELDGTSPI
FT                   VLELSSWQLHDLENLCPIISIITNIYCDHQNYYSNFDSYIADKSKIFINQNSGILISQD
FT                   QAYYNYFYKFKSKSKLILFSETVPLNFKNDIFYFEMGKVYLNNKVMGTLSDSRIVLLIS
FT                   KMITVFIASYLRLDLSVVSKILTDFDGIEHRLEFVREFEGVKYYNDTASTIPDSTVLSV
FT                   KSLRPYGGLINLITGGTDKGLDFAVFGEILSMVKTWILLRGSATLKIIKFLEDNNLHYF
FT                   IFSSLEECVYYAKKNSIRDDIVLFSPASASFELFKNEFDRGLQFKNLVSIMT"
FT   gene            complement(613408..614457)
FT                   /locus_tag="BH0586"
FT   CDS_pept        complement(613408..614457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0586"
FT                   /product="N-acetylmuramoylpentapeptide-ornithine
FT                   N(5)-glycyltransferase"
FT                   /EC_number="2.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17091"
FT                   /protein_id="AAX17091.1"
FT                   /translation="MNIKKTQIESLNENYLQSKLWTIVKKTSSNKSPWKAIALSSDHFN
FT                   KILVMQRKIFGNLYLSYIAHPEFSNKKIEEINAYELNTQIKKFSEDIRQYLHKNTIFVR
FT                   YDLMFYTTRSLKEDYIPLKLKFKNLKKSFDDIQPSNTTILDLQDSLDAIKAKMKKKTRY
FT                   NINLSSKKNIKVIIDDDFKYFDEFYKLHKETAQRDKFAIHSKDYIKNLIKAFTEDTNSK
FT                   IKLIIALHNEQLISGIIVGIYKDKATYLYGASSRSNRHLMPNYAVQFKTIQMLKSLSIK
FT                   EYDLLGIPPTADAKHPLFGLFQFKTGFGGKLIHRIGCYDFVYKKFLYKVYSILEILRYI
FT                   YYKIIKKRF"
FT   gene            complement(614479..616668)
FT                   /locus_tag="BH0587"
FT   CDS_pept        complement(614479..616668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0587"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BH0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17092"
FT                   /db_xref="GOA:B2S0T6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0T6"
FT                   /protein_id="AAX17092.1"
FT                   /translation="MKKKNLITAALPYVNNIPHLGNLVQVLSADAFARYSRMMGIETLY
FT                   VCGTDEYGTATETKALIEKTTPEELCNKYYEIHKSIYEWFNIKFDIFGRTTNKRHKETV
FT                   QDLFLKLEKNGYTTEKESEQFFCKQDQMFLADRYVTGECPNCGNNAKGDQCENCSKLLS
FT                   PTDLINPKCIICKNIPIIKTTKHIYIDLPKIKDELSHWMQITELNTNWNTNAIKITNAF
FT                   LRDGLKERAITRDLKWGIPVPKKEYENKVFYVWFDAPIGYISITKEISKDWESWWKNNE
FT                   ETNLVQFIGKDNILFHTVIFPSIALGSKENWTMLSKLASSEYLNYENLKFSKSAGTGIF
FT                   GNDVITTGIPSDIWRFYIYYNRPEKSDFQFMWDDFMERVNSELIGNFSNLVNRVLTFYK
FT                   KFFGDQIDKIEIKEDFWQEINLKYDKTLNFFKQVELKSALKEILDISRTGNKIFQDKEP
FT                   WKTKDSTPQKTKELLLNLIYLIRDLSILISPFIPHTSDKIRRFFGNSYEISNRFLGTNL
FT                   GLSTIQFTEVLFIKLEKHLINSLKLKYSGSKNMQDEQTSNQINPINLFSEQVCLKVVQV
FT                   KTIERNPDAEKLFILKLNDGSSDGKQIVSSLADYYKEEELIGKHIIIVDNLKPAKFRGI
FT                   KSEGMLIATEDKDKNFKVIIVEDFKDNPIPGERIILESDSYKELKSPAKISIDKFFKTQ
FT                   IVAENGELKINGINLILEHSKEKILSIEIPNGKVY"
FT   gene            616784..617842
FT                   /locus_tag="BH0589"
FT   CDS_pept        616784..617842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0589"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BH0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17093"
FT                   /protein_id="AAX17093.1"
FT                   /translation="MESIMGSFNFKDYVCGRAKRIVMEKGDRASIVFPESMDDRILKAT
FT                   IYILKEKLAGLVVLIGCKDKVFRRLKEFVGFSGDILEMIRVIEPNSFKDFNRYLDEYLS
FT                   LRYSKTLTLSKAREELLDEIVFSMMMVRLGEVKTCVCGALASSAKVLRSVFGILPKLKE
FT                   TKCISSFMIMDTGNDFGRFETCFGYEGILMFADCAVIINPDSMQLAEIAIQSANSFKNI
FT                   FSAEPKVALLSFSTKGSAHSVEVEKVRCALDIVKKKCINLLIDGELQIDAALVKSVAEK
FT                   KCSDSLVAGAANVLIFPNLEAGNIGYKLVERLAFAKAYGPFLQGLKNPVSDLSRGCSVD
FT                   DIVLTSALMIGS"
FT   gene            complement(617813..618649)
FT                   /locus_tag="BH0590"
FT   CDS_pept        complement(617813..618649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0590"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17094"
FT                   /protein_id="AAX17094.1"
FT                   /translation="MNINYNSINSIKRMLESKNIAPRKIWGQNYLINEHIREKLVDALE
FT                   IKENERIWEIGPGLGAMTIILLKKANFLTVFEIDPKYSEILNEQFGQLKNFKLIKGDFL
FT                   KTYKQEGQNINKIFSNLPYNIASKVISMLIEDEILTHMVFTVQKELADRMLAKEGNKNY
FT                   SSFTVLVQSHFNVIKIMDIDKKNFYPIPKVKSTTLKLIPCKKEIKNFKAFNKLVRTVFT
FT                   SRRKKLKNTIINFIADDNILNEDFLKNFLDKRPEEISVKEFIAISNKLTTNHQCTC"
FT   gene            complement(618677..619951)
FT                   /locus_tag="BH0591"
FT   CDS_pept        complement(618677..619951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0591"
FT                   /product="COME operon protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17095"
FT                   /protein_id="AAX17095.1"
FT                   /translation="MILLFIISALNLFIRYYLRLNPIYLNLILMLIFLIKRNAHLSLTF
FT                   MISISFLIIFEISLNFKRLEDNVYQITNITYFEKYSNTKIESIDGFGKKYKFIFKNIED
FT                   KYKIGDIVKIQNKKMQLIKRPLLVKLREKYNKLINQFLNSISIKYSHFSKAILTNNKSN
FT                   ITKYESNLFQKAGISHILVVSGLHFYLIYIIFYYLVHIIKSEKLKYLILSAILLNYLIL
FT                   TGFSPSALRAFIMIETLMIYKLTYGKINLLSTLSISFIINAIILPHTLNSIGFKLSYLA
FT                   VLGISISLALNQRYNLNNLISPIFTTLLIQVSTAPILYANDLNLQPISILSNLIVTPLM
FT                   LVFLILTILSLGVYTVNTHLFLFFDLINTHIFKAIKDTAIIFGKFPVIQNYNIGIFLVL
FT                   SILTIFYIIYKLEQEKRYGNKSVKH"
FT   gene            620066..620773
FT                   /locus_tag="BH0592"
FT   CDS_pept        620066..620773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0592"
FT                   /product="CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:BH0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17096"
FT                   /protein_id="AAX17096.1"
FT                   /translation="MTLLNKYPLRYACLEILLSYFIVSRISPFDYVGVDLWNFSINHYY
FT                   YWLYSAFLIIFIIYFAKLTSSYDFRDEFFIPEFKPIFICQAFLIFVKLLIYIFFLLIIL
FT                   CLCILYCFPESLRLWVEAGSSGFMWNIGSKQSLALMVITSLFTGGVEELFYRAFIITKL
FT                   KQVGVASLIAAFLGSIIFAYGHFYYGFIGFFFALIFGGILSYIYLTHKNIYYSVFVHSF
FT                   YNIFVSVLLFLLN"
FT   gene            620787..622718
FT                   /locus_tag="BH0593"
FT   CDS_pept        620787..622718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0593"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17097"
FT                   /protein_id="AAX17097.1"
FT                   /translation="MLDTIPKRFREIVGFYGDLDIFIYKENESKDFKKQIYSDFWNEVK
FT                   RAGSGLLHYGIKKGDRVALISDSRREWIIIDIAVMSLGCIDVPRGNDSSDDELAYIINH
FT                   SESSFVFVENAKQLQKIIAKKHELKFVKHVVVIDDDKLYEDKLGNITIISYKKLLSVGY
FT                   DYLKDNPKMFDSELEKVSGKDIATIIYTSGTTGLPKGVVLRHESFIFQLDRISNYLPTL
FT                   EPGKIMISILPLWHSFERSCEYIVTLNGIAVAYSKPIGPILLKDFATLNPHAIISVPRI
FT                   WEGIRIGIIKRVSESFLKRILFNVFLKVGIIYVKLKEKFLGFVPVYKKSNFVVSFFMKV
FT                   IYLAGLILILPFKFLGYVLVFRKIKKALGKRFEFGISGGGALVDYVDYFFKAVGIVVLE
FT                   GYGLTETGPVLSVRCLRRPVANTVGPLLPDVEYRVVDSDGNALPPGEKGELWVRSPQVM
FT                   SGYFKDEATTREVLTRDGWFKTGDLVCATMNNEISIVGRTKDTIVLRGGENIEPEPIER
FT                   ALSKSVFIESVVVVGQDQKFLGAIIVPNFEVLEKWAGSNGVLFSSRDDLLSNESVNKLY
FT                   SKCISDIVNPKSGFKNFDRIVGFVLLKDSFVVGEELTNTLKLKRYYIFEKYHKKIMSIF
FT                   NKDDCELL"
FT   gene            complement(622749..624503)
FT                   /locus_tag="BH0594"
FT   CDS_pept        complement(622749..624503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0594"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BH0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17098"
FT                   /db_xref="GOA:B2S0U2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0U2"
FT                   /protein_id="AAX17098.1"
FT                   /translation="MNSKIKKDLKDIISKTIKELALRESIKLEEINIIMQKPPKSELGD
FT                   LSILIFEFSKILKLNTSIITEEIIKQIGDKYATKAMGPYLNIKFNRKEYIKDTIKKVNE
FT                   QKEKYGINNVLKNKRIIIEFSSPNTNKPLHIGHLRNDIIGESLSRILKASGAQVTKINL
FT                   INDRGTHICKSMLAYKKFGNNTTPELSLKKGDHLIGDFYVKYNEYAKNNEMAEDEIQQL
FT                   LCKWEEGDEKTVQLWKKLNQWAIEGIKATYKLTNITFDKIYLESEIFKIGREIILKGLE
FT                   EGLCYKREDGAICIDIPTEKNEISEQQFKQKVLLRANGTSIYLTQDLGNIVTRKNEFDF
FT                   DEMIYVVGSEQIHHFKTLFYVANKLGITKENNLVHLSYGMVNLPEGKMKSREGNVIDAD
FT                   NLIHDLSESIILEIKKRNSDKKDYQEIALNISLGAIHYYLLKTAIHKDILFNKEESLSF
FT                   TGNSGPYIQYVGARINSILEKYDELNLSNETINFDLLVNENEWEIIKIISEFEEHIIKA
FT                   SKDRNPSVIANYSYLLAKSFSTYYQDTKIIDKNKPELTHARIDLSKAVLQTIKNCMHLL
FT                   NIPYMKKM"
FT   gene            complement(624493..625086)
FT                   /locus_tag="BH0595"
FT   CDS_pept        complement(624493..625086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17099"
FT                   /protein_id="AAX17099.1"
FT                   /translation="MHNKTFYITDKYLKTSLMLFPIFSYTKNFLEGTIISIWISLCILL
FT                   PAMIIKQIGLRNQILIIYLLTIGIVTSLTYLFMYYVTPTLYENSRFSIPILIVIIISFH
FT                   KNEPFKGLKDQLSILKYSKLPIITFISLSAIISVFREILNTGSLQLFNIKLSIIKDSNI
FT                   IKTQAYSSNVFLAASLIFLSINILINIKGKKNEQ"
FT   gene            complement(625102..627330)
FT                   /locus_tag="BH0596"
FT   CDS_pept        complement(625102..627330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0596"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17100"
FT                   /protein_id="AAX17100.1"
FT                   /translation="MRIQVKRNHSSSTLFYKFNLVIVIYTIIIAMTIFILLDHGYRKII
FT                   TKELQSFTKFVNNIMIKSFSRDTRNMLIAIDDFVKHYNQHLGTQKSEHVKNVISIDQLS
FT                   LFPSYIKIIEYTNKNGKILYSSDARRLNTHIKLQEMKTGHNTDNYHTLTLNQDLTIINN
FT                   KSYIPMLYKIPQPDQNDLHNTSNENIKSGKDMIINHDGYIVLYADILEQIKQLRKNIFM
FT                   LLERSLLEKGNQHKSYHYFKIYAINSQGDIFGEQNEETLKPIKLSINSLFENNTKITTP
FT                   LLNAITKRKNNYNTSYNNNIISITRLASSSWYLAIQMNYNNIFSNELNNIKLISISIII
FT                   LLVIIFILIMIITIKKLIISKIEKLNQIIPKVKEGDLTIKIESKGKDSISATINYFGHF
FT                   IENLKNVINSLQGRVKLLKDNGDLLFNEINKAYDTITNSNKYIEKTQGEIEKQVEFISN
FT                   TTNTIENLSKNIASLDNSIETQAASVEESSSAIEEMIGSIQSVTEITQKAAKSTEELKM
FT                   FSDDGRKKQEEIIMQIKDIYKNSTRLQEANALISSIASQTNLLSMNAAIEASHAGEAGK
FT                   GFAIVAEEIKDLAEQVTSQSESVAASINEIMDSINQTVKTSELTNKAFNQIFNSINLVV
FT                   QVIEEINHTMQEQSIGSQEILKALNTMREITYEVKIGSNEMFRGNKEIINAVSVLEEIN
FT                   VTVSNSMRGLKEEIKKLIEAVESIKTFGTTNSNHITEINTDTNQFKTK"
FT   gene            627491..629716
FT                   /locus_tag="BH0597"
FT   CDS_pept        627491..629716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0597"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17101"
FT                   /protein_id="AAX17101.1"
FT                   /translation="MGLILEIFFMNEDLVNVKLKNMRFSLYLILFIFICFGLLFLGQAY
FT                   LNYRNRYLERVESDFKLFSKNVAFQVKNKYNGAVGVLKNLIANDNVVNVLRNVSNDFIA
FT                   SVDLRFIDLSTSIALFLSSKGFNEASKVFQHVPLEANSLEGIFYIPVGQNVLISNKNFS
FT                   FLGINNIIENSIYLVPAKKRVAYYSSYKRVKNRLYSVVSMPVIDDDSAVLGVICFFVCF
FT                   DNLFSDIANQFNSYLKSSNKHYEFFVVDKEFNPLFLSLNDLNINNFAENYASSVLSKVM
FT                   ALTKESPNISRDILKYKTSSYFLSTAQIDGNGVQGIILNMSYLPLRFQSNAIFFLGFIF
FT                   FVYLIIFYLYNRFILPFIRDFRMLINYKKEREDILSLESVLEVKYKSFIFSYISAEFDS
FT                   LFSKTTNVNNSIKAYVQELRKCLAEISIPAESIDKMHNSLATYDRMGDAFSKFEKSIIN
FT                   ILKDFESISNPISEHSKNILDIATRFEENANVFYGIDKNLEVFSKVVASNSASIDDVKN
FT                   KVVELNSIFENINKNFSELLSQTNNLQSANKLLVLISAQTNMLAMNAAIEAAKAGDAGK
FT                   SFAVVAEEIRKLAINSGKYSTTIKDELKMVNNIISVISSEIDAIYKDFIDIQDNINNNS
FT                   VQHERINVTLAKHVKEIEEFKDKYLSHDIKIKDTKNMCKEIFNSYFVISGKFNNLNNDL
FT                   GEFEVSKMSLDALESLREHISLVNECRDKIANMKDIVENINHEFWGI"
FT   gene            complement(629718..630635)
FT                   /locus_tag="BH0598"
FT   CDS_pept        complement(629718..630635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0598"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:BH0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17102"
FT                   /protein_id="AAX17102.1"
FT                   /translation="MSKNINNFLKKINIKPKTKNLANYTTYKIGGISKLFLTPKTIKDT
FT                   EHIFKVAIEEKIKIFILGGGSNLLINDGGEIDFPIIYTGHLNKIELQDNQIIAECGTNF
FT                   DDLCNFALQNELSGLEFIYGLPGTLGGAIWMNARCFGNEISEILDQVVFIDEHGKTICK
FT                   KFERGEFSYKISPFQNKNTVILKATLNLAKGNKKHIEEIMKQNKQNRIDKGHYLFPSSG
FT                   STFKNNRKFSKPTGQIIEECHLKGLKIGGAAVSHYHGNFIINNDNASSKDIKTLIERVK
FT                   TEVQIKTGFLLEEEVLYIGFNDKN"
FT   gene            630826..632271
FT                   /locus_tag="BH0599"
FT   CDS_pept        630826..632271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0599"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BH0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17103"
FT                   /db_xref="GOA:B2S0U7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0U7"
FT                   /protein_id="AAX17103.1"
FT                   /translation="MLLKLYNTKTKSLSDIKNFSDTKVYACGPTVYNYAHIGNLRTYIF
FT                   EDLLIKSLRLLKYNVNYAMNITDIGHLTGDFDEGEDKVVKAARERGLTVYEISRFFTEA
FT                   FFDDCAKLNIVYPDKVLVASEYIASMIEVVKVLEQNGFTYFVNGNVYFDTSRFNGYGQM
FT                   AGINLNNFGRSSVSRVEIDLSKKNKSDFVLWFTNSKFKDQEMKWDSPWGFGYPSWHLEC
FT                   AAMNLDYFKSTLDIHLGGVDHVGVHHINEIAIAECYLNKMWCDMFVHGEFLIMEDEKMS
FT                   KSNNNFITIKDLESDGFSPLDFRYFCLTAHYRTQLKFTFSNLRACKIARENMLNKLTFF
FT                   YSSLSQFDMALLNKNCENIESVSENKYYNNFLEKIAFDLSIPQALALLWDIVKDDDLSA
FT                   LLKLLLAFKFDEVLSLGLKEGVLREIERDRVNIDDTMHSLIEERRLAKLRKDFKRADEI
FT                   REYFRSKGFVLIDTEEGTKVKRG"
FT   gene            632275..633831
FT                   /locus_tag="BH0600"
FT   CDS_pept        632275..633831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17104"
FT                   /protein_id="AAX17104.1"
FT                   /translation="MAVFFKSQSIILSFIFLIFLSLFVFSGFLFYLKPVIYEISPMPAS
FT                   HENVIVIKGRNLGNKIGEVNINNHYLTKSSIISWSNKKVVFRITDEISSGLVFVKSEEG
FT                   ISNELFLVISRQVPIKLEEKTKPFLFDTENLVLMTNVPVTLRGKNLISDFAVVEIFIQT
FT                   KHELYKILSRDILTLSQEEIKFIPPKTLHIDGEIFLLVDGVESNRIPFNFDKNFFMWNL
FT                   KRSRNFKIFHEIYFVQANSKEDSSAISDDINFNVFYLSPIENERQKIKFSDNNGSVLDL
FT                   DNLFFKSLKSNTYHLKFEVETYKLDLDIFDRNALKRIKVNTDSDMYEFKTYVLNKRNRY
FT                   LSYDSLDLSPINLNINNRDSAYELAKSIIDALILHFTVIDNDLTLDESIKMREISADNL
FT                   ILLTNLLFLRNNIPLRNAVGFYFDSKSSSLKKHIWCEFFLEHVGFIYFDIVNAVLFRDS
FT                   SNYFLNMSENYIHYGYKEDYDDDLLADEYFDLVLFKYKSLTNSNYSLNYRITLEENIND
FT                   R"
FT   gene            633821..635074
FT                   /locus_tag="BH0601"
FT   CDS_pept        633821..635074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0601"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17105"
FT                   /db_xref="GOA:B2S0U9"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0U9"
FT                   /protein_id="AAX17105.1"
FT                   /translation="MIDSILFDLIEREVKREKENIELIASENFVSSDVRRAVGSILTNK
FT                   YAEGYPSKRYYGGCFVVDDIESLAISRARELFGANYANVQPHSGSQANMAAIMALIKPG
FT                   DRILGMELSHGGHLTHGSKVSFSGMFFDAYSYGVSRESEMIDYDDVRKIAKECRPNLII
FT                   AGASSYSREIDFKKFREIADEVSAYLLCDVAHTAGLIATGFHNSPIDVAHLTTSTTHKT
FT                   LRGPRGGLILAGRESSIIVNYNNKERRLEDAVNSCVFPGTQGGPLMHVIAGKAVAFREA
FT                   LMEDFKDYISRVISNTKAMAECFISEGFRIVSGGTDNHLFLVDLGILGITGADAEKVLE
FT                   RVNITLNKNAIPFDSKNPSVTSGIRIGAAAITSRGLNRDDSIRVAHFVIRALKTKSEDE
FT                   LKKIKRDVIEFISSFDMP"
FT   gene            635101..635850
FT                   /locus_tag="BH0602"
FT   CDS_pept        635101..635850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0602"
FT                   /product="DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17106"
FT                   /protein_id="AAX17106.1"
FT                   /translation="MSNLFQIFLLLLPFILILSPFLLSVFFIFFIFFIISSILGGFRIY
FT                   TTRDYSYSKSREFEFYKLSFLLMAKLISILGSMTGEQLNYINFIISSLNLSEKHKTELY
FT                   NIFHFSVTQNRNADKILYTLKLGYFQHKDLFVWLVSALKEINNLARYGNLEGDKFIRYV
FT                   SSFLELDFESYDTYKNINIEIVNPYEVLGLKYNASDDDIKKAYKRLVIQYHPDRFANEP
FT                   IKQKEANEKFIKIQNAYEKICKERNLK"
FT   gene            complement(635960..637762)
FT                   /locus_tag="BH0603"
FT   CDS_pept        complement(635960..637762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0603"
FT                   /product="p66 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BH0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17107"
FT                   /protein_id="AAX17107.1"
FT                   /translation="MKMKKMIILYVLIILLSTTTVFADDLNTDAPKSNPWSPKFTFENS
FT                   SEFRFDMDELIPGLENKSQIGFKFTPFEKNKEVGKDDPFSAYIKIEDLFIKAQGKKDAI
FT                   LKINVGNITAKINMYDFYLKMESMTNFDFNQESLFSFAPMTSIQSKYYGFPSNNSATRR
FT                   TILARGTAKKIGSLQFGYTLPQLELVLAIGATGTGNRNHQKNANDSEADKKKKEETPYN
FT                   DTYQGMLYGTQVKWKPIKNELEQYSSDVIAETPFELNFGISGAIGNSTFNHSSITYGLQ
FT                   DTAVAGSDLVSPTLSNASIMTSIGFTYKLGLTKINNRNTYLLLQTGSDLGIDPFASDFS
FT                   ILGHISKKANTDDKSQFNPKENKLQFDTKRTTNFAFSIGTGIGLAWNTDEGEKESWSIS
FT                   GGSSYSKRIFGTQGKKSGIGIGITYGQNLYKPTSSNKVIQEIAAKAFQTFNAEISTYED
FT                   NKKGIIPGLGWIASIGVYELLKERPQSDDIITILTPNTTATTTNNQSVSFADAAKIGGA
FT                   LYIDYAIPVESGSQNAHIIPYVGTHFLGSLKGSDKSLYLKAGLELDKFIKLTTISLGWD
FT                   SNDLFARKDQKGSVFLQLKVNFNE"
FT   gene            complement(637943..639478)
FT                   /locus_tag="BH0604"
FT   CDS_pept        complement(637943..639478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0604"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BH0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17108"
FT                   /protein_id="AAX17108.1"
FT                   /translation="MVNLKRSAYLIMNFYDFIKALVPIMLIIIGLGIIKKPAYYVIPIC
FT                   LIVTMAIVLLDKNLGIANTSLAIFEGTIMGIWPIIIVIIAAIFTYKMAESQNDMKIIKA
FT                   MLSNVSSDKRIIVLLVAWGFGNFLEGVAGYGTAVAIPVSILIAMGFEPFFACLICLIMD
FT                   TSSTAYGSVGIPIISLAQATGLDVMRLSYDVSLQLILPTLVIPFILVMLVGGGIKALKG
FT                   GMFILTLLSGASIAISQVYVSKTLGPELPAILGSIPAMAITIIYAKLFEKKGTTNNNIK
FT                   VSVMQGFLACLPYILIVSLIIIVSPLFYGINKYLSNFKTTLSIYPGTNPLQFKWLTSPG
FT                   PLIILATVVSYSIRGVSIVEQLKTFGLTIKKMALSSFVIICIVSISRLMTHSGMIKDLA
FT                   DGISTLTSTSYPLFSPLIGALGTFLTGSDTVSNVLFGPLQTQIAANIDVNPYWLAAANT
FT                   TGATGGKMISPQNITIATTTAGLIGQEGKLLSKTIAYALGYIFISGILVHFLL"
FT   gene            639525..640475
FT                   /locus_tag="BH0605"
FT   CDS_pept        639525..640475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0605"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BH0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17109"
FT                   /protein_id="AAX17109.1"
FT                   /translation="MKIVFTILSFLILFSIFGKLFSIDLFDIERVTEDAKSVVLIDYDT
FT                   KRIFYAKNPNLVFPPASLTKLVTIYTALVEARKKNIDLKTIVPISSAASYYNLPLGSSL
FT                   MFLEEGHKVNFEELLKGLVISSGNDAAIAIAEFIVGKNLSNFVNLMNINVLNLGLVNMN
FT                   FVDTSGYCNGNQITALEMALFARTYIEEFEFMLAIHSLKDFIYPRSENLGNTSSSKMLN
FT                   LKQENRNVLIFNYPYADGLKTGYIKTSGLNLVATAKKDDIRLIAVVLGVNKGINSVGEK
FT                   KRALIAQKLFEYGFSNYSRFPFIGKIRKKIYNGTW"
FT   gene            640469..640630
FT                   /locus_tag="BH0605A"
FT   CDS_pept        640469..640630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0605A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0605A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17110"
FT                   /protein_id="AAX17110.1"
FT                   /translation="MVNISFKKLFNLFFEEIQFKAVESSIKALIAPLENNEVVGILILD
FT                   TFNLEVLN"
FT   gene            640678..641205
FT                   /locus_tag="BH0606"
FT   CDS_pept        640678..641205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0606"
FT                   /product="chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:BH0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17111"
FT                   /protein_id="AAX17111.1"
FT                   /translation="MFIKNFKRVIDFMLNHFNFKLKRDVTIIVPGEAFVSNDRVISTIL
FT                   GSCVAVVLYDEMRKLIGVNHYVLVKSDSVINAAQRGRYGVYAIPMLIDAMLGSGASKSN
FT                   LKAKLFGGANFMAKETIRVGIENSEFALNSLAKYGIPVVACDFDQSKSRKIFVFPENFR
FT                   VIVEYPDGAKVF"
FT   gene            641466..642887
FT                   /locus_tag="BH0608"
FT   CDS_pept        641466..642887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0608"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17112"
FT                   /protein_id="AAX17112.1"
FT                   /translation="MENVVIRYFKQISQIPRCSKNLKGISNFIKEEAKKFGYSFKEDGI
FT                   GNIVVGVKANGCSNMLPIILQAHTDMVCEKNESVMHDFEKDPINIIEDNGYFVASGTTL
FT                   GADDGIGVAMMLAIMSESLTFKHPDLELLFTVDEEIGLIGAIGLDPNLCSGKMLINLDG
FT                   EEEGYFLVGCAGSRLVHINFEPQYRQSRKKTGVEIFFTGLKGGHSGADIHIDLANSLKL
FT                   MFFALNTLRANMEFEIGYISGGDKSNAIPREAKALILIEAEHYVLLERELKSFKRHAQE
FT                   MYTLDSDFEILLRRVNFSGNVLDDMSQDKLLNMGMAFLHGVQKVENYDEKLIRTSLNFA
FT                   SLLKVGNEYQFIFTIRSLLDIEKEYIFNHLKAISDLSGANLRIVYDYSSWKPAENSKLL
FT                   NHLKNVYKDMYLKEAKTVVIHAGLETGIISAKFGGIDSVTIGPWIKSPHTPRERVDIAS
FT                   TIRVYNFLKRSLETL"
FT   gene            642996..643068
FT                   /locus_tag="BHT0018"
FT   tRNA            642996..643068
FT                   /locus_tag="BHT0018"
FT                   /product="tRNA-His"
FT   gene            643087..643160
FT                   /locus_tag="BHT0019"
FT   tRNA            643087..643160
FT                   /locus_tag="BHT0019"
FT                   /product="tRNA-Arg"
FT   gene            643218..643298
FT                   /locus_tag="BHT0020"
FT   tRNA            643218..643298
FT                   /locus_tag="BHT0020"
FT                   /product="tRNA-Leu"
FT   gene            643305..643376
FT                   /locus_tag="BHT0021"
FT   tRNA            643305..643376
FT                   /locus_tag="BHT0021"
FT                   /product="tRNA-Gly"
FT   gene            643425..644771
FT                   /locus_tag="BH0610"
FT   CDS_pept        643425..644771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0610"
FT                   /product="trigger factor, ppiase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BH0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17113"
FT                   /db_xref="GOA:B2S0V7"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0V7"
FT                   /protein_id="AAX17113.1"
FT                   /translation="MILNDDVKLIPGSKVEAVIKISKEFVKGKYNEILQDYSSRLKIKG
FT                   FRIGKVPFSIIEGKYSDNIRALTIEKLIHKSLEEFFKSATYKPLGYAVPKILDEKLEID
FT                   FNKDFEFTVVYEAYPEFEIPDISNVEVEIPEVTVSDSDVEDELKLLQLENAMVVDDSGD
FT                   VKVGSIVRVDFVELDDSLSEILTTKRQDFVFTVGESNNYYGFDNDIIGMKKDEEKIIEK
FT                   NYSADYKFSELANSFKRLKIIIKDIKKRDIPELDDDFAKDIKDSFNTLEELKAHIRENM
FT                   LRLVKEKRESLKLSKLLSDVSEKLNIEIPSAMFEAELKNVVNEFSTQNKIDLKKLNDSS
FT                   MGLEGVSDVFKENVLKKLKSKLVFQKIVDNDLTEITDADLEDELVKQAEDTKMRLSEIK
FT                   KFYQEKNLLGILKDEIKRQKVKDKILKNVKEIKLKEIAFRDFINYKTGE"
FT   gene            644771..645370
FT                   /locus_tag="BH0611"
FT   CDS_pept        644771..645370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0611"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:BH0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17114"
FT                   /protein_id="AAX17114.1"
FT                   /translation="MIREYMHNLVPTVVEYTGNYERVFDIYSRLLRDRIIFLSGEINDI
FT                   RADTVIAQLLFLESEDSKKDIYVYINSPGGSITSGLAIYDTMQYIKPDVRTICIGQAAS
FT                   MAAFLLAGGAIGKRESLSYSRIMIHQPWGGIGGQASDISIQANEIIRLKRLIIDIMSNK
FT                   IGVSKEKLSLDIERDYFMTPKDALDYGIIDGILVRN"
FT   gene            645382..646683
FT                   /locus_tag="BH0612"
FT   CDS_pept        645382..646683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0612"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:BH0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17115"
FT                   /protein_id="AAX17115.1"
FT                   /translation="MRFYMAKSKSQKIEGCSFCGRTNAEVEGRIISAKSVAICFECSKI
FT                   CHNLFKEDTEKPERGRSSRSLPTPKQLKSHLDKYIIGQEDAKKVLSVAVYNHYKRIFRG
FT                   NKKESGVELEKSNVLLVGPTGSGKTLLAKKLADEMNVPFAIADATTLTEAGYVGEDVEN
FT                   ILLKLIHAANGDVSFAERGIVYIDEIDKIAKKGENVSITRDVSGEGVQQSLLKIIEGTI
FT                   ANIPPKGGRKHPYEETIEINTQDILFICGGAFVGLENIIKRRINKSSIGFSSVGKQDSR
FT                   ENNSLKYLEMEDLVKFGLIPEFVGRLPVHSYLEKLEKEDLIKILIEPENSIVKQYYHMF
FT                   KMDNVELVFERDALNAIAEEAMLKNTGARGLRSILEELLKDVMFEIPSTKQIKKVIVTK
FT                   ESVLNSNIEPFILTGRHVHKPWAKELYEINSKSN"
FT   gene            646628..649063
FT                   /locus_tag="BH0613"
FT   CDS_pept        646628..649063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0613"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:BH0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17116"
FT                   /protein_id="AAX17116.1"
FT                   /translation="MFISLGQKNFMKSILNLINSKRDDLPVILLRQNVFFPNVTLWVNF
FT                   DDSVSINAIYQSMLEGRLILFFCVNDLKSDNNGKISLENLYSIGTYAKIIQVVKVTETL
FT                   IKILVNFQDRVIIKNFLKKKNYFRAKVDFISDKCEFNSELFTYSKFLREAYDTYKSYLS
FT                   VNTLEDDESNNLFDSPAKLVDVIASNMNLEYKVKVELLQELDVKVRIEKLIINLSVETE
FT                   LLMLKKDIKTKVKTRLDKGQKEYFLNEQLKEIQKRLGRDENDYLERLNCKDIPEDIKPR
FT                   IEKEISRLTRMNTNSPDANIVRNYVELLLDLPWNENTVMNNSLREIEFILKNAHYGMDK
FT                   AKEKIMNFLAVYHINSKVQAPILCLVGPPGTGKTSVALSIAKSLSREFAKISLGGLRDE
FT                   TEIRGHRRSYVGALPGVFINAIKVAGKSNPVILLDEIDKINSTYKGNPESALLEVLDAE
FT                   QNSKFVDHYLEIPYDLSNVLFVATANSLHEISRPLLDRMEIIKIEGYSCVEKLEIAKNF
FT                   LIPKIIKESFLSKVYIKIEDDVVLHIIRNYTMESGVRSLKRVLTNLFRMVVRELLYVYS
FT                   REDIIEGNFYFPSSLMHGNNSLFTHDPDIPGIYKIINMSNFHFYVDCEYKFNLIRIDSS
FT                   GFVYGLAWTSYGGAVLPVEAIKFDRKGDIILTGSLGAVMKESAQLAYSVVKTYSSELNL
FT                   DINEIPEIHLHFPEGATPKDGPSAGITIATAIASVLSDKKVPLDLAMTGEVTLKGSVLP
FT                   VGGIKEKVLAAYRHGINRIIIPRDNEKDYIKLPEDIRDNINVKYVSHLGEVFDYLNII"
FT   gene            complement(649281..649907)
FT                   /locus_tag="BH0615"
FT   CDS_pept        complement(649281..649907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0615"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17117"
FT                   /db_xref="GOA:B2S0W1"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0W1"
FT                   /protein_id="AAX17117.1"
FT                   /translation="MNRKNIAKGKLVRRFGINIFEQPKYDKLLKKKPNPPGMHGRSRRA
FT                   KITEYGKQLIEKQKVKFTYGISERQLTNIFKEARRQHGVTGDNLLALLERRIDNVVYRA
FT                   GFAISRAHARQIVSHGIIMLNGRRVTIPSITLRANDIIQVKEKDSLKKLVRSNIEKTST
FT                   LRKLPTWIEVNADDLNVKITRPPSRDEIPTLANEQMIVEYYSKRA"
FT   gene            complement(649928..650001)
FT                   /locus_tag="BHT0022"
FT   tRNA            complement(649928..650001)
FT                   /locus_tag="BHT0022"
FT                   /product="tRNA-Met"
FT   gene            complement(650057..651370)
FT                   /locus_tag="BH0616"
FT   CDS_pept        complement(650057..651370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0616"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17118"
FT                   /protein_id="AAX17118.1"
FT                   /translation="MIKIINDKNTNKCAHLKLAVLKKNEIYIVYTENNIKTISYLKAQI
FT                   QDKEIKINDFYIDPNFKAEGIERVLIHNLIYYGKKNKLQKILCTINDIKEELKNLGFEN
FT                   NNNVYEKDLIYETKKNTLIMRIGFISVLAEVASIISKLTVGVIFSSFALIADALHVTSD
FT                   FILSTITYFSLKITNRPETIYYPYGYKKMENLIAFIIGIIIIISGFTIFLSTTGLNKLI
FT                   NFRSESGLHLHHHGDNDHHHDHYHHDHYHEDKKNILEIFSNNSLKKSIWIPLIPFIFFL
FT                   VKIIEYLIKFQIGKRYNNYLLLALSSSDKNCIFSHGGTTLSLLLANYVWTGFDKIISIC
FT                   IGFIMIKEGLHVIINNANNLLSRQNINLKREIKNTLKNININFKELNFFYQGNDLSLYI
FT                   KLDLSYENGLKSLIQKTEKMKYTIKKHHKEICEIYILI"
FT   gene            651489..651857
FT                   /locus_tag="BH0617"
FT   CDS_pept        651489..651857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17119"
FT                   /protein_id="AAX17119.1"
FT                   /translation="MLQSQFFVKRCKRCISKDEVLVNNVKNVENIFYDFLKIFDKKSLE
FT                   CIFNYYYENFDFDEGIYAFIDKFIPIINFLSLEVVDYEFNIDEKKLILEVFDSSACTFK
FT                   ADKLSEFARAIVSLGILN"
FT   gene            complement(651891..652346)
FT                   /locus_tag="BH0618"
FT   CDS_pept        complement(651891..652346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0618"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:BH0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17120"
FT                   /protein_id="AAX17120.1"
FT                   /translation="MEHSEQNAIEKAFQMAETARNNAYSPYSKFKVGACIKTKDNLFFQ
FT                   GSNVENASFGATRCAEQAAMMNMISSVGTQEIDFILIATTPASVPCAICRQVMSEFFEE
FT                   NTKILITDPNQFNATKTISQTYTLNDLLKVPFNKKELSRIFKANQET"
FT   gene            652480..653439
FT                   /locus_tag="BH0619"
FT   CDS_pept        652480..653439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0619"
FT                   /product="phosphoesterase, DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17121"
FT                   /protein_id="AAX17121.1"
FT                   /translation="MIDVIEFIKKYNNFIIIGHKDPDFDCIGSSLALASFLSRIGKRAI
FT                   MLNEGPFVRKEIIPFKDKFLSRWPDIASSDYAVIILDCSILNRIGDEFAFYVKDMPILV
FT                   IDHHASGDKLDVPGYIDPFAPSTTFLIEKLVREFGHEVTKEEAWYILVGFCTDTGFFRF
FT                   ISNSDPEPFEMIARLVSKGLSLKDVYNYVESVKSIASIDILGVMLNNLKSYFDGRVLLT
FT                   VLPFNDKKDANVSGVNELFYALLANVENNEILVILKETEDGSILVGLRSREYFDVGELA
FT                   KCFGGGGHKHASGFKVKNSSLNLLESQVIAYIKGAIKS"
FT   gene            complement(653429..655084)
FT                   /locus_tag="BH0620"
FT   CDS_pept        complement(653429..655084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0620"
FT                   /product="beta-hexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:BH0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17122"
FT                   /protein_id="AAX17122.1"
FT                   /translation="MKKIVCITIFFIHNNCFPYNFWTIEDKEKLIDKIVSQMNDKELLG
FT                   QMFMISYPGNQITKFALNFIQEKNLGGIKIFGWNAQNLHMLIESINKAQSMSQKNRFKI
FT                   PLFIATDQEGGWTQHIKLKTSKTIGNLGITATLSPNDSYLTGYHIANELRQLGINLNFA
FT                   PITDIYSNEENFTIGPRAYSNNSQIVSLFALAFYKGQKQAGIISTAKHFPGHGNTVLDS
FT                   HTKMPIINLNLKEVCSNELLPYQILIQENIPIIMSGHLAYPMLTNGKEIPASSSIKIIK
FT                   ELLRKNLKYDNLIITDDLLMNAVKYQNESIYDTIERIIRTETDILLISINENIQNNAYN
FT                   KLLSLMQKDNEIRENIIKSNKRILRIKLEYLKENKNEAEIYPNHKNAQSIPTKEAKKFF
FT                   EQNTLRGITKIKLLKKVSKHKKTLLISPYNTMVKEGKKIFQNSSSYYYDYYPLNSINPT
FT                   KLQAIKNLIEKHEQVIFNLSTPASLKYIDNLKEYKDKISIIVSLTPQHIKNLDWIQNIV
FT                   IVYGTTTLSFKSGFLTLTEDFNPKGQIPLINFKI"
FT   gene            655396..655469
FT                   /locus_tag="BHT0023"
FT   tRNA            655396..655469
FT                   /locus_tag="BHT0023"
FT                   /product="tRNA-Met"
FT   gene            655486..656031
FT                   /locus_tag="BH0621"
FT   CDS_pept        655486..656031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0621"
FT                   /product="4-methyl-5(B-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BH0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17123"
FT                   /protein_id="AAX17123.1"
FT                   /translation="MRAAIVLANGFEEIEAVVPMDILRRGGVDLKVIGLNDDRVVLSSR
FT                   GFTFWTDKKISDCSADHFDLIILPGGMPGATNLFESQNLDKILRNMNLQGKLIAAICAS
FT                   PAVVLSAKGLLGTNKFTCYPGFENGITDGEFVDDDVVVSNNFITSKGVGTAFKFAFTLL
FT                   KIIKGESVLEDVKRKALL"
FT   gene            complement(656115..657341)
FT                   /locus_tag="BH0622"
FT   CDS_pept        complement(656115..657341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0622"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17124"
FT                   /db_xref="GOA:B2S0W8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S0W8"
FT                   /protein_id="AAX17124.1"
FT                   /translation="MKILTLNTGSSSLKFTLYQHKNTQILASGTIEKIKTKKSIIRIKT
FT                   QNDLLEKIDKHIKSHKEALKQLIKILTNKKLNIINNLNEIQGIGHRIVHGGPNFKNSVI
FT                   LNENILSELEKISALAPLHNPTAIKVIEITLKIFPNAKQVLCFDTSWHQTMNENAFLYA
FT                   TPYSWYKDYNIRKYGFHGLSYAYITKRVATILNKHKKDLNLIILHLGNGSSINAVKKGI
FT                   SYDTSMGLTPLEGLAMGTRSGDIDPAIIPLMSKVLNKTPRKIEEILNKESGMLGISLKS
FT                   NDLRDIWEGVENNEYNSKLAVEIMAYRIKKYIGSYLAILEFNIDAIVFTAGIGVTDYGI
FT                   RELSLKGFEKIGIEIDLQKNNLAREKNIESDISSEKSKTKILVIPTNEELTILEDTYNL
FT                   ITEHSRDLK"
FT   gene            complement(657358..660726)
FT                   /locus_tag="BH0623"
FT   CDS_pept        complement(657358..660726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0623"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BH0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17125"
FT                   /protein_id="AAX17125.1"
FT                   /translation="MNIEKELTTILNDNQNLKKIQQLIKENLPFTLVGHGGFFEAFLIN
FT                   KIKEYSGNNKIILIVNNENIADALKDDLMQITDKIYELNYFSPLVYKGIGSKSTIFSER
FT                   IKFLINFYENNPGIYIVLLKSLLSKIPTKENLFKNIYKIQTSKLINIKNLESKLIRLGY
FT                   EKTMRVTLPGEFTIKGEIIDIHSFNKAEPIRISLHNDTIKEIKYFNPLTQLKKGNEISE
FT                   FDIIPKKEIIWNNESINRLKHYIKENEYKKLFEQIETKYHARAEEIFYPLIGDTYLSQE
FT                   INEDTLTINFEIPNLQEEIKKIYKEYEKLYSQAIESGEKTIAPKEIFINLNDLKLKTNI
FT                   FFVKTPANTQTEELVEFEIESGRRFFSNIALAKEEIQNWLNNGFKVIIAAESSSQKEKL
FT                   KYIFKDLPKIKIEVLKISSSLIINKEKIAIILESDIFNRRQKINKVFESSRTKPIDSFI
FT                   EVEKNSHVVHINHGIGIFKQIKRIKTSLLEKDYIEIEYADNEKLFIPIEQTHLIQRYIG
FT                   NENQNIKLDKISSKTWEKKKANAKKRIDAIADQLVSLYSARESTKGFQYPQDNEWQLLF
FT                   ESEFAYDETPDQLTAISEIKQDMMSLKVMDRLLCGDVGFGKTEVAMRAAFKAVMGTKQV
FT                   AILSPTTILAEQHFNTFKKRFKNFPIKIAMMSRFIKKSKEREIIKNLATGEIDIIIGTH
FT                   KILSKKIIYKNLGLIIIDEEQRFGVREKEKLKEIKVSVDCLTLSATPIPRSLHMSLIKL
FT                   RDISVLKTPPQNRIKIETYVEEFSELLIKHAIEHELSRDGQVFFVHHNIQELDLIKAML
FT                   EKVVPYARIATIHARLTGDQIENIMHDFINKSYQVLLSTTIIENGIDIENANTIIINNA
FT                   NRFGLAQLYQLRGRVGRSSQKAFAYFLYKESSSLNESAIERLRAISEFSELGAGFQIAM
FT                   KDMEIRGVGNLLGKEQHGEIESIGLDYYLTMLNKAIEKRMGKNSKEDEITIEINYNGFI
FT                   PDSYVNNEQDKISIYKKISAIQSEEENNKIRAEIHDRFGSIPEELNTLLILSELKLLAK
FT                   KLNITSLKEKNGLLEIEYLDIKSIPVYRIMQIIKDDPTTLKINPKDKKSVFLNLKNVKE
FT                   SEKINCIYRHLNLLL"
FT   gene            660824..661786
FT                   /locus_tag="BH0624"
FT   CDS_pept        660824..661786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17126"
FT                   /protein_id="AAX17126.1"
FT                   /translation="MEFRKLLFVISLMVVPFMLFPRDYKGLDFKIKFFNQSIYRVDSNV
FT                   SIEVSLSNLSDDLLTLEVGDINTFGFDFDVTDTTNIKVKRSLEYVKDRSKNVAIPVRTL
FT                   SLRPNERFSVMMSLNQFVQFDKDGVYFVRGKFFPDISDSQKCIESNVITLFLKPKMDDV
FT                   AEKFNFSNLSSNREVQSVLKRENLSPDKVIEYLFSALRLGEREKFFLYIDIESLILNDQ
FT                   NKSYLYKQELRSGSNSMLEEYKEYLWNNSNSDIAKVPNKFSIVETTYTDSTGKVVSDVY
FT                   FEDGHFYVAKRYTFFFKKYDYYWIIYDYTVQNTGIKEKY"
FT   gene            661722..663803
FT                   /locus_tag="BH0625"
FT   CDS_pept        661722..663803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0625"
FT                   /product="autolysin"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BH0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17127"
FT                   /protein_id="AAX17127.1"
FT                   /translation="MIITGSFMIILFKILELRRNTRLFIFRIKGLSIVLWIISSFSLYA
FT                   DFKHEVVKGDTLYSISLKYKISIKELKNANNLKSESIRIGRILVIPSSSKVNKVLTKKG
FT                   DEKSKLSKLEPDAKVHVVKVGDTIEDISKRYGIREKELVAWNNLTSKILKVGSKLHLGE
FT                   PDFLKPYIVKKGDSLSKLSVDFDISIADIIRFNSLESKKLIIGQKLYLKRVSGDIHFHY
FT                   VKRGETLGKIAYIYGVTAKHLVHLNGDKAINLKADSILDVSKIIEENPLSSKSLQLKAE
FT                   KGSSETFISHRVSVGETLYSIARKYGVLLEALKSWNNLSGNNIFHNQELKIYDKRKGPV
FT                   VANKDSRQFVDNSSDSKTKVKAIANVISAKSKKLDLNFSNVLNNRDAFDISALVILDPK
FT                   IPMFEANGVFYYWYKPKKVSQPSEFYSEDWYSPLNAYKKASQLFKSFESLVRSRPIKNS
FT                   NLKNKLIIIDPGHGGLDPGAIVKARDGLNNEIFVVEDEYVYDIALRLYVYLKEYGANVE
FT                   LTILSPDHLIRDSVSANNTFVNVKNEVYNDYDLNKTDTVDSWINGTQEGLKKRLAVVKK
FT                   FVNKYKNVKAKDILYISLHSDNSVGAPRCMGFYYQSEDGKGFDTHSKSVIEKMTEGFKR
FT                   APYIKGQNLYVLKHNVVKTKLLVEVRNLAFDEEAWAIRASKLRDQDSRILADAILKIL"
FT   gene            663881..663952
FT                   /locus_tag="BHT0024"
FT   tRNA            663881..663952
FT                   /locus_tag="BHT0024"
FT                   /product="tRNA-Asn"
FT   gene            complement(664496..665764)
FT                   /locus_tag="BH0627"
FT   CDS_pept        complement(664496..665764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0627"
FT                   /product="probable M18-family aminopeptidase 2"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17128"
FT                   /protein_id="AAX17128.1"
FT                   /translation="MHDHTLDISHFQNLLDKSLTAYHLVNYIEQKLVYYLNAKELKLDD
FT                   KWTLETGHYYVKKEGTSLIAFNINTNKIHEPFLIAAAHSDSPGLKLKIESSKHKCNVFS
FT                   HHIEVYGGPIISTWTDRDLSLAGIVYFNKDGRINSELITIENIGIIPNVAIHLNRKANE
FT                   GFAYDTHENIMIITSFKKSIKEKIIEKLQISEKDFLSCDLIFTASEPAKIIGSEGEFLA
FT                   SKNLDNKSGCHAIMNAFIHTNNNKNKAAVFFDNEEIGSGTSRGADSKLLTEILERIDHV
FT                   LNLGKEEHLIKLNKSFNISMDGAHGTHPGYICKHDPNYQISLGKGVTIKSNANFKYATT
FT                   ASGCAKLKALAMKNNIKIQEIIMKANTNAGTTIGPIANAQTGIETIDIGTPMWGMHSLR
FT                   ETIAISDHIEAIKLLRAFFENWN"
FT   gene            665863..666588
FT                   /locus_tag="BH0628"
FT   CDS_pept        665863..666588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17129"
FT                   /protein_id="AAX17129.1"
FT                   /translation="MDKFYKFMLVPLIFIACTTVSEINLQDDASGTVSLILNVNKEFER
FT                   IRKELVATLVGAEIAKMPLFPIDKIEQYFSDEGKKLGLKLLSIKSNGDSLKLVAQFDNL
FT                   VKVLKDYLEEERMPIFKVENKNGKNILDMDINLKNVTKVINENKENVSDALAALLPSEE
FT                   IPMSEKEYKDALVYFLSDFTSHASELIDNSDITVKIKTSRTIQEQFGFKQLNLNSLELK
FT                   LGMIRALSLERPIKLRLAY"
FT   gene            complement(666622..668469)
FT                   /locus_tag="BH0629"
FT   CDS_pept        complement(666622..668469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0629"
FT                   /product="PTS system, fructose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BH0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17130"
FT                   /protein_id="AAX17130.1"
FT                   /translation="MQDLFSKKLILLNYEAKSKDDVIEKMADMLNENGYLSNKENFITD
FT                   IKKREEISGTGLEEYIAMPHAKGNFVAKHGIAILRVTGEGFDFDASDSKPSRLFFMIAV
FT                   PANTTGDTHIKTISYLNNIFNNEILRQEIMSTNDISRFLEILLNSNTNVIMNESSSKNF
FT                   ILAVTACPTGIAHTYMAAESLKRAAAELNVELKVETNGSSGIDNPIEEEEIKKAKGIII
FT                   AAGKTVNKERFNGKPLIEVGVKDGIHKAKELIQNILDNKAKIYKSKTVKGESKTNKKTG
FT                   GAYKHLMNGVSFMLPFVVSGGIIIAISFMFGIKAFDPNDPSYNQIADILMQIGGGNAFF
FT                   LMIPILAGYISFSIAERPGLAPGMITGLMMSKGNAGFLGGILAGFIAGYVTLAIKSISK
FT                   KIIPQNISGINPVLTYPFFSVLISGVLTYFLLTPIAYINISITNMLNSLSGTNMALLGA
FT                   LLGGMMAIDMGGPVNKAAYAFGIAMITAGNYIPHASVMAGGMIPPLGVALATSIFNKKF
FT                   SQEEHEAGKVCYVLGACFITEGVIPLAAADPLKIIPACIIGSSIGGFLSALFEVKLMAP
FT                   HGGIFILPIVTNPLMWVISILVGTLITGLLIGFIKRDKK"
FT   gene            668595..669497
FT                   /locus_tag="BH0630"
FT   CDS_pept        668595..669497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0630"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:BH0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17131"
FT                   /protein_id="AAX17131.1"
FT                   /translation="MVYTLTLNPAIDYKIVINGFQKGCLNRVVKSNFFAGGKGINVSNV
FT                   LKNFETESVAFGFLGGFTGDYIKTHLDLMGIKHDFISIADNTRINIKMMSDGKETEING
FT                   NSPAILESDFKSLILKLKKLDQDVLIMSGSIPSSLGCRAYNEIAKNLSSNVRLIIDTSG
FT                   PALQEIIELKPFLIKPNVNELKELLGMNLISNKDLINAGHELIERGVQNIIVSMGSEGA
FT                   MFINNKDAYVASVPQIDSLSTIGAGDSVVAGFVYAYQNGNSLCDSFKFGVAAGTSTALR
FT                   GQLCSLDDVKDILGKIKLE"
FT   gene            complement(669719..669792)
FT                   /locus_tag="BHT0025"
FT   tRNA            complement(669719..669792)
FT                   /locus_tag="BHT0025"
FT                   /product="tRNA-Asp"
FT   gene            complement(669840..671666)
FT                   /locus_tag="BH0632"
FT   CDS_pept        complement(669840..671666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0632"
FT                   /product="exodeoxyribonuclease V alpha chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BH0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17132"
FT                   /protein_id="AAX17132.1"
FT                   /translation="MRNYLVLREFLKDHKRNYLNPELKIYEIIETLNINIENYYKSHLL
FT                   IKTIKNETCKELTIFLIFLFNYLSKGHLRANIDLLIKDIQNTIECAFLELEEEDQFYQK
FT                   SINILEELAKFTKSIKIHEMILSLKENNIMKDFNKDEKITTPLILENNIYIYTQKNFRE
FT                   EEELIKKIEQRLKDNKSEISDQRIQNIMANLNTKDLSKEQINSIKKSLKSNFFILSGGP
FT                   GTGKTTTINYILKAIDIHLNVKQKVALVAPTGKASQKLKSSLKESFQNLETRYSTVQKL
FT                   LKMSFISKGNKYDEANPLEFEIIIIDEASMIDASTFLKLLKAVKTSTKLIITGDKNQLP
FT                   SIAGGNVYASLTAIKEISNENVEILKKNFRSNDEINLLAEAIYKEDTDLIDTQLNANKN
FT                   IILKDINKVNIENELLNHIKNLYKNISNFELSSLNDKEIESIINPLLNNVILCSRNFGK
FT                   FGTKRINEIIKLYLKKIYGNLIGQIILITQNDYKNDLFNGERGILFKENSKIYALFKRE
FT                   DEKYKKINFNLINKFELSFATTIHKSQGSEYQHVQIIIEDHPFLTKELLYTAITRAKAS
FT                   IEIISSKDIIKNVSLKTIKRDSKILEHIDALK"
FT   gene            complement(671676..675149)
FT                   /locus_tag="BH0633"
FT   CDS_pept        complement(671676..675149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0633"
FT                   /product="exodeoxyribonuclease V beta chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BH0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17133"
FT                   /protein_id="AAX17133.1"
FT                   /translation="MLNLLRCKVNHMKEIIDKIKYNEKILIEASAGTGKTYTLENTITN
FT                   LLINKMYSPSEILVLTFTKKATEEMHIRILKSIENAYQNSKTDKSLKTIYEQSNKIFIS
FT                   TINKFALYALNNFQIETENFSKYSVKENFTSEIDEIVYEFLRKSDSLKKEFEIKDDEFE
FT                   IFKSKFKNTKDMTQYIRQGYKRDKTQELGDWIETQTIFNQMLTNKDKLIDKYNLIVEAL
FT                   NEMTMEEKRTFLNKHNQGIKISEIKYSHEKDIVKITDILTNNKFFCKIIESNLKKNVTL
FT                   LPKELKIQTALRELSHETNTDKEDKNTLRRFINLKVEYKILKYIERELATTINATNTID
FT                   QKQIMLNLKKHLESRDNRLLNSIKNRYKIILIDEAQDLDLIQIEIFELLSSCGIKLVFI
FT                   ADPKQIIYTFRNADISFYNQNIKDKIKDDARITLLTNYRSNKKLIEPLNIMFDNIYNKA
FT                   RTDEIEQIKFTKSKTDPKNDENKIFVNGQEIEAINIIETEEDKNVLQKTALTIKYLLTN
FT                   GKIYDNNKLRQIKESDIKVLCRTSKEVDFIDRELKNQDVKTNKLAESFFKTKEFNLIFY
FT                   LIKCLDRKQNFQTLNYILTSKIINLPWELYLSLLEENGIKHIEEAIIDIIYLLENQEIT
FT                   LIEAIDEIISKKDLWLNLAKNFRNTTFTEFAQSKKSYREILINEGKFEELKNYETSLDF
FT                   ISKIYYEDKNIESLISTLEDLILNKDIEQDEDKITTGDNQAIEILTIHKSKGLSINIVF
FT                   LIGDIQNNDNLLKKSDTFYKFYSKNKIEYDFLKLKENQQFAKNKILNEEQNIFYVGTTR
FT                   ARFALFIINQGATINKMLELAEIKTIEKINLNFNVYNLIKTNQFNKLDINDNKEIKLIP
FT                   PKPINKYLFRKEHTHSYTSLASIYKSNHHENPETRNDETYDNDATCSGETLPRGKDIGN
FT                   ILHAIMQDINFSDAKDSFNNFQKINIALIQKKIEHFNSKLNTPKLQEMLIKMIYNILNT
FT                   KIRFIGARLCDIQELQKEMEFLIKINTKIYEQKSLFKDHNKLDLVLNDGYIKGIIDLIF
FT                   KINNKIYILDYKTNYLGENLKDYNLTNLKKKMKQEQYDLQYKIYALGIKKILFKNIEEY
FT                   NKHFGGVIYLFTRAFQKNIKEQSKTQNGIYSTIPNFKELDLEQIYLQLKY"
FT   gene            complement(675121..678342)
FT                   /locus_tag="BH0634"
FT   CDS_pept        complement(675121..678342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0634"
FT                   /product="exodeoxyribonuclease V gamma chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BH0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17134"
FT                   /protein_id="AAX17134.1"
FT                   /translation="MYKIYKTNKVSRIYNKIKELTQNDDIFKKETIILLKRNILGEEIK
FT                   KYLATLNEVSYNLNIKQNITKTIYNLSTENQNIKNFLENNTLLLYSETEKFILYHILKD
FT                   NKIKNIKQFKSTKNRYIFAAKIITLFHKYYSKFSNLIDNWRQNELLFEDKNKIHYESMQ
FT                   KEMFEKLFENQINILDLHKKIEQEITDNRQSIETKKIIIIGETREIDRKILHCLQKIFD
FT                   ITVYELILEDITQIKSILIDELVPLKIKKCNSKIQIEQEIDIQLFEEKNFLASFKNNII
FT                   KGTPLSNLDNSFKIIEAKTKKREVEILVNNILHSTQNNNLKINDIVITCLPKDMNMYLP
FT                   YIEEFLNKYELEFTILDSKDVSKSKSVIALKQLMKLFISTRGTISNFNRKEIIEFLSNT
FT                   KVMNKFNISISELEYLIKFSDAVNINFGMNDIHKESLSYDKNFLNSWEDGFNRFLTSAI
FT                   FNCKYECKNCQESISFQDPDSIIRLISIIKSLYEDIMYFKEQEYTIYEWAEIMDIFIDK
FT                   YIKLENNNKIDEYINTRIQYLKNFSKDFNENLHKDYLAKIKDRKVDFALFKVMLEESIE
FT                   QKAYQVSNQNTGILVASSDKIEYLQKSEIHFLGSHQLNASIHFDNMDLLNEYYDYINLE
FT                   QDNISNLIKIIFAASNKFYLYYSLSESLNPDINKPKVINKIVNYIKDMGLELKIEIHPN
FT                   ENYDFEYFKYEKANYLINYDIEAFNIAKSLQKGKHPHFKQKRLKLKKQITLEIEDINKA
FT                   ITNPYKYFYEDILNVHIKDISQISEIKEKQEEQIIDIENFNYKLMNNFIPIHECIKDEP
FT                   NEHIADRIDNIIENQIQRGIIPINIKKETIKEEFIVKLNEIKNNITASFQEFFKMQETD
FT                   IILNKSIPINFEGETLEFKLNGKLKNIYKIDNRYYYVNLEKKDYGQDKIIKKINLYIIG
FT                   LMLKSAIENIDSIQEIRITYETSKLSLGNQYTNEEINSIDLENLLKQIAYISSYPTPIY
FT                   KDLIQKSLIKIKDINEFREVLKKQIKYPQKSISINKSMEFILQQRDITWCPYYNRFKDT
FT                   HALNIDDNLEKLLQDFYAKFIKVQS"
FT   gene            complement(678347..679792)
FT                   /locus_tag="BH0635"
FT   CDS_pept        complement(678347..679792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0635"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:BH0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17135"
FT                   /protein_id="AAX17135.1"
FT                   /translation="MKNLSLFTDFYELSMMNAYFTKNINPKAKFEMFFRKTPFKNGYII
FT                   LAGIHTLINILKELHFRKEEIEYLESLEYFDKKFLEYLKTLKLNIKISSIEEGRIVFPH
FT                   EPILIIEGNLIELLLIEGLVLNTINFESLIATKTARIKEAGATNLAEFGLRRAQGINGA
FT                   LSASKAAYIGGADFTSNVLAGYKYNIPVTGTMAHSWVMSFKSEEEAFWEYAKIYPNNVS
FT                   LLIDTYDTLNSGLKNAIKVFKTLKRKGHKNFSVRIDSGDLEYLSKEVRKILNENGLFEV
FT                   KIIISNELDEDIIMYLNSIHAPIDCWGVGTNLVTAKGEPNLSGVYKMISIQQNGKFIPK
FT                   MKISNNVDKATLPSQKGVVRIYSNAQMIFDLIFLKEEEEEIKEMLNLKKKFTIFHPMQD
FT                   NIFKEIKTYESFEFLIHTVFENSKICQNSKSSLAHIRKRVQSDLKKIDHTYKRLINPHI
FT                   YKVSITEKLKNLKNKLTKENKIR"
FT   gene            679965..681398
FT                   /locus_tag="BH0636"
FT   CDS_pept        679965..681398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0636"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:BH0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17136"
FT                   /protein_id="AAX17136.1"
FT                   /translation="MREKNVSNFDVVIFGVTGNLSRRKLIPSLFNLYKDGHISNFRIIG
FT                   FSRRSFTDEELNIYVKDSLWQEESTVLVDDFLKFFVYLSGDFREKDAYVKLSSLLDNRE
FT                   RIYYLSTSPEFYEAIIENLKPYSFNNTSYLSKIILEKPFGSSLDTARCLNSLLYSVFKE
FT                   EQIYRIDHYLGKETVQNIFTFRFGNSIFENIWNNRYVDFVQITVAEEAGIDGRAEYYDS
FT                   VGALRDMVQNHILQLLSLIAMEPPIGFNADFIHDEKVKVLKSLKKLNRKTMQNYIVKGQ
FT                   YVCSQVQGILKKGYREEAEFLSTSNTETYLAMKLFIDNWRWSGVPFYIRTGKALVRKFS
FT                   EIYIQFKKPGFTIFNTELNNLSNALIFRIQPRDGIEIKFNTKRPGYNYEIQEANMEFSY
FT                   HASFNKFFGESYERLLFDAFLGDRTLYARNDEIDSSWEFVSDILDKWSDIKNWDYFYGS
FT                   EGPVEANMVLEKDHFWRKM"
FT   gene            682550..683887
FT                   /locus_tag="BH0638"
FT   CDS_pept        682550..683887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0638"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17137"
FT                   /protein_id="AAX17137.1"
FT                   /translation="MNKGSHIRPNFLGLVPFLVFIIVYVGTGVALEMQGVEMAFYQMPP
FT                   IIAMLLAVVTAFLLFKGSFIEKLNEFIEGCSQTDIIFISFIFLISGAFSAVCKEIGSIE
FT                   TVANIGLKYIPANLLVAGIFLICLFLSTATGSFLGTVVAVTPIGFEIAGKSGIPLPMVA
FT                   GAVLGGGAFGDSMSLISDTTIIASRTQGVKIIDVFRNGVFFTFPASILSTVAFAILGSY
FT                   VGGVGVNVELGEISYLKVIPYLFVIIFAFLGVDVFLVLFLGILIAGGIGILNGDLTLLL
FT                   MAQKINVGLLDLSEMLILVIFTGGISYMTISHGGFEWILTKLKYLAKCRRSAEFTITFL
FT                   IVMVTGFLSNSGLAILVNETVTKGISEANSVCPKRCAALLSISSCALIGALPYGMHMIS
FT                   VMNIAKGAISPLDIMPFLFYQVFLGIIIFSIAFLGLKNQFLNSTKP"
FT   gene            complement(683928..684977)
FT                   /locus_tag="BH0639"
FT   CDS_pept        complement(683928..684977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0639"
FT                   /product="spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17138"
FT                   /protein_id="AAX17138.1"
FT                   /translation="MKKILVSITILIVISCSFQKKQNTLSILNWAEYIDEELIAQFERE
FT                   NKVKINYECVNNNEEMMAKFNNTKGYYDIIVPSEYLVEDLVNANKIEALDHSKLPNVKN
FT                   NILSELKSLEYDPGNIYSVPLFWGVMGILYNKTKVDIEDMNEFDILFNEKYKKEIAMLD
FT                   SPKENIGVALKKLGYSLNEHNISKIKKAEELLKKQSPLVVGYFSDIAAKSLMLNGEASI
FT                   QLTWSGEALDAMHKDPNLDFYVPKSTNLWIDVMAIPADAPNKELAHKFINFLYENEASY
FT                   ANYKETNYNSPNKNVFKQLKEEAKDNPEINLYLEERFVPKNFSTHEVFKMIPKKIKEEQ
FT                   MRIYVELSS"
FT   gene            complement(684994..685785)
FT                   /locus_tag="BH0640"
FT   CDS_pept        complement(684994..685785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0640"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17139"
FT                   /protein_id="AAX17139.1"
FT                   /translation="MLKILKNTFLFLTFGFVYAPILILVVYSFNAGDNGFFYQGFSLKW
FT                   YKEVFVSHQIKTVIYNTLLVAILSSLISIAIGILGAYSIYKTKNKKIKTILLSINKIPI
FT                   INPDIVTGISLMTFYSLIKIQLGFSTMLMSHIIFSTPYIIIIILPKLYSLPENIIDAAR
FT                   DLGASESQIFKNIIYPEIIGSVVTGGLIAFTLSVDDFLISFFTTGQGFNNLSILINSLT
FT                   KKGIKPIINAISSILFFVILSLLFIINKCVGIKKLTVDTEI"
FT   gene            complement(685796..686617)
FT                   /locus_tag="BH0641"
FT   CDS_pept        complement(685796..686617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0641"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17140"
FT                   /protein_id="AAX17140.1"
FT                   /translation="MQGTIKMNRIILILYTLFLSIFIIFPLVIIITLGFFNEQNEFTFA
FT                   NFIRLLEPSYLKIFSRSINFALITTIFCILIGYPTAWFISMSKKNVQNMLIIMIILPMW
FT                   INTLLRTYAWIRILGKNGIINNLLEAMGFKSIELIYNEKAVIIGMIYNFLPFMVLPIYI
FT                   GLLKIKYEYIEAARDLGARMWQILLYIKLPLTLSYLATGIIMVFIPSITVFIISDLLGG
FT                   AKQILIGNLIEKQFLFVEDWHTGAAISFIVMIVILIFNLTILKLMHKNNIE"
FT   gene            complement(686602..687648)
FT                   /locus_tag="BH0642"
FT   CDS_pept        complement(686602..687648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0642"
FT                   /product="spermidine/putrescine transport ATP-binding
FT                   protein PotA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17141"
FT                   /protein_id="AAX17141.1"
FT                   /translation="MHNYILEIKDLSHYYTDSSNKVLDTINLKIKKNEFITLLGPSGCG
FT                   KTTLIKIIGGFLNQTEGKIHFLSKEISKITPNKREINTVFQNYALFPHMNVFDNISFGL
FT                   RMKKTNNNLIKEKVKAVLSLIDMQKYAYRNINELSGGQKQRVAIARAIIMEPKLLLLDE
FT                   PLSALDLKMRQEMQRELKKIQRKLGITFIYVTHDQEEALTMSDRIVVMNEGVILQIGTP
FT                   EEIYNEPKTKFVASFIGESNIFEGTYEKEFVVNMFGKDFKCLDKGFKNKESVDLVIRPE
FT                   DVRILPKGQGHLSGIITSAIFQGVHYEMTLEIQKSNWLVQSTKLTNVGEEVDISLGPDD
FT                   IHVMCKEQ"
FT   gene            complement(687732..688583)
FT                   /locus_tag="BH0643"
FT   CDS_pept        complement(687732..688583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0643"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17142"
FT                   /protein_id="AAX17142.1"
FT                   /translation="MSSKINWFPGHMKRALDLIQANLKRTNIVLEILDARAPMSSKNPL
FT                   TEKIIKNSNKDKIILLNKSDLVKTREILKWREYFETLGNNVLITNIYKKGMKKQIIDNI
FT                   KKIANVKKIKTYTEKIKVLVIGVPNVGKSSIINLLVGKKSTSVANKPGHTRNIQILKVN
FT                   EEINIFDMPGILWHNLEDQEIAKKLAILDMIKNEIIDNTELALYLLKEMHINNKNKLLN
FT                   KYSIKSTDSLQILEEFARTRGFINKKHAMDIERASKILIKEYREGKFGKIILDVKCHHN
FT                   NK"
FT   gene            688788..689423
FT                   /locus_tag="BH0644"
FT   CDS_pept        688788..689423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0644"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17143"
FT                   /protein_id="AAX17143.1"
FT                   /translation="MHSSFIMSKMALAAKMGGAVGIRANSVLDIRQIKSEVDLPIIGII
FT                   KRVYNNSPVFITPTIKEVDELCSEGVDVIALDATLRERPDGLLLSEFFNKIKKKYPNQL
FT                   FMADIASLEEAINADKLGFDFIGTTLHGYTKDTEGCNIADDDFAFLKNLLKYDFKSKLI
FT                   VEGKIDTPLKAKRSFELGISLVVVGGAITRPMEITKNFVDKINEVKEI"
FT   gene            689475..691019
FT                   /locus_tag="BH0645"
FT   CDS_pept        689475..691019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0645"
FT                   /product="PTS system, glucose-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BH0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17144"
FT                   /protein_id="AAX17144.1"
FT                   /translation="MGKFFENAQKFGRSFMLPIAILPAAGLFLGVGGALSNPATINAYS
FT                   FLNVFFIQSVFNVMRTAGAIIFVNLPPIFAIGVAVGLAKSDKGTAGLSAFIGYLVLNST
FT                   IGILVDMFGKAEDLSSGAVGVILGIKTLETGVFGGIIVGILTYYLHNKFNKIEFPRVLG
FT                   FFSGSRFIPIVVSCSNILLAVCMFIFWPFMQSGISRVGVLVDATGYVGTLIYGIFLRML
FT                   GPFGLHHIFYLPFWTTGLGGSEIINGKLVEGTQNIFFAELASQSTDRFFIGTSRFMSGR
FT                   FITMMFGLPGAALALYRLAKPSQKAKVFGLLFSSALTSFLTGITEPLEFSFLFVAPVLY
FT                   VIHAVFDGFAFMFAHILEITIGQTFSGGFIDFILFGILQGNARTNWILVPMVGVFWFFL
FT                   YYFSFTFLISKFDYKTPGREDSINSNDAFLSVANGKRDNVASQVIMGLGGSDNIIELDC
FT                   CATRLRVTVKDSLKVLKDTLENTGAKGIIIKSSGVQVIYGPGVSVLKNEIEEILDN"
FT   gene            complement(691061..692092)
FT                   /locus_tag="BH0646"
FT   CDS_pept        complement(691061..692092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0646"
FT                   /product="carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17145"
FT                   /protein_id="AAX17145.1"
FT                   /translation="MKNLILMMKIIKGKQYMHIKNSIFIFIFLLLLIVVGPKMKVRNEF
FT                   AKTKIPNKLEEIDQYLLIEESKFNLEANTKKEIIWNEAQKRTEYAVVYIHGFGASKNEI
FT                   YPIPNNIAKALNANIFFTRLKGHGINNKDAFKGVNTQDWLRDIDEAIQIGQSIGEKLII
FT                   IGTSNGGACTIWALKNYPNKIYSAVLISPNIYPKDKRTSLIYYPWGRQIAYLITGGYNS
FT                   LEIRQNKRTEYEEVTTFYSPIRQVDSIISMMGLVKLINDNGFDNIKIPLTIAYSPNDPT
FT                   VDSNEINKFISEYGGHKKTIPIMLIESLHSHVSVGNHSYRSAQNTSYLTKYAVDFIKNI
FT                   KSK"
FT   gene            complement(692058..692576)
FT                   /locus_tag="BH0647"
FT   CDS_pept        complement(692058..692576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0647"
FT                   /product="oxidative stress response regulator BosR"
FT                   /db_xref="EnsemblGenomes-Gn:BH0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17146"
FT                   /protein_id="AAX17146.1"
FT                   /translation="MNNNTIEVHSTLEKVGITNDPILLKSLTTELGMKASHSRNRIILH
FT                   IASNPKEYFTAKEIYNKLIKEIPSLSKATVYNTLNILKERNILKDIKTTDQKETRFYLS
FT                   LTSTIAHFKCNKCNQVYPIQLDDIKDILKDKLGEEWKTKSIEIIYSGSCNNCYQQSKDE
FT                   KSNIDDENN"
FT   gene            complement(692668..694359)
FT                   /locus_tag="BH0648"
FT   CDS_pept        complement(692668..694359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0648"
FT                   /product="serine/threonine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BH0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17147"
FT                   /protein_id="AAX17147.1"
FT                   /translation="MMFRKFRNSRTYIVIISITAFAESKLYSILSNTKYLIENKNLSYK
FT                   IHWTFPTYFFEILKLNSELNEWFLKRLKNNEDIYIPSTYSGSPHEYMLHDEIHVDLYWA
FT                   LKNPFKSGYKDLFKDNPHTFYVYNMEKSRKRVLELYRNLNFNYIEGIRIAKNNKKYLVF
FT                   YKNNCQLLSEIQEPETKKQNIDTLIYFHEIKDIYNNQELKNFLLSLKELDANFYSIKIQ
FT                   NLEGKKITTELLEIPEFNSLKEQALILQFQNKRLKEYQVNETSLKEFLVNKNFEYHLTN
FT                   LEPITSKNLEYNMEGNFTLSHEKYHVKFEEGKLNKIKYKERKVEFLDFCRTYIKVLSKK
FT                   EIVIEPTIESSFSFSNEKIVGIRQYLNFNEKEKSIIDFFLDESLAGFFISIKIAWPSAI
FT                   TCNNKSPKISNTNYLLEYSSLEIPIFEVEKGTNLKITARYNDSDTYEKIIETKKDIKGY
FT                   INGTEFLISKGNDQNSNFFISFLNIEKHIIYTINYKISKRGFKRWFILNIGGSYNTVKA
FT                   EDLQNYSLSLNLLLIPINNNFDNKIKINSKIKTLLFYPNIKKNENK"
FT   gene            694552..696216
FT                   /locus_tag="BH0649"
FT   CDS_pept        694552..696216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0649"
FT                   /product="60 kDa chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:BH0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17148"
FT                   /protein_id="AAX17148.1"
FT                   /translation="MLYLKGVKFMAKDIYFNEDARKSLLSGIEKLSNAVKVTLGPKGRN
FT                   VLIDKKFGSPTVTKDGVSVAREIELENAFENMGAQLLKEVAIKTNDLAGDGTTTATVLA
FT                   YAIAREGLKNVSSGINPIGIKKGIDRAVTLAAEKIRKSAKKITTKEEIAQVASISANND
FT                   TSIGEKIAEAMDRVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVS
FT                   FDDAYILICEKKISTIKELLPVLEKVLNTNKPLLIIAEDIEGEALAALVLNSVRGALKV
FT                   CAIKAPGFGDRRKAMLEDIAILTGGVLVSEELGLTLENVELEQLGQAKSIRVDKDNTTI
FT                   INTGNKEPIKERAELIKKQIEETSSEYDREKLQERLAKLVGGVAVINVGAVTEVELKEK
FT                   KHRVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTVDTSKLSYEEKQGFEIVKRSLEE
FT                   PMRQIIANAGFESSIYIHQIKTDKKGLGFDAASFKWVNMIESGIIDPAKVTRSALQNAA
FT                   SIVGLLLTTECAITEVKEEKSNAGGGGYPMDPGMGMM"
FT   gene            696277..696573
FT                   /locus_tag="BH0650"
FT   CDS_pept        696277..696573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17149"
FT                   /protein_id="AAX17149.1"
FT                   /translation="MSENEFVFCIGYDGSKAIIDKELLSQHKGKSAEELFELGFYRSAF
FT                   SKALYRKDNTLIEYLIDRYNKISKSSYSKKEELELLFGVVYPDDIASTKATYV"
FT   gene            696589..696897
FT                   /locus_tag="BH0651"
FT   CDS_pept        696589..696897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0651"
FT                   /product="protein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17150"
FT                   /protein_id="AAX17150.1"
FT                   /translation="MFLLQDFSHSSSFFRSLLVFIPVIAIFWFLVISPQRKEEKKKKDM
FT                   IKNLKKGDKVLTIGGIFGVIKKVSDSEVVLELSPTSEAKFIKSSVEKVIFDEIKNKN"
FT   gene            696980..698752
FT                   /locus_tag="BH0652"
FT   CDS_pept        696980..698752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0652"
FT                   /product="protein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:BH0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17151"
FT                   /protein_id="AAX17151.1"
FT                   /translation="MLFMNKVSKFILILFVTSFAYLLIFPTLKWYFFTNDGDRKISSYS
FT                   KEALRDYSKSKALSSLVKLRELYQRDPNAQIPDDLKYLIPVAKNNYRIYGKEPPKFFNN
FT                   VKVLRDGFLTDSDIEELSLEIYRYYEDIKRNKSKIIQLGLDLSGGMSITISLDYSGLEQ
FT                   KLGRTLSALEREEALGRTIQILKERVDTFGLTEPKITREAGGNKIFLDIPGEKDEKRVD
FT                   SLLSGRGNLTFYVVDNDATSVLNAKILEAGPLYSISDIKSSMGLGDNKEIFPWYVKDSY
FT                   GIDDESSVHYYVVDSSVESSFDGSHIKDAGVLNDHKTGRDIVTFNLDNEGSEKFFVFTQ
FT                   KNIGKALAVVMEGKIKSVANISHAIAGGNVSIQGDSFDKREANELALVFKTAAFPVEIK
FT                   IDDLRVIGPTMGEKTIALGIKASLLALVLVFLFMLAYYKMSGFVAGFSLVIYNLFLILA
FT                   ILSAFNFTLTLTSIAGLVLTMGMAVDINIVIYERIKEEIRNGRKFGRAFEDGFKKAFWA
FT                   IMDSNVTTFIAVLFLTLLGTGTIQGFAWSLSIGIVASLFSSLIFSRFILEVIISLSKSK
FT                   CVSISWSSNYAKSV"
FT   gene            698736..699635
FT                   /locus_tag="BH0653"
FT   CDS_pept        698736..699635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0653"
FT                   /product="protein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:BH0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17152"
FT                   /protein_id="AAX17152.1"
FT                   /translation="MQKVFNFLKYGNKAIIVSICMIFSGFIYTFMYHDGYNWGIDFSSG
FT                   VNINFVIDKAGIKDYDMQKVLFPVYKTFDVNEIISSDASKSHFSIIVKSDITDYTLKKE
FT                   IHTTLIDKLNAEFGVNVEILDSYFIDSNFSSILRTKSMLLVCLTFALILVYVALRFRLS
FT                   YAVASIFATIHDILFVVAFLGVFRIEINSSIIVSILTIIGYSLNDTIIIFDRIRENSRN
FT                   MTDTSFLNVLNLSIRQTLSRTILTSITTFVAVLSIYVFTDGAIKDFSLIFMVGVVVGTY
FT                   SSIFIASPILLSCYKKIK"
FT   gene            699659..700813
FT                   /locus_tag="BH0654"
FT   CDS_pept        699659..700813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17153"
FT                   /protein_id="AAX17153.1"
FT                   /translation="MKFFDFGSLGFYRFFDFQKHLNFSIFRYSLINYYSYKEQSNLIND
FT                   ANLLKCKIVFLDKTHKDIANIASASSSKLNDNLNVNKKVFCDVLNTIKNLIKKYHPESE
FT                   FLDLECDVLLNNEDIFNRFLDKLRYLNFRVDLKKKIEEFDSKNKTPYSCIKIATFFIKE
FT                   EFLERLANSIDFFSNEANNNSLDLINKEIDEYCGKVEQVKVSENIKDTHKKFVIEYAKE
FT                   RISKIMKEHSLDISKLLIKISLLDITIQCFESYYLNLLETLNILLSISNIIDIGLDELP
FT                   DAIFNEWNEFIYLRRKEFQKLVLISDYVFQKRIISTINSGGWKFTFFSLSPRQGDIIQF
FT                   AVDINKNFNNIEDGIKEYELKINRLNDLKLDWEKSLKNFEHLFV"
FT   gene            complement(700819..701658)
FT                   /locus_tag="BH0655"
FT   CDS_pept        complement(700819..701658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17154"
FT                   /protein_id="AAX17154.1"
FT                   /translation="MSKDYYNILGIHKNATIEEIKKAYKKLAIKYHPDKNKGNKFAEEK
FT                   FKEINEAYEILSSPQKKANYDNFGSADFNNNFNTESFSKGFKNTGFHHFENFDLFSNIF
FT                   GESTRGILKDKEITIKISLYDAYMGGRKSILINNEKIDINIPKGTIETTKLKFNGKGNI
FT                   HPISGKRSNLIIKFEISSYKNFNLKERNLETKITVYPWEIALGSEKIFETIEGKKIKIK
FT                   IPKDTKNGEILKLKGLGMPALGNTIKGDLKATLIIDVPKIINDEVKKIYERLKEIYN"
FT   gene            701779..702918
FT                   /locus_tag="BH0656"
FT   CDS_pept        701779..702918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0656"
FT                   /product="coproporphyrinogen oxidase, anaerobic"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17155"
FT                   /protein_id="AAX17155.1"
FT                   /translation="MNFLCLTDLSIYIDLTRCFSYVFFNKILHELSCCLEVLGFPKIKT
FT                   LYIKYETLGFGNDANLESFLTSLSKNFDFVTLDEFTFELHPGEITPSLLTILNDFSVSR
FT                   ISLDVKSFSSKFLRILGASWISVGRVNIAVDNIHKFDFDLNIDLSINIPYQEKMHLKSD
FT                   LVKVIACAPEHICLSEVLVDEENCNIELFKEVSCNYDEAKAEYFWFYALDFLESSGYIN
FT                   YEISNFALKGHESKHNARYWALKPYLGLGINSVSLLVAHKGDGLEAVIRRDDNFLGSPR
FT                   ASATFESLSDLDFFICHFITNLGTKNGLDVSILKRRFIYNQENFYKLIDYLLSLSKSVV
FT                   FSNDILYLDGHERFKLDFYLRLIREYLINNSFKVNFKFL"
FT   gene            complement(702905..703591)
FT                   /locus_tag="BH0657"
FT   CDS_pept        complement(702905..703591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0657"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BH0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17156"
FT                   /db_xref="GOA:B2S100"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S100"
FT                   /protein_id="AAX17156.1"
FT                   /translation="MEEQKKLVSQYAIDHYIKSNMHLGIGTGTTVFYAIKYLSDKIKSG
FT                   DLKNLKLYPTSSDTKYLLAKENITYESKFTKFSKNIDITIDGADEILLEKKALIKGGGA
FT                   AHLMEKIIAYNSHQLLIIADETKIVQTLGEKVSVPIEIVPDALPFITANLEKMNFNPVL
FT                   RTCKFKAGPIITDNNNYILDVKMNIENPKGAEKYFKLLPGILEIGIFNHQNTKVIYYQN
FT                   GQIKEI"
FT   gene            703816..704562
FT                   /locus_tag="BH0658"
FT   CDS_pept        703816..704562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0658"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17157"
FT                   /db_xref="GOA:B2S101"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S101"
FT                   /protein_id="AAX17157.1"
FT                   /translation="MYKLVLVRHGESEWNRENLFTGWTDVKLSEKGISEALEGGRVLKQ
FT                   NGYSFDIAFSSMLVRANDTLNIILRELGQSYIDVEKSWRLNERHYGALQGLNKAETAEK
FT                   YGEDQVLMWRRSYDIPPMPLEESDKRHPIHDLRYKGIPKSELPSTECLKDTVARVIPYW
FT                   TDKIAKAIIEGKRVIIAAHGNSLRALVKYLDNMSDDDILKLNIPTGIPLVYELDQDLRP
FT                   IKHYYLGDEDKIKAAMESVANQGKKK"
FT   gene            complement(704645..706210)
FT                   /locus_tag="BH0659"
FT   CDS_pept        complement(704645..706210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0659"
FT                   /product="class 1 lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BH0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17158"
FT                   /protein_id="AAX17158.1"
FT                   /translation="MKTAHWADFYAKKIIEEKGEKEQYTVASGITPSGTVHIGNFREVI
FT                   SVDLVARALKDAGRNVRFIYSWDNYDVFRKVPKNMPNQELLTTHLRQAITRVPDTQTNQ
FT                   SSYARANEVEFEKYLPIVGIKPEFIDQSLKYMSSDYSSQIKFALDHKDEIEKVLNKYRT
FT                   TKLADNWYPISIFCTKCNRDTTTIKNYNHCYSIEYCCECGNKESLDLRKTWAVKLPWRI
FT                   DWPMRWKYENVDFEPAGKDHHSSGGSFDTSIEIVKIFGGTPPITFQYDFISIKGRGGKI
FT                   SSSSGDVVSLKDVLEIYTPEVTRFLFASTKPNTEFSISFDLDVIKIYEDYDKFERVYYG
FT                   IDDIKENKKEAFKRIYELSQPKLPDKEIPYQIGFRHLSTICQIFEGDKDKIFKLLNDVK
FT                   ESQKAKLINKIECAINWIKKFAPEDFKFSLRYTFDNIEPLKDNNKQGVTQLLDFLKKDF
FT                   NNITEKEIQDEIYNIARNNNIEPPLFFKQLYNILINKDKGPKLAGFIKIIGIKKFEEIV
FT                   KHYI"
FT   gene            complement(706297..707169)
FT                   /locus_tag="BH0660"
FT   CDS_pept        complement(706297..707169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17159"
FT                   /db_xref="GOA:B2S103"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S103"
FT                   /protein_id="AAX17159.1"
FT                   /translation="MKSGFVSIIGRPSTGKSTLLNSICGHQISIISSTPQTTRNKIKGI
FT                   FTDKRGQIIFIDTPGFHLSKKKFNIALMNNVHSAITETELILYVIDIQDEPGIEENEIL
FT                   TIISKSKINFLVVINKIDIQKTKEREIMIFLEKKGIKKDNIIKISAEQKINIEEIKDKI
FT                   YANLQEGPLYYPEEYYTDQEMNLRTSEIIRGVTIKKLKEELPYSLYTQIEILEDRKNKL
FT                   FIKANIIVAGESQKGIIVGKGGQGIKAIGEEARKIISKIFEKKCDLFLQVKLRKNWNKN
FT                   SKLIKNLIN"
FT   gene            707266..707622
FT                   /locus_tag="BH0660A"
FT   CDS_pept        707266..707622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0660A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0660A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17160"
FT                   /protein_id="AAX17160.1"
FT                   /translation="MKKVKFGVFCEQCGGKVGLGKSVCSNCHAKLGDLECPNCGYVGIV
FT                   SAFEDGCPKCSYSPFEEKLSRSFRGRHRGGFKGFWNNSSFLKSRFYFGLSINVMLYLFA
FT                   SFLMVLLFVYILFF"
FT   gene            707635..708042
FT                   /locus_tag="BH0662"
FT   CDS_pept        707635..708042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17161"
FT                   /protein_id="AAX17161.1"
FT                   /translation="MVITVFYLLSVFLSFKMGDNVKSVEDNVSQNSIFYYDLEEVEFPY
FT                   AKTQTLRFEGKSPIRYAYFNFDKDKLYSYTFVFDKKLISQYSIVIGVKEKFGDATAVTP
FT                   FNYTWDVGDSIIVLSSSILRMTLKSYVSKES"
FT   gene            708039..708473
FT                   /locus_tag="BH0663"
FT   CDS_pept        708039..708473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17162"
FT                   /protein_id="AAX17162.1"
FT                   /translation="MILRFLFALIFYVSCTSHVYDKAIIINNTKFFVKLAFDELTRTKG
FT                   YMGTKNINENNGMLFIFKKEKNLSFWMKDTPVPLEIAYINSAGIIKEIYSLVPFSKRIV
FT                   NSRYKVKYALEVPEGSFSKFKIKVGDKVNFNFDVNSLNVE"
FT   gene            complement(708474..709121)
FT                   /locus_tag="BH0664"
FT   CDS_pept        complement(708474..709121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17163"
FT                   /protein_id="AAX17163.1"
FT                   /translation="MVSTKMLKISILNIKQLKYSIVIANLILITFISCKDKNITYDKRI
FT                   KKILDNNKIEYRIDKENDFIISKTINQIKTEIIVRSKLNSYKNSKIREIFGIVEIFDVN
FT                   SDKIQEISESLMSDSYNNRVLGSWEIVHDPERGNNSLVYIVKAEENAKETFLLDALDEV
FT                   AATIAIFKKVITDNTTEIKINNTPNEINNDTLQNEDKIKDHAEEELQKIKAE"
FT   gene            709165..710124
FT                   /locus_tag="BH0665"
FT   CDS_pept        709165..710124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17164"
FT                   /protein_id="AAX17164.1"
FT                   /translation="MYFKSNDYSYTVIQSKNNYVQRSTFGISFVILNRGTKIFREDLFE
FT                   SLSNFDFIREIISIEKQSNRNSLQFISESYDKLKFILLSDDLNSGEKVNLAMKESICSF
FT                   VFVLQSDMYLLNPFWIPNIFDEIVKKNVLLVGGEFFDKEEEVVPSVFLPTIDKQQKLKV
FT                   ILINSERDYEKTLITMDYCGLYSKEKFVQLGGFDRRIKNEYFQKLDFGLRAIYFGESIH
FT                   IYRKLRIQYTALNVPEDLTKNRSFLIFLLKNYVPIFVGNGIKFSFLRFLQLCLRYGVNP
FT                   FKFGREFKEIKHETIKNSLRFKGDLKSAIELWENNIID"
FT   gene            710087..711112
FT                   /locus_tag="BH0666"
FT   CDS_pept        710087..711112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0666"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BH0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17165"
FT                   /protein_id="AAX17165.1"
FT                   /translation="MQLNFGKIILLINLIFVFLFLDAREFDYVNILDSFDSRRFKFNFN
FT                   IENDILTIEHEKGHLKLKVGFEYGLLSIGYYIYVDPILLKNGEILITKRALMQIKNYFS
FT                   SLQSYSKPRITSIVIDPGHGGHDRGAVVTHKINEHNITLLEKDFSLTYSIYLYKILSNY
FT                   FLDRNILLTRVDDVFVSLQDRSELANAIKPDFPNNVIFLSMHVNNAPNPEARGIEFWYL
FT                   PQDSKREVVRNFKGYDIRGNRYLRELNDILDIQYKYESKKLAEILYETFSDVLYETKIR
FT                   SIREEQWFVIKNSSMPAVLIEIGFLSNIDDAMLILDYNYMSKMNMLVLKSLIKFIEFYE
FT                   K"
FT   gene            711093..711641
FT                   /locus_tag="BH0667"
FT   CDS_pept        711093..711641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0667"
FT                   /product="flagellar filament outsheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17166"
FT                   /protein_id="AAX17166.1"
FT                   /translation="MNFMKNDVLDMILKNNSIYCNFLGRNGEKYLLGILIVLLLLSFLW
FT                   SSCIIFVNYENIFFRKVFYFYSENELISDLRYLKEKKTLKENLDFLVGDFLLGNSKGFS
FT                   LQFATRNVKLLYSFISNDVYFINLSKEFYNSFKNGGYNDSDKLRVNLFVESLKKTINFN
FT                   YSGNIREIVIFIEGYILDV"
FT   gene            711720..712754
FT                   /locus_tag="BH0668"
FT   CDS_pept        711720..712754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0668"
FT                   /product="flagellar filament outer layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17167"
FT                   /protein_id="AAX17167.1"
FT                   /translation="MTKARNIVFILFFLIILSPLFGQEAIGAGANSPKDEPGEVVFDFV
FT                   ELARDPSSTRLDLADYVDRVYSGASSVVKAEDMVLDLGISNWTVLLAPSARMQAYVKNS
FT                   VVVPAVVKAESKRYAGDTILGVRILFPSYSQSSAMVLPPFKIPFYAGEDGKQFLGKGLI
FT                   DNIKIMKEVKVTVYSLGHEVDLEVLFEDMSGMEYVYPLGTLKFKGWADLVWSNPNYIPG
FT                   MSARVVKDNIPNYPLPSSKMRFKAFRVLKSHSSRDQNLIFYVKDVRVIYSKLSVSLDSD
FT                   IDNESVFKIYETRGAESLRRLKSQEALKRVLKIRESVSMPGESFQSFLEKGGNDESGAR
FT                   TEKQ"
FT   gene            712829..715399
FT                   /locus_tag="BH0669"
FT   CDS_pept        712829..715399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0669"
FT                   /product="chemotaxis protein CheA"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17168"
FT                   /protein_id="AAX17168.1"
FT                   /translation="MLDSDSKELLEIFFEEAQNLVDTLEENIMSLEDDPNNAETIDEIF
FT                   RAAHTLKGGSASVDMMELSGFTHVVEDVFDAIRDNKLKICNDLVDLLLNALDVIKGMLD
FT                   ARLNGDVYLQDVSELKNKLRGFLGDEHQTASVVSLENINDDEFLLSSRELSDMREVVGL
FT                   EQKVLRVSIYFDQDNPMATIAGIQMFQALKDLGPILYTVPNYEQIIADKFLSRVDYYLI
FT                   SLNNRNVAEKIDLSDVALSYAIDEFDIGSELAKANSREKNAVVHDTVSKGELQLSNDEL
FT                   ISLREHIGDAELFEVKLNFNKDNPMATISGFQMLQALKSLGEVYKSIPDSEDLLTDKFF
FT                   DSIVYYLISNTSVESISKKVDLSDVVISFDIKKIDLEHIKDGDLNTEVESYTPVKEPKK
FT                   PAVNVNLIRIDSKRIDSILNLVSEAVISKSAYNQINSDITSFLYGFNHFYDYQESFRNS
FT                   FLVDLKMIFKDVGLELESSLESQIANLVEHKIDKTLQDMVGLRDLLLKILQDSRFASNR
FT                   LSRIITDLHESVLKTRMLPVSGIFSRFTRVVRDLSKKLGKVVELRTEGEDTEVDKSVID
FT                   DLVDPLMHCIRNSMDHGLETVDERLSNGKDKTGHIVLRAKNEGNVISIEIEDDGRGIDP
FT                   NIIRRKSIERGLIKENTVLSESEILNLIFEPGFSTASQITDVSGRGVGLDVVKSNVKKL
FT                   NGNIIIDSKVNVGTTFKIKLPLTLVIVQGLLVKSGSEIYVIPLNSVLETHRISEENIKF
FT                   LENDHEVYNLREEVISVLRLDELFNIKDDQTLYEKFLIVISINDKKAGIIVDSILGEED
FT                   FVVKPIKDKYASSPGIVGATTLGNGKVVLIIDVFRLFDLKDMKG"
FT   gene            715404..716783
FT                   /locus_tag="BH0670"
FT   CDS_pept        715404..716783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0670"
FT                   /product="chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:BH0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17169"
FT                   /protein_id="AAX17169.1"
FT                   /translation="MMEIKEIYSGEHNLSRQVKGINPVNLDFKVVSFNIGNDNYLIDIM
FT                   QVKEIRKSSNFTYVPNAKEYVVGLDNLRGEIISIIDLRIMFNLEVIKKELEDIMVLRND
FT                   DLLIGVIVDKVNNVFSIDSSLIQEPHPVLSHGALIRYIKGVVEYSGKLYILLDVDRIFN
FT                   YDREEELLLEEISNDDEVNTADSESLSYSNNSLELPESSVSEIVTSPKDDLVDLKVIKK
FT                   NLFKYSFNASLVSDEFLKKVSMKLDIANINDLSYDNFLGEFYSKSSGCLWSDKYLKGFQ
FT                   DEIVKQHVNDMSDVGTVLNVFEIGCGEGKETISYVSVLYESYKNPFKVTAIDNDLIKVI
FT                   GTSNLVFSESEINLSEIYKKNSFEQSPGVYKFKPEIINSVLFEYSDAILSEFPENLGII
FT                   FLRDVLCFLSDDGQVLILDAIAEKSVRGALLILGDNEELKNNDLFVKDISVKYFNLYKR
FT                   I"
FT   gene            716795..717280
FT                   /locus_tag="BH0671"
FT   CDS_pept        716795..717280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0671"
FT                   /product="pili chemotaxis protein methyltransferase
FT                   CheR-like PilK"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:BH0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17170"
FT                   /protein_id="AAX17170.1"
FT                   /translation="MRIDYIEPFLDAASSVLRDMLLVEDIQMGSPGLKSINQKIRGASV
FT                   IVGLAGSVEGSIIIDMDIDTALFVASKLNFEEYVDFDDEETKEMVAATLTEVGNIIAGN
FT                   FVTTLHAKGFVFDITPPAFIYGENMKISNKGSEALIVPFTLPDGKIIEVNIAIRERV"
FT   gene            717329..717769
FT                   /locus_tag="BH0672"
FT   CDS_pept        717329..717769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0672"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17171"
FT                   /protein_id="AAX17171.1"
FT                   /translation="MIQKTTISMDSSNKPKGINYETGAPFNVLIVDDSVFTVKQLTQIF
FT                   TSEGFNVIDTAADGEEAVIKYKNHYPNIDVVTLDITMPKMDGITCLSNIIEFDKNAKVI
FT                   MISALGKEQLVKDCLIKGAKTFIVKPLDRAKVLQRVMSVFVQ"
FT   gene            complement(717785..718300)
FT                   /locus_tag="BH0673"
FT   CDS_pept        complement(717785..718300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17172"
FT                   /protein_id="AAX17172.1"
FT                   /translation="MIKKIFLLLIINTSIYSRLITTSIEKRSSETTRQYSSFNLITEEA
FT                   YYTQYPKNTHEIQIYELTENFIKSIFKDKIDYTAITPTYKEANQYLLQSEIIDKDFSKY
FT                   KIFKIKTIDSIFKSSALIYTKKGFYKLELHMGNNNKNKLEIFNLNMSYFTKSPNEISNE
FT                   LIFYKNTK"
FT   gene            complement(718297..719343)
FT                   /locus_tag="BH0674"
FT   CDS_pept        complement(718297..719343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17173"
FT                   /protein_id="AAX17173.1"
FT                   /translation="MVKIFANFFKATLITSILAFLIEELSIILFLPYKIRFALIFIGLL
FT                   FDAILILIFFHKILKAYFSRTLQIYIRNNLFFDLIHCLIPLIFYSSHQIQNIINPHETI
FT                   LGPIILSLFKLRFLRLLRFNDLMIEIYYNPKEKNLILIAFARTFSISLLIPFIFFIIFS
FT                   SSGFANTIPEKQEFNIIKNISITTEKNYIKEKYPFILIIKDIDKTIYSKSDDIFFYYSP
FT                   SEYKIIEMDQTKFYIDKYLQRKNDSVIGIFLFTLFVSFSLFLTNFYKFFKASFLNPIIL
FT                   MQKVLQDPIEYRKIQIPFHFSEEKVYEMAKTFNNLLLKDKLNAKRKSKLPLEIEKVKRI
FT                   INSNKEHI"
FT   gene            complement(719337..720200)
FT                   /locus_tag="BH0675"
FT   CDS_pept        complement(719337..720200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17174"
FT                   /protein_id="AAX17174.1"
FT                   /translation="MKLKVYFPHLYHYLFNHESIRGLSVFEKEIEIIKYLEENKKTIST
FT                   FIDENFKFDTDSLTQYVKEKTDIIITSLVLSNIESIDLNIVKDLFNKKFNKNNLELIFG
FT                   SIKANPYLRKEFLYNFNAISSGHITFYINKLFEDKNSYTIYLIKKENDILDSSKLVKNY
FT                   IKILLLLRVLIIKFYLEKDIKLIPRNVEDTSKLVSREIDFLDDNTANLITQSLFKYEHL
FT                   SNMSPIATLISIFSNRTRIPSIKNNRIKGFMGYDESWFSIKQSSSKDYDPRIIKELLEI
FT                   ARKNKW"
FT   gene            complement(720197..720859)
FT                   /locus_tag="BH0676"
FT   CDS_pept        complement(720197..720859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0676"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17175"
FT                   /protein_id="AAX17175.1"
FT                   /translation="MRIKACIFDMDGTLINSIMDIAFSMNAALKKLGYTEIKTDEFNTL
FT                   VGRGYSKLVENTLEHLNINLNNKHLKDNLYLEFVKSYNQNLSSRTKAYDGIPELLRKLN
FT                   SLNIPIGILSNKNHTELLIISKDIFKDINFFEVRGYSTRFNAKPDPANALDMITELNLT
FT                   PEEIAYIGDSDVDMITAQNAGFLPIGVSWGFRTIEELKASGAKYILNSPSELLGIIK"
FT   gene            721053..722657
FT                   /locus_tag="BH0677"
FT   CDS_pept        721053..722657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0677"
FT                   /product="nucleoside transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17176"
FT                   /protein_id="AAX17176.1"
FT                   /translation="MLNFRLSLMQDILTLDKVTKRYGNFVANDNICISFKKGEIHAILG
FT                   ENGAGKTTLMKTIYGIHRPDSGQIFLKGNELRLKDSSESIRSGIGMVFQHFMLIPKFTA
FT                   VQNIILGYEDSKFGFINYDRARRKILKLSEKYGLKIDTDKPIENLSVGMGQKIEILKVL
FT                   YRNADIVIFDEPTAVLTPNEINEFINVLKILAVEGHTVILITHKIKEIKAVAQRCTIMR
FT                   FGKVIGTFAVAETDERMLTKLMIGKETSFDISKRQVVDHTNVLEIRDLNVKDERGVLKV
FT                   KNISFNLREGEIFGIAGVEGSGQEELIEAILGIRDVFSGDIIKKIDGKFESIKGLSVKQ
FT                   IIDRKIGHIPSDRQNHGLILDFNIFQNIGIKSFDNVNYLKIKCSDVCNSKLKFKFFNTL
FT                   KKQFVDFNLTFLKKITEQLAVSFDIRPRDILSKVKNLSGGNQQKVIVAREINLKPEVLL
FT                   AVQPTRGLDVGAIKNIYKKMMEQRDAGMTILLVSLELDELMSICDRIAVMYDGRIVGIL
FT                   EDNFDAEVIGKMMMGVI"
FT   gene            722658..723809
FT                   /locus_tag="BH0678"
FT   CDS_pept        722658..723809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0678"
FT                   /product="nucleoside transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17177"
FT                   /protein_id="AAX17177.1"
FT                   /translation="MIINNYKYKEIIAAFLNSAIFINFFAFFLGILILGLIVLLLGYSP
FT                   LRMYYVMIEVAFSSPKHFGYIISYATPLIFTGLSIGIALKVGLFNIGVESQFMLGSISA
FT                   LIAGIFLDFPPLLHVICIFIFAFLASGILGVLIGYLKIKFNINEVISGIMFNWILFHVN
FT                   NLIIDLPAIKKNNSDLSKPIRESAFIDFFGSWKLSSEGLAYRAEHSFINDLLKAPLNFG
FT                   IVIGIIIAILMWILLNKTMLGFKISAVGHNIVASYRMGIDIKKILLFAMFLAGALAGLA
FT                   GAIQVMGVNKAIFKLSYMEGTGLNGIAVALIGNNSPIGIIFSSTLFSILLYGSSRVQSL
FT                   MGLSSSIVSLMIGIVVIVISASHFFNKIVLGGIKSVKHTNISN"
FT   gene            723781..724707
FT                   /locus_tag="BH0679"
FT   CDS_pept        723781..724707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17178"
FT                   /protein_id="AAX17178.1"
FT                   /translation="MLNTLIFLISETLVNSQALILAGLGGLISEKSGIINIGLEGTMAL
FT                   GAFVGATVAYYYGSPLFAIFVGGLSGLILSVLHAIFTIFFKSDQIITGMAINFLGPAIA
FT                   MLFGTFIFGSASTPPINIKLPILFDGVLDKKSFIFQIFGKRYSLYIAIMCVILFHVMFK
FT                   YTKIGLRIKASGEEPEVLESLGVNVIMIRFFCVLLSGLFAGVAGAVISTVIASSYMQGI
FT                   IGGQGFIAIVMVIFGNWQPFGILMGSFLFSFIRTLVVMISQISFLSLKVPFKILIILPY
FT                   VVVILSLMFLSKNNYAPKALGLPYKKD"
FT   gene            724835..727087
FT                   /locus_tag="BH0680"
FT   CDS_pept        724835..727087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0680"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17179"
FT                   /protein_id="AAX17179.1"
FT                   /translation="MINLRGSFMLKIKHRFVGFLFLCLLITILFFSLIFKFVLSNRLER
FT                   YYKQLTRAQARRAAFAMQALLDTFYIVIDGASSNLALETMDEYSSIKNGGHMFSEVELD
FT                   RLRENSQIVLDSVKGHKRYRDRLYDILWNLKLDTVYEEFAFLDFEGKVIVTTRHANNMD
FT                   FGQSEANTEYFKKSVEEYNKSKLSFIGWYSGLIEGIAGEVAVRSYYEDKKASAIVVPVY
FT                   SAEDKVFLGYLIGYLLDDIIRDKLDRARFGFYNRGNLFYLDPYNNLVNPLIEYNESSKL
FT                   SAQFVDVLKDTLSKPPRQSIVSTEVPVYQIEKAYLPEMGLYNYYAILPISSELGENSGI
FT                   LVARIPYEDIHGVIDSLALKFIVSSVLGIIILVVILSMRVERIISSRLNLIRNLVKEIV
FT                   QGNLDKDYIIGNDKYSDELSSLGLQIIKMRNAIADAIASVLKNINYVNKASVEVANSSQ
FT                   SLSSSALQQASTLEEMSANIEQISAGVKMSANNSQETERIALITNESAQVGGKAVEESV
FT                   VAMQAIVEKVSVIEEIARKTNLLALNAAIEAARAGEEGKGFAVVASEIRKLADLSKESA
FT                   LEIGELVEENSRLATEAGLIFKDMLPEIEKTTNLVKRISEGSYKQNEQIMHFKMALDQV
FT                   GEVVQASASSSEELSSMADRMLEKAKELRQVISFFKVKDSEGDSSDAFNDADDGFVAGS
FT                   LTTLNVESNPSLGDRQDDIHGDSNVSYKPINKRVDPKKAIDVVDKDLDFDEDFSDF"
FT   gene            727117..729024
FT                   /locus_tag="BH0681"
FT   CDS_pept        727117..729024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0681"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17180"
FT                   /protein_id="AAX17180.1"
FT                   /translation="MKLKLKVRILLIVSILISIFISVLFFVFGMTINSSLVEQQLDLME
FT                   NLIGNVKNSVTIYLSSMEERVKINSMYLDSSDRFESIAKSKPKRIEAILDQIEILLKTG
FT                   RGSNLMITNNKGEIIFTTAVKDNSDYGISIADKGYFVNLRSTSSVYNSSVLLADSGSVE
FT                   EVLMKDISKIRNKAGQIPYLLIGVPLRDHDTNDIFGYFMIFYATDYLYNSFKGIVFGTL
FT                   GSGRAMVFDKTGSFLVHHTWFPGDNLVGTNPYYDDVIKKTSEDLIQKNKEISVGRYVDP
FT                   LDTAYIGLAQKIKCKLSNMSFIVYLRVKEKDFYYMSRLTTVILGVSFIVTLVVLGGVTI
FT                   YLVGKLSAVLNGILSYSGRLASGDFTVSNYSLEWKTLELCGLYENLELLRSNFSSVARG
FT                   VVENLDYLYENAIQIANASQNLSSGAVEQASTLEEMTANIEQISQGVIENTDNASTTES
FT                   IAVNTNEKTRDGHQSVVKAIEAMEVITDKISVIDEITRQTNLLALNASIEAARVGDKGK
FT                   GFEVVAAEVRKLADQSKESAREIIDIAHKSLTIASKAGNNFEQIVPGMEKTAGLVKNIT
FT                   RESSNQSNQIGQFKNAIEQVSQLVQTTASSSEELSAMSDRMLESVKHLKESVDYFKIDK
FT                   "
FT   gene            complement(729080..730153)
FT                   /locus_tag="BH0682"
FT   CDS_pept        complement(729080..730153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0682"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BH0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17181"
FT                   /db_xref="GOA:B2S125"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S125"
FT                   /protein_id="AAX17181.1"
FT                   /translation="MQIMKIAVLLSGGVDSSVALYTMIQKGYKNIKCYYLKIWLEDELS
FT                   YIGECPWEEDINYVEAVCTKFNVPYEIISLQDEYYKRVVTYAIEELKIGNTPSPDIFCN
FT                   QRIKFGAFFDKINEHYDLIVTGHYAKIENKNNHYILKQAKDKIKDQSYFLSHLSREQIS
FT                   KLHFPLGDLLKTEIRQIAHKIDLPNKNRKDSQGICFLGKIKYDEFIKYHLGELKGNIIE
FT                   QETGKILGTHNGYWFFTIGQRKGIKLSHGPWFVTEKDIQNNIIYISNSVNYLAQGKHQF
FT                   LVHKTNWINKPVNNIDLSAKIRHGEKKIKCKIEMLKNDIIKVDLEEKDYGISPGQFCIF
FT                   YQEDECLGGAQILQTLT"
FT   gene            730208..731464
FT                   /locus_tag="BH0683"
FT   CDS_pept        730208..731464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0683"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /EC_number="2.3.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:BH0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17182"
FT                   /protein_id="AAX17182.1"
FT                   /translation="MAIIFFNWRKSMRVGISDIRVFLPLNYLNFNVLLSNSLYKSDGIF
FT                   FKKFNRAIDATLQKAFRFTSPNEDSVTMASSAVKLIFDNNNLKLDKMRIFLGGTETGVD
FT                   YSKSISSYVYGALKLAGIDLKNNFLTFQAQHACAGSALALHSAASILSQLDRSEYGIVF
FT                   SSDIAHYNNLTTAEITQGAGATAVLIEQNPKVLSINLSEFGVYTDDVDDFFRPFGSLEA
FT                   KVKGRYSIECYNKANEEALADFAYKKNMSIKDLFSNYRFILHVPFAKMPIDSMHYVLKK
FT                   YYSEDESERNAYLESIDFYDSVEASKEVGNLYTGSIFLSLMSYLKRVFAKKDISGEKIL
FT                   FCSYGSGNIMVIYELTVEDHAQYVVKTWDIDKILSVRHNASFDEYRDFFENKIAPGESQ
FT                   GFYLKEIREDGYRVYGYRA"
FT   gene            731433..732512
FT                   /locus_tag="BH0684"
FT   CDS_pept        731433..732512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0684"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:BH0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17183"
FT                   /protein_id="AAX17183.1"
FT                   /translation="MDTEFMGIEPNILNNKKRQIEICLNKEDVSKSDNLLNFVNLKHDA
FT                   LSELDFYEIDTSESIFGYDIAMPIFISSMTGGIQEGNKLNKSLVKIANNLRIPMGLGSF
FT                   KLIFKYPEYIKYFALRKCADNIPLFSNIGAIQLREFGIFKVIEIIKKLEVDAIIVHLNS
FT                   GQELMNSRGDRNFKGIKDSIARLCDASNLPVIVKETGFGISPGCVISLLDLGVSYVDLA
FT                   GSGGTNWVLVEGIKEENLNVASCFSNWGISSVLTLLSIKDSFKDRIFASGGYETGIDIA
FT                   KGIALGAKLVGIASAILRAFYAGGEDALYKLLKDYEYVLKMSMLLSNSKNLVQFRLNKY
FT                   FLSHPLSFNVKSFKDFYET"
FT   gene            732478..733752
FT                   /locus_tag="BH0685"
FT   CDS_pept        732478..733752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17184"
FT                   /protein_id="AAX17184.1"
FT                   /translation="MLRVLRIFMRLSENFRNKNISDKRQEIKSILKLNPCDFFYDSVDE
FT                   NFLCHMIENYVGYLSLPIGIVKNLKVNGKYYAVPIATEESSVIAALNFAAKILESANLS
FT                   YSVGEVLGIAQVYIRTDKDLSDMLLSLFEKIDLWSKPLLHNMELRGGGFRRLSTKFIKE
FT                   IGIQKLNIYVDVCDAMGSNLLNSVAERVAHHITLEFGYECVLKILSNDSNDFVIKANFK
FT                   LNVNALLKDNEESLALAQNISLISKIGFFEEERAVTNNKGIMNGITGLCVATLNDTRAL
FT                   AACIHKFASRSGRYLPLSKFYISDENLIGEIELPLQVGVKGGSASSHEAAILSFKIMGI
FT                   DCKEEFMGILSCVGLASNFAALRALALDGIQRGHMKLHVNKILYLLKRDYNLSSDEIEK
FT                   ILLKMSDSGIYSLDFALKLLKDLRV"
FT   gene            733754..734692
FT                   /locus_tag="BH0686"
FT   CDS_pept        733754..734692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0686"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BH0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17185"
FT                   /protein_id="AAX17185.1"
FT                   /translation="MKIRCKANPSLALIKYWGKRDKFLNIPATSSIAVSVDKFYSISEL
FT                   ELSCKDEIILNSRAIVLQEREINFFNYARKILNEPNVGFRVISENNFPTAAGLASSSSG
FT                   FASIAACILRYFNQYSHQKASQLARIGSASAARAIYGGFTFLKEGARSAFQLNNFNYFN
FT                   DLCIIFAIVDSRKKDMSSRAAMEICKQEKFYWDAWIKSSRNIFKEALFFLLKGDFNEFG
FT                   LKIVKSYQCMFALMLSSSIIYFKSNTIELIKYIAALRSRGISVFETMDAGPQVKVLCLK
FT                   KDLELVLTELTSNFRDVDFIVSRIGSGLEWI"
FT   gene            734683..735624
FT                   /locus_tag="BH0687"
FT   CDS_pept        734683..735624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17186"
FT                   /protein_id="AAX17186.1"
FT                   /translation="MDIINFSVPGNLLLMGEYFILEENGLGLAIAIKERAYFSFKQSDT
FT                   WRFFAKKTKIDNFTLIENNDDFVFRMFRYLKQKYFANLEDFPFDVYIDTSNFFLNSGVK
FT                   KGFGSSAVVAVGIVCGIFLILNDINYFVKDKIFMYCLEAYRHAQGGMGSGYDIATSLFG
FT                   GVVRFRGGDSPTYELLDKICFDNFYLMQGLNPVKTTSSIIKYNEHRSYLMSFMEDFNIV
FT                   MEEIILNASNFSGCLLPSLKLAKDIGLEIGRRIGISADLPLSLSYLEKECTFIKALGAG
FT                   NETFLVYKPNFEVFKQFNIEPINLDLDGVKFQ"
FT   gene            735625..736518
FT                   /locus_tag="BH0688"
FT   CDS_pept        735625..736518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0688"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:BH0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17187"
FT                   /protein_id="AAX17187.1"
FT                   /translation="MFIIKKPSKILFLGEHSAVYGFPVIGATIPLYMHLVYTFSASWRY
FT                   LGVPFLKIDEVIHFINKRFNKVRPIEFLIFSQIPVGLGFGSSASLSLCFAEYIVSHDEY
FT                   STYDKILLAREIENIFHGRSSGMDVLLVELDGTFYLESRNGALSYLRISFCNFYFLIGA
FT                   VRRECATNEIISDLSYRISLDNDQFEIIKKLGWIARDSYVAFEKRDIALLANNMNVANN
FT                   CLNSLGLSSGVLDYVIERGRKFKALAGKLSGAGRGGAFILLFQNKNEASLCLEELNKDL
FT                   DKNNIDLIFKLKIFKC"
FT   gene            complement(736764..736837)
FT                   /locus_tag="BHT0026"
FT   tRNA            complement(736764..736837)
FT                   /locus_tag="BHT0026"
FT                   /product="tRNA-Val"
FT   gene            complement(736890..737333)
FT                   /locus_tag="BH0689"
FT   CDS_pept        complement(736890..737333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17188"
FT                   /protein_id="AAX17188.1"
FT                   /translation="MQKKFICIILIFTSQFTLLGINEDLKFLYSSIHKLRGDLNLKHLE
FT                   IDKTLEIVAKEYAINLNKNKVLTHTLFGTTPMQRVKKYDKYFCRIREILASGLDVQDVT
FT                   GAWLNSQKHKEALLNKDTSKMGGYVLRTQDKKNIFVVLFGEKF"
FT   gene            737405..737938
FT                   /locus_tag="BH0690"
FT   CDS_pept        737405..737938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0690"
FT                   /product="neutrophil-activating protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BH0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17189"
FT                   /protein_id="AAX17189.1"
FT                   /translation="MSNHLSYLKKDDLDKINLKLQELLAGLHVFYANLRGIHWNIKDIN
FT                   FFVIHKKTEKLYDYVAEVIDIIAERSRALGYDSEFRCSEFIKKSFINEISLDETSSLMP
FT                   SISSIVSNLKDILKNISDTRCFIDGTSDYGTANVLDDIIVSFEKYLWMYSSLLGGCGCA
FT                   LLHKMEHCEKGYVS"
FT   gene            738010..740070
FT                   /locus_tag="BH0691"
FT   CDS_pept        738010..740070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0691"
FT                   /product="protein translation elongation factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0691"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17190"
FT                   /protein_id="AAX17190.1"
FT                   /translation="MKKAIAESIAFIVFEGFMEIRNIGIMAHIDAGKTTTTERIIYYTG
FT                   KTHKIGDVDSGNTVTDWMTQEQDRGITISSAAITCYWKDHQINIIDTPGHVDFTAEVER
FT                   SLRVLDGGIVVFSAVDGIQAQTETVWRQASKYGIPRLAYVNKMDRVGANFFKVVEDIRN
FT                   KFGIVPIVLQIPIGSENNFEGVIDIIRNKELHFELRDGKPIVLEDVVREEFVENVKIFK
FT                   ENLIDSLSNFSERITELFLENSVIDDSLIIEEIRRCTISGFIIPVLMGTSLKNIGIEPL
FT                   IDAIVDYLPSPFEKKINAYSLKTDRSVSIEPKDEKRLSALVFKVQYFSAIAAHLYFIRV
FT                   YSGELSSSKRVLNIAKNKREKFTRIFRVFSNKNEQIDEVKAGDIGAVIGLKYSITGDTL
FT                   VEEGNEIMLEPLVFPEPVVLISIEPERASDDGRLKEVLEIITKEDPTFSYKESKETGQL
FT                   LVSGMGELHLEIIVMRIRDDFKLNVYTGKPQVSYRESLSVTVNDVFEFVNMFAGKELNL
FT                   KIGMIVSPLMRGEGNKIEFECNVEPLFKAAILRGITSSFSSGIIGYPIIDVGVKITSLD
FT                   YDKSKVNESVIESIAGLAFNEFFKRANPIKLEPIMILEIRTPIEYTGEVVSTLNFVGGM
FT                   IHSISNIEDYEIIKAEAAFEKLFGYTSILRSATKGRGVFTMEFSYFKEKCE"
FT   gene            740382..741590
FT                   /locus_tag="BH0693"
FT   CDS_pept        740382..741590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17191"
FT                   /protein_id="AAX17191.1"
FT                   /translation="MQGENMVSIRGGNRKKILLSLKNMQYSRTDLARKLALTNAAVTIL
FT                   TNHMIKENILVEVGSKESGIKKHGRKEILLDINKDFAYSMGVIISSNYFQIGIANLKCE
FT                   VLISEIYSFEPPVSAYEILEKIKDHMIEIIWKHNFSRDKFIGLGFSITGIIKDKESGIV
FT                   NDSHGAWIEKDVPVKAILEEYFSLTVYLESYVKNLSLAEFMGKNVDNIMFFDYTDTAEL
FT                   SIWSDGNVYSGFNNKSGMVSHMVIDYGGEKNCPTCGNKGCVNMLISNFALQRLISKEFM
FT                   NGEIPELYDKYEGRLKKVTIYDIFALHDKYEFIHKIMEDTVKYLAIVIINIQRVLDFNY
FT                   LVLYGQSFKLKSFFDLLKEEIKRLNKESIILKLSSLDTEVSVVGPASSVIFNKFYLTGG
FT                   DID"
FT   gene            741650..742999
FT                   /locus_tag="BH0694"
FT   CDS_pept        741650..742999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0694"
FT                   /product="signal recognition particle, subunit FFH/SRP54"
FT                   /db_xref="EnsemblGenomes-Gn:BH0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17192"
FT                   /protein_id="AAX17192.1"
FT                   /translation="MFEKLGAGFRDFVKYVSGKSVINEKNIEDAIDTIKDALIEADVNL
FT                   RVVRRFVNSVAEEAKGIKVLRDVDPKSQFVKIVNDKLVNFLGDKHSELILNPVNKLSCI
FT                   LMLGLQGSGKTTTCAKLAMRLKSENRKVLLVAADTFRAAAVDQLRVLGEQIGISVFAIE
FT                   SENDPIKVVKKSIEYAKVELFDTVIVDTRGRLEVEDLLLKEIKKIKDIVTPTETILVAD
FT                   AMTGQVAVNIAKEFNESVGITGVIFTKFDSDARGGAILSLKTICGAPIKFVGVGERPED
FT                   LDIFYPDRVASRILGMGDVVSLVEKAQSVIDKEEALRLEEKIRKANFSFEDYLNQFKYM
FT                   RNMGGISSLMGMLPGVSPEMLGRGINERELKREEAIILSMTKKERVNPVILNSPSRKKR
FT                   IALGSGTTVFEVNKLMKKFSQTILMMKKMKNKSFQNKITSLLGGKGGMVN"
FT   gene            742996..743247
FT                   /locus_tag="BH0695"
FT   CDS_pept        742996..743247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0695"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17193"
FT                   /db_xref="GOA:B2S137"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S137"
FT                   /protein_id="AAX17193.1"
FT                   /translation="MSVRIRLKRMGAKKRPYYRIVVMDSASPRDGRAIEELGYYHPVEM
FT                   QNQVKINEDKFRDWIGKGAIPSDTVKRILNKNNFKVES"
FT   gene            743257..743505
FT                   /locus_tag="BH0696"
FT   CDS_pept        743257..743505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0696"
FT                   /product="RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17194"
FT                   /protein_id="AAX17194.1"
FT                   /translation="MKEYGNEIELIEFVVKSLVDKRDEVKLNVVEGEKSTILELRVSAN
FT                   DVGKIIGRRGRIARAIRTLLSACAAKTNRRVQLEILD"
FT   gene            743509..744009
FT                   /locus_tag="BH0697"
FT   CDS_pept        743509..744009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0697"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:BH0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17195"
FT                   /protein_id="AAX17195.1"
FT                   /translation="MFVKGIILSSYGINGYAKVKSISNNFNDFLDLKGSKLVLKKECCS
FT                   SIEVKVEDVSLMNKSLLLKFEEFDAPEPIKDLIGFELWVNDEFASKLEEDEYYFGELIG
FT                   YKLINNGQELGVVVSFYECVKSILLEVKVGSKLFFVPFLNVYLGDINRELKTIELKVLD
FT                   LLK"
FT   gene            744006..744725
FT                   /locus_tag="BH0698"
FT   CDS_pept        744006..744725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17196"
FT                   /db_xref="GOA:B2S140"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S140"
FT                   /protein_id="AAX17196.1"
FT                   /translation="MKITILSLFPSIITPFFENSIMKKVVDRGIISYEVISIRDFSDDK
FT                   HKRCDDIPYGGGAGMVLKAPPISAALEYVNAKSKTTIFVSPSGLKYTQKLAYDLSKKSE
FT                   LVIICGRYEGLDQRVIDLYVDLEVSVGDYVLSSGEVAALVIIDSVYRLLDGAINPSSLL
FT                   EESFSFDCGLLEYPHYTRPYEFKGLEVPDVLLSGHHEEIKKWRFIKSVEKTKKNRYDLY
FT                   LKYLEMIGENDGFSKKN"
FT   gene            744700..745065
FT                   /locus_tag="BH0699"
FT   CDS_pept        744700..745065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0699"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17197"
FT                   /protein_id="AAX17197.1"
FT                   /translation="MMDLVRKIEAKGKRTESFDFRAGDTIRVSYRIIEGTNERVQNFEG
FT                   LVISIQNKGIGQTFLVRKISSGVGVEKIFPMHSPIIEKVQVLKRGKVRRAKLYYMRNRI
FT                   GKAAMKVKERLDIKKLK"
FT   gene            745043..745873
FT                   /locus_tag="BH0699A"
FT   CDS_pept        745043..745873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0699A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0699A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17198"
FT                   /protein_id="AAX17198.1"
FT                   /translation="MILRSLNNTQVSKVTLNKNVPLNGRLEIVKSLGLNKWLVSFLGNC
FT                   FEVKSSLPLKVGFTYFAKMISTSGNFLIHVNYASLFRDLDLFESNNKVILKLRGEPLEQ
FT                   NTWKLFKNVFDNIKDEFILKFLLALHEQGIREQDFMQIYDYFGSKVREREQYNKLPVFI
FT                   ESNNNFIIAIPFRFMEGNGLLFLFSYKDLEMVYKWSFVYFLNEQEKIICEINNSGSNFK
FT                   LRIYADFSLSKIIRELKSSLFCYNVTDIEILDSIQEFEDFDCEVIVVKGINYKI"
FT   gene            745870..746130
FT                   /locus_tag="BH0699B"
FT   CDS_pept        745870..746130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0699B"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0699B"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17199"
FT                   /protein_id="AAX17199.1"
FT                   /translation="MSGEKLALLIKYDTKFPAPFILAKARGEKALRIKELAKQEGIPIV
FT                   EDKYLSESLFLINEGDFIDFKYFKVVAQILSVVYKLKSNKL"
FT   gene            746444..747001
FT                   /locus_tag="BH0701"
FT   CDS_pept        746444..747001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17200"
FT                   /protein_id="AAX17200.1"
FT                   /translation="MEEIALKSDQSKAHGNDFRRRNRIPYSKMRKAKSEPKKQNVAALN
FT                   TAATNKSVGTSFNNQKNYKGNRQKGISKDRGLRIRFQEVCSICEKQIKDILSCMSMKFN
FT                   GEDKPIHFDCAIDKLKAENELVNNESLVYRGVGKFFVVDKSVRGNNLAFKIVKEIDFEN
FT                   LESRPIWRKKILQDMNKGFKFY"
FT   gene            747004..747501
FT                   /locus_tag="BH0702"
FT   CDS_pept        747004..747501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0702"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17201"
FT                   /db_xref="GOA:B2S145"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S145"
FT                   /protein_id="AAX17201.1"
FT                   /translation="MRVALFPGSFDPVTWGHIDLVKRASLIFDKVIVLVANNSAKNYLL
FT                   SDVERYELTFEVIASLGWSKIFVDRYDGIILDYALKNDIGFIVRGVRAFHDFEFEFERY
FT                   VVNNKLSPLVDTIFLPSSDRYLFVRSDLVKELIKNKNFDLSSFIPELVQKKLKSKFIDK
FT                   LS"
FT   gene            747553..747735
FT                   /locus_tag="BH0703"
FT   CDS_pept        747553..747735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0703"
FT                   /product="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0703"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17202"
FT                   /db_xref="GOA:B2S146"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S146"
FT                   /protein_id="AAX17202.1"
FT                   /translation="MAVPKFKPSKSRSRTRRSINMRKKIPQLQECSNCGYLVIRHRVCL
FT                   KCGYYKNIQYLELGL"
FT   gene            747737..748000
FT                   /locus_tag="BH0704"
FT   CDS_pept        747737..748000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0704"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0704"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17203"
FT                   /protein_id="AAX17203.1"
FT                   /translation="MNEECLFMDQSEIFKKVRSIISEQLDKKEDEITMESRFVEDLGAD
FT                   SLDIYELLYLLEEAFDDKIPENEASEFETIGDVVAFIEKKKG"
FT   gene            748006..748737
FT                   /locus_tag="BH0705"
FT   CDS_pept        748006..748737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0705"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17204"
FT                   /protein_id="AAX17204.1"
FT                   /translation="MGSAIVKLDVDRRRKLDEFLMGLHIDFNDIDLLNMSLSHSSYANE
FT                   FDQKYANNERLEFLGDSVLNLIITDYLYKFYPEKSEGELSKARSYIVSEESLSSIAREL
FT                   NLGNYILLGRGEENNDGRNKKGIIADAIEAFVGALYLDGGFLKASAFVVELFEVHIRLM
FT                   FNRGDFKDYKSLLQEYVQKKYKISPNYRLAKELGPDHNKIFCVELYVNDKFISNGKGKS
FT                   KKEAEMIAAEMALKTIANIDL"
FT   gene            complement(748715..749932)
FT                   /locus_tag="BH0706"
FT   CDS_pept        complement(748715..749932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0706"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /EC_number="2.7.7.72"
FT                   /note="tRNA nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0706"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17205"
FT                   /protein_id="AAX17205.1"
FT                   /translation="MNIGTNTKDIMKISKIFNNNNYEFFLVGGALRDLLLKKIPDDFDF
FT                   TTNATPKEIMRLFPNNIQTGMKHGTISIIFNKKIFEVTTYRIDIDYENKRSPKEVKFTK
FT                   SLNEDLQRRDFTINSIAMNILNCEIIDYYNGKQDLNKKIIKCIGEPNKRFEEDALRILR
FT                   AARFASTLDFTIDQNTLISMKYKKANILLLSKERINNEFIKLLEGKNPRKGIHYLQKIN
FT                   FFRYFFNTEINKKLKNKITLLNRNKFYLKAIVIFTSKKDIRCLREKLELLRFSNKDIKL
FT                   ILFYKTIINEINTLRIKKLHDVRILLSKATRENYKEILDIYKALKGRDNKLKFIMNKIK
FT                   SKKLLNDPLSLKELKINGNDIKDLKLTDNKNIGEILNYLLREVLTNPKLNKKEILIKKI
FT                   KDQYLQ"
FT   gene            750019..751824
FT                   /locus_tag="BH0707"
FT   CDS_pept        750019..751824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17206"
FT                   /protein_id="AAX17206.1"
FT                   /translation="MFDLYLNIYKWGFMNKSNVNIYDSIGELSKDSRAKLIREIKKNLS
FT                   LNSSVLSENNSNYLNSDSTVQIDDFLSKKFMEESLWIKIWVYILSFFQKDKTKEDIYKM
FT                   HLLKNLEGHINSMYKNPVINFKKGYLRVGFVEMFFELYCYLIELKGYFKMLETGNIVEQ
FT                   AMFEVIQSKIPNSQCRLEDFLALEEHEQFLRKDKSQNELEAIIRIKISNYINSIPSQTY
FT                   TVVEDMFEFFYVLNGIAFFPYKSFLSFFNVELLDDVDNFDVADLDGTVSISFESVDKYF
FT                   RCFFELLHTLRDIEINEEVLKIIVKNYFLIIKSDENGILSEENLLGIDSMFKSILGIMI
FT                   KIISFSKTLPYLDVFKIYYENPVLKPKKYVPCFDVKSFYENVLFLNVSGQLVKNYSKSL
FT                   TVLLNKELKDLIKNYSVIMNLDNIIFKGMGLEYSNLKKLYFLNEFFKYVYDVKMMEILR
FT                   TVNNVVLVNNTDLRSLYIKLERDISVLRKEVYDLYFELNYKNEEYEKYNEDYNIDDSYK
FT                   DKILEWYLREIETVKRLVFNFMSYFIDLRGKYIALLENNNAFIQSALNLSHKLSTDDNV
FT                   KISLSYVIDNILFIIKQALFILENL"
FT   gene            751828..752154
FT                   /locus_tag="BH0708"
FT   CDS_pept        751828..752154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0708"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17207"
FT                   /protein_id="AAX17207.1"
FT                   /translation="MMKNSDASDLRLFSILIRVLVIILFLNSVLSLFMFLAGAYNVFMH
FT                   SFQKFSLEFTIVLSAVAFGLEVTRLIFFYLFGGKRIKRYTILVFSFIICFCAFFIKIFL
FT                   SLEI"
FT   gene            752220..752293
FT                   /locus_tag="BHT0027"
FT   tRNA            752220..752293
FT                   /locus_tag="BHT0027"
FT                   /product="tRNA-Thr"
FT   gene            752298..752379
FT                   /locus_tag="BHT0028"
FT   tRNA            752298..752379
FT                   /locus_tag="BHT0028"
FT                   /product="tRNA-Tyr"
FT   gene            752617..753651
FT                   /locus_tag="BH0709"
FT   CDS_pept        752617..753651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0709"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17208"
FT                   /protein_id="AAX17208.1"
FT                   /translation="MAIKKIFIFLFVLFIVFSVLVFFLYFLNSSPLKSDLVYEFEVQKG
FT                   WGVKKIALELNKKGLIRSHKLLIAISYLFGSDKSFREGKYLINGNCSTFDVYREFLKGR
FT                   PILPINITIPEGYTGRRIALKLNESGIISDVQSFVDLINDVKFIGELGLSYDSLEGFLF
FT                   PDTYKFYKGMDMKEIIRIFVGNFFSKLGFIGIDHKSYSSEELYNKVIIASIVEREYRVK
FT                   SEAPIMASVFYNRIKSNMALQSCATIEYIITEELRKPHPSRIYFSDLEINSAYNTYINK
FT                   GYPPGPISNAGIVSLKAAFFPNNTNYLFFVIKDPKIGIHKFSSAYNDHLLAANSYIRNF
FT                   ITKD"
FT   gene            753658..755439
FT                   /locus_tag="BH0710"
FT   CDS_pept        753658..755439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0710"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0710"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17209"
FT                   /protein_id="AAX17209.1"
FT                   /translation="MEYAKVIDLIKQRVDIVGLIGERVRLVKAGASYKGLCPFHAEKTP
FT                   SFSITPSQGLFYCFGCRRGGDVIKFLMDIEKLDYNDAVKSLCSRIGIAYDEIKKTTGFK
FT                   NKTQDKALISKIYDLNARLVKTFLFFLNNNQDNQGVLNYILKERGISKEVINLFNIGYL
FT                   RCDVPGKLGFYDFLVLKGYSDELLSKSGLFAKQNRRFSILSGRLIFPIRDFKGNVVGFG
FT                   GRDLGKNNGPKYINSSETEVFKKRELLYGFYEGFSVIRESKSVILTEGYIDVLSFFTAG
FT                   VKFAVSTLGTSFSREHLALIRRHADKIMLCFDDDAAGLAATFKAYQICLPFNVDVSVIR
FT                   MKYGADPADVLKNKGASVLKNMINDNCEAFEYLLEKYSAKYDLNKTTDLNGMINLFITL
FT                   ISLSSTNTQRDLLLEKLESRVGIKLETLRKDYYSMRERSAIASYKKNTSSYEINTYERY
FT                   LLVALLKDFNYFTIIRRNISDSDLYDVDVKRIFVCFEKLFENNKGFSLLNLRELLKNKH
FT                   SVSEVFFENMLRVEFEVDDEMVKQILFAIKKRKVENRILVFKEMSRDNFSIDAKAQIRE
FT                   LMFLNMQRENLRIYLNE"
FT   gene            755432..757324
FT                   /locus_tag="BH0712"
FT   CDS_pept        755432..757324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0712"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:BH0712"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17210"
FT                   /protein_id="AAX17210.1"
FT                   /translation="MNSVENKDLQAFKKKNSKAIKAILSYLGDKKVITFEDLSTFLSGD
FT                   MLEPENIDYMYGVLENEGISLINEKMESAICSIDEFDEASKLDSQCMILDDSVQSDDEL
FT                   DDKLDEFEDETLDKEDFSSGYIKSGLLKDSNSEDPIRLYLKEIGKEFLLTGNQEVELAK
FT                   QMDSGESIIENILKNEGLVIENYYNLVNAIYSRVDKEEFFKKEKEREKDNNFDYYNKKK
FT                   RITSFYKASLKSFQDRLVKYIEKKHRLYELGEDIFEESINNERLHIKEMLKSVPLYQEE
FT                   LRIFSDDYIDSASKIKDLKRQQKSILDRLKIDKVRNLRILGRDLAIPERRERIEQSLNI
FT                   REDLIKEQITEAQLAQKELERIEMYYEYPMDKIISMSEEILKGKQMMQHAKDQLIKANL
FT                   RLVVSIAKKYANRGLHFFDLVQEGNIGLIKAVEKFEYKRGFKFSTYATWWIRQAITRSI
FT                   SDQARTIRVPVHMIEQINRLNRETRYLIQVLGKDPTDEELSARLGWDLKKVKTVKNVSR
FT                   EPVSLETPIGEEEDSVLSDFIEDKAIKNPAKHTSFVVLQDQIRSVLGTLPEREQEVVKM
FT                   RFGLEDGYSLTLEEVGLHFNVTRERIRQIESKALRRLKNPKKTQKLKDYLEDLN"
FT   gene            757337..758095
FT                   /locus_tag="BH0713"
FT   CDS_pept        757337..758095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0713"
FT                   /product="Zn-ribbon protein"
FT                   /note="possible nucleic acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0713"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17211"
FT                   /protein_id="AAX17211.1"
FT                   /translation="MESNIDILKNLECIYKAKFELEERQKNIPKYLQTKKAQIDGLIET
FT                   LAELQFKFKEYQKEDSSLKLDIQDINVRKSKAEEKIDSIKTQREYEALEKELQTIIDDE
FT                   VAIRKKMTHITGLKTKVDREIADIKSKLEIEQDIYATESSALENELLEIVKKLDSIRSE
FT                   EEKYASRMDEDFLFKFQRIIRNKSNGVVPLIENVCKGCHMILPVEFANKVRREPDDIKF
FT                   CPYCSRILYYQDRFEVGLEMVPGGLADLIE"
FT   gene            758480..759454
FT                   /locus_tag="BH0714"
FT   CDS_pept        758480..759454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0714"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0714"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17212"
FT                   /protein_id="AAX17212.1"
FT                   /translation="MGINYLKCTFYLIISLSLLFFIFYFLSYFKTFSNSYLKAGPTEVN
FT                   LLVLWDNKEYKEIIDYAENGLKENKFDFNLNLLLGFSYFYYSLMLNDSYLKNQFLDNAI
FT                   ERLRFLMSINDDVPMSSLYYILGKAYSHKGEYYSDLSVKYLNKALYSSSFDFMSVKDDI
FT                   YEYLGYSYQLLKDYNSSLKFFEKAYKENKSDLVLWSLAYVNYKTGNIDKSVEYINKFFI
FT                   PLDEDNESLRDEKSDDNLMQKVYLLYGDIYFERDAYEDAFNCYDKVLKINSLNPNVYVK
FT                   IGDIYRKRDKDYPKARKYWREALSINPYLEEARERLKISLEDF"
FT   gene            759467..760516
FT                   /locus_tag="BH0715"
FT   CDS_pept        759467..760516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0715"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17213"
FT                   /protein_id="AAX17213.1"
FT                   /translation="MNIFKSFLIDIGIDLGTCNTLVYIKDYGVVMSEPSVVAIDVSKSN
FT                   RVVAVGRNAKKMLWKTPENIKAVRPLRDGVIADIENTEKMIKYFISQIFSKKKLFFKPR
FT                   MVIGVPTCITEVERRAVKESAMNAGAREVKVIEESLAAAIGSDIPIFEPTGHMVCDIGG
FT                   GTTEISVISLGGMVVSRAIRTGGDEFDESIIKYMRNAHNIIIGQQTAEKLKIKIGNVYP
FT                   DTHNLKVETIDIKGTDAVTGLPRKQIIDSMEVRESLQEPISIVVDEVKRTLGATPPELA
FT                   TDIVERGIILTGGGALLKGLNRLLSKETGVPVYVADNPLLSVAVGAGLFYDYANRIDIS
FT                   KNIYSFINE"
FT   gene            760519..761364
FT                   /locus_tag="BH0716"
FT   CDS_pept        760519..761364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0716"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:BH0716"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17214"
FT                   /protein_id="AAX17214.1"
FT                   /translation="MKFLVNFKNFIKVFSVLIFAVIIMIYDSSDSKKNKRDDFFIFTLN
FT                   SYIQRNMYEFFNFISSIFKAINEYKDYGETIEAYKKRIQQLEIVIQNVQVLRQENARLK
FT                   EQLGFYSAHSNDFISAEIIYLNYANVSSLMAINKGYNDGVQKDMIAVAYQDGFSGLVGK
FT                   VVKVYADTARVLPLTSYENFVSARIQNSKFIGLVEGKGYGEALEMNYVNKLAENALKIG
FT                   DSVVTAGFSDYPSGIYIGQITNFDVLEYNSLLNIKIEPIIVLDKLEYVFLIKGNQRVEK
FT                   "
FT   gene            761361..761843
FT                   /locus_tag="BH0717"
FT   CDS_pept        761361..761843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0717"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:BH0717"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17215"
FT                   /protein_id="AAX17215.1"
FT                   /translation="MISFILYYIVSIFWGQIFQYYCDISFSFSIDIFLIILIFNSLNFV
FT                   FNVGLISSILHGLIMEYFNGLPLGFFVFNYVLIFYLLEKVKMIVPKSMFSITLFFIFSK
FT                   FVIWFVAMTFADFIDLKGFNYSIFDLNLVINIVFLNFLYPILNYCTKSLYTIKEEY"
FT   gene            761844..763646
FT                   /locus_tag="BH0718"
FT   CDS_pept        761844..763646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0718"
FT                   /product="cell elongation specific D,D-transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0718"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17216"
FT                   /protein_id="AAX17216.1"
FT                   /translation="MKVILSGRYKFGLLLLSFVFFSYLFTLFKMQIGKHLLYDREATVL
FT                   LSRVEKIKASRGEILDSNFNVLANNLTAFVLKISLEQYYGMSLEDRDGMLNFLSSILGI
FT                   ERELILSKIEATRGYLKDVEIVELSPEMLFRVAEKRSYYPALLWTYSFKRNYLVDDSHS
FT                   HPIGYVGRINQRELRSFYNVQGYDNNSTIGKLGIEQVYDSYIRGKEGLIRYKVDSRERK
FT                   MDSGSIIERMIPGNNIVLNINKDIQLLAKNTLGKRYGTIVVLKPATGSVLALHSYPYYS
FT                   MNDVYNKHSKEDYSFLNRAIQSVYPPASIFKLVMTTALLEEKVLDKGKKIHCPGYFRVG
FT                   NRVFHCWQRGGHGYVDLEHAVAHSCNVYFYILGLKYLGIEKIFKYAKEYGFGEKTGIDL
FT                   PNEVSGILPNPEWKKKTFNQPWVGGDTVNCSIGQGFLSATSIQIANMIAMIANEGVIYK
FT                   PRIVSKILNGTTNEVILENVPEILKKTDIISRNTFKVLKKYMRNVITYGTARNSVLTKA
FT                   VAVVGKTGTGQTGVTGLENSSFVSLAPYNAPPSEQIIIFSLVEGRSNTDNMWSAKSVDL
FT                   MMQGIFTNQSYEDILREYRPWYIR"
FT   gene            763652..764971
FT                   /locus_tag="BH0719"
FT   CDS_pept        763652..764971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0719"
FT                   /product="rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0719"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17217"
FT                   /protein_id="AAX17217.1"
FT                   /translation="MAVFRKSYDSLALFSLVMISFIGVLLIYSSDYTSNGSLMKIEYLK
FT                   QIVWVLGGFFVILIIGRYDLKIIHGVIYPLYFLLVASLIFTAIFGVSVNGARSWIGIWK
FT                   LGGQPSEFGKIISILTLAKFYSSKNEYHNFFVFVFAFMLIFPIILLVFLQPDFGTAVVY
FT                   LNMFIFISFFAGVDIHYILYFALTGFFSFLFVVLPVWYEYKADMGNVLYLIFSNNFYFQ
FT                   VAFLVLILVFLSSAIGFFVSKYNLNVRVIYFYISFISSILLISAFFSKFLSKFMKPYQI
FT                   KRFLVFLDPNIDLKGAGWNLNQVKIAIGSGGIFGKGFLKGPYTHANYVPSQSTDFIFSI
FT                   LAEEFGFVGVSVVLILFFFIFFKILILMNKSKDRYMSLVLAGVLGLLFFHTSFNIGMSL
FT                   GLLPITGIPLPFLSYGGSSTITFFFAMALYFNIESIVTMD"
FT   gene            765125..766876
FT                   /locus_tag="BH0720"
FT   CDS_pept        765125..766876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0720"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0720"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17218"
FT                   /db_xref="GOA:B2S162"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S162"
FT                   /protein_id="AAX17218.1"
FT                   /translation="MSEKLDRESILYKKRHSIAHVMAEAVLELFPNTKIAIGPPIKDGF
FT                   YYDFDFEKHITEDDLLLIEQKMREILKTGSPFVKEVITKEQALMLFKDEPYKMDLIRGL
FT                   AITDEISIYKSHNFTDLCKGPHVDNMGKIDPKAFKLTSIAGAYWRGDEKNKMLTRIYGT
FT                   LWNNEKDLKAYLKLREEIKRRDHRKLGRELDLFSVHEDIGPGLIFFHPNGARIRAIIED
FT                   FWREEHFKNGYDVLFTPHIGKSCLWETSGHLDFYKESMFEKMEMDKSNYYVKPMNCPFH
FT                   IAIYNTGKHSYRDLPFRWAELGTVYRYEKIGALHGTMRVRGFTQDDAHIICAYEQVKSE
FT                   VQEVLRFALYMWNQFGFADLKAYLSTKPEKAVGDKDDWEMSVKVLEEALIDLNIAYDID
FT                   EGGGAFYGPKIDLKIIDSLGREWQMSTIQFDFNLPERFKMTYTAEDGKEKRPFMIHRAL
FT                   LGSIERFFGILVEHYGGAFPVWLAPLQVIIIPVNNVVEEYALEILSLFKNEGIRIKLDN
FT                   DCNMRMNAKIRQYQSKKVPYMFIIGEKEVVEGKISIRTRTNDQINGLELKEALEFVRLK
FT                   VKNKEIL"
FT   gene            766878..767501
FT                   /locus_tag="BH0721"
FT   CDS_pept        766878..767501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0721"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:BH0721"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17219"
FT                   /protein_id="AAX17219.1"
FT                   /translation="MNSKSIISPNKITFFRIILSFVILFIFCLEDFWNPYLFLILIWFL
FT                   IIFNEITDLIDGYIARKYDLVSNVGKILDPYADVLQHLTYFVFFFYKGITPYYFFVIFI
FT                   YRELSVGVIRNLIIQFDIVQQAKFSGKIKSLFYAISTFASLFLYSLDKLKITTLIENFI
FT                   SLILNLDFNFSFIVGIIYAISAFLTLISLIDYIVIFLDLGKYEK"
FT   gene            767482..768930
FT                   /locus_tag="BH0722"
FT   CDS_pept        767482..768930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17220"
FT                   /protein_id="AAX17220.1"
FT                   /translation="MASMRSNFLLIFVWLLIGFYSHAQLKQVLTEVEPLSISSESGKGS
FT                   IYLKVNKSSNYILTFDISLGSDFVYMVYDVLNKKYITDKIRKRDVKLKLHKDILYAVIY
FT                   VTSENANINFVLADLDLSIISDDALRAKISNIKKQDKTFLLRDLPSFKLGAKLKKYILR
FT                   TYSRNIYLAYQMENSDNIKVSSFIENIGWFDISTAVNDNITDIACFDFAVNSKGELYVV
FT                   FTTKSTDDFSSELIVKKFNSRKWIDISPKFRTNIGFLVNISIDKRDNLYVAYLKKVGSE
FT                   YKVNFVANRGYSNIWNNVMDSYMSKGDAYVDVSSIGIISEPFLGIFYNYKVNDYVNSEF
FT                   IVDRGKTWANANIQSANMADSVKLLSNFKSGQVVLSYITKDRPIVSVFSLQDDKWKNIS
FT                   PNIRIKGITSDILSYRNDLLLTFEDGDDIRLIYFDEDNWYFLNESEIFQKSACKPQFAK
FT                   YQDEGFILSYLSLDFKVLSFKLIS"
FT   gene            complement(768907..769431)
FT                   /locus_tag="BH0723"
FT   CDS_pept        complement(768907..769431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0723"
FT                   /product="adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0723"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17221"
FT                   /protein_id="AAX17221.1"
FT                   /translation="MFEIELKAFIPKNKLKKILKLANQKFKFIKEEIKNDTYYSNTEKI
FT                   IRIRKFNTSEEIVTFKIQSLENDIEINREIEFKVDQINNFIFFLEEMNFKILYKKIKKS
FT                   LIYQKGNLNIEINDIENLGFYLEIEKIIYDKNELSLAKTEIYETIKEFKLQNNIEKKSY
FT                   FELILANQFKG"
FT   gene            769530..770849
FT                   /locus_tag="BH0724"
FT   CDS_pept        769530..770849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0724"
FT                   /product="potassium uptake protein KtrB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0724"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17222"
FT                   /protein_id="AAX17222.1"
FT                   /translation="MLKFEFSDRFFLFSYFILIMFLGSLLLSLPIAWNGEEKLEYIDVL
FT                   FTSVSAVSITGLVTVQIENFSTFGFIVIMLLMQFGGLGFITITTFYLLIPKRKLKLTDA
FT                   RIIKQYSLSNIEYNPVKILKSILFVTFLIELIGLILILVCFKLRGISISLLEALFTAIS
FT                   AFCNAGFSMHSESIYAWRDVPEAIVVIAILIICGGLGFMVYRDVTNTIKYHKKLSLHVK
FT                   IVFLLSFFLIVFGAIVFFLSEMHKLEEGYSLGTLIFNSIFYSISTRTAGFNYLDNSLIA
FT                   GRTQMLSLPFMFIGGAPGSTAGGIKITTFFLIILAVIKSQDGNGYIIGSYKVSIDSIRF
FT                   ALLFFVRAVFILCFSFFVLLAAESGGKWRVIDLGYEVFSAFGTVGLSVGVTQDLSFLGK
FT                   VIIIFTMFAGRIGLFSMAIFVSRRSRFEEFTRPRQDILVG"
FT   gene            770856..771638
FT                   /locus_tag="BH0725"
FT   CDS_pept        770856..771638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0725"
FT                   /product="potassium uptake protein KtrA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0725"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17223"
FT                   /protein_id="AAX17223.1"
FT                   /translation="MKTFVIIGLSNLGIHILENLSKLDCQIIIVDTSKELVEEYDVIAT
FT                   ESFILDQFTKNALKKVIPVDTDAVIIDFDNDLGKSALVTHYCNLLGVKEICVKTEDRDD
FT                   AEILKTLGATKIIFPSKDAARRLTPLLVSPNLSTYSIVGHDIIVAETVIPKEYVGKTLL
FT                   EADLRREKGITVIAVRNLSNSRYEFVDGDYFFLKDDKIVICGKPDGIENFTNNKDLIKD
FT                   LISVSKAEDVSSKEDFKKLGFLRFFDFMKKFNKDKKND"
FT   gene            771645..772622
FT                   /locus_tag="BH0726"
FT   CDS_pept        771645..772622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0726"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0726"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17224"
FT                   /protein_id="AAX17224.1"
FT                   /translation="MKMTKIIPVASGKGGVGKTSFVANIGYKLACLGKTVILVDLDLGG
FT                   SNLHTCLGVKNTGVGIGSFINKREKDFSSLILKTPYKKLYLIPGDALYTGTANIPFSIK
FT                   KRIIDSIQRDLVADFVFIDLGSGTSYNTVDFYLSAYSGIIVTVPETPSILNAYSFLKNA
FT                   LYRLLYLSFPSKSAEREYISNFFKNKIEGTNVKFKDLVTGIEVISLSASLKVKKMMNSF
FT                   YPRVVLNRIESSEEIAMCENLINVVKNNINIPVEFVGFIPFAKSFRESVNNRVPFIDFD
FT                   RNSKLNKYFEFIAGNLIKSPVEGSPYIYDDIYDMIKEQSQFIRK"
FT   gene            772661..774004
FT                   /locus_tag="BH0727"
FT   CDS_pept        772661..774004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0727"
FT                   /product="pyrophosphate--fructose 6-phosphate
FT                   1-phosphotransferase"
FT                   /EC_number="2.7.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:BH0727"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17225"
FT                   /protein_id="AAX17225.1"
FT                   /translation="MHRIRNENLDFKIENLGECKQDNPLISFYAKESHVHFTDETSKIR
FT                   LNVYKNEEGWEQYENVFLEKAGPRYKIYFDPSHVKAAITTCGGLCPGFNDVIRSIVRTL
FT                   WKVYGVYNIYGVKFGYQGLLPESNLSFMKLNPDVVDDINQLGGTILGSSRGGIKPVEIV
FT                   DTLERMEINMLFNIGGDGTQKGSVLIAEEIERRNLKIAVVGIPKTIDNDLMFVQKSFGF
FT                   ETAVEQAVAAVAGAHFEANSAYNGIGLVKVMGRDSGFIAAYTALSSNDVNFCLIPELDF
FT                   DIEGPNGLLAHLERRLLAKENLDEMPHAVILIAEGAGQKYFDPGSRKRDDSGNLLYEDI
FT                   GLYIKDKVNTYFKSKNIPVNLKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMAGKT
FT                   KLLISLWSTKFVHIPIKMAVIARNKVNINGSFWRDVLSSTGQPFSMKN"
FT   gene            complement(774044..775375)
FT                   /locus_tag="BH0728"
FT   CDS_pept        complement(774044..775375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0728"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:BH0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17226"
FT                   /protein_id="AAX17226.1"
FT                   /translation="MKIIIIGGTAAGTSAAAKAKRTNKGLNITIYEKTNTTSFGACGLP
FT                   YFIGGFFDEPNNMIARTPEEFAQNGISVFTEHEVIKVDIKNNTLKVKNLKTQQIFNDTY
FT                   DKLMIATGGNPIIPPISNIQLNNFYTLRNMKDGQEIRELFKKKDIKNIVIIGAGYIGIE
FT                   MIEAAKTLDKNIRIIQLDKRILTESFDKEITNIMEEELIKNNVLLHTDEFAKSLIGKEK
FT                   VEGIITNKSEYKADLVILSTGIKPATEFLEGQLETLKNGAIIINEYGETSAENIFSAGD
FT                   CATVYNIISKKNDYIPLATTANKLGKVIGENLAGRRVPFKGTLGSASIKVLSLEAARTG
FT                   LTEEAALRLGIKYKTIFIKDKNHTNYYPNQEDLYIKLIYNKETKEIIGAQIIGKNGAAT
FT                   RMHALSLAVYSKLTTNELGMMDFAYSPPFSKTWDALNIAGNAAK"
FT   gene            complement(775384..776772)
FT                   /locus_tag="BH0729"
FT   CDS_pept        complement(775384..776772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0729"
FT                   /product="sodium:dicarboxylate symporter family protein
FT                   YhcL"
FT                   /db_xref="EnsemblGenomes-Gn:BH0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17227"
FT                   /protein_id="AAX17227.1"
FT                   /translation="MDTTIIYTLINIIIMLILIGFLYFLHKKHISFTKRLLIALGLGIV
FT                   FGITMKYCYEPESTILKESIQWINILGIGYVRLIKMMVIPLILVSIISAIVKLTNSQDI
FT                   WKMSLSVIFMLVFTAGIAAIIGICTSLSFKLTAEGLQPGVDEITRGKKLNQGLERLQET
FT                   PITQKLSEIIPENIFSDMTGARPNSTIGIVIFAALVGIVALRVAKKNPESIEVFKQIIS
FT                   TAQDLTSGMIMLILKLTPYAILAMITKISATSDISSIMKLGKFALASYIAIGITILMHM
FT                   SLIALNRLNPIIFIKKAWPVLTFAFISRSSAATIPVNVEVQTKQLGVSEGIANLSSAFG
FT                   TSIGQNGCAALHPAMLAIMIAPTQGINPTEPLFLLQLIGLIIITSFGAAGAGGGATISS
FT                   LMVLSSMNLPVELVGLLISIEPLIDMGRTSVNVSGAMIAGIITAKNLNQLDINIYNNQN
FT                   EIEK"
FT   gene            complement(776863..778437)
FT                   /locus_tag="BH0730"
FT   CDS_pept        complement(776863..778437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0730"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0730"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17228"
FT                   /protein_id="AAX17228.1"
FT                   /translation="MLKYINLNKLKNFQELKQTNPEELKKTLSEDRIKEYDIKIEGHHV
FT                   HYNYATKQINENHLRIFQNLSDEANLIEKYKEIIDGKNINISENRKVLHHLTRGQLGIE
FT                   VTENNENMRKFFESELKRIFEFAKQVQNGTIKSTSGRVFKNVVQIGIGGSSLGPKALYT
FT                   AIKNYAKKKNLHLMKAYFISNVDPDESEEILSKIDLQETLFIIVSKSGTTLETASNMQF
FT                   LIKKLKDNGIKEYQKQIIIITSKGSMLALEQGYLEYFFMHDSIGGRFSPTSAVGLTLIT
FT                   LCFTENVTKEILKGAYEVDKKALNKNIKENAPLLAALISIYESNILNYSSNCIIAYSKA
FT                   MENFYLHLQQLEMESNGKSVNRFGEKIDYKTVRIIWGGIGTDVQHSFFQMLHQGTEIVP
FT                   MDFIGFSESQLKQDITLEGTSNNNKLKANLIAQIIALSCGKEDTNKNKNFKGERPSALI
FT                   YSKELTPYTIGAILSHYENKVMFEGFLLNINSFDQEGVQLGKVIATKILKNNDLKDGII
FT                   SSYDSLL"
FT   gene            complement(778472..778864)
FT                   /locus_tag="BH0731"
FT   CDS_pept        complement(778472..778864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0731"
FT                   /product="chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:BH0731"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17229"
FT                   /protein_id="AAX17229.1"
FT                   /translation="MLIDLEQIKIKRRIRQNVGDTTTLKESIKKHGLIYPIIIDKNKNL
FT                   VAGFRRYQVLKELGYKEVDVKVIPIEDKKTLLEIELDENNARKSFTKSEAETGEEQLKN
FT                   YSEKNIIIRLLNLITFKIKKIFKRKK"
FT   gene            complement(778870..781704)
FT                   /locus_tag="BH0732"
FT   CDS_pept        complement(778870..781704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0732"
FT                   /product="multimodular transpeptidase-transglycosylase PBP
FT                   1A"
FT                   /db_xref="EnsemblGenomes-Gn:BH0732"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17230"
FT                   /protein_id="AAX17230.1"
FT                   /translation="MLEGHNLKRINFSKKDNILIYLTYFTISFSIILLSITIAETINIQ
FT                   RDKKFGDVNPAIPSKLFDTNGRIITQFISDENRELLSLREMPNNLINTLLIREDLSFFF
FT                   HRGFSLMGILRAAFNIALGRYFSGGSTLTQQLAKLLYTNQAKRSILRKLNEIWWAIQLE
FT                   KKLSKYEILEKYLNKVYFGNGNYGVVAASKFFFNKRVKDINTAEAVLMIIQLPNAKLYS
FT                   PFYNPEFAKKIQKAVLNQVSSNGIISPELAEAEFNEYWANYDWTRMADTSAISDKEDHA
FT                   PYFSEYIRQRITKHLPAGANIYKDGYSIYTTLDLNAQKYANEVTQEMITKARKMYNSTK
FT                   SSETLIINSEIVPVIDTISDLLGIRSTRVNGRQYKKLRTRKFYEDNIDLIASFAAILGI
FT                   DKIDKATREYTINNTTNPNLIVQPEGAFIALDTATGAIKAMVGGSGYRKGSEFNRATQA
FT                   KIQPGSAFKALYFSAAIDLKKITAATMFSDSPVAFFNQEGEVYAPENYGGKWRGNVLTR
FT                   KALALSLNIPSLRILDILGFENAIKYSAKLLGIKDQNEINKTFPKVYPLALGVISTSPI
FT                   QMARAFAILGNNGKEIEPYGIKYIEDRNGKVIANVESETLTAIKNKGANAQIISPQTAY
FT                   IMTDMMKSTIQYGTLANQRYTNLKDFKSDIAGKSGTTQNWADGWAIGYSPYITTALWVG
FT                   FDKKGYSLGTAGTGTGIAGPSWGKFMAEYHKHLPKKVFIRPKGIVNVQVQSETGLLPEG
FT                   VPNETTINEIFIAGTQPFEKSRYYENKSEFLNKMEFNVYGIDKIDDNDELNIEINEFEY
FT                   LMDDFNQLNEIDNKIEPENDINETNNSNPDSNLETENNKANVNHDMPDIRIDNTINNTR
FT                   TDDNIDIDDNINIDYNIDTDDTDKNNTDKDNNTEIKENEHKDNTDKESSITDYNEQIDE
FT                   NEQKDVNGDNIQLD"
FT   gene            782155..782940
FT                   /locus_tag="BH0733"
FT   CDS_pept        782155..782940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0733"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17231"
FT                   /protein_id="AAX17231.1"
FT                   /translation="MFLSRKIKDYEVKYKGKEIKMSTEINSFLNIRNSVEMRVGTYVAS
FT                   GVIYSISMSAIKLILQDDKVLPVLAQNGNSGNIQLKSFDNVGDNSFFIPSLVVKLVNTS
FT                   SYSVQDKEYNLLTLDFLSPLSEEVAVKIGKLLDLKLGQNQRIHERIIIDKDSIRKLNLS
FT                   SDKAFIKVNGVKHKCLIKDMSYGGALLISYFDYEGMDESNPDLTLSFDIADKEVSIVGK
FT                   ARNLSVIQTPNGKVLALGVAFCEEKIPLAYTMLIHDYFN"
FT   gene            782924..784036
FT                   /locus_tag="BH0733A"
FT   CDS_pept        782924..784036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0733A"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0733A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17232"
FT                   /protein_id="AAX17232.1"
FT                   /translation="MIILIRGFMLKNIVYISLPEDFTSQIKDFIFDPKILLPVEVGDVQ
FT                   HFSQDELNFEAVMSAILKISAYDQGNVNFPYYKKLLLALNPNIVNMLIHVGLTKIDEGD
FT                   YNLALEIFLALKGIDGENEVLLSNLALLYEKMAENFLRVDQNVEAMTSNQNALKIYERL
FT                   LELESPNENVFANAGFFFVKQYKLDRAQELLRHYLRISNNLKLKSKVSEVLDAIGVHKS
FT                   LALNLERIYDLIILSKEDEAISELVKLLEYHEGSWNAWFLLGWGYRRKGFYSEAKDAFL
FT                   KVLSIDSKNVDAMNELAICFMELVEFNDSLEYLLKALKLEPDNIKIISNLGILHLKMER
FT                   SKEAREYFEIVLEYDSSDPIALKYLELLDS"
FT   gene            complement(784062..785072)
FT                   /locus_tag="BH0734"
FT   CDS_pept        complement(784062..785072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0734"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0734"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17233"
FT                   /protein_id="AAX17233.1"
FT                   /translation="MTSMKTEIIEQSEIEKAAKFIRTGELVVFPTETVYGIGANAYNDD
FT                   AVRMIFLVKKRPITNPLIVHVESIEKINELVEHIPKSALILMQKFTPGPLTFILKNAGK
FT                   ISNLISGGLESIAVRIPSEPVALKLIKISGVPIAAPSANLSRRPSATNFKMAIKELDGL
FT                   VKGIIKKNEESKIGIESTVIGFDLKGNISILRPGSITKEMIERELKGEFRVEYSVGKEM
FT                   LSKSPGNLLEHYRPRIPVYLFKQKDNIRCYASRQDTKVLITRDTFKSYWFNGFWNMNNI
FT                   CVFNTLEEYAKNIYKVFVESEKEYKQILAEFVDNNQLGYSINNRLKKASLNKFIF"
FT   gene            785191..785997
FT                   /locus_tag="BH0735"
FT   CDS_pept        785191..785997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0735"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:BH0735"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17234"
FT                   /protein_id="AAX17234.1"
FT                   /translation="MQYGIICGMVSLFSLMGTSFRFGFLFLFFTATQLHSATVGLASWY
FT                   GEAFHGKPTANGEKFDMTALTAAHKELPFNTVVRVTNLLNNRTVVVRINDRGPFRKDRI
FT                   IDLSKSAAEKLDFLGIGVAPVKIEVLEQLSEKKAVTQESRKTVNGENSSKSDSVVSASK
FT                   LERDVALDKDHSEVAEKLLDNSTKEPDFYIQVGSYKIKDYAQRAYKILQKAGLNVLVNS
FT                   HGPFFTVFIPTYADDVHKNVELIKSTGYQDILVRKTKIPGDSISID"
FT   gene            complement(785987..788044)
FT                   /locus_tag="BH0735A"
FT   CDS_pept        complement(785987..788044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0735A"
FT                   /product="ATP-dependent helicase, DinG family"
FT                   /db_xref="EnsemblGenomes-Gn:BH0735A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17235"
FT                   /protein_id="AAX17235.1"
FT                   /translation="MKLIEYILKQAELNIKGFVKRNTQLRMIKKISKAFENENFLVIEA
FT                   PTGTGKSLAYLIAAIDFIQKTQEKVIISTASINLQEQLIKKDIETLEKLIPFKMRFGVI
FT                   KGMRNYLCLRRLEELEKNLLTYTFNKKHLEALIYWTQNTKTGDRDELHFIDEQIWEEVS
FT                   ASPETCSGITCPDENKCFFKKARKKILECDIIITNHHLLLNDLYIKNEILTEKENYENG
FT                   SEKNYEEINLILPNVKNIIIDEAHYLEEAARTLFSKNFSRIGIKQIFTKIDKIIKKQNI
FT                   NGAYKKNFEIETMLSFENVEYIIKIQKDFPSIYRITNDTHKTDFYIRIKTHLQNIIYNL
FT                   ENYKVSITSIIQNMENKTAKIELERLIKNIEYKESLIKNFISENQYDNFCFWIENKKNI
FT                   PIFKTSGIYLGPELNKIMYKRVKRIIFTSATLMINQSFSYFINQTGLNLINQDIEMEKL
FT                   PYSFPYKEKSILTVTSDIEDPNKAEEFLNQSIQYIKELVILNKGGTLILLTSFKSLEYI
FT                   GKNIKDFLRENNINLFIQGELPKHELINSFKKSPKKSVLIGMKNFWEGIDIKGDKLTMV
FT                   IIPKLPFQTPSDPILIAKNALATKSNENFFTQETLPQAIMKFKQGFGRLIRDSKDYGII
FT                   VCFDKRIFEKTYGKLFLQSLPEIKTYYLNFENIKHTINTFFKEIEQNTNL"
FT   gene            complement(788047..788436)
FT                   /locus_tag="BH0735B"
FT   CDS_pept        complement(788047..788436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0735B"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0735B"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17236"
FT                   /protein_id="AAX17236.1"
FT                   /translation="MTRNNNDNLEQDFKQSLVHSNSKLKEFTKNIYKNIFREEIKKNVY
FT                   SAVLGLVITTISRTNFFKTISAKLTETSTMPEIRGKVYLKMNTAIISNIINMKKMQKES
FT                   LNHKKVKINSAKYIKIYKIINKDTY"
FT   gene            788669..789664
FT                   /locus_tag="BH0737"
FT   CDS_pept        788669..789664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0737"
FT                   /product="histidine phosphokinase/phophatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BH0737"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17237"
FT                   /protein_id="AAX17237.1"
FT                   /translation="MNFLSNMSRPIMILAPMEDVTDTVFRNLIHLIGNGKDVPDIYFTE
FT                   FISVKGLLNKSKQSMQHILTKNDELNRPLIAQIWGKEPDEFFKAIEILSNLGFWGIDLN
FT                   MGCPKKKIVKKGVCSALINNKSLAREIIMASKEACLKFGLPLSVKTRHGFFYSEVEDWL
FT                   GFLLELGIDMLIVHPRLAVNQSEGPIDVAVFHELVKLRDQINPSALIIGNGGILSLEQA
FT                   HQIVREYSIDGVMFGCGIFRNLNLFRKGLSNFLSNNLNYRLNILKLHITDFHSTWSLTK
FT                   DFNKLKKYFKIYFNEDERHSEYFYNIMNSSNYDELFENLSRMDIGDELKQ"
FT   gene            789661..792285
FT                   /locus_tag="BH0738"
FT   CDS_pept        789661..792285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0738"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17238"
FT                   /protein_id="AAX17238.1"
FT                   /translation="MSDELSKNYNPKVFEDKIYQKWLDNGVFSPNDGIESRFSMVAPPP
FT                   NVTGILHMGHALNFTLQDILVRYKRMQGANTLWLFGTDHAGIATQAVFEKQLKDFGKSK
FT                   DDFSREEFVEEIFKLKNKHREIIVNQIEKLGASYDHSRERFTLDAGLSQAVNKVFIDLY
FT                   NKGLIYKGEYLVNLDPGSGSVVSDEEVEYKEVIGKIYFIKYLLDDDTFIEVATTRPETI
FT                   FGDVAVAVNPNDDRYKSLIGRDVTVPIVNRKIKIIADSYVDMEFGSGALKITPVHDPND
FT                   FEIAKRHDLAKINILTKDAKLNENVPIEYQGLSVSAARSKIERDLKDQGFLIDVKSHKH
FT                   QVGYCHRSGEIIEPYLSNQWFVRMKPLADAALKALINGEIKFYPKKWENTYKHWLLNIK
FT                   DWCISRQLVWGHRIPAWYDVKTGEIIVSESDPSLSEEHKERSFVRDPDVLDTWFSSWLW
FT                   PFSSLGWPEITLDFKNYYPTNTLITAYDIIFFWVARMVMAGLEFTGQVPFKDIYITPLL
FT                   RDKKGKKMSKSLGNGIDPLEIIDQYGSDALRFTLAFLSVQGQDLNIDTKDFMFGAKFSN
FT                   KVFNASKFILSNLEGRVVLDRLELDDIDKWLLTSLNSTVAILDWAFKNYKYNEATKAVY
FT                   EFFWNDFCDWYIEISKINLNSDDINLQNMIISKLVFFLKESLRIMHPFIPFITEEIYSK
FT                   LMSLKDVLALEKYPEFISQRDFKEEFHRFNLLKEFIVSIRTLRSEFGIVPNIKINVALK
FT                   FGNTFKYEKYFKEHEHIAKKLINFDCIFYNENYDNMIGVPNVDFESFADIKNLIDTDKE
FT                   LAGLSKQLEKYERLKHATLKKLQNQDFLLNAPGEIIDLEKSKLEEFDSFISKINNYIDN
FT                   LRR"
FT   gene            complement(792437..793114)
FT                   /locus_tag="BH0740"
FT   CDS_pept        complement(792437..793114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0740"
FT                   /product="tRNA (5-aminomethyl-2-thiouridylate)
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0740"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17239"
FT                   /protein_id="AAX17239.1"
FT                   /translation="MDKLIFQGKTIYSSKFGDIYYDPQYGLEESIYVFIKGCDLDKELV
FT                   NLQSITIAELGFGTGLNFIALLKHLTENNLKTKINYYSIEKFPLKKEQIKKISQFFIKD
FT                   IHYFKILLKKYPNTPMKNIKYQITNNINLKILVGDAREKLKELPKYIDYWFLDGFSPNK
FT                   NPKMWNKEIFTIISEKSKIGTKLSTFSAARIVKDGLKLANFNYYRIKGFNNKRHMLKAQ
FT                   KEQ"
FT   gene            complement(793324..793683)
FT                   /locus_tag="BH0741"
FT   CDS_pept        complement(793324..793683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0741"
FT                   /product="10 kDa chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:BH0741"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17240"
FT                   /protein_id="AAX17240.1"
FT                   /translation="MKFQVLSKYIDLILHFSYIYIIKLRRCLKMKNIKPLADRVLIKIK
FT                   EAESKTTSGLYIPENAKEKTNIGTVIAIGSNKEDITVKVGDTVLYEKYAGAAVRIEDKE
FT                   HLILKAKEIIAIIEE"
FT   gene            793740..795371
FT                   /locus_tag="BH0742"
FT   CDS_pept        793740..795371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0742"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0742"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17241"
FT                   /protein_id="AAX17241.1"
FT                   /translation="MIAVSNLEVAFGERVLFKDVNVKFSSGNCYGIIGANGAGKSTFLK
FT                   VLGGTIEPSKGEVAVAKNQRMAVLEQNQFAYDDFRVIDTVIMGHKKLYAVQREKDLIYE
FT                   KPDFSDEDGIRAGELEAEFAELGGYEAESNAAVLLKGLGIEESVHSSLMRDIDAALKVR
FT                   VLLAQALFGEPDILLLDEPTNNLDIQSIKWLEEFLINFENTVIVVSHDRHFLNQVCTHI
FT                   VDIDYGKIQVYLGNYDFWYETSQILNKQLKDAKKRSEEKIAELKTFIQRFSSNASKSRQ
FT                   ATSRKKLIDKIRIEDLKPSSRKFPYVNFKSERDLGKNVITIKNLSKEFEGQHILNKFSI
FT                   VIEPGQKVVFLGSPISASSLFDVITNEDRDYKGHYEWGATVNFAYFKKDNEQYFSVDLS
FT                   LVDWLRQYSKEQDETYIRGFLGRMLFSQDEALKKVNVLSGGEKVRCMLSKIMLSGANVL
FT                   LLDQPTNHLDLEAITSLNTGLQDFKGVVLFTSHDHQFIDTIANRIIEFTPNGIIDRFMT
FT                   FSEYIDDSKVKELRDKLYEGHTSLKL"
FT   gene            795376..797079
FT                   /locus_tag="BH0743"
FT   CDS_pept        795376..797079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0743"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0743"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17242"
FT                   /protein_id="AAX17242.1"
FT                   /translation="MFNHYRMFVVLKVNVCIFIFLGACFSLSADVNLYFQKALTGQVLG
FT                   NPILDERRNTITVLTKDRWLVTYTVSLNKKYSYRLDRTPYPFLLKDFGSGYYVITGRNE
FT                   VQKIRRGKLIWRYNLGVPPIKAPSIGNGYILIPQADGKVIALRLGDGQKVFEANIEGKA
FT                   ATSSVVLENGNFYIANENYKMFAFNSEGEQIWSTELMSFPNALMISTNNEIVVGCQSGD
FT                   VVVYDSDFGDMLGSISLNYPINFLFEKFNGEYIAVSDIGIFFNLSRNFDLMFSENLPLK
FT                   LKEAVLYDNKNLFIVMESNGVLALDEYFKPVDRYDDIKEISGLVSNVGMIATGGFNWIL
FT                   TTYYYEYKDELDFIVWNHTLGNRYHQNRIDFREKSLVDHEDIYLALDEMLNSTYNRKVY
FT                   NKFLSVLDSLVMKYGSFPKKYLNLYRKAINNWLAPKNGVDRIAQRGQLYKYFMYVDDAA
FT                   SVKSFINMAIEEKDINNVIQLVNSIAGFEYYYGQDELVYNYIQYVILNYQGNLEIAYAV
FT                   LLSLRKIILNSTEDNLKRYRSKYLTLLKFVRRQNFSEKINQCINEIIVSL"
FT   gene            797215..799743
FT                   /locus_tag="BH0744"
FT   CDS_pept        797215..799743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0744"
FT                   /product="p93 antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BH0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17243"
FT                   /protein_id="AAX17243.1"
FT                   /translation="MKRIWILFNFLFIFLNIFTFHAREVDKKKLKDFVNMDLEFVNYRG
FT                   PYDSTDTYLQIVGIGEFLAKNLTNNKSNYYSKYYVNRYIDSESEKSSSDVFIIGESSSL
FT                   DSILNLRRILTGYLMEGFNYSKESAELLAKAITIYNATYRGDLDYYSDAYIQPALEGLS
FT                   KHNVGLSRVYSQWAGKTYIFVPLKRNILSGNIESDVDLDKIVTDKVVISLLSENEEVGT
FT                   DFARDLTDVQDEIRDVDQEKIDIESATLKSIDDELTETIDNLREQLERATDDAEKEGIK
FT                   KQIDDKTVKRDALKDKTDGLKKSQKKLDSSQEKLDRQRDAVKDKVQESIDKGNRDKNLP
FT                   KPGAISSPKVDEKLQLIETIEDLEEQLERATDDAEKEIIKKQIDDKLVKRDALKDKTDG
FT                   PKELQRRLDGQRDAAEDKVQEGINKGKRDNNLPKPREVNLLKKDEKLKSASELKNQLKR
FT                   ATDDAEKEIIKKQIDDKLVKRDALKDKTDGPKELQRRLDGQRDAAEDKVQEGINKGKRD
FT                   NNLPKPREVNLLKKDEKLKSASELKNQLKRATDDAEKEIIKKQIDDKLVKRDALKDKTD
FT                   GPKELQRRLDGQRDAAEDKVQEGINKGKRDNNLPKPREVSLLKKDEKLKSASELKKQPK
FT                   RATADISKNIPSVVNNQSRRLPAKPLAFRKQSDQSEGVDKLPLETENQKPIHKPMFLEV
FT                   LNPNTNLGVLRLIDSDGGQLEEASRYGIRRYGVYERKDDFVAIKLCSGIAKLQLLNKAE
FT                   NLKVESEADFELSRDSSLYVDSKMILVVVKDNNVWKLAKFSSKDLSEFILSEDEVLPFT
FT                   SFTVDAGHVYLQDASKKLITLDLNTLKKVS"
FT   gene            complement(799826..799898)
FT                   /locus_tag="BHT0029"
FT   tRNA            complement(799826..799898)
FT                   /locus_tag="BHT0029"
FT                   /product="tRNA-Pro"
FT   gene            complement(799908..799981)
FT                   /locus_tag="BHT0030"
FT   tRNA            complement(799908..799981)
FT                   /locus_tag="BHT0030"
FT                   /product="tRNA-Arg"
FT   gene            800065..800700
FT                   /locus_tag="BH0745"
FT   CDS_pept        800065..800700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0745"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:BH0745"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17244"
FT                   /protein_id="AAX17244.1"
FT                   /translation="MFYNYFMLNIDLIVDETLSRYPDVKPFLTFRNNYELLIMVILSAR
FT                   TTDNMVNKIAPKFFKRYGDFESLANADLIDVKQLIYKLGFYSNKSKYIINCARMILEKF
FT                   KGIIPNNIFDLVSLPGVGRKTANVILGVIYNKPAIIVDTHFSRVVIRHGITFKRTPLEI
FT                   ELDLKSKIPADKQYRFSMAINRHARDICTSRSKTCKNCFLEKFAPRLF"
FT   gene            complement(800720..801571)
FT                   /locus_tag="BH0746"
FT   CDS_pept        complement(800720..801571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0746"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0746"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17245"
FT                   /protein_id="AAX17245.1"
FT                   /translation="MYKLKKLCIISLGIFILFLIIIPELINENSKFAIYKKDPNKTYIQ
FT                   TINKLPQTPTATNPLGTDKMGRDILARLIIATRNSILLAFSYAAISAIIGIFIGIIIGS
FT                   LKFKTCLIISKPIEALQTIPFSYILMLIFYYFAKQENYNILKVAFTLALIHGWIKFSFI
FT                   ARNNTLLIKNLDYVKASKTMGASQFRIIIYHIFPEVFSSISSIIPLQISKSLTTFEVIN
FT                   FLQQKDKSYYPSLGELLGYIEMGREYAWIWAYPLMILLIINIILTFISSKLKKHMKYFI
FT                   SS"
FT   gene            complement(801571..802518)
FT                   /locus_tag="BH0747"
FT   CDS_pept        complement(801571..802518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0747"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0747"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17246"
FT                   /protein_id="AAX17246.1"
FT                   /translation="MLLNAIISTFFCISLINIFSNDNSNIPFIQKNIFRDYLEYIGILK
FT                   SIESYKLTYDFDPNVPLDNDHFAKHIEGSLYIVYKTQYKGLIWGTPHNSPLTKGKSPMS
FT                   VIFNKMKNTLKISIPGAVLSYAAAILLILIWTLFVNNKILNNILEYIMLFLHSLPRNLT
FT                   VILITSLLYYLKINPKNLIIGGFAWFFSFFIFNAVIFKQSLDKNLSEFYIITAKSRGVK
FT                   NFKIITLHALIPSLVPLITQLRPTLATAFFGASFIEIMFGIDGIGALTINAIKHNDYIL
FT                   YKDLLFIGVFIRLIPNLITDVLTHNINPYKDVIE"
FT   gene            complement(802566..803006)
FT                   /locus_tag="BH0748"
FT   CDS_pept        complement(802566..803006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0748"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17247"
FT                   /protein_id="AAX17247.1"
FT                   /translation="MFLIKKIMLSIYTGVISYFIITPIFGETGIVNYKKLNSNLILMKE
FT                   HTEKLKNIQKTLKTKYINLQISKPAILREASKLGYYPKNSTIIKSLDKNENYYQGNILN
FT                   IKHSLENKNIDKNFYLISIVISLISYFLLSYFDKIKTLHKGR"
FT   gene            803114..804706
FT                   /locus_tag="BH0749"
FT   CDS_pept        803114..804706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0749"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17248"
FT                   /protein_id="AAX17248.1"
FT                   /translation="MTNHKNSFFIKAGPSEVDFDMDSVFLQHSVDGKIVSLRSDEIKDL
FT                   LDEKLLKLDYSLAQRHGELVNYLRKVEGRISRVEDEILGRNLNFLEEFDNPNLKSMNLM
FT                   SSQSEANVKDNEFGELVRKENNLPNISLDQEELDALLEGLNEISRDDKKSFSSNNNLEN
FT                   DSDVGISFEDAPKNELNGLGIEHNLSAQAENNMHNVVDALSNKEDREPLGVDLITSQDN
FT                   DLLGKSSFGAANIVNGDGSKGQDLMINLDGDDKVLREPIVGKSSLGVDLEIENNVHSGD
FT                   FVLNEASFNVESVQEENISSYEQDDLRGHEHPLDDGLSEIEYSAENLEDLNREEFKEGN
FT                   EELSDVNDIIAHEIDNVDVNLSGDVLLHEVNDGIDSSVLKQKQEIDNVSSGLKKLDNFE
FT                   DVLKADLNCMDLQGCIKDFEEKNLYDTDISDLEEKLGQDEGLDSYTSKEQEIRDDNDTS
FT                   DFSFADVETIINKFNDNEYLSKIKLSCEERAVLVRFISRLEGDLDSSPKGNSFKIKKEY
FT                   EILQKIKRLLVRE"
FT   gene            complement(805216..806226)
FT                   /locus_tag="BH0751"
FT   CDS_pept        complement(805216..806226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0751"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BH0751"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17249"
FT                   /protein_id="AAX17249.1"
FT                   /translation="MDNKKILIGMKENIKIIIIVILTSTFLLGIIFSNQNQVTKLLEEK
FT                   FFAIDFNQTAKIETELDGTIIKSGKGWELQYNDIKLPIDEQRVNSMIQDIEKLQKNKLV
FT                   SRDPKKHKELGIKESPDFKLFDDKNNLLTEIFIGNSGEGDSRLSYIKGSDANVYLTNNI
FT                   FLSYKGNSYNTFANTKLFKEKDAKIERLSFKVLNKPKKTEEDIIQNDYNVSIQDGLYFF
FT                   NKEVLRKERLLQMIQEFTTDGLEIDKTKINDYNLQYNIEIEWNNKSVNNIDVYFNKDEK
FT                   NRDILMKRDNDVYYYTTNKWSFFDIFNLEKKIKTKDNDSNEDHLKDDTDHHDHQH"
FT   gene            complement(806238..807740)
FT                   /locus_tag="BH0752"
FT   CDS_pept        complement(806238..807740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0752"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0752"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17250"
FT                   /protein_id="AAX17250.1"
FT                   /translation="MKNKHKEILNLTLNLTIIFLLFCNISILVFKIDFTKNKAFTISKV
FT                   TKDLFSNANEKIYVTYYNSASLGNYFAFPDQIKNFLTSFADSSSGKVIYREIDADKLTT
FT                   PLEQIGIPAQQIDLREINQLSILKIYSGIEIIYESKREVLPIVTEISNLEYDLASSLDK
FT                   LINNTKKVLGVAFGDAKLKATHKNFIEIMQKAFKTEVKEINLSNEQLKDINGLFIIGSK
FT                   EINEEILKKIDEFIINNGKVLLATSKIDYDPQSPYTTTPIKSALFNLIESYGIKYNENI
FT                   ILDKRAPSLFLGGNFQTYYPWILIDKSNIIDPNNPLLKNFYDAIIPWTSSLDLIEAKDG
FT                   GEIKYLPLFASSRESWQVNDEEVASIAMHSFNVPKTFNKEDKQKILGYSVEGQIKSLFN
FT                   DKKSENSKIILLGSSMLFSDYMYNGSPSNFELAGRISDYLMQKEAFFSIKSREVRSKLK
FT                   FINSSKEMLNAKFSLILINLIILPIAIIIFGLSRFTKKRRIN"
FT   gene            complement(807748..808482)
FT                   /locus_tag="BH0753"
FT   CDS_pept        complement(807748..808482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0753"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0753"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17251"
FT                   /protein_id="AAX17251.1"
FT                   /translation="MKIDLRQSLALSKKELKVLFGTLTAYVVMLFFLIFVNFSFIFLSG
FT                   FFIKDNASLMSYFSSMPIILMLVLPALSMGVFSEEHKTGSIELLYALPISPQEIVLGKF
FT                   ITLKIFTLILFTLTLPLTIMTIFMGEFDLGIIFLQYLGIILYSCSVLSMGVFISSITKS
FT                   QIVSYILSVFILIIIVFSGKLVMIFGKDNIFGQILNFISITNHFSYFNMGILNLADLIY
FT                   FITFAVTFLMLSSYSIRLKKWR"
FT   gene            complement(808479..809405)
FT                   /locus_tag="BH0754"
FT   CDS_pept        complement(808479..809405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0754"
FT                   /product="bacitracin transport ATP-binding protein BcrA"
FT                   /db_xref="EnsemblGenomes-Gn:BH0754"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17252"
FT                   /protein_id="AAX17252.1"
FT                   /translation="MINVKNITKTYGSFTALFNVSFKVNEGEVLGILGPNGAGKSTLIK
FT                   ILTSFHYPNKGNVKIFGKDIIENSKEILQNVGYIPEKLALYPELSVKEYLNFISEIKGV
FT                   ENPKKEIDKAIGIFKLESVKNKLISTLSKGFKQRVGIAGALINNPKLIILDEPTNGLDP
FT                   NQIIEFKEFLKELAKTSTILFSSHILSEVESICKRIIIINNGEIIADDTKENIVKNRLK
FT                   ETELDLIIYKDSGITKEHFSSNDIFTSIKVEEYEQEINVSLRLAPDKTEKELFNYVISK
FT                   GMILKAMIPKHESLEKIFSKLTKERKQ"
FT   gene            complement(809427..810386)
FT                   /locus_tag="BH0755"
FT   CDS_pept        complement(809427..810386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0755"
FT                   /product="metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0755"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17253"
FT                   /db_xref="GOA:B2S197"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S197"
FT                   /protein_id="AAX17253.1"
FT                   /translation="MNFNINILGTGGTRPLHNRYLTSVLIEYHGESFLFDCGEATQMSL
FT                   RKQKISWQKIKVICITHLHADHITGLLGIVMLMAQSGDTRKEPLTIIGPIGIKKYLDAN
FT                   IELLRVHKNYDIIYKEIIINKTEPILYEDKKKRIEYIKLKHSIECVGYLFIEKDKPGKF
FT                   NTQKAESLNIPKGPIRKTLQEGHEVILNGKKILPSEILGESQKGLKFAYITDTAYFEEL
FT                   STHIKNFNLVIIESTFKNDLKDEAKKKLHLTAKLAAKITKKANVYQTGLIHFSERYTLN
FT                   KDLCELLDEAQQEYPNGEIFLTKDGMRLKANKDKFIIK"
FT   gene            complement(810708..811769)
FT                   /locus_tag="BH0756"
FT   CDS_pept        complement(810708..811769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0756"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:BH0756"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17254"
FT                   /protein_id="AAX17254.1"
FT                   /translation="MEYEFAVIGGGIAGSTLTYEILQRKKSVILFDNGDCKATTVAGGL
FT                   INPIMGRKMNIAWREPEIFAFAIQYYKEMEKNISCNFLKENPIFRPFTTKTQQEELILK
FT                   MKNDENLKEFILAIKNGKVYDFSNDNDGGILIKGATINTNLYIQTLKKYFIKYNSYIEA
FT                   EINENEIKANDKFFTINGFKFKKLILTRGHKEKITGFFSYLPFKLAKGEILIIEIQGLH
FT                   LREIYNRHVSLIPLQDNKFYLGGTYEWETLDTSTNEWAKKELLDKLKKITNLNYKIIQH
FT                   KAHIRPSTLDREPFLGEHPKHKNIFILNGFGTRGISMAAYLSKNILDYIERKSNLPTYY
FT                   DIKRYENLYNSLR"
FT   gene            811987..812577
FT                   /locus_tag="BH0757"
FT   CDS_pept        811987..812577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0757"
FT                   /product="ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:BH0757"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17342"
FT                   /protein_id="AAX17342.1"
FT                   /translation="MDFKDMKMQTEIQQSLEFALKSRSIVITGEINKDTSKLFQEKILF
FT                   LEASDCDKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTIGVGLVASAGALIFLAADS
FT                   NSRFSLPHARYLLHQPLSGFKGVATDIEIYTNELNKVKSELNDIVAKETGQELNKVEKD
FT                   TDRDFWLDSESAMQYGLVFKIVTTRLELEKFIS"
FT   gene            812423..813280
FT                   /locus_tag="BH0758"
FT   CDS_pept        812423..813280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0758"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17255"
FT                   /protein_id="AAX17255.1"
FT                   /translation="MILLQRRRGRNLIRLKRILIGIFGWIVNLQCNMVLSLRLLQLDLS
FT                   LKNLFLSFLMLSCSLSKRDFSILEFGVTSFPKNFISLNTLVDVAYNMFFSDFDLVLIKD
FT                   LSKEELDLINNKVSFASFKNAYFIRQNNNSSIGILAKEKIKIQILDFIEGFYEYRLGVV
FT                   VDFIFKDRHYGIVVFNFDEDIADNLDIAIVDEQITYLNHRYENLLFILDKRELSVLDIV
FT                   IRNGYFSLIYDSINPMHIINTIDDRVYSNFVAQIFLHSLDYVILSYLYDNFYINNFPKS
FT                   IVIK"
FT   gene            813340..813423
FT                   /locus_tag="BHT0031"
FT   tRNA            813340..813423
FT                   /locus_tag="BHT0031"
FT                   /product="tRNA-Leu"
FT   gene            complement(813405..814289)
FT                   /locus_tag="BH0759"
FT   CDS_pept        complement(813405..814289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0759"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0759"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17343"
FT                   /protein_id="AAX17343.1"
FT                   /translation="MISVYIKGLLIGIASIIPGVSGGTLALILGIYYKIIHSSANLIKL
FT                   KRVKESIIFLGILSLGILTSATILAKIFKNYILDGATRETYLNALFIGLTTGSILTLKK
FT                   EINIKRNKYKITKYFLFLIGLLSILFFLMLKTYDISSNISEYQDKTSIKYYLLIASSGI
FT                   IGGCAMILPGVSGSLILLSLGTYKEIVNIISQLNITLCTIFGISTIMGIGITILIIKKT
FT                   IDKHLVKFLYLSIGLILGSIIQMIFVITKLNVHPTLMLNLSLSTLFITGIYINKLLEDR
FT                   FSNFKTLNTENRT"
FT   gene            complement(814323..814652)
FT                   /locus_tag="BH0760"
FT   CDS_pept        complement(814323..814652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0760"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0760"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17256"
FT                   /protein_id="AAX17256.1"
FT                   /translation="MELNEYQIKAKQTAKYKNKKEELILTTLGLAGETGEVVEKIKKLG
FT                   RDKEYVLDDEYLLAIKKELGDVLWYISNLSNNLGITLEDVAITNLEKLKKRHENGTING
FT                   EGDER"
FT   gene            814762..815649
FT                   /locus_tag="BH0761"
FT   CDS_pept        814762..815649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0761"
FT                   /product="cell wall endopeptidase, family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:BH0761"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17257"
FT                   /protein_id="AAX17257.1"
FT                   /translation="MGKFALLLEVVFFFLQLDYVCSYPVIKNFSNKDPIFHDLRAKIAK
FT                   YNKRESVPLFIYSYKVKEGDTFFKIANKVNGWQASISTINLLDSPFLRAGQDILIPSKK
FT                   GLFIFNNKEHRFNNLLLATRDLTKAEKIKVRKNNKIYEFYFFDSMKQPELSFFSSTEML
FT                   FFLNSEFIFPLKRFIISSDFGFRPDPFTGMGSFHTGIDLAASMNSLVYCSSYGVVVVVD
FT                   YNDIYGNFVVVEHKNSIKSLYGHLSSYIVRKGDVLKTGDIIGRVGQTGRSTGPHLHFEI
FT                   LKKDAPINPIKILK"
FT   gene            complement(815896..817251)
FT                   /locus_tag="BH0763"
FT   CDS_pept        complement(815896..817251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0763"
FT                   /product="sigma-54-dependent transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BH0763"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17258"
FT                   /protein_id="AAX17258.1"
FT                   /translation="MSKLLVADDEKNIREGIATYLEEEGYFVFTASDGEEALETIENEK
FT                   IDAIISDLRMPQISGEELLKIVKDKNPNIPFIILTAHGTVDSAVDAMREGAYDFLTKPV
FT                   DLERLLLIIKRALNGKNDRRHENISQENVIIRKDLNYYERIFGRSLIMQKTLELVKKIA
FT                   KSKASVLITGESGVGKEIIADAIFDLSNRNDKPFIKVNCAALSESILESELFGHEKGAF
FT                   TGAISQKKGRFELADKGTIFLDEIVEISPELQVKLLRVLQNKTFERVGGETTMQVDIRL
FT                   LTATNKNIEEEIKKGRFREDLFYRLNIININIPPLRERKDDIPNLTKTLIKDVASENNR
FT                   EEKSLSNDALKALYAYDWPGNIRELKNVLESALILSKGKQIARDDLPPKIRNNTNQIVK
FT                   ITLPIGISLKEAEKEIIKQTLLHSKNNKSKCAEILKIGRKTLHNKIIEYDIS"
FT   gene            complement(817244..818404)
FT                   /locus_tag="BH0764"
FT   CDS_pept        complement(817244..818404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0764"
FT                   /product="nitrogen regulation protein NtrB"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0764"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17259"
FT                   /protein_id="AAX17259.1"
FT                   /translation="MSKFLKKTLTKLNKLSSDQKLKFIQDIYKKIEIYDGIFASINEGI
FT                   LVLDKLNNIIYLNKMLFQILAISPKYKLETLKDIQIPTLTNLIEELATNEDKIIGFEVQ
FT                   VSTNIYIKISFMPYVIDQKLEGNIILIEDIKDKKHKEELFRRAEALAAFTRHARNIAHE
FT                   IKNPLGAIDINLQLLKKELDRQGIKSIKANNYFKIIKEEINRMDKTVTDFLLTVRPIKI
FT                   IPEKKDITDIIKSVYNLLNPELRNKDIKFILNLKKVSLVLIDEKLIRQVIINIVKNAEE
FT                   ALLESNKKIKRIEISIHENEEKIYINIKDNGNGIKNETKDDIFKPQFSTKESGSGIGLT
FT                   ISYKIVKEHGGEIFVESKEMKGTSFTITLPKLNTGKILIEGCLENE"
FT   gene            complement(818404..819447)
FT                   /locus_tag="BH0765"
FT   CDS_pept        complement(818404..819447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0765"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BH0765"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17260"
FT                   /protein_id="AAX17260.1"
FT                   /translation="MERLPDIAQEIINEYEKGNLPNAILFWGERFSYKKTTAIALAKRI
FT                   LNTKILTNPNLIIFSSLNIIEAKAYLNVSSNEVMSKYLEYVKNIIFTKYNFSNDKNLKK
FT                   IEININFINDIYYKNEYNETTTKELIKKIEEIIKDISFNITINDVRKIKFWALSEKHKI
FT                   KVIYINEIENLNFNVYNALLKILEEPPLNIYFILATRNKNKIPKTILSRLRVYKFRKEN
FT                   RDFEIAKFKATFNKNDELTTEEYFNSFYSEEHTKLKEEIKRILNIIKEKQGIFNLDTFN
FT                   FLKDDNTFKLFLQELTSQLRDEFLSQNLDINTYLKRLEYLKHILKYSPYNQNKKLIIEN
FT                   LMLNYED"
FT   gene            complement(819462..819950)
FT                   /locus_tag="BH0766"
FT   CDS_pept        complement(819462..819950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0766"
FT                   /product="colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0766"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17261"
FT                   /protein_id="AAX17261.1"
FT                   /translation="MLVNDPFKITGIVDILIIIIFISLGLRGFLRGFIKEIAGFFEIFT
FT                   LIFLLYNKTNDFKILISPILDLSYVQALLVFFLVIHIGFLILQALIESIISHLKLLFFN
FT                   RMLGLILGLFEAFGIIAIVVYIIYSQQIFNPNYFLEGSKFLEYLNPGINYLFKISKTQ"
FT   gene            complement(819940..821028)
FT                   /locus_tag="BH0767"
FT   CDS_pept        complement(819940..821028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0767"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:BH0767"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17262"
FT                   /db_xref="GOA:B2S1A8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1A8"
FT                   /protein_id="AAX17262.1"
FT                   /translation="MNTKKRIFFTGGGTGGHVFPGIAIISKLKELDTNIEFFWLGQKGS
FT                   MEDNIIKEHEYIKFIAIPSGKLRRYFSLQNFTDVFKVIFGIIKSFFIIKKYKPQIIYAT
FT                   GGFVSSPPIIAASLLRVKSITHEMDLDPGLATKINSKFASKIHISFKESTKYFKNKNVL
FT                   YTGSPIRKEFSNPNPNIITELTQNTKKPIISIFGGSLGAEVLNKLTLNIKNKIDAYFIH
FT                   QCGKNLDATRENNYLRSQFFNAEEMASIIKFSNIIISRAGAGAIKEFASAGACVIFIPF
FT                   VKGSRGDQVRNTKILEEQNACLKIDEENLSESQIIDMIKEILTNKEKFDILKNNIKKFH
FT                   NQDSSNLIANLLLKDFEDINAS"
FT   gene            complement(821268..822062)
FT                   /locus_tag="BH0768"
FT   CDS_pept        complement(821268..822062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0768"
FT                   /product="pyridoxine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:BH0768"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17263"
FT                   /protein_id="AAX17263.1"
FT                   /translation="MKRVLAMHDISTMGRTSLTMCIPVISSFNMQVCPFVTAVLSATTA
FT                   YNEFEIIDLTNNLEKFIYSWKDQNESFDIFYSGFLGSNNQQKIIENMFKLFKFEKIIID
FT                   PVFADNGILYPTFDKKIVSGFRSLIKHADIITPNITELKMLAKTEDIKNKDEIIKAILS
FT                   LEINGIIVVTSVEKENLIGTVAYNTKTKEYKEIFLEKLEQNFGGTGDLFASLLIGYLEK
FT                   WEIEYALEKATKVIHSIIKYSIENNTSKKEGIQIEQFLKNIF"
FT   gene            complement(822059..823075)
FT                   /locus_tag="BH0769"
FT   CDS_pept        complement(822059..823075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0769"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:BH0769"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17264"
FT                   /db_xref="GOA:B2S1B0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1B0"
FT                   /protein_id="AAX17264.1"
FT                   /translation="MIVLGIESSCDDCCAAIVEDGVKILSNIKLSQKEHKKYYGVVPEI
FT                   ASRLHTEFIMSVCQKAITNAQIHASEIDLIAVTSKPGLIGSLIVGINFAKGLSIALKKP
FT                   LICIDHILGHLYAPLMTIKIEYPFLSLILSGGHTILAKQNDFDDIEILGRTLDDACGEA
FT                   FDKVAKHYKMGFPGGPNIEKLAKCGNQYAFNFPITIFDKKENRYDFSYSGLKTACIHQL
FT                   EKFKDKNENITNNNIAASFQRVAFENLIIPIKRAIKDTNIKKLIISGGVASNLYLREKI
FT                   KNLEVETYYPPIDLCTDNGAMIAGIGYLMYLKYGASPIETDANSRIENYKYTKGAKL"
FT   gene            complement(823075..823968)
FT                   /locus_tag="BH0770"
FT   CDS_pept        complement(823075..823968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0770"
FT                   /product="cation transport ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:BH0770"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17265"
FT                   /protein_id="AAX17265.1"
FT                   /translation="MNIENASIFLKKHKLKITIAFIIVTSFVSIIVLFSSLVYIKSNAK
FT                   KLNLNFKDRLAKIKKKDLIRVQKKRKTNNLKPEFYLIIDDVGYDEFMLDEFMKIDLNIN
FT                   FSIIPFLPKSMDFYNKLTSKNKITMIHFPMQSKYKNSIEKFHININDNEFAIRKKIEKT
FT                   FQTYSNAKIMNNHMGSLITSNEDIMQIILIKLKEENRYFFDSLTTQESISEKTGKNIGI
FT                   LVEQRDIFLDNKDNEKAVIQALKRAKQIARTKGIVKVIGHIWSKNTLKILKQESENLKQ
FT                   EFEFKNLINLYQREEN"
FT   gene            complement(824015..824818)
FT                   /locus_tag="BH0771"
FT   CDS_pept        complement(824015..824818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0771"
FT                   /product="RNA polymerase sigma factor RpoS"
FT                   /db_xref="EnsemblGenomes-Gn:BH0771"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17266"
FT                   /protein_id="AAX17266.1"
FT                   /translation="MNIFSNEDLNIYLKSVREHRLITHEEEIELAKQIKLGDLKAKNKM
FT                   INANLRLVLKIIKRYAGKGLKVEDLIQEGNLGLIRAAEKYDPSKNTKFSTYASFWIKQS
FT                   LQRALNTKTRLVKVPYRKENLILQINKYLMEEEKSPKKEDIMERFNLTTAQYVKIIPYL
FT                   EKEYSLDKKLEGSENSTLLNLYEDNSFNPESTLEQNSTLKHLNHILETKLNDKERYIIR
FT                   KRYNLDNNDKKSTLKDISSELGISSETVRQIEKRVLKKLREELYQ"
FT   gene            complement(824928..825269)
FT                   /locus_tag="BH0771A"
FT   CDS_pept        complement(824928..825269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0771A"
FT                   /product="flagellar protein FlgJ"
FT                   /db_xref="EnsemblGenomes-Gn:BH0771A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17267"
FT                   /protein_id="AAX17267.1"
FT                   /translation="MINKINLQGLKIKNQIKQAKTLKDKVEKTNQYQNDKKLYEAALEF
FT                   EAIFVNQMLKSMRNSLKKENNLINGGQTEELFEDMLYLERSKQIAKSKSFRLADLIYNQ
FT                   IAKVNNFRK"
FT   gene            complement(825272..826291)
FT                   /locus_tag="BH0772"
FT   CDS_pept        complement(825272..826291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0772"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /db_xref="EnsemblGenomes-Gn:BH0772"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17268"
FT                   /protein_id="AAX17268.1"
FT                   /translation="MPYKRNRIMKKLIILAILNLKIVLSAFAQENQPSKNFSKENNTIS
FT                   QISEQIKLKNIAEIRSTDSYTLTGIGIVAGLTDKGDSLRGKEILNKALNQIGINEIDLT
FT                   NIGSKNIALVSATITINGNMIKGANQNVYIASMLDSKDLTNGILLRTELKDKEGKVLAT
FT                   ASGPIITNYKSKGTGYILNGATIHENKDYTHYNIILKKADYTLADSISKNLTSKNIKNN
FT                   IKSGNIIAIEINEIGLLSEIEKIEIETMPKVLISEQNKIIIASTNAEIGPLILSIERDD
FT                   KNLLNNKNNEKIKIKIQKMKLNEFISKNSDMFSNEELIKIIKAAKKINKLHGELILEE"
FT   gene            complement(826490..827128)
FT                   /locus_tag="BH0773"
FT   CDS_pept        complement(826490..827128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0773"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0773"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17269"
FT                   /protein_id="AAX17269.1"
FT                   /translation="MKTLTSKLVFYLFTINLSQIMPYETCFTISPSKVYFFSKGYSKIC
FT                   NNNNLSQIYIGSHFKQKHIIFEMISYITKDLASKNIYILQFSFDESEINIENKFSTNVK
FT                   FKTIKSTLYKNIPIQKTLVYYAKKFEDYKKHNKINMYIDIIEPIVFAKTDLKAGQSLNE
FT                   YNVYFKYQINTTKHNEILSLNELNQSKYMVLQNIMKNDEIRLNKIQKQQ"
FT   gene            complement(827125..827922)
FT                   /locus_tag="BH0774"
FT   CDS_pept        complement(827125..827922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0774"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:BH0774"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17270"
FT                   /protein_id="AAX17270.1"
FT                   /translation="MMRALWTAASGMKAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLI
FT                   YQTQRRAGTPATEDTVSPLGNQVGHGTKVSATHRIFEQGNLQATNLNTDVAIEGNGFYK
FT                   ILLPDGTYGYTRDGSFKIDANGALVTSQGYKLLPDISFPEGYIKDSITISQEGIISVKV
FT                   DESPEPIELGQMEIVRFVNPAGLNAIGNNIFKETIGSGEEISGTPGSDGMGRLRQGILE
FT                   MSNVSIAEEMVTMIVAQRAYEINSKAIQTSDNMLGIANNLKRQ"
FT   gene            complement(827935..828783)
FT                   /locus_tag="BH0775"
FT   CDS_pept        complement(827935..828783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0775"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:BH0775"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17271"
FT                   /protein_id="AAX17271.1"
FT                   /translation="MVRGIYTAASGMMAQRHRLDVISNNLANIDLAGYKKDLSVHKAFP
FT                   EMLIRRLNDDGLYKLPKGYLETAPVVGKLGTGVEENEIYTSFEQGPLKITGNPLDLALT
FT                   DEGFFVVQTPEGERYTRNGSFTLGPEGMLVTKDGYPVIGEKGHIYLKDNNFKITDQGQI
FT                   FHNTTFEENPKRLVSEYENSWENYELLDNLKIVNFEKTRFLKKQGSSLWNRTEISGQAK
FT                   NIEINSRPKIETGALEGSNVNAINEMVSMITVNRAYEANQKTIQTEDSLLGKLINEIGK
FT                   F"
FT   gene            829011..829580
FT                   /locus_tag="BH0776"
FT   CDS_pept        829011..829580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0776"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17272"
FT                   /protein_id="AAX17272.1"
FT                   /translation="MLTQRLILGVCMSKDVLKIMFLLCFSFFAFAESEKTENKKDGSEV
FT                   LGYWVGYDDTTNVKNSVIYVYKYNDKVYGRILNVIKDGKVHDINDPSGSKVVGFDHLTT
FT                   EGLDFMWGLKYVKSSRKWDKGRIIDPKNGKIYTSEMRVDPKTGNLVTKGKVWIFGRSKI
FT                   WTRAKEDEIPKLDVEGIVPNPPVAEE"
FT   gene            829601..830143
FT                   /locus_tag="BH0777"
FT   CDS_pept        829601..830143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0777"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:BH0777"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17273"
FT                   /protein_id="AAX17273.1"
FT                   /translation="MEISMKDKTEYYDKFIMRVPNFPKEGILFYDITNVLLQAEAYKSL
FT                   MEDAHAFYASRKIDCIAAIESRGYLIGSPLALKMGLPLLLIRKAGKLPRQVLREEYELE
FT                   YGFSSIEIHKDDVKQHSNILLVDDILATGGTLKAAAMLLKKAGGVVSDIFCFIELVKMN
FT                   GRDILREYSLNSLVRYF"
FT   gene            830239..830562
FT                   /locus_tag="BH0778"
FT   CDS_pept        830239..830562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0778"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0778"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17274"
FT                   /protein_id="AAX17274.1"
FT                   /translation="MIVMYALLEIKGKQYKAVMGEMLKIDKIGASEGDKLEFSSVMLVN
FT                   KDGDVKIGKPYVAGSCVKCSYIEDKRDKKVISYRYRRRKSSERKIGHRQSYSYVLVDDI
FT                   IVS"
FT   gene            830562..830894
FT                   /locus_tag="BH0779"
FT   CDS_pept        830562..830894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0779"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0779"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17275"
FT                   /protein_id="AAX17275.1"
FT                   /translation="MINVLIKTRNNIIIYILANGHARGNNYINIVCSSFSFILRTFLSV
FT                   LDCEKEDFIVDNSLRGYLEFKASFRSLDKQSLFYYSKFLIQGVKDLCFEYPYDIKLILE
FT                   ETSGNK"
FT   gene            830881..831126
FT                   /locus_tag="BH0780"
FT   CDS_pept        830881..831126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0780"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0780"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17276"
FT                   /db_xref="GOA:B2S1C2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1C2"
FT                   /protein_id="AAX17276.1"
FT                   /translation="MATSKSGGSSKNGRDSISKRLGVKRSGGQFVRAGEIIVRQRGTKF
FT                   HKGKNSGLGRDYTIFALKDGIVEFKTYRGRKYINII"
FT   gene            831149..832132
FT                   /locus_tag="BH0781"
FT   CDS_pept        831149..832132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0781"
FT                   /product="GTP-binding protein CgtA"
FT                   /note="probably involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BH0781"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17277"
FT                   /db_xref="GOA:B2S1C3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1C3"
FT                   /protein_id="AAX17277.1"
FT                   /translation="MHILKDSLSITVSSGDGGAGCVSFLRERFNTKGGPDGGDGGRGGD
FT                   VIFKVKANLKSLSLYKNGQRLAANNGKPGMGSRKSGASGEDLVIFVPPNTCIYDVATGS
FT                   MLFELQNFDDEVIALKGGRGGLGNVHFKSSTKRTPRFAQPGESGATLNLRLELSLIADI
FT                   GLVGFPNAGKSSLISTITASKSRVANYPFTTRFPHLGVLKASYNDLVIADVPGLIEGAS
FT                   QGIGLGFEFLRHISKTKILVFLIDVASDNFMSAYDILVNELSAYDIGLSSKKRIIVANK
FT                   LDLEGAIENFNQLKRALVGERVLGISIYDNTGINELVSELFALSRI"
FT   gene            832224..832796
FT                   /locus_tag="BH0782"
FT   CDS_pept        832224..832796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0782"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /EC_number="2.7.7.1"
FT                   /note="nicotinamide-nucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0782"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17278"
FT                   /db_xref="GOA:B2S1C4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1C4"
FT                   /protein_id="AAX17278.1"
FT                   /translation="MRIAILGGTYNPVHIGHMFLAKELEHFLNVDKILFIPTHKPVHKR
FT                   VENISVKDRIAMLKLAVQHEKNMFIDECDIVNGGITYTVDTIACIKNKYVHDDIYLVIG
FT                   DDLFESFDSWKNPEKIVESVNLVVVHRIYSERLISRFKHTYIDNRIFPISSSEIRHRIE
FT                   QGLPVDYLLPFDVLRYIKNNNLYVKGK"
FT   gene            832797..833981
FT                   /locus_tag="BH0783"
FT   CDS_pept        832797..833981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0783"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0783"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17279"
FT                   /protein_id="AAX17279.1"
FT                   /translation="MRKELFFLVLIILIVCGIVIFFVDSSKREQIYFELNTKSNISFLF
FT                   LIEDESDNLLSMQEIFINIKTGSVGFLDIPVYTGYEDLKGNVSWFEDLYKKNRFVEFLS
FT                   KVSRQLNHEPDYYIRFKKNNFVKFIDYLGGVRLLVKNPVKIYSLVRSILIPSGNSVFDG
FT                   DKSYDYLSYFRDVASYDERSEFFKEFFKKILTQFSDFKEEYDYFSKMYFMLETNLSETV
FT                   FKYILTNYKINNERLIFINIKGQEETFKDNDDNLIKVIFPYYGGAVLKESIENLNRDLM
FT                   GETRNEEAIRVVVLNGTKTAGLAKNVADIFKSFKFKVVRFGNADRHNYSHTLIINNSDN
FT                   LEIAIKVGDVIRSRTIKPISEFRVDTLGLDMPDMSPDVIIILGDDFDGRYVKNR"
FT   gene            833947..834306
FT                   /locus_tag="BH0784"
FT   CDS_pept        833947..834306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0784"
FT                   /product="iojap protein family"
FT                   /db_xref="EnsemblGenomes-Gn:BH0784"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17280"
FT                   /protein_id="AAX17280.1"
FT                   /translation="MILMGDMLKIDDIKKLCKIISDFGGIDVLSIDVSSVCNWADFFII
FT                   VSCSSFKQMEALHAERLVTFFKERDFNYCIQGKGFIYDWTIISCEGLVIHLMSEKAREY
FT                   YELEKIWDRGEVIYP"
FT   gene            834406..834696
FT                   /locus_tag="BH0785"
FT   CDS_pept        834406..834696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0785"
FT                   /product="stage V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:BH0785"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17281"
FT                   /db_xref="GOA:B2S1C7"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1C7"
FT                   /protein_id="AAX17281.1"
FT                   /translation="MNITDVRIRRVDNKNPGSKLLAYVTVTFDDCLVLHNIRVIRGQKG
FT                   VFIVMPNRRTKVGEYKDIVHPINQSFREILQSAIFKEYVKENPSSLELEIG"
FT   gene            834760..834831
FT                   /locus_tag="BHT0032"
FT   tRNA            834760..834831
FT                   /locus_tag="BHT0032"
FT                   /product="tRNA-Gln"
FT   gene            834855..835403
FT                   /locus_tag="BH0786"
FT   CDS_pept        834855..835403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0786"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0786"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17344"
FT                   /db_xref="GOA:B2S1C8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1C8"
FT                   /protein_id="AAX17344.1"
FT                   /translation="MDSSRILRYEGRLDFGSLRARRIRAESEIPAVVYGKESDVLHIKI
FT                   KSSEFNNKFAKFTDNTVLILSDGKIEKCVFIKDVSENLTKRLIYHVDFYEVDKTKDIER
FT                   DIAIKFVGASVGVKEGGTLSVLRTKIKVKSLPLNLPEFVEVDLTPVKKGDQVTFKDIVL
FT                   PDNVKLSEENENSVVLLVK"
FT   gene            835410..835976
FT                   /locus_tag="BH0787"
FT   CDS_pept        835410..835976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0787"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:BH0787"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17282"
FT                   /db_xref="GOA:B2S1C9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1C9"
FT                   /protein_id="AAX17282.1"
FT                   /translation="MDLLIVGLGNPGSNFFHTRHNVGFELVDNLVIKNGLSLKKVKNYE
FT                   YSDFNFENKRIVLIKPLTYMNLSGNIFPSVFAKFYMKIANLLVVVDNVDLPLGKCKLRK
FT                   VGGTSTHNGLRSISLSLGSTNYGRLYIGVGSNNESSLREFVLAKFRGSELERIKSVFEF
FT                   LSEEILGIDESNFEHKVATINSSSF"
FT   gene            835973..837292
FT                   /locus_tag="BH0788"
FT   CDS_pept        835973..837292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0788"
FT                   /product="tRNA(Ile)-lysidine synthetase TilS"
FT                   /db_xref="EnsemblGenomes-Gn:BH0788"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17283"
FT                   /protein_id="AAX17283.1"
FT                   /translation="MMFWNDIVTKIESFYFKNSLPKGKSIVAFSGGADSTTLLLGLKEY
FT                   LNNNIVAFYFAHYIRPEFEQNLEIEHIKKFCNFHNITFQIKRCSVDIKRESSQLGMSVE
FT                   ELARKYRYNALLEALKENEARYIALAHNKNDQFETLVMRFFQGSFLDGFSGIPIINGNI
FT                   IRPLLEVSREEIEQFLSLNNIVYFVDSTNHEDLYLRNRIRNNLMPVIGKIFKGYERGLE
FT                   RISDFSSDLVDYFDKKDFLPYSKGNYYYSFDAMTFFSLPKYLVFRSIFKILNLEGIVSN
FT                   LSYGALNEIFRVNPANKRSKILLRTNEFFLEKRQDKVNLIFRRDEEMHEPFDFFLRVNE
FT                   YHSLSLGKILLKYLECEDNSIPTLRCCSYEFRHSFFKNKLQSKRFFSKFVRYNPLYLML
FT                   LVLNDKIIGIIDLNTLNLMWSDKSIIKKINISLFGGFLKE"
FT   gene            837289..839196
FT                   /locus_tag="BH0789"
FT   CDS_pept        837289..839196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0789"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0789"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17284"
FT                   /protein_id="AAX17284.1"
FT                   /translation="MNINNNNLNNNGKSNNKKKNKNWILILVIVFLILAIFMSYFMRGG
FT                   ENYKNVPYSTFQTYLDSGLIESAVIIDKSQIQFIVKNSNLGKSYFSTSIPYFDLNLLSE
FT                   LKAKRVEVSSGKSQSSLIGVILQTLPWILFFVFFFFIFRQTQGGGGKVFSFGKSNAQKY
FT                   EAGKNKVTFKDVAGQEEAKQELSEIVEFLKYPKKFEKIGARIPKGVLLVGSPGTGKTLL
FT                   AKAVAGEAGVNFFHMSGSDFVEMFVGVGASRVRDLFDNARKNVPCIIFIDELDAVGRSR
FT                   GAGLGGGHDEREQTLNQLLVEMDGFGTYTNVIVMAATNRPDVLDSALLRPGRFDRQVTV
FT                   TLPDIKEREAILNIHAQKTKLSKEIDLRVIARATPGVSGADLANLINEGALIAARNDQS
FT                   EILMHDLEEARDKILMGVAKKSMTITDRQKLETAYHEAGHALLHYYLEYADPLHKVTII
FT                   PRGRALGVAFSLPREDRLSINKNQILDKIKICYGGYASEQINLGFTTAGVQNDLMQATN
FT                   LAKKMVTEWGMGEDVGPIFLVDDESPIFLPKEFSKAKAYSENTADRVDREVKRILEGCL
FT                   KEASDILMKHKDQLVKLAKALVARETLTDNEVRELLGFEIIESDHEKSLKEPKLETVNV
FT                   "
FT   gene            839218..840696
FT                   /locus_tag="BH0790"
FT   CDS_pept        839218..840696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0790"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17285"
FT                   /protein_id="AAX17285.1"
FT                   /translation="MVVLKIMFLLLFLVNLDAKLKERDKDISEILFIKAKSFDGTQRGL
FT                   DMIYGSLEFSLKNSDSLYELSLRNDISLLDRIYLLKAAIDINNFAFVKPRALYYQYFSL
FT                   ILSQNEDIDKNREIIDIYDKLDSDLQNDKDLIYMRLEASSRLGDFKGSFSKVLANSFAV
FT                   YSDDLRFFKWFLKEDKFFPSLFSKLKLKEDSFFNSNNIDFIFKNTTLNEPNSVALFTFL
FT                   KNKSKKLNGVQSIYLLKYKLLTPDEAYLFFKESPPEIIGEYKMFYDLLRDPIIRDEFLS
FT                   RYKNLSGMYFVNDKNNAAVFENGVLVSFFSKIVDYSTDVNLGEKYFNKVDFKDKVPVRY
FT                   ENDLLGYKVSYSVYPYVSMIEVDYPDKKNVYTFALNSFRYEIFDGFGYKFDYVGINEFL
FT                   VANVPEIFLPSMLSLNPKRVSVLNIQKSLIEKKTFNNSDVIEVKNYSFGDLISVYRKIN
FT                   GSKKFNYVEIYDKGVLKVKRVILDDSFDIYHNVN"
FT   gene            840710..842350
FT                   /locus_tag="BH0790A"
FT   CDS_pept        840710..842350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0790A"
FT                   /product="protease HhoB"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BH0790A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17286"
FT                   /protein_id="AAX17286.1"
FT                   /translation="MMHRKIFIIFMLIFSCSTIKDIDDKRIYYIPSESINKHIEKNNFE
FT                   IALSSYYNLKNSGFKMDQGILDLRDKALSGIQNEYFKFCKEKDYESALFKLETLNLFGI
FT                   MLHESREQLILKHLESLKRKDPMLASFFAKYYSFDNTFDSLKKFVINKKSPSRNVLLDT
FT                   AVLTVWVDMGTKIVNGHRLPNIAVGSAFVVDNLKGYALTNYHVISSQVDNDYKGVSNLY
FT                   VRLPRGKGEKLPAKVISYSKKMDLALIKVSFKLEHQFNLNYSSNINIGDRIYAMGSPMG
FT                   FEKTITSGIISGKNRNLLSVGDSYQIDAAINQGNSGGPVVNEGGEFVGLTFAGILHSQG
FT                   LNFVIPSKWVLKVLPFMYEGGILRNKWLGFTFSESLKNLEISYIAPNSPADIGGLRSGD
FT                   SILSVNSLKFDSLRELQYYILQRRSMVRIRYRRDNKEYESYLYPQDRPEDIIESIVESD
FT                   SFKNLMGAFLGLNLNLISGREYRVAKVFSNGLGDELNFRANDEIFVYSFNYLMDKRLFV
FT                   LLLYVKRLFSGYLGAPLQLVIPFDSLIFV"
FT   gene            842383..843489
FT                   /locus_tag="BH0791"
FT   CDS_pept        842383..843489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0791"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BH0791"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17287"
FT                   /protein_id="AAX17287.1"
FT                   /translation="MSFYLKLVSGDTESKLDNIVSISHFDFQDNLNLMLIIGPMGSGKT
FT                   EYAAKIYKDSLIIKNKSPKVLNSITKGRRNRANVFFIRNILDKKRFKNYPLNVIPYRGG
FT                   GSDRVDGVDFAGSSFDVGQLIDENPEYGTFIIDETCFYDERLVFILNKIALDSNVLFIL
FT                   PTLLYNFRKEMFNNTAKLLIEYSDKICRLGAYCEHVDCMDESFLTYRYYFYGGKEIAAP
FT                   YFDPLLIVGGDEIVESAIYPNYATRCSRHHYLVGREYFFTVLKPFALLYAQGDKKLLER
FT                   EIVDLSSNARNANFENSLLIESRGRYDIAVLENLLKLPFLAERALITLSLECNILSKRN
FT                   LKELIDKFSLSKDYIQKVIVSKEHKWIF"
FT   gene            complement(843496..844113)
FT                   /locus_tag="BH0792"
FT   CDS_pept        complement(843496..844113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0792"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17288"
FT                   /protein_id="AAX17288.1"
FT                   /translation="MFYKNFFVLCLVIFSILLITNINASSKFFYAEQWYVIFNEQMKKT
FT                   PDDYKRNIFFLQNALKYPFGNPNYSLSKVETREEWNKYKLLFKMHVNLLLVKQHLYLGN
FT                   LFDTRHTYFYKTPKKKGILANLNQATNFYKLAASYYTEALKYHEQLHKYKFTKMQSDGI
FT                   TNWEDEYHRIEMKELNYYDIIKRELIRIEKTKEFFQKRPNYY"
FT   gene            complement(844145..844783)
FT                   /locus_tag="BH0793"
FT   CDS_pept        complement(844145..844783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0793"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:BH0793"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17289"
FT                   /protein_id="AAX17289.1"
FT                   /translation="MLKTSKEIIFVNKILKNFYCIEGIDGSGKTSIIQKLQKLCNNKLK
FT                   YHFTKEPSQGIIGKFIRKQLTNLKNPLRRVSLAHLYAADRYEHLYNTKNGILEILNKGK
FT                   TKVITDRYLFSSIVYQGELGYKLNRDFPLPEKLFFIKTDPSIAYKRIQENRIQADLFEF
FT                   EEAKFKDISSRYTEMLKIFDDLIDIVYIENLTKEDLETSTIKIFDLIKF"
FT   gene            844816..849216
FT                   /locus_tag="BH0794"
FT   CDS_pept        844816..849216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0794"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0794"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17290"
FT                   /protein_id="AAX17290.1"
FT                   /translation="MHRYMNLFFVRNKITLSFIFSILVFISILVVFILFIQAQVYSARF
FT                   FVISYLESKSGLKIKYDKIAPYFLSSIKIDNLELSLNDKDKILMNTVKVNLDLFRLLLG
FT                   DKNIILDVFVRGSTLNFDLNDFKFLKSQNSHSHTLKLNADGTNRGVLGKMFNSFNSLHM
FT                   HLEDIDMNLKLTSEKFVRFQIKSFALKTIDDDFLFSFIVDFSSLAVLNSDVSHENILDS
FT                   TFYFEGKFKKDLEDGYINFSFLKLHTGYFALLEQGFQINYSKGNIEIFNIIRENMDFNL
FT                   RYDFNKNFLRLDALFFDVNLLNWISLNENLSNYNNYLDTSLNGQLAFSYDFKDKDLRYA
FT                   FLLNSSSKANMADKEIQGVKVQIKGNSKVADIQNAFVKLKRGFIGYKGYYSLKDLVPIG
FT                   RLDFRSAKFFKFKDINGHLDFSKEAQYFCVKSDDLKVGRLKIQNLNMKTSFAQDNIHVD
FT                   YLLNFANNNSRILLKGDFNKENLNLNLGIKEFPMLFLKDILPETLMTKVIPEYFLSGKY
FT                   LNLTSDFDFNTVDYTKSKLNSLNFAVLSKLDDFNLIFDASGENELYKVKRFNYSSGDYN
FT                   VNSSFLIQLFNDSFKINTEVNYLNRNYPLYFELNFKDRHVNLQFSPKAQFSLTYSDASI
FT                   IYLFDINDFRFYNGNSEILLNVNSFGDYQIINNDLNVTIPKFSLDKISGDPAYNFNFSF
FT                   EGLYKDKKVSLSNIRFINGISNLQGQGHFNLDDKLSGNLNLFSNLDSERYFLGVDSNED
FT                   GSYFVGRFQGFDFNNLKFFSFVNGKINGNFILSFKDSDLFNYSLSAYLETDGLSLVGVP
FT                   TYCSLNLGLVDNNLNIYNIKASQNEIEILTGNFRYDIKNSIGISSLNINSNLFSSRVNA
FT                   SFQKFENKTEEEFGILKSETNGEISLRELRYKDKNLSDLTIELNNNLERFVMSSVEYDL
FT                   LSCLYEYNDGNFNVRLNDYLPLSFIASGNISRNKITSNIQDIKFDSKLITEDLLGSKTF
FT                   YNIKEHFVLYDLNVAGTLDVNGDLYNPNLNGEFRVVHGLISTEYLKLSRQYGKSRILEL
FT                   IDVPVIIKDNSVIIENKFNLDYYSDVNIAAHLNLNFLSDSIVDYYKIDIGASGSSGVPI
FT                   KFDKVAINFVGHASGNFFIEGNSEEIMFRGDLSVSNAWVYLLENSIVDLLIDPYKRSRK
FT                   VVASDVNSKGLDITTDLKINFDSSVAFHWPDNKISFLNAIIARGNKLEVKSDTKTDDFI
FT                   LKGDLNIASGSFNYNNKQFVFRGVSYISFNENKNKFDPWVKAEATNVIKDGNENLLITM
FT                   SIDGPLSLWNLSFSSYPARTEQEIKYLLSNAIIGGEHGLQSAGTNTAEMALGLASDILV
FT                   DLIVQPIEDYMRSVLKLDLLSIKTDILRNAIGILGSSTTFAGVLDKTNVKVGKYIADGV
FT                   FAKAGFGFLKEEVTPFSQNLNFSINFGLELDSPFFFVDYIFDYNFMKYGHGIGNQISIF
FT                   WKFKY"
FT   gene            849237..851696
FT                   /locus_tag="BH0795"
FT   CDS_pept        849237..851696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0795"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0795"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17291"
FT                   /protein_id="AAX17291.1"
FT                   /translation="MQLFKIFIFVVFILFVFNLGYSQENYKDKMIKSIDFNGLKNIKEN
FT                   DLKFILNVYLGQTYSDELFDRLQVDLYALDYFEGLIRPEFRIEDDKLVITFFVKEKSLV
FT                   KTVTFIDDSGIFWNSELRDKSDVKVKEALNLSRIKKSVVKFEEMYKDAGYLDVTVEFDI
FT                   KEENSLVDIVFKINAGPKYVVKEVSFEGNLNFKSRILRKYLVSKPSSLFADGKYLKSNV
FT                   DKDKMRLESYYKNNGYINAKVVNNTVDIRIPSDSKKMEREVYLKYFISEGNIFKFGKFE
FT                   ITGNLVFKLEELQSLITFREGDIFDDSRFEQDFAKIRDKYYSDGYIFTEIVPSRTIRDE
FT                   FVDYSINILEKEKAHIESITVSGNKKTASHVILREIPLMEGDVFSLEKLRMGMLNLQRL
FT                   GYFGNVIPDVVPSSIEGLMKINFVVEERETASLRFGMNFGGVSNSWLPFSVFGQWEQSN
FT                   FLGEGYALSARLNLAFSEQSFRLMFEDNWFMQTRWTLGGFIDFSHSINTAYQDINGPIF
FT                   IGKKEVPDPFVSWEAYNNDKNFSDFNIMNYSLAKFSISGFTGYTFSNYLGKQSFVGTVQ
FT                   TALKYVYYDNNVNRPSNYYLRDNYNTIRFENSFGISVAWDTRNSQSLSNNGFLLKQQFD
FT                   FFGGFLLGQSHFSKSTTTFERYFSLLGYQDVFTPYFDLILTLRSVYSNVLPPLGNGFEI
FT                   EVQPHHLIVISENFMIARGWGTLSNIYSSFVNTLQISMPLIKNILVWDILFLDMASYSL
FT                   EGQENSLFVPFSNFIFSWGFGIRSVLPQMPLSFVIAYPFYFSNEGVNRYYNYSGGFKFF
FT                   LAIDMRY"
FT   gene            851732..852250
FT                   /locus_tag="BH0796"
FT   CDS_pept        851732..852250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0796"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0796"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17292"
FT                   /protein_id="AAX17292.1"
FT                   /translation="MVSMMLLFACFFPLNLFSVNVTKVGIVDFEKVVIGFLSPQLKSNL
FT                   EQLKNHYQDKIDTLNSEIKDLRKMYDESVSIHDLENAKSYGNQYNLKIDELKKLKNLAK
FT                   SNLEQQKQININSLNSDGLLWGKILNGIQYVAETNGISLVMKKDNPYILYYNSTVDVTD
FT                   DVIKYLNAQ"
FT   gene            complement(852271..852777)
FT                   /locus_tag="BH0796A"
FT   CDS_pept        complement(852271..852777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0796A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0796A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17293"
FT                   /protein_id="AAX17293.1"
FT                   /translation="MNDTSQSNVFYVCRDDSIFIKLINRFTALYSVNFKIFIKNIFINN
FT                   NDKINKLYIDLSETKYLDSTFMGVLLYINNKSNEHKKTFKIINSSKEALKNLKSLGLEK
FT                   ILKIENKEEKLQRSEMKEYLCFNTHKNTIFKSMLKSHISLSSLNRDNKKEFCTLIRRLK
FT                   KENKN"
FT   gene            852853..855438
FT                   /locus_tag="BH0797"
FT   CDS_pept        852853..855438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0797"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:BH0797"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17294"
FT                   /db_xref="GOA:B2S1E1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1E1"
FT                   /protein_id="AAX17294.1"
FT                   /translation="MKKDVTPMMRQYLSIKNKHKDAILFFRVGSFYEMFFDDALEGSKL
FT                   LGLTLTKREDIPMCGVPCHTSKEYIKKLILLDRKVAICEQGGVQTDPKGPLEREVVEVI
FT                   SPGVVVDEDFLQDDVNNYLVAISDYKDYYSFSYIDLSTSRLGIILYEGSFLEKLRRDIE
FT                   KYSPKEIIVSESFYYKYLEKLALDRFLVNKVPHWHLDKDIAIKSLKDHFNVLSLSAFGF
FT                   KEDEPYYISSFLIIDYIKNNLKNLLINIDTIYINSDSEYMFLDDVTQINLELVKNNNDL
FT                   TARYSLYSVLNDCKTPMGKRLLREYILNPLLDIAAINNRLDHVEFLNNNVNLSIKLREI
FT                   LSNVWDIERIISRLQMRKYAKKDFLFIRETLIAFFSVKRLLNEYSFNYWIFDVNDEGDI
FT                   RGIYSLIDCAISNEQDELIKQGYNSEIDRLRELKNNASKYVDDYLDFERNFSKINSLKI
FT                   KRINVRGLFFEVTKSYYGQVPSHFIESQTLNSVKRYKTNKLIELERDINDAEDNLLSLE
FT                   QEIFDEIALKVVKYSTVIKKVAEFCAYIDVVSNFAYLAKKNEYVRPTLTNNKEIILECA
FT                   RHPVVEHYMKGVEAFTRNSVRIDGEKYFCLITGPNMAGKSTYLRQTALVVLMGHIGSFV
FT                   PANKAIIGITDKIFCRIGASDNISKGESTFLVEMNETANILRNATQDSLIIMDEVGRGT
FT                   STNDGLAIACSIVEYILEDIKARSLFATHFHELSAINHDSFVNLSMKIERQGNELIFLR
FT                   EVEEKPSLNSYGIYVARIAGIPLKVIKRANIILKSLTSRENLCVSEFFTSATSVVNDGE
FT                   DTMEEDLSYELDLNAYLELKNLISKIDINNITPFQAMNLLSEIILKTKM"
FT   gene            855441..856052
FT                   /locus_tag="BH0798"
FT   CDS_pept        855441..856052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0798"
FT                   /product="amidophosphoribosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0798"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17295"
FT                   /protein_id="AAX17295.1"
FT                   /translation="MWMWNWVVLKNIFLPLCSCCHKNYVYLNALCKDCIEFFHFDVKSR
FT                   DDFWYFFEYKSEYKNLLLAYKRDGQRLLGQFFANGILQFLMSIDFDLVVSVPCSFKRKI
FT                   FYGFDHMEYIGDLLGNSGIKYVNVFKRGLGKSQKLLRGDLRHSNLENKVKLKLKYRNIE
FT                   FKRVVLIDDIVTTGSSMTFCRDVLIKHGAWSVIKLSLARV"
FT   gene            856165..856596
FT                   /locus_tag="BH0799"
FT   CDS_pept        856165..856596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0799"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0799"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17296"
FT                   /db_xref="GOA:B2S1E3"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1E3"
FT                   /protein_id="AAX17296.1"
FT                   /translation="MVKIVDNSEVYNLIKNVTDRLGIEIIEINTFRKRGEGRVQIVLYK
FT                   GDDFGVDTLCDLHKMILLNLEAVLKYNFSLEISTPGINRKIKSDREFKIFEGKKIKLML
FT                   DNDFEEGFILKAGADSFIFKTDNKEVKVLYSDVKKAKLS"
FT   gene            856568..858058
FT                   /locus_tag="BH0800"
FT   CDS_pept        856568..858058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0800"
FT                   /product="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BH0800"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17297"
FT                   /protein_id="AAX17297.1"
FT                   /translation="MMSRRLNYREGVLDMIKGTGQMISNIASERGMSIDAIRKTVRESV
FT                   MIAYKKYFGTSENALIKFDEDTGDLVVYSKKKIVEEVQNDILEILQDDIQEFEVVEDGY
FT                   AYIEIDPKIFDRLSIQVAKQRTKSDLQGIEDNELYLEFKHKLHKIVIGYVQQNRNGDLY
FT                   VNLGSTDGVIPKKYQSSREVYGLNDKVRVLVYSVKKGKNGIEVVLSRTHPKFIEELLTL
FT                   EIPEIEEGIIKIHKIVRDPGYRTKVAVYSEKEEIDPVGPCIGQKGVRIQSIIKELEGEK
FT                   IDIIPYSRDIKEFIRDALTPAKIDNVYIVDEDLHKALVVVSDEQLSLAIGKMGQNVRLA
FT                   NRLLDWAIDVKTNSQFAEMKASGEFKQETFEMFDKILQDNVQEDEFEEINRISELKILD
FT                   SDIVDKLIEAGLDDIDNFLDASEENLFELGISYEKQEEINKILKEGMVIIANDDDGSIE
FT                   GIKDEEELLCPECGAVINENMTFCPGCKIGLSFEFEEE"
FT   gene            858039..860657
FT                   /locus_tag="BH0801"
FT   CDS_pept        858039..860657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0801"
FT                   /product="bacterial protein translation initiation factor 2
FT                   (IF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:BH0801"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17298"
FT                   /protein_id="AAX17298.1"
FT                   /translation="MNLKRSNSLSENIDDDRSEDEKKIKVVKLRKKVVKVVAHTDRNLN
FT                   KSKDDFVEPSNSWGNQDPNRGYSYGNRDNRGGMRPSSVHKDKDNTGSQQQGNRGYLGRT
FT                   NTNTYNRDNRGYSYGNRDNRGGMRPSFVHKDKDNTGSQQQGNRGYLGRTNTNTYNRDNR
FT                   GYSYGNRDNRGGMRPSSAHKDKDNTGSQQQQGNRGYSSRANAHSSSGAQTFRRVIRTKV
FT                   ISSVAMSPSDSDNKGLNRKLGEKKKQQQESQKGYKRKKEEIESQTIEQKVFDQLQKKKK
FT                   ENLANPIPKSIDIMGTITVAELARKMNLKSSDLIAKLMTLGVMATINEKIDSDTATILV
FT                   EEYGSRVNVVSIYDETVIESEEDDEREMVAKPPIITIMGHVDHGKTRLLSVLQNIDINQ
FT                   TEFGGITQHIGAYTINYNDHEITFLDTPGHEAFTMMRSRGAQVTDIVVLVVSAVDGVMP
FT                   QTVEAINHAKDAKVPIIVAINKIDLPDSNLDRVKHQLSEYDLIPEDWGGNTIFVAISAL
FT                   KNIGITELLDMIILQSEVMSLKANPTKRAIGRILDAKIDLGRGIVCSVIIEDGTLSIGD
FT                   SFVGGVYHGKVRALINERGVSVRSVGPAKAISVLGFSSIPQAGDPFQVTKTEKEAKLIS
FT                   SKRQDLKKYENAKNVKKVTMSNLYDSIKDGELRELKIILKADVQGSVEALKHSLEKLAN
FT                   NEIRVKVIHSSVGAITETDISFAAASEAIIIGFHVRPTTKAQLLADQEKVEIRKYNIIY
FT                   DAINDIKSVLEGMLEPDIEQQFIGFAEVRAVINIPKVGVVAGCYVSQGCIKRDAVANVV
FT                   REGLQVNSGKIASLKRFKEDVKEVSAQYECGIMIDNYFNIKEGDIIEAFEIKKVKRRFG
FT                   S"
FT   gene            860681..861040
FT                   /locus_tag="BH0802"
FT   CDS_pept        860681..861040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0802"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:BH0802"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17299"
FT                   /db_xref="GOA:B2S1E6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1E6"
FT                   /protein_id="AAX17299.1"
FT                   /translation="MEKEIRKSKLESLLVQEIGNLILTKGIKDPRVHEFLTVVRVEISN
FT                   DLINAKVFIGSIKEGASLDNAVKALNNAKGFIQGEIVKRIRVRNTPKLSFLRDDTISKA
FT                   FYVNKIIENLSFSDE"
FT   gene            861050..861895
FT                   /locus_tag="BH0803"
FT   CDS_pept        861050..861895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0803"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BH0803"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17300"
FT                   /protein_id="AAX17300.1"
FT                   /translation="MNGIILLNKRIGITSCDTLFPLKRYFSTSRVGHTGTLDKFASGLL
FT                   VVLVGKYTKLSNYITSLDKEYISEFEFGIETDTLDPNGRIANRTDYIPNLEELSLGIRS
FT                   FIGEIYQIPPKFSSVHVKGKRAYKLALSGEYFELQPRKVNIYDIQILNYNVDSRILKLQ
FT                   IKCSKGTYVRSIARDLALSLGSFAYVKSLERIKIGDFRLDNACFCEDFNSNSLMSLESL
FT                   GLFEKIYVDNSMIKLIRNGAYINVVINVGEFKILKSYNEEILAIICGIGLNKYKYIIIF
FT                   "
FT   gene            862196..862462
FT                   /locus_tag="BH0804"
FT   CDS_pept        862196..862462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0804"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:BH0804"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17301"
FT                   /db_xref="GOA:B2S1E8"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1E8"
FT                   /protein_id="AAX17301.1"
FT                   /translation="MISKEQKQKIITEFGKNPNDTGSVEVQIALITDRIRYLTEHLKSN
FT                   KKDHSSKRGLLKLVGQRRSLLRYYQKKNLEAYRTLIAKLGLRK"
FT   gene            862446..864629
FT                   /locus_tag="BH0805"
FT   CDS_pept        862446..864629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0805"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:BH0805"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17302"
FT                   /db_xref="GOA:B2S1E9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1E9"
FT                   /protein_id="AAX17302.1"
FT                   /translation="MDLESNKGLILRKILRLKVGREDLILETGLLAKQANGAVLATYGG
FT                   STVLATVCCSDSVRENLDFVPLSVEYNEKYYAAGKIPGGFIKREGKPKDKEVLVSRLID
FT                   RPMRPLFDKRFGREIQVVPTTLSTDQMNPPDIVGMNAAFAAVFLSDIPFNGPIAAVRLA
FT                   YLNNEFIVNPSFDEIQDSILDIVVAGSLDGITMVEGGANEVSEEVLLSAIDKAYEYIKQ
FT                   ICNLQKEFVSIIGEREKLPLAYEEGVFEFKDELKNLIYSELKDACFVKGKLNRDKAIKL
FT                   VKQKAYEHFSSISQVNEDNEFLFYKAFDDFEREIVRKSILENNLRTDGRTSTQIRDIVA
FT                   EVDLLKRTHGSSLFTRGETQALAVTTLGTSIDEQIMDDIDGDKRLNFMLHYNFPPFSVG
FT                   ETGRLMTGRREVGHGHLAQRSLEAMLPKKDDFPYTIRVVSEILESNGSSSMATVCSGSM
FT                   SLMAAGVPVKEQVAGIAMGLISDGDKYVVLSDILGEEDHLGDMDFKVAGTKNGITGFQM
FT                   DIKISNVTKQLMKDALEQARIGRMHILSIMDSVISRSRDDISVNAPKIVQLQIDIDKIS
FT                   LVIGSTGKTVKAITDEFEVRVQIEQDGRITLFGTDSLKMQKAKAKIESIVREPKIGEIY
FT                   DGIVKKINSFGAFIELTPIKEGFLSNRARSRDDRYGDMRHSRYGSGRHSRYGRDNRNTF
FT                   GMNPPRLEEGQIVKVKISDIDKFGKIELELVRD"
FT   gene            864638..866137
FT                   /locus_tag="BH0806"
FT   CDS_pept        864638..866137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0806"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17303"
FT                   /protein_id="AAX17303.1"
FT                   /translation="MKFVNYINNIFKNKLVFMSLFFFFSCLTSRDTNLSIVVDDVQNSN
FT                   VDELDVNERSRLLGLKDDESFFLSDAFLKEDNFYFKSARESYAQKNFGMTTYYLNKIVS
FT                   DEKSYGKELLAKANLFFGYVNYNMGVYDLSEYNFDNFLKYYKYSHASLRAAELKYFVKD
FT                   RIGAISALRDIDKTSLNADYDRGIYNFLNDKFGINYLNLEALGFLDNSIFDMFISGSNI
FT                   FISNIFGGLLRYDVKSNEYKVYIKDKKSIVLNGLKGFAEHKGVIYVGGSNALYYIDDLE
FT                   GSIKQVKIPLKVNLNSIQVLLGAKDGIFVGTLDSGLWFYSDVGEWTYIKVGSNRISSLY
FT                   LDEQKNLLLIGTMDKSIYSIDLADFNNVKHLNFFSKVESESNINFIKKHDGGYYVGTYG
FT                   GGLFKLNLDNHTYVKCDVNNDPSIGYFLDMEIRDNKLLFATFEHGLLIYDTVNASWDYL
FT                   GPGDGLISLNLVKILNFDDYVILGTLNNGLVFVNESIKKQL"
FT   gene            866112..867401
FT                   /locus_tag="BH0807"
FT   CDS_pept        866112..867401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0807"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0807"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17304"
FT                   /protein_id="AAX17304.1"
FT                   /translation="MRVLRNNYESYIITEFCKYFLITFLFFFFVFFINQILFFMRILLQ
FT                   NYVPFFKAFIFVIYSLPMVIALSPPFAALLSVILTIYRFKLNNEILAFRSIGISIFDLL
FT                   VPFFKLGVVIALIAFILNDFLLPLGSIGRLKIFNEIKEEIPHLILKPYSSKQYGDLIFV
FT                   SGEKSDTGYRNVTFFDNTRLKGYDRIFMARELNIQKENYQVYFILNDVLSIALTEDESG
FT                   FYDYFYADRMKYSIDQVTFSDSWLLSNVTPSQMSMRDVIKLIVKQDKLVKELDMRNDLE
FT                   EDLLHLNFSNTYLNYLYATNSIVDENYFLENLNYMYNLSLNYSPYEDLLAKRSYALFYL
FT                   EFYQKISLPLSVLFFIFLAFGMGMYSNKKYSIILELVISILICVFYWVMFIGGKVYTVQ
FT                   YAPNPFLVTVLPNVALIFAGLILFLRLLKK"
FT   gene            867398..868465
FT                   /locus_tag="BH0808"
FT   CDS_pept        867398..868465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0808"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0808"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17305"
FT                   /protein_id="AAX17305.1"
FT                   /translation="MKVDKLFVNNISLTFLFMNFLFVILIVLFDLFTNLFTYLDHNLSI
FT                   SDIIYIYYLYLPKCFSDGLALSFLFAVSNLIGNLSMRNEIIGLFSCGISISRILRSIIM
FT                   LSVFISVLLFFFDNYLVIDTVTKRDAFLKNSIGSKGANDRNIIIKDFAREIYNIRHYDI
FT                   ENDIIANLMIILKDQNDNFKKRYDISKAEWTNSRWRLYGVREFSKVERDVIEKFHEVLD
FT                   GGGIVNLEPEYIKIIMLSSKTLNFSKLISWIGALRRENLDSSEALFDFFSRIFFSFRLI
FT                   LLSFTVGFVSFALKKNIFIWSLLNSIAFAVVYVISIMVFSFLADLGYLPIFVASSLPTI
FT                   LFIIINFVVYNLVCK"
FT   gene            868484..869611
FT                   /locus_tag="BH0809"
FT   CDS_pept        868484..869611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0809"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:BH0809"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17306"
FT                   /db_xref="GOA:B2S1F3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1F3"
FT                   /protein_id="AAX17306.1"
FT                   /translation="MFNIIKNDKNSNARIGVLELPHGKVTTPCFMPVGTLGVMKALKHD
FT                   VLEKLGCNLMLANTYHLYLRPGIDVIKEYGSLHNFTTWNKNFLTDSGGFQVFSLSNFRK
FT                   IETEGVDFKSHIDGSRHYFTPESVFKMQEIFESDIIMALDICSSYGIDYSEASLYANIT
FT                   TSWARRTLRAYENRKEGYDGFLFLITQGNFFKDLRKRSTEAILELNSPGIAIGGISVGE
FT                   PRDKYLEILEYNSSLIPKDKPKYVMGIGTPHYILDAIYYGIDIFDCVNPTRIARHGSLL
FT                   TDNGILRIKRAGFNVDTSPIEQDCSCTLCTRYSRGYLRHLIKSGETLGVMLASEHNIHY
FT                   MFRLIQKARNAIMNDDFTQFRKLYLSKYDEGNFNE"
FT   gene            869586..871127
FT                   /locus_tag="BH0810"
FT   CDS_pept        869586..871127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0810"
FT                   /product="virulence factor MviN"
FT                   /db_xref="EnsemblGenomes-Gn:BH0810"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17307"
FT                   /protein_id="AAX17307.1"
FT                   /translation="MMKAILMNRDIISTIIVMVSIFFSRIMGFIKIKVFSYYFGANLEA
FT                   DIFNYVFNIPNNLRKILSEGAMTSAFMPEFAHEMKKSNTHALNFLRRVITFNVISISLV
FT                   ICIMILFSKQIMYFVSSYRGNNLELASYIFNYLILYVLLISLASIFASVLNSYKVFFIP
FT                   SFSPVMLSSSIILSIYLFYRQYGIYSAVIGVIVGGILQFLIQMINCIYIGLTYRPMFNF
FT                   NDPSFLRFLKRWANMILSALAAIATQQISFALASTLDIGSVSVLSNAIVYYQLPVGIFY
FT                   VSIATVIFPKMAEYASLGNKKGLDLILNQGIDILIFLLVPMSFLMYIWADPILNLLLTG
FT                   GKFSVYDTQKTVSVLQYFLIGLLFSSIFGLFQKYYFSIRNSKIPLYFNLLFAAVDIVIS
FT                   VLGIKFYKIVNVLPIAQSISFALCVVIFYFVGFKCGIKLELLRSSIALIKAFISLIPLY
FT                   LFYTFFNNFKWDVGFSLNNFYLLSVAGIINIIILILCYYLLGVSKIFKFISREIA"
FT   gene            871124..872548
FT                   /locus_tag="BH0811"
FT   CDS_pept        871124..872548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH0811"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17308"
FT                   /protein_id="AAX17308.1"
FT                   /translation="MREFILLFCIVLDLFAIKELTLSTKSLVTTQESETSTDKDMKENN
FT                   VERDVTSESEFKSVNLDVKQVNDVISYGLDTQVIEIIGSLKKSGDGEYNALLEKRLQKT
FT                   FNIDLKRAILELFLSLKYAGGVDAANYILDSYESNRYPNNLINLAISYLKEFGEKDALK
FT                   KTLIGILENKEGNIVATAAYYLGELSSPEYSKDMMDVYDKYSANDGAKSAILIALGKSN
FT                   AVDYVDRFYEISVDSYENPSIKASAIRALSYLMPEKITENANLYLQNNNNNYNIKIAIV
FT                   RALSKDISLKSKEILHDFLRDSDASIRIGAIEAIKEHNDIASKEVLIYKLKSDPSLKVR
FT                   ESSGKALVDMGSGYEEIQNIMLDSSIENNFKLTIFSYLLDKDVNSARLIALNLLEKENI
FT                   NKPSKLLTNISMLLSVRKGNFDDFYSRIIESKNVDLMNLAIRGAVYNKSPSLSGKLKEI
FT                   KRTTSSGYLRKLLTNY"
FT   gene            complement(872542..873732)
FT                   /locus_tag="BH0812"
FT   CDS_pept        complement(872542..873732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0812"
FT                   /product="phosphopantothenate--cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /EC_number="4.1.1.36"
FT                   /note="phosphopantothenoylcysteine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BH0812"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17309"
FT                   /protein_id="AAX17309.1"
FT                   /translation="MYKINMKKHKNILIGICGGIAAYKSACIVSSLIKMGYNVKVIMTE
FT                   NATKFITPLTLETVSKNRVIKSLWNTTHEEVEHINLARWANLILIIPATYNIISKIASG
FT                   IADDALSTIISASTAPTYFAIAMNNIMYQNPILKENIEKLKKYNYKFIEPDEGFLACSL
FT                   NAIGRLKNENDILKIILNALAPKLPLKNKKILITASRTEEALDPIRYLSNKSTGQMGFN
FT                   LGIEAQNLGADVTIITGPSNEKKPYGINIIKIKTAAEMYKEAISIYQEFDIIIGAAAVA
FT                   DFRPDKTYKTKIKKNTMEELHIKFIKNPDIIKHIGKNKTKNQVVIGFCAQKDEILIEKA
FT                   KEKLKTKNLDYIIANDLKYLGSSLNKIYIINKDSVKELPEMSKKETATEILKILYQ"
FT   gene            873776..873970
FT                   /locus_tag="BH0813"
FT   CDS_pept        873776..873970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH0813"
FT                   /product="hypothetical protein"
FT                   /db_xref="Ensemb