(data stored in SCRATCH3701 zone)

EMBL: CP000049

ID   CP000049; SV 1; linear; genomic DNA; STD; PRO; 917330 BP.
XX
AC   CP000049;
XX
PR   Project:PRJNA13597;
XX
DT   23-DEC-2006 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Borrelia turicatae 91E135, complete genome.
XX
KW   .
XX
OS   Borrelia turicatae 91E135
OC   Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borrelia.
XX
RN   [1]
RP   1-917330
RA   Porcella S.F., Raffel S.J., Schrumpf M.E., Montgomery B., Smith T.,
RA   Schwan T.G.;
RT   "The genome sequence of Borrelia hermsii and Borrelia turicatae:
RT   Comparative analysis of two agents of endemic N. America relapsing fever";
RL   Unpublished.
XX
RN   [2]
RP   1-917330
RA   Porcella S.F., Raffel S.J., Schrumpf M.E., Montgomery B., Smith T.,
RA   Schwan T.G.;
RT   ;
RL   Submitted (03-DEC-2004) to the INSDC.
RL   Laboratory of Human Bacterial Pathenogenesis, Rocky Mountain Laboratories,
RL   National Institutes of Allergy and Infectious Disease, National Institutes
RL   of Health, 903 S. 4th Street, Hamilton, MT 59840, USA
XX
DR   MD5; 85e70cb38a4a6be59ac27b5df10d58ea.
DR   BioSample; SAMN02603508.
DR   EnsemblGenomes-Gn; BTR0001.
DR   EnsemblGenomes-Gn; BTR0002.
DR   EnsemblGenomes-Gn; BTT0001.
DR   EnsemblGenomes-Gn; BTT0002.
DR   EnsemblGenomes-Gn; BTT0003.
DR   EnsemblGenomes-Gn; BTT0004.
DR   EnsemblGenomes-Gn; BTT0005.
DR   EnsemblGenomes-Gn; BTT0006.
DR   EnsemblGenomes-Gn; BTT0007.
DR   EnsemblGenomes-Gn; BTT0008.
DR   EnsemblGenomes-Gn; BTT0009.
DR   EnsemblGenomes-Gn; BTT0010.
DR   EnsemblGenomes-Gn; BTT0011.
DR   EnsemblGenomes-Gn; BTT0012.
DR   EnsemblGenomes-Gn; BTT0013.
DR   EnsemblGenomes-Gn; BTT0014.
DR   EnsemblGenomes-Gn; BTT0015.
DR   EnsemblGenomes-Gn; BTT0016.
DR   EnsemblGenomes-Gn; BTT0017.
DR   EnsemblGenomes-Gn; BTT0018.
DR   EnsemblGenomes-Gn; BTT0019.
DR   EnsemblGenomes-Gn; BTT0020.
DR   EnsemblGenomes-Gn; BTT0021.
DR   EnsemblGenomes-Gn; BTT0022.
DR   EnsemblGenomes-Gn; BTT0023.
DR   EnsemblGenomes-Gn; BTT0024.
DR   EnsemblGenomes-Gn; BTT0025.
DR   EnsemblGenomes-Gn; BTT0026.
DR   EnsemblGenomes-Gn; BTT0027.
DR   EnsemblGenomes-Gn; BTT0028.
DR   EnsemblGenomes-Gn; BTT0029.
DR   EnsemblGenomes-Gn; BTT0030.
DR   EnsemblGenomes-Gn; BTT0031.
DR   EnsemblGenomes-Gn; BTT0032.
DR   EnsemblGenomes-Gn; EBG00001239521.
DR   EnsemblGenomes-Gn; EBG00001239522.
DR   EnsemblGenomes-Gn; EBG00001239523.
DR   EnsemblGenomes-Gn; EBG00001239524.
DR   EnsemblGenomes-Gn; EBG00001239525.
DR   EnsemblGenomes-Gn; EBG00001239526.
DR   EnsemblGenomes-Gn; EBG00001239527.
DR   EnsemblGenomes-Gn; EBG00001239528.
DR   EnsemblGenomes-Gn; EBG00001239529.
DR   EnsemblGenomes-Gn; EBG00001239530.
DR   EnsemblGenomes-Gn; EBG00001239531.
DR   EnsemblGenomes-Gn; EBG00001239532.
DR   EnsemblGenomes-Gn; EBG00001239533.
DR   EnsemblGenomes-Gn; EBG00001239534.
DR   EnsemblGenomes-Gn; EBG00001239535.
DR   EnsemblGenomes-Gn; EBG00001239536.
DR   EnsemblGenomes-Gn; EBG00001239537.
DR   EnsemblGenomes-Gn; EBG00001239538.
DR   EnsemblGenomes-Gn; EBG00001239539.
DR   EnsemblGenomes-Gn; EBG00001239540.
DR   EnsemblGenomes-Gn; EBG00001239541.
DR   EnsemblGenomes-Gn; EBG00001239542.
DR   EnsemblGenomes-Gn; EBG00001239543.
DR   EnsemblGenomes-Gn; EBG00001239544.
DR   EnsemblGenomes-Gn; EBG00001239545.
DR   EnsemblGenomes-Gn; EBG00001239546.
DR   EnsemblGenomes-Gn; EBG00001239547.
DR   EnsemblGenomes-Gn; EBG00001239548.
DR   EnsemblGenomes-Gn; EBG00001239549.
DR   EnsemblGenomes-Gn; EBG00001239550.
DR   EnsemblGenomes-Gn; EBG00001239551.
DR   EnsemblGenomes-Gn; EBG00001239552.
DR   EnsemblGenomes-Gn; EBG00001239553.
DR   EnsemblGenomes-Gn; EBG00001239554.
DR   EnsemblGenomes-Gn; EBG00001239555.
DR   EnsemblGenomes-Gn; EBG00001239556.
DR   EnsemblGenomes-Gn; EBG00001239557.
DR   EnsemblGenomes-Gn; EBG00001239558.
DR   EnsemblGenomes-Gn; EBG00001239559.
DR   EnsemblGenomes-Tr; BTR0001-1.
DR   EnsemblGenomes-Tr; BTR0002-1.
DR   EnsemblGenomes-Tr; BTT0001-1.
DR   EnsemblGenomes-Tr; BTT0002-1.
DR   EnsemblGenomes-Tr; BTT0003-1.
DR   EnsemblGenomes-Tr; BTT0004-1.
DR   EnsemblGenomes-Tr; BTT0005-1.
DR   EnsemblGenomes-Tr; BTT0006-1.
DR   EnsemblGenomes-Tr; BTT0007-1.
DR   EnsemblGenomes-Tr; BTT0008-1.
DR   EnsemblGenomes-Tr; BTT0009-1.
DR   EnsemblGenomes-Tr; BTT0010-1.
DR   EnsemblGenomes-Tr; BTT0011-1.
DR   EnsemblGenomes-Tr; BTT0012-1.
DR   EnsemblGenomes-Tr; BTT0013-1.
DR   EnsemblGenomes-Tr; BTT0014-1.
DR   EnsemblGenomes-Tr; BTT0015-1.
DR   EnsemblGenomes-Tr; BTT0016-1.
DR   EnsemblGenomes-Tr; BTT0017-1.
DR   EnsemblGenomes-Tr; BTT0018-1.
DR   EnsemblGenomes-Tr; BTT0019-1.
DR   EnsemblGenomes-Tr; BTT0020-1.
DR   EnsemblGenomes-Tr; BTT0021-1.
DR   EnsemblGenomes-Tr; BTT0022-1.
DR   EnsemblGenomes-Tr; BTT0023-1.
DR   EnsemblGenomes-Tr; BTT0024-1.
DR   EnsemblGenomes-Tr; BTT0025-1.
DR   EnsemblGenomes-Tr; BTT0026-1.
DR   EnsemblGenomes-Tr; BTT0027-1.
DR   EnsemblGenomes-Tr; BTT0028-1.
DR   EnsemblGenomes-Tr; BTT0029-1.
DR   EnsemblGenomes-Tr; BTT0030-1.
DR   EnsemblGenomes-Tr; BTT0031-1.
DR   EnsemblGenomes-Tr; BTT0032-1.
DR   EnsemblGenomes-Tr; EBT00001584924.
DR   EnsemblGenomes-Tr; EBT00001584925.
DR   EnsemblGenomes-Tr; EBT00001584926.
DR   EnsemblGenomes-Tr; EBT00001584927.
DR   EnsemblGenomes-Tr; EBT00001584928.
DR   EnsemblGenomes-Tr; EBT00001584929.
DR   EnsemblGenomes-Tr; EBT00001584930.
DR   EnsemblGenomes-Tr; EBT00001584931.
DR   EnsemblGenomes-Tr; EBT00001584932.
DR   EnsemblGenomes-Tr; EBT00001584933.
DR   EnsemblGenomes-Tr; EBT00001584934.
DR   EnsemblGenomes-Tr; EBT00001584935.
DR   EnsemblGenomes-Tr; EBT00001584936.
DR   EnsemblGenomes-Tr; EBT00001584937.
DR   EnsemblGenomes-Tr; EBT00001584938.
DR   EnsemblGenomes-Tr; EBT00001584939.
DR   EnsemblGenomes-Tr; EBT00001584940.
DR   EnsemblGenomes-Tr; EBT00001584941.
DR   EnsemblGenomes-Tr; EBT00001584942.
DR   EnsemblGenomes-Tr; EBT00001584943.
DR   EnsemblGenomes-Tr; EBT00001584944.
DR   EnsemblGenomes-Tr; EBT00001584945.
DR   EnsemblGenomes-Tr; EBT00001584946.
DR   EnsemblGenomes-Tr; EBT00001584947.
DR   EnsemblGenomes-Tr; EBT00001584948.
DR   EnsemblGenomes-Tr; EBT00001584949.
DR   EnsemblGenomes-Tr; EBT00001584950.
DR   EnsemblGenomes-Tr; EBT00001584951.
DR   EnsemblGenomes-Tr; EBT00001584952.
DR   EnsemblGenomes-Tr; EBT00001584953.
DR   EnsemblGenomes-Tr; EBT00001584954.
DR   EnsemblGenomes-Tr; EBT00001584955.
DR   EnsemblGenomes-Tr; EBT00001584956.
DR   EnsemblGenomes-Tr; EBT00001584957.
DR   EnsemblGenomes-Tr; EBT00001584958.
DR   EnsemblGenomes-Tr; EBT00001584959.
DR   EnsemblGenomes-Tr; EBT00001584960.
DR   EnsemblGenomes-Tr; EBT00001584961.
DR   EnsemblGenomes-Tr; EBT00001584962.
DR   EuropePMC; PMC2991353; 21124792.
DR   EuropePMC; PMC3347450; 22354035.
DR   EuropePMC; PMC3754566; 23749977.
DR   EuropePMC; PMC3833655; 24112474.
DR   EuropePMC; PMC3924360; 24526628.
DR   EuropePMC; PMC4128717; 25111141.
DR   EuropePMC; PMC4157404; 25229054.
DR   EuropePMC; PMC4182126; 24813576.
DR   EuropePMC; PMC4356817; 25583724.
DR   EuropePMC; PMC4470780; 25700888.
DR   EuropePMC; PMC5708834; 29145396.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000049.
DR   SILVA-SSU; CP000049.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..917330
FT                   /organism="Borrelia turicatae 91E135"
FT                   /strain="91E135"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:314724"
FT   gene            98..655
FT                   /locus_tag="BT0001"
FT   CDS_pept        98..655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17346"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYF4"
FT                   /protein_id="AAX17346.1"
FT                   /translation="MLQFLTHTMKNLILISLHLLIIYTHAWGEKFNNENIKPLQIGIIQ
FT                   HNYINLTPYNQHYKYYAFIGITMTYNEWIDFNIIPIHFYPHVPTLFSNVYFTLSISLYI
FT                   LKYQIHIYSFIINILIGTQLPIALRTSIITGNNISAFLFPAFPFVSVKLNIPITNLFSI
FT                   LSTFSSSLREYFLVDIAITFPI"
FT   gene            complement(713..1780)
FT                   /locus_tag="BT0002"
FT   CDS_pept        complement(713..1780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0002"
FT                   /product="beta-hexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:BT0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17347"
FT                   /db_xref="GOA:A1QYF5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYF5"
FT                   /protein_id="AAX17347.1"
FT                   /translation="MIWYLGKVSGMFRFVLFGLLLSSLVLLGSIPDIDYDYFENDKFDL
FT                   VDIDKFLGRVNVKNILRERCFFIGIRNVANPSAVQALSKEELGKIREINPVGIILFREN
FT                   FKDAQQTKELIEGIKRYLGSDILIAVDEEGGLVSRASENKKLGVYNFPAMESVGKTGDS
FT                   QLAYKIGEILGKQLRRLGINVNMAPVADAKFVPNSPLGSRTFGYSSYNIGLMVEAFIDG
FT                   IQREGVFAVVKHFPGLGGTKVDTHKDLALLPYSKNFLMVNNFIPFLFGKEAKFIMLGHV
FT                   LVPKISGDVSSMSKDIVDIIRHNLNIFSIIMTDAYDMGAIVNNFSLGHAIRKSLNSGID
FT                   VVLIPEGFKKLNVEE"
FT   gene            complement(1743..3197)
FT                   /locus_tag="BT0003"
FT   CDS_pept        complement(1743..3197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0003"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17348"
FT                   /db_xref="GOA:A1QYF6"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYF6"
FT                   /protein_id="AAX17348.1"
FT                   /translation="MYEVIDEIFSKKMLDMLNMHKLKTLSISVKNFPDESHGSILSLAN
FT                   NSVKLKFKKELVEHNLKKYIDDFTKFSVSSESNFYVFTGDDLERLGLLLYPYLSFGILN
FT                   GGSATSYFDILKNNDFNEELYSLYADKILEARRLFGHLPKGITPAYVNRDGSYGFSFLA
FT                   LKMRHLLMLSNRYCELYGKSIKPSIFQMTSFKTYKPISNFLDNIFDDNLIKDLNSCGLQ
FT                   RADILTAIQPLVYCYNKLDDGQYEYFSYCTNGKRSFLALPAGHGQNFKVLRDIYFKLYN
FT                   SGKKFVYIGNVDNIGFTVNLQTLAIMAITNSSSGFEFSVKTPLDTKGGVLVLDDDNHLT
FT                   CVDIGSVISKEAVLKAECRGSRILFNCATGLFNLEYLIENMDRIISDMPIRIIEQDKEF
FT                   GRYTAIEQITWEVMRIVDNPLIFEVNREDRFLPAKLFVDTLIMSNYMNDKFSGNISDIA
FT                   RYLNYALNNALKNKYDLVFRQGKWDV"
FT   gene            3262..5145
FT                   /locus_tag="BT0004"
FT   CDS_pept        3262..5145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0004"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BT0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17349"
FT                   /db_xref="GOA:A1QYF7"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYF7"
FT                   /protein_id="AAX17349.1"
FT                   /translation="MLIIIEYVTIIIVLQIKANIKLKYTNEEENMLKRYILNMTNLSNA
FT                   INEMILSHSGFRKIFAKSKNENSIEYEINDDDKILVALITLTISNYFKDKPKKYINVGS
FT                   DSRATGNIISEIIIKTLILNNNSVKFFGILPIPEILAYTKENQNSKGFIYISASHNPTG
FT                   YNGIKIGLNDGGVLNSNETKKIICQIRSNIENETLINNLITNLQKFNTNALHLKTYETI
FT                   ITSQARHKTQSYNSYKSLMQQIIYSDTHNQKNIDILKKTIKKEPIGIIGEMNGSSRINS
FT                   IDREMIESLGIKLEFHNTEIGIFKHGMTPEGTSLNMCKQILEQKFKNDNSFKLGYVPDC
FT                   DGDRGNLVAILKKEQASIITPQKIFALSVLSELSYLYHTGIKDNLAIVVNDATSLNIEK
FT                   IASLFNTKVYRVEVGEANLTEMADLLRNKGLIVKILGEGSNGGNITYPSKVRDPLTTLF
FT                   SIIKLLKIKNLYKIWCSISNNSYNEHYTLGDILKTINFYSNVEVSSEKAMLKIKVENQE
FT                   ILKTNYEKLLDKEFNNNNNTVLHKLPIHNYEIINYEGIKQNISRTGDSSGGLKVLFKNN
FT                   KHEIIASLWFRGSKTEPIFRVLSEVISEHNDLLYPLLDFHIDLIHSANSLI"
FT   gene            complement(5227..6282)
FT                   /locus_tag="BT0005"
FT   CDS_pept        complement(5227..6282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0005"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BT0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17350"
FT                   /db_xref="GOA:A1QYF8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYF8"
FT                   /protein_id="AAX17350.1"
FT                   /translation="MQRKVMLTGDRPTGSLHLGHYIGSIVNRLKYQEEYETYIIIADLH
FT                   TLTTKPDLKSINEISVNVREMVLDYLACGINPEKVNIYLQSAIPELLELNLILSMIVMV
FT                   NRLQRIPSIKDMSVAAGLSEVPYGLLGYPVLMSADILMTKANLVPVGRDNEAHIELTRE
FT                   LARKFNYLYGDFFPIPEAIFTDSQALVGIYGKAKMSKSLGNAIFLSDDEKSLRKKVMSM
FT                   FTDPKRVRADIPGEVDGNPVFIYHDLFNSNVDELYEFKTRYRKGTIGDVEVKERLFEVL
FT                   NQFLIPIRERRKFFEAKKGYIDEIIFEGTSKTRKVAIEVIKNAKNLMGISRTWNGVRRN
FT                   VEKILKNNLSI"
FT   gene            complement(6285..7358)
FT                   /locus_tag="BT0006"
FT   CDS_pept        complement(6285..7358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0006"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17351"
FT                   /db_xref="GOA:A1QYF9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYF9"
FT                   /protein_id="AAX17351.1"
FT                   /translation="MSLELKPTDRLKFVKLQSVFYVIALIVMLIAILKIAQTIFKPLAI
FT                   AVVLGFLVYPIYTFLKKLKIPRVLIVFVIFFVLFSFSYLVFSFVYYSVTVLIDQLPYYQ
FT                   KQLIFIMVDILEKYKLDSAIISTIDFSKYIYPFLTRISNEIIGFASSLVVLFLLLYFLL
FT                   SEIHIFDIKVKNAFKQSVSSIFIEALSTINSQISKYLGIKLFVSCLTGFLVFIGLKLFG
FT                   QDFPRVWAVLTFVFNFIPSIGSILAVFFIMIAALVQFYPNLNLVFYIFIYNTFVQMLIG
FT                   NILEPKMQGHRLDLSPFLLLCFLFFWGWLWGIVGLLIAYPFTVIIKVIVDNIACLKPFS
FT                   VFLSGSKILSVDNNKES"
FT   gene            complement(7455..8318)
FT                   /locus_tag="BT0007"
FT   CDS_pept        complement(7455..8318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17352"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYG0"
FT                   /protein_id="AAX17352.1"
FT                   /translation="MFMGKKEKIIALIFDFDDTLIYGNMQQVLFDEYNVNASLFWDEVE
FT                   NLSITYNKNHCNIIANEMIYLSHFLTYVKEGIFKGLNNKILFELGSKLRFFEGVISLFK
FT                   EIDEINRSLKKSDTVINIYIVSSGFRQMILGSSIAPYVTKVWACEFIDTYLMPFYQNLD
FT                   NKFSENVVLSSVCYFVDHTIKTRVIFELNKGSYDKINKRIPKGRREIPFENMFYIADGF
FT                   NDIPAFEILNNSLNHYKNTLTVYHGNDENAKRLVKEKRVGDLAEANYSKGTKLYNWIME
FT                   KIHLNI"
FT   gene            8440..9216
FT                   /locus_tag="BT0008"
FT   CDS_pept        8440..9216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0008"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17353"
FT                   /db_xref="GOA:A1QYG1"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYG1"
FT                   /protein_id="AAX17353.1"
FT                   /translation="MIMIDISSINQIKDIFSKVLDVSLISILVYYIYKNVINSYSVNLL
FT                   KGMIIITSIGIVSYYFNLYTINWLLNYIANILPIAMLILFHQEIKKIIMQIGNFNLSFK
FT                   LANNKEETTKTIVEIIKTIKHLSENKSGSLICIEKKIQLDQIINKGIRLDSIVSNEILI
FT                   SIFDYETPLHDGAVIISNNKIVYAGSFLPLSNVESISKTFGTRHRAGLGISENSDAITI
FT                   ITSEETGSISLTQNGKLEYNLSLNEIKKKLNLALIE"
FT   gene            9220..10215
FT                   /locus_tag="BT0009"
FT   CDS_pept        9220..10215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17354"
FT                   /db_xref="GOA:A1QYG2"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYG2"
FT                   /protein_id="AAX17354.1"
FT                   /translation="MIITKKFMNIIKLLFEDWQNKAISILIAIIMFTTSYFHSIESITI
FT                   EKKFNILLEDEVTLGKIPDFNKMLLTVKINKKDLKYLDLDRITLLVEANNIKEAGEYEL
FT                   PIKIKNFNPIPIVEYKLSKNKITLNLDKKISKLVKVEPKFKLLEKEGKGEYFIAKYNIV
FT                   PEKLKIHGPEKVIKTINSIKTKIKEFDINTVFISEHLEVISPNPLITLEKNHVIVNITL
FT                   GKKYIHTTIKNPNLIFNNLKNGLEIKNKEKILDPENEMFIKIRSGLSEKIIKMHIANKN
FT                   INLNLDLSQIATPGIYNINTDIILKNNTHGIEVYEYEPKTIKIEVISTEQ"
FT   gene            10217..10594
FT                   /locus_tag="BT0010"
FT   CDS_pept        10217..10594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0010"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:BT0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17355"
FT                   /db_xref="GOA:A1QYG3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYG3"
FT                   /protein_id="AAX17355.1"
FT                   /translation="MTKSIGCDIIKVTRFNSFLQNRKKLERFFTQREIENSAMKGKGVL
FT                   ESLAGKFSAKESLIKALSPLINIKIKYSLKDIEIISLPKGNIIFQLHNDIKTLINQMNL
FT                   KLYLTISHEREYAIAFVIVEN"
FT   gene            10598..11446
FT                   /locus_tag="BT0011"
FT   CDS_pept        10598..11446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17356"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYG4"
FT                   /protein_id="AAX17356.1"
FT                   /translation="MKKISYLTKYEIECPLCKHKFRKEELLTGSSRLIAGELKVDLKRE
FT                   YIKNEKYGNIYPRIYSITVCPNCYLAAFPNEFNAIALINNNIKQILIIRTDERKEIKSI
FT                   FEDNLNFNEPRRLQEGAASYILAIMCYEHLDKTHNPTFNQAKCAIRSAWIFEDLDKEYP
FT                   NQNYNYLQKIFYHKAAYLYKLTIEKEQNNSEPINAEIVFGPDTDKNYGYDSVLYLSSLL
FT                   EYFYGNKEDKQYRYNQLVDIKTLLSKITGMGKSSKEKPSILLDKIKEVYFKISNEIKTF
FT                   K"
FT   gene            11447..12184
FT                   /locus_tag="BT0012"
FT   CDS_pept        11447..12184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0012"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BT0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17357"
FT                   /db_xref="GOA:A1QYG5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYG5"
FT                   /protein_id="AAX17357.1"
FT                   /translation="MKKVLAKITYDGSLYYGFQIQPKKPTIQGEIEKVLEKISKTKIKI
FT                   HSAGRTDKGVHARGQIISFYIKINIKLKNLKTAINSLLKDDIRIIKLKYVEDKFQPRFD
FT                   AKRRKYSYYILNNENHYPWEGYRAYYVKKKLNINRLNEMAEMLIGIHDFTTFSCIRDQT
FT                   NSKLKEIYYARFKKKNKFIIFEIIGSSFLWKMVRSIVGVMIDIEIKNEPVDTFKKILNS
FT                   KNRKLTRKTAPAKALFLDKVFYE"
FT   gene            12177..12755
FT                   /locus_tag="BT0013"
FT   CDS_pept        12177..12755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17358"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYG6"
FT                   /protein_id="AAX17358.1"
FT                   /translation="MNKSKLLKKLILLRTLKNNISENIYSKQEEFEKLKNQIIKARNIK
FT                   ILKHTEQKDIKENNRLIKSTGYKINKNDKKGLLIVYIDKKYLNQNAKIIVKKWCESIKI
FT                   LNYKIIDNPNTLTFEINNQQPKAILACEEVALFLNQHLRIQIVRGFELNFKGIPIVFTY
FT                   LPTNQVTNPEIKKEIWQDLKIIKGIIKYG"
FT   gene            12748..14724
FT                   /locus_tag="BT0014"
FT   CDS_pept        12748..14724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0014"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:BT0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17359"
FT                   /db_xref="GOA:A1QYG7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYG7"
FT                   /protein_id="AAX17359.1"
FT                   /translation="MDKNSEHNFYYEIAFNIPVNRLFFYKYNLKLETGIRIITNFNGKD
FT                   TIGIIIKRYAKEELKENFTFEIKDIIKVIDKNAIIIEHNINLAHWISQKTFSGFGETLF
FT                   CGLPKISTSNKEIKNNDNENLSYKLPIQLNEEQNSIYKEIIESNIQNTFYLFGVPGSGK
FT                   TEIFIKLCENYLEQKKQIIFLIPEISLGYQIIKRIKSNLSTNKVYEYNSKVSNSTKTLI
FT                   WNKVKNGENLIIIGVKSALMLPFKNLGLIIMDEEHEYTYKSENTPRFHSRHIGFFLQST
FT                   FNAKFVMGSATPSLEAYLAMENNQIKKMVLKNKFFERTFKELKIIDMKKERQIISSELL
FT                   YSIQKSLIDKRQALIFINKRGYSKTLECKICGHIIYCPHCSFNLIYHKSENKLICHYCN
FT                   YKTNIINNCPNCNSQDIIYKTYGIQFIERELKNFLPNARIARTDSDLNKKEIIQSINAF
FT                   ENGQLDILIGTQIIAKGFNFKQIKTLGIINADIGMGLPDFRSSERIFAIISQVLGRAAR
FT                   FQSDNTIIIQTKNPDYYPIKYAYEGKYEEFYKEEIKIRKELNYPPFKKIIRIVIRSKKQ
FT                   ETARHKCLEFFEISKELLNDKIEYLGPSKAPMSKISKYYRYNIIYLSKSFNLLEKLIRH
FT                   TKEKIKLTRDTYIEIDYYPISLL"
FT   gene            complement(14721..15341)
FT                   /locus_tag="BT0015"
FT   CDS_pept        complement(14721..15341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0015"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:BT0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17360"
FT                   /db_xref="GOA:A1QYG8"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYG8"
FT                   /protein_id="AAX17360.1"
FT                   /translation="MVKIIGITGGSGSGKTTVVNKISEVIPEFVLISQDNYYKSVGDYE
FT                   YEFLDVNFDHPDAFDNNLFYKHLKKLKENKLIHMPLYDFINHKRKDETVEIVPTPVVIV
FT                   EGIMIFVEERVRNLIDLKIYIDTPNDIRFIRRLERDMSKRGRTLESVIEQYLSTTRAGY
FT                   YRFIEPTKEYADLIIPEGGHNDKALYVLSSFLRTLGQESSVFF"
FT   gene            complement(15334..15723)
FT                   /locus_tag="BT0016"
FT   CDS_pept        complement(15334..15723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0016"
FT                   /product="rhodanese-related sulfurtransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BT0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17361"
FT                   /db_xref="GOA:A1QYG9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYG9"
FT                   /protein_id="AAX17361.1"
FT                   /translation="MIVSYIKLICLIVFLFFYIWFFIVLKMKRTNLVLLEKIKNGAKIL
FT                   DIRSPKEYSKSHYAKSINIPFKDLFAKKDKLGNVETQIIIYGKTFNKSIEAKKILKGLG
FT                   FNNVFVAGTLKNMPKLPSSKEEVNG"
FT   gene            15852..16820
FT                   /locus_tag="BT0017"
FT   CDS_pept        15852..16820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0017"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17362"
FT                   /db_xref="GOA:A1QYH0"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYH0"
FT                   /protein_id="AAX17362.1"
FT                   /translation="MKKKRNKWTRIKQKIKFIILKILRKQLKNILKDPKLILISTLQIT
FT                   TGSLLMAISTNILYIPHGLLSGGIAGIALMMHYLLNFNLGLTIFILNIPLFIIGIKFLN
FT                   ITFVIQSWIAMALYSLIVNYSQFLQYKMQINDMILVSILAGLISGLGLGLIFRAKGSSG
FT                   GTDIVSMIIKEKYSISIGTTNFLFNLAVLLIAAAFFNIEIALYTLIASFVTAIMTDKTS
FT                   TGFGNQKAILIISDKGKEISYLLTNKLKVAATLLEGKGAWAGNDKTIVFIVVPTMRMSR
FT                   IKYISQKIDPNCFITVLNTNEITGGKKIIESPITNKYDTTT"
FT   gene            complement(16817..17797)
FT                   /locus_tag="BT0018"
FT   CDS_pept        complement(16817..17797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0018"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BT0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17363"
FT                   /db_xref="GOA:A1QYH1"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYH1"
FT                   /protein_id="AAX17363.1"
FT                   /translation="MKKFQKEFIVRKDSQRLDIYLSEDLCLFTRSQIKKREVKAFKYHD
FT                   GVFVAIKLSRPVFVDDKILIEFNEEINLREYVRPLNLPISILYEDINVIVVDKPQGILS
FT                   HPGISNLENTIVNFLLYHISGLRDSFQEDKLRPGIVHRLDKETSGVMICAKNLKTLNFL
FT                   SRQFKERFVKKVYIAVVKGNFKIDSGIIETFIDRDRHDRKRFSVHENRGKRALTEYRVL
FT                   ASIGNYSLVALKPKTGRTHQLRVHMKHLNHPILGDSIYARLDKEFKEMSLMLHAFKLEI
FT                   NIKEGSLKKFISVFPQRFINFLSIFYDKETLSILVNDFIVFLDKF"
FT   gene            complement(17798..18295)
FT                   /locus_tag="BT0019"
FT   CDS_pept        complement(17798..18295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17364"
FT                   /db_xref="GOA:A1QYH2"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYH2"
FT                   /protein_id="AAX17364.1"
FT                   /translation="MMIRFLLLLFNVFILYSNSLDYFKFELEYLNYKFSLRDKISSSEN
FT                   NIDFGSEFFVRLESNDDFFYKDVQENKDLNIEKTINSNWGKKLFRFSAISVGTFPIALF
FT                   VGLYCFDLSYYFNNMDGKNFPYPFSSGFELSKDETFKKFMISASAGLAISLIIALIDCF
FT                   SY"
FT   gene            complement(18300..19964)
FT                   /locus_tag="BT0020"
FT   CDS_pept        complement(18300..19964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0020"
FT                   /product="pyrophosphate--fructose 6-phosphate
FT                   1-phosphotransferase"
FT                   /EC_number="2.7.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:BT0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17365"
FT                   /db_xref="GOA:A1QYH3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYH3"
FT                   /protein_id="AAX17365.1"
FT                   /translation="MVSVFQKERYKYIPKLPKILENDFQNISVVFGEKTEALGDRDALR
FT                   EIFKNTYGLPVVNFTQGSSNVDFTRVLNVGIILSGGPAPGGHNVVAGIFDAIKKSNPNS
FT                   KIFGFKGGPSGLLEDKKIEITQELIDSYRNTGGFDIVSSGRTKIETDAQYEQALSVILK
FT                   NNLNALIVIGGDDSNTNAALLAEFFKKKHHDIQVIGVPKTIDADLRNAHIQISFGFDSA
FT                   TKTYSEMIGNLCRDAMSTRKYWHFVKLMGRSASHVALECALKTHPNICIISEEILAKKK
FT                   TLSELVRDITSVVVKRSLKGYDFGVVIVPEGVIEFIPEVKSLMIELCSIFDSNESEFKG
FT                   LDVEDIRKIFISKLSGYMREVYVSLPLFIQIELVNSVLERDPHGNFNVSRVPTEKLFME
FT                   MVNVRLEELRKLGEYSGKFVPIDHFFGYEGRSVAPSNFDSDYCYSLGYNAAILVLNGLT
FT                   GYMSSVKNLNKNATEWLAGGVPLTMMMNMEERYGVAKPVIKKALVDLKGAPFNEFVKNR
FT                   EEWAVNNLYVSPGPIQYFGVSELVDEVTLTLKLELEN"
FT   gene            complement(20033..21070)
FT                   /locus_tag="BT0021"
FT   CDS_pept        complement(20033..21070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0021"
FT                   /product="putative S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17366"
FT                   /db_xref="GOA:A1QYH4"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYH4"
FT                   /protein_id="AAX17366.1"
FT                   /translation="MDTKEFYFDLPCKLIAQYPSEKRGLSRLMVLDSGNQKIYHNDSIN
FT                   DIFKYINSNTFLVFNDSRVRKSRIYAKTEHGGSIEFLILDRLAGDEFTSLISKAKKQNI
FT                   GKVYMFPQGLLAQIISKTDNEFIIKFNKCVSESYFEQHGLIPLPPYIKRNYDRADEERY
FT                   RTIYSKYIGSSASATAGLHFSEELFSKLDENNIEYDFITLHVGLGTFLPVRTKTIEEHK
FT                   MHFESFSIKNSVALRLEESKALGKKILAIGTTTLRALESAYDKQKGFVRGEQKTNLFIY
FT                   PGKGYEFKFVDMLFTNFHTPESTLLMLVSSFGGKDFVFSAYREAVKMNYKFFSYGDATL
FT                   FLNHM"
FT   gene            complement(21060..22103)
FT                   /locus_tag="BT0022"
FT   CDS_pept        complement(21060..22103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0022"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:BT0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17367"
FT                   /db_xref="GOA:A1QYH5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYH5"
FT                   /protein_id="AAX17367.1"
FT                   /translation="MDFGGGSKFLSSDKNFLYDRNESELRPKSLKDFVRQSHIKENLNI
FT                   FIKASRDRNEALDHVFLSGPPGLGKTTLASIIAFEMNTTIKMTSAPALDKPKDIVGILT
FT                   TLDDKSILFIDEIHRLKPVIEEMLYIAMEDYKIDWIIGQGPAARTVRMPIPKFTLIGAT
FT                   TKPGKVASPLYARFGIVFRFDLYNEDELVKIIQRNSIILNVKLEDKAAWLLARSSRGTP
FT                   RVANRLLRRMRDFAQVGGYGLITESIVSSGLEMLKIDHKGLDEQDRNILRSLILKFKGG
FT                   PVGVETLAISVGETADSLEDFYEPYLILKGLIERTSRGRKATDFAYFHLNLNKNNHDDL
FT                   NTGEYGY"
FT   gene            complement(22158..22748)
FT                   /locus_tag="BT0023"
FT   CDS_pept        complement(22158..22748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0023"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17368"
FT                   /db_xref="GOA:A1QYH6"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYH6"
FT                   /protein_id="AAX17368.1"
FT                   /translation="MINKICGKIVEKRESSIVIVALPFEFEILVSSFCNAELGLQEDVE
FT                   ILTYLHLREDEIRLFGFLNVSEREVFEKLISVDGIGPKAALRILSGIKYNEFRDAVERE
FT                   DVKLISNVKGIGNKMAGKIFLKLRGKLVKVNEASSGVLKFKELEQSIVNMGFDRKLVAA
FT                   AIKEIMLIDEFLMLRQVDQEQFLFREILRKLSG"
FT   gene            complement(22836..23321)
FT                   /locus_tag="BT0023A"
FT   CDS_pept        complement(22836..23321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0023A"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /db_xref="EnsemblGenomes-Gn:BT0023A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17369"
FT                   /db_xref="GOA:A1QYH7"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYH7"
FT                   /protein_id="AAX17369.1"
FT                   /translation="MIMRILGIDPGLANVGWGILDRKGSKYMYVQDGTVITHPFMSLKD
FT                   RLKLISDEIILIIDNFKPDVASIENIYFAKNKKTAISVSEARGAIILTFALKNLDFYEY
FT                   TPIQVKNSISGFGRIEKVQVKYVIRILLGMKPDFIFTSDHSSDALALAICHGNYHIL"
FT   gene            complement(23347..24081)
FT                   /locus_tag="BT0025"
FT   CDS_pept        complement(23347..24081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0025"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17370"
FT                   /db_xref="GOA:A1QYH8"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYH8"
FT                   /protein_id="AAX17370.1"
FT                   /translation="MSGHSKWSTIKRKKGALDAKRNKIFTKLIREISIAAKMGGGDIES
FT                   NSRLRLAVNKARVSNMPKDNIEKAIKKGSGDDNIGSEYFELTYEAYAPHGVALIIKCLT
FT                   DNKNRTASEVRSVLSKSGGSLGAPGSVSYMFHKKGLISYSLDKYPEDEIIELALEAGAE
FT                   DIYSEGSQIEVITSAENFEAISSFLRTKFEEDIAEIALIPGNKLSLNKEQMDKVLALIE
FT                   KLEDFDDVQEVVHNLEIIDEIN"
FT   gene            complement(24082..24987)
FT                   /locus_tag="BT0026"
FT   CDS_pept        complement(24082..24987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0026"
FT                   /product="methylenetetrahydrofolate dehydrogenase (NADP+)"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17371"
FT                   /db_xref="GOA:A1QYH9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYH9"
FT                   /protein_id="AAX17371.1"
FT                   /translation="MNNVFDGKLFANQYYLLLKEFLIHHDLVDKVSLKVILANDNPASK
FT                   LYVAVKERVSREIGINFHVIKLAGNSEQDNILTLIEAENINEYTDGIIVQLPLASEIDV
FT                   NMVLNSIMSTKDVDGLSAINLGKLISGDRKGFIPCTAFAVLKVLFDKGIEISGKTVVVI
FT                   GRSSLVGRPISILLSSKPYDATVITCHSKSTNLDVYVRQSDIIISAVGKPKLIKASMID
FT                   GYPYVIDIGISRVEIDGNSVLIGDVDFESVKEKVKFITPVVGGIGPVTVLMLMFNTIKA
FT                   HLIRYNKFDILEKLEKLVEV"
FT   gene            25147..25782
FT                   /locus_tag="BT0027"
FT   CDS_pept        25147..25782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17372"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI0"
FT                   /protein_id="AAX17372.1"
FT                   /translation="MKKNFLVGLTLLFLLHANVNRIEAYSIDRNGNSIIEVDLSLGIPL
FT                   FYHSLSKVFSSNLYPGGIGALKYKYHILSNLAIGFELRYMFNFDINHSFNLLNPDSGIG
FT                   KTFSTVPITFLTAYVFDIGEIFQIPIFSNIGFSLSSYGDKSDNISNLRTFDAMPVMSIG
FT                   SGILWNFNYQWALGITTAWWTMFELGNMAKIGHFLLISLSVIVNINKL"
FT   gene            25789..26820
FT                   /locus_tag="BT0028"
FT   CDS_pept        25789..26820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17373"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI1"
FT                   /protein_id="AAX17373.1"
FT                   /translation="MDKKGYKKFMIIILIMLVLSCSSESIFSQLSKLQKINSNNNILDT
FT                   SSPSGISLVNDTLYVAAMHLFKKSNGNVERVNFSNSYEFVIDLVNISGKTYLLVQNKNG
FT                   QLELYSLESNNWKLLFQKNLIPIKFLKSIGTSGITSAFILALGENGNQTILDTNGNNQT
FT                   PNSTTNNDKFYQISNDQQSITGKSAKIWKLKGGGVINVKSTNEIMAIIETSIRGSKETL
FT                   VFTGRNHDTSDHKFKIYSSTNNYQDPIFNRDGIGEFIAYFAREVDGIILIGSNNGFVEL
FT                   VRDKNTFDLQPPSQSVLPGSYNGSQLSKTRLNDIIPTSNKTIYILTQGKGLWKIENKKL
FT                   IKE"
FT   gene            complement(26806..27237)
FT                   /locus_tag="BT0029"
FT   CDS_pept        complement(26806..27237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0029"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17374"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI2"
FT                   /protein_id="AAX17374.1"
FT                   /translation="MLNKIFVDADSCNLQVIKFLQNFVSNRNVRLILVANRHLNLEMSK
FT                   NTSVKIARDVDSLILELIDKNSMVVTRDILFVKNLLNLQIKVMNDEGQIFDTNNINYLY
FT                   FRSKLNINLGIKVKKYFHEETNKVRYSNFAMNFYRLFFN"
FT   gene            complement(27227..27862)
FT                   /locus_tag="BT0030"
FT   CDS_pept        complement(27227..27862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0030"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BT0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17375"
FT                   /db_xref="GOA:A1QYI3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI3"
FT                   /protein_id="AAX17375.1"
FT                   /translation="MAAYLTFEQRLLRKKRRQNFLKIILLFLVLNYFFTKFVLQIFIFQ
FT                   GDEMLPLITKNDSLIFISKYMRSFFVPLKVNDVVLYEDSNLRRNFILNFFRDLFFLNKI
FT                   FNTRSYKIAKIVATQGDLVYVKGFDILVHRRDDNSYYLNGNFMSGYRLNDFFNFNEVIR
FT                   CFALKKNEFFLLNENLKILNDSRVFGPVEQSHILSFLVLRIMDYKFVK"
FT   gene            complement(27865..28845)
FT                   /locus_tag="BT0031"
FT   CDS_pept        complement(27865..28845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0031"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:BT0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17376"
FT                   /db_xref="GOA:A1QYI4"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI4"
FT                   /protein_id="AAX17376.1"
FT                   /translation="MYLEKLDKFANFLVKIIEKYLTYRKKRKYFYKLKAKRRGFMLNFL
FT                   LELLGASIFVLGINQYFLQAYRIPSGSMENTLQIGDLLFVDKFSYGPELLPGVCKINGV
FT                   KEPNEAEIVIFENVEYESKGLFFDILHRLLYMLSFSFVDLDRDENGNPSVRFLVKRALF
FT                   ADGKLVRFRNGTVFVRKEGEESFIEENSYKASLGYNFGIKKVIEDVDYKVYDNLAMFIA
FT                   LNQLSVDLENISDFSFFNVREVDRFEIERLEYRYLVAFMPYVDYYMEKAIMRDYGIYVP
FT                   YGYVLPIGDNRDNSYDGRFFGVINKSKILGRAFFMYFPFSRIGLI"
FT   gene            29037..30506
FT                   /locus_tag="BT0032"
FT   CDS_pept        29037..30506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17377"
FT                   /db_xref="GOA:A1QYI5"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI5"
FT                   /protein_id="AAX17377.1"
FT                   /translation="MLKENDRLDINEELLTVKLKPILGITPKIYVFFTIIILPLILVFS
FT                   LIINTKLNNPGAYLKIKTNVNNAHVYLDEKYIGRTPLKKYINTTKGTLKIQRLGFETYE
FT                   KKIDIQNKFFTSYQFNIDLRLKNPDKIIAQRQKELSVMTKIKNNNDNIQLIPVFSLIVN
FT                   DLPNSPEHIKKFFKTSIPHIHSNTMFKDFLIAYKDMYSINNNNSKEIWKSLQQNFNLEN
FT                   RTIIWFFENLDKEQQKQISNETWFKTLIEKLKNENKILNFETKNINLHLKDFKKIAPQN
FT                   IESTQNYKLYSQNLTLKTTYKLKEFLIQNRNVTKTEYQKFLNENPKWTLNNKDNLIKEE
FT                   LVDESYLKTFKQMPSNEDITHISYHAATEYAKWYSSNLPKGFKARLPISQEWEVYQKEV
FT                   PKAIESLNTNEISKKVGFWNLMQNPNINDSILFQDENDIYYAHSNFNSLITEIRTYNYN
FT                   NNSTLKPSTQASFLKHWCSPNIGFRLVIEKE"
FT   gene            30509..30958
FT                   /locus_tag="BT0033"
FT   CDS_pept        30509..30958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0033"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17378"
FT                   /db_xref="GOA:A1QYI6"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI6"
FT                   /protein_id="AAX17378.1"
FT                   /translation="MSILLLENKKARFNYFIEDKINCGIILKGTEVKSIKLKKFSFNDS
FT                   FASIKKDEVWLENLHIAKYKEGNIFNHEEIRRRKLLLTKKEIQKLKKFKEKEGYTLVPI
FT                   SIYLKNSLIKVELGVCKGKKLFDKREVLKQKSIKKDLNREIKQYR"
FT   gene            complement(31174..31698)
FT                   /locus_tag="BT0034"
FT   CDS_pept        complement(31174..31698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17379"
FT                   /db_xref="GOA:A1QYI7"
FT                   /db_xref="InterPro:IPR008420"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI7"
FT                   /protein_id="AAX17379.1"
FT                   /translation="MKKILILMLVFFCAFVSFAQNHDELVGSGGNVEKMLLYETYKKDA
FT                   VVPCLLNLFVGFGIGSLVQGDITGGLLSLGFDVVSIGLLSYGTYSIIESHYEKKEKPTV
FT                   LALSLAAVGGATLVLTRIIEAVLPFTYASSYNRKLQENLGITLGGLQPEVDMNFNEDAR
FT                   LMLEVSFTKRY"
FT   gene            complement(31829..33715)
FT                   /locus_tag="BT0035"
FT   CDS_pept        complement(31829..33715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0035"
FT                   /product="topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17380"
FT                   /db_xref="GOA:A1QYI8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI8"
FT                   /protein_id="AAX17380.1"
FT                   /translation="MDIKTLLKDNFLQYSSYVIKDRAIASVIDGFKPVQRRIIHSLFEM
FT                   NDGNFHKVANVVGNTMKYHPHGDTSIYEALVNMANKDLFIEKQGNFGNLLTGDPASASR
FT                   YIECRLTPLAFEVLYSKEITSYEPSYDGRNDEPLIFPAKIPVILVQGSEGIAVGMAAKI
FT                   LPHNFNEILSAVKSELLGESYELYPDFPTGGIVDVNEYADGNGKVLVRARIEPTDDNKA
FT                   ILIKELPFGETTESLIASIERAIRKNYIKVSSINDFTTENVEIELTLPRGVYASEVIEK
FT                   LYHYTNCQVSISVNLLLLSDRYPVIYTVTDIIKFHAEHLQKILKMELELERNKILEKIF
FT                   SKTLEQMFIEKKIYKILETISKESDVVNIVLSEILKYKDSFLYRDIVLDDIENLLKIPI
FT                   RKISMFDIDKNNKDIRNLSKELKSVESNIKSIRGFSINFIDTLLEKYSKVYRRKTEISL
FT                   IKSKNVKEIATKNMKVYLNLKAGFVGTSLIDGEFIGNASYYDKILIFKKNSYVLKNIED
FT                   KTFIDKNNVNVLVYDINNSKDQVFSIIYLNKADNFYYVKRFKIDKFITDKIYEFLNDGD
FT                   EFIDFALNPEFVEFSTSKDIVRMISIDDFMIKSRISVGKRISSSIIKKVKFK"
FT   gene            complement(33715..35511)
FT                   /locus_tag="BT0036"
FT   CDS_pept        complement(33715..35511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0036"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17381"
FT                   /db_xref="GOA:A1QYI9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYI9"
FT                   /protein_id="AAX17381.1"
FT                   /translation="MNTNSYDESKIVTLSSLEHIRLRSGMYIGRLGDGSNIDDGIYILV
FT                   KEIIDNSIDEFIMGHGKEILIKKENNIISVRDYGRGIPLGKVVESVSVINTGAKYNDDV
FT                   FQFSVGLNGVGTKAVNALSSNFLVRSIRDGNFFEAIFSKGNLINTIEGKSNEQNGTYIE
FT                   FLADTEIFGKYKYSEDFLRRRFFHYACLNKGLKINYNDQIFQSDNGLLDFINAEIKGED
FT                   LLYDFVYYSSKTLEFAFSHTNNYGETYFSFVNGQYTSDGGTHQTGFREGFARAINDFLK
FT                   KTYSSTDIREGLIATLSVKIKDPIFESQTKNKLGNIETRSSVAKEVQRIILEILYKDKT
FT                   LAKAIENKVVDNERLRKELSSVRKEAKERAKKISFKIPKLKDCKFHFNEKSMHSDSTMI
FT                   FLTEGDSATGSMVSCRDVYTQAIFSLRGKPQNMFEKNKSEIYKNEELYNMMVALGIEES
FT                   IENLRYNKIVIATDADFDGFHIRNLLLTFFLTYFEDLVLNGHMYILETPLFRVRNKSST
FT                   IYCYFEEEKQKAVRELKNPEVTRFKGLGEISPSEFRSFIDVSNIRLTKVDLVNIKEIKE
FT                   HLGFYMGPNTPERRNFIMENLI"
FT   gene            complement(35498..36271)
FT                   /locus_tag="BT0037"
FT   CDS_pept        complement(35498..36271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0037"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:BT0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17382"
FT                   /db_xref="GOA:A1QYJ0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ0"
FT                   /protein_id="AAX17382.1"
FT                   /translation="MKILRSIVTYINFFFFVLVFTVLFPVFLIFKIFRFENYFIKFSFI
FT                   LVRFAIKISLWFAGIKVIVTKDDDCSLPEDGVVIMANHIASMDPLFLIYVFMKPFVIVA
FT                   KKSLLKIPLINFLLISMGSIFINRNSIKSSAITQRKAAKVIQEGGAIGIFPEGTRNRGG
FT                   STRDFKRGSVNLALRTNSSIIPVTLFNTHKVFVKNLILNSGLSIYVHVHSLIDVSNLTD
FT                   DDKAQLHIIVRDKIIKKLEKMKIQYNVDRNLNEYK"
FT   gene            complement(36277..37728)
FT                   /locus_tag="BT0038"
FT   CDS_pept        complement(36277..37728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17383"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ1"
FT                   /protein_id="AAX17383.1"
FT                   /translation="MCFKKWIIFLFVTLFSCVKGSKDFIVFNKEMKKISEISYSDTGLS
FT                   GDTGEDVFGSLIDLKGYKILSVHQENLNLDVYFEQVVLAQNFADLKTYLFIIGFDPKSH
FT                   EAVVLFKTQVNIDSKNSYNMYLEDITGDYNFDIVIQGFLDEDSVLYIFQRAVANDVASY
FT                   RPIFFDKVNGSIIINKYDRSSAYDDKKSRESYSISLERYEKQGEDMIVSKIEKYEYSQL
FT                   QGKYYPLSASEKVRRIDNDVYQTLKNLPKEEVYKFLYGVWYDSNAHQRLRKSNFEDALF
FT                   LSFNRHLNEISIFKNNAQEIAHIEYISRPAYNTLNISTKSIFSDLIVYNFWIKIIDIDN
FT                   IEIKIDTGTDAYDKYGFSGVFKRFNDSVLVEDDKDSLFIPNGNYVCKDIIYDFSYPNLT
FT                   YIVGDNIYYGIFNVFSLNNNLVLEYEISMDENKISEAFIIEYSERIVQKQKFSTILLNP
FT                   IKILKDEVSLVKGQKLKLERIEKLG"
FT   gene            complement(37793..39286)
FT                   /locus_tag="BT0039"
FT   CDS_pept        complement(37793..39286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17384"
FT                   /db_xref="GOA:A1QYJ2"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ2"
FT                   /protein_id="AAX17384.1"
FT                   /translation="MRKRVNQAKEVISKVDFNDKKVGTWGLLALIVIVFGFIIAPLMPG
FT                   LFDTTDSSSLKFGSYKGQPVYYEKDNKFAQYVKSYSNFYSKLKKNNSLDIEYFIWNLAF
FT                   MKYVEDIAFIDLAKTNSFYVSKNILNKNLMNSPVYLDSSGNFSPKRYNKVSDYQKFKIH
FT                   NETVDNLLSSNIQVLLSSSFILPDSLLNAIKSMNEIRRNIVYVSLSYQDFPKDKVISYA
FT                   DQNQKLFKSLDIVSIRFKNLSDAGGAYEKLSKGMPFEEVAKFYSEDVTNFKGIASSKKY
FT                   YFDLDLVLEKKEDLAAIFSLKMNEFTSPIKSKNGNGYDIYKALSNIGDFDKNSEHDISS
FT                   VRNYIETYEPSVIETFLEKKLNDILTEVNFDGPQQVFKKHNLVLKKDVVNLAYNMNIYP
FT                   STLRELSVFSNSKDFYDVIFDLKEGQWSKPFLADQRVYLFSFSSSVNDSVNSDNLIKED
FT                   RMLDILYQANNKLVLDYILNKNNFKENFNEAFFSLQDFS"
FT   gene            39488..40327
FT                   /locus_tag="BT0040"
FT   CDS_pept        39488..40327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0040"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:BT0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17385"
FT                   /db_xref="GOA:A1QYJ3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ3"
FT                   /protein_id="AAX17385.1"
FT                   /translation="MNNEFNIKINQEEFNRLTKIIYNNFGINLNDKKKLLIESRLSSTI
FT                   RAKNLSNFTEYINYLEKQNNQISLIELVDKISTNHTYFFREPNHFEFLEKKLLPKMLKQ
FT                   MAQSREEEIRIWSAGCSSGEEPYTIAMILNEYINNNKIHCKAKILATDISITVLNEAKM
FT                   GIYSEDRVKTLPNHLKIKYLNKITNDKFEVKDILKKMIQFKKLNLMNAIFPFKKKFDLI
FT                   FCRNVMIYFDEKTRNKLAEKFTQHLKDDSYLLIGHSEAIRDSKNLEYIMPATYKKIN"
FT   gene            complement(40375..41046)
FT                   /locus_tag="BT0042"
FT   CDS_pept        complement(40375..41046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0042"
FT                   /product="phosphate transport system protein PhoU-like"
FT                   /db_xref="EnsemblGenomes-Gn:BT0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17386"
FT                   /db_xref="GOA:A1QYJ4"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ4"
FT                   /protein_id="AAX17386.1"
FT                   /translation="MIRRRLTKQLEVIKDYLWDMKECVLKIIENSLIALESRDKNLAKK
FT                   IINEDEKMIDDYQYDIEDLCGRIIATEHPVATELREILAIIKIISSLERIADHSTKIVK
FT                   VVLLLESNVGDFSSVDIYQKPLREMADTAKDMLANIFDAYFDGDFVKILKIVKYDNIID
FT                   KLFSKQKTIVIDAMKNNPENLDYLLNILFLNSFLERVGDHVATIGELLYFVKVGEKVNL
FT                   T"
FT   gene            complement(41058..42083)
FT                   /locus_tag="BT0043"
FT   CDS_pept        complement(41058..42083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17387"
FT                   /db_xref="GOA:A1QYJ5"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ5"
FT                   /protein_id="AAX17387.1"
FT                   /translation="MSKECFIYFNFLFFIINIIPSLAFENRYSTYELDFSSEKQEFLVN
FT                   TNSKFNFFFKDSTWIYIKNVKNNAFIRLVSESYQNGAMFTFQTSKNIGIIILTFKYQNV
FT                   KDSREFTKNVILKIAKREESSNLNEMNPKGNLSLDKFIKTDKSNNNLSLRDIMKRALNL
FT                   SYINDYKGAIALLNKYDFDDNEYTLLKAELYYKSGDYLNSYLNYLSLRDVYFNKIFLNL
FT                   IDLGIKLSKVENVLRDVRFLVENNIDFSENTYLDILEFLLMNGEYEFFLNLSLLYYPKY
FT                   LNSRFPDRYNYLLGKLYETESKYKDFIKSLSYYKRVIDSYPFSSYYELSKLRFLFLKRF
FT                   F"
FT   gene            complement(42080..42466)
FT                   /locus_tag="BT0044"
FT   CDS_pept        complement(42080..42466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17388"
FT                   /db_xref="GOA:A1QYJ6"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ6"
FT                   /protein_id="AAX17388.1"
FT                   /translation="MREKKFRFQKYFLILILLSIIVSFFTYFYSYRMIEKTRSNTEEHL
FT                   NQKLKLLNIEDFYFDLNSSLNMDDFFFPKPNLPDGKLGDSVMHHQSISEELLKSLWVKS
FT                   DNLFNIDLEKENESLVDKILENYK"
FT   gene            complement(42494..44959)
FT                   /locus_tag="BT0045"
FT   CDS_pept        complement(42494..44959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0045"
FT                   /product="chromosome partition protein Smc"
FT                   /db_xref="EnsemblGenomes-Gn:BT0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17389"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ7"
FT                   /protein_id="AAX17389.1"
FT                   /translation="MGVALFLEKIGLLGFKSFVKMQELKLNSSLNFIVGPNGCGKSNLL
FT                   DAIRFCIGEDNLSVLRVKYITDLISDVKSGESNFAEVTLFFNNEDLSVSDFRDRFYIRR
FT                   RLYKDGTSEYFLNNDTLNLKSYESLINKLRLKNSPYMFINQGKIEKISSSGSINLKSLI
FT                   EEASGIDMLRVEEEQAYKRLEKSKENLNSLWTLRDELNEKYEKIKNDFFLKGKYQKLKM
FT                   DLEILEKNLRLKKLFNINFELNELKSKLDIKDIDKILSLNSFSIESVKEKLEFYSFREK
FT                   NVIKNIEVIKKEIETLKSKLLEIEIKIQKLEHDRKGKLNLADIFMSNKVQIESVKVGIN
FT                   EELVDLNNSLQSKKKDFFTVTDEINRYTRSFFELVDLVLSISKESNIEEFELLKKNILN
FT                   SLKYFEDTLSIKYIKEIRENLLKYIVKEDKLLNLLKEKIEPIFEQNVDLRKFLLAKNNS
FT                   KTSLAKEITTIEGLVSNKTAKLNEILGEIEYTELSRLKNEDEIKLIDSNLRFLFETRDE
FT                   LRERLNNLNLKLDELSLERSDINVNLDKFLSEAKGSELVASNEINSLNLLDAFKNSSYY
FT                   EYMKKQAEYDILFNSSLDIADEIKDFNLVNKNLEKFEFTEDMAKIGALQKEINMIEHNN
FT                   YIFFNVEREYNEIKEKVERISSQIDDLNSTKESLNKLRKKIKREIDKRFNDAFNEINNH
FT                   FVYFFNRMFTGNGSLFYGKDSGEIEIKIDFKDKLAKGNKMLSGGEHSLISIAFLFALYY
FT                   YSPASFCVLDEIDASLDFENSNKLSVLLKELGQRVQLFIITHNMYVAQGSKNLIGVTSD
FT                   NGESVIFNI"
FT   gene            45014..45562
FT                   /locus_tag="BT0046"
FT   CDS_pept        45014..45562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0046"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:BT0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17390"
FT                   /db_xref="GOA:A1QYJ8"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ8"
FT                   /protein_id="AAX17390.1"
FT                   /translation="MMICGIDEVGRGCIFGPVLSAAVIFKGNPKFLNALDDSKKLNKSK
FT                   REYLSSLILENSYYAFAEVPNEIIDKINIHHASLLAMQIAYEKLNIECNLVLVDGKFIP
FT                   KIKAKKIQAIIKGDSIINEIKAASIIAKVQRDKLMDEYDKIYPLYALKKNKGYPTKEHK
FT                   DAIKKYGISRLHRRSFQLI"
FT   gene            complement(45571..45945)
FT                   /locus_tag="BT0047"
FT   CDS_pept        complement(45571..45945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17391"
FT                   /db_xref="GOA:A1QYJ9"
FT                   /db_xref="InterPro:IPR006628"
FT                   /db_xref="InterPro:IPR021694"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYJ9"
FT                   /protein_id="AAX17391.1"
FT                   /translation="MEDLMGERGEVYSDKLFTNSDRTYFFNVKENRKGDYFLNIVESKR
FT                   NVNGDFERHSVFVYEENIEEFESNLLRAISVVKKKISKNSVTRGDYHNDFDRHRERSKN
FT                   GNLSFDRNYRFSDKSRDENN"
FT   gene            46089..46161
FT                   /locus_tag="BTT0001"
FT   tRNA            46089..46161
FT                   /locus_tag="BTT0001"
FT                   /product="tRNA-Gly"
FT   gene            46726..47412
FT                   /locus_tag="BT0050"
FT   CDS_pept        46726..47412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0050"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17392"
FT                   /db_xref="GOA:A1QYK0"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYK0"
FT                   /protein_id="AAX17392.1"
FT                   /translation="MNNEILWFIMLICTYSSLIIIYKLFGKKGLFAWVTSSVIIANIQV
FT                   LKQITIFGFNATLGNIIYASSYVATDILSEFYGRKISKKAVYIGFISFIAFAFITNIQL
FT                   YFSTSSSDIYLKSLESIFSSIPILLVASIIAYIISQLNDIYLYQFIKDKFPKFLFIRSN
FT                   GSTLVSELIDTIIFVSIATYFNIFPKEAYLDIVISTYFIKGFAGILGTPFIYIAKCVYQ
FT                   NKKNSI"
FT   gene            47464..48147
FT                   /locus_tag="BT0051"
FT   CDS_pept        47464..48147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0051"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BT0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17393"
FT                   /db_xref="GOA:A1QYK1"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYK1"
FT                   /protein_id="AAX17393.1"
FT                   /translation="MMDMILWMTLLVFVYLQLTLLYYLFGKSGLFCFNIIMTILSNLII
FT                   LKKVFIFEQQISLAGIIFLSILCSLNLITEKYNDKLAIESTTLNMFIHITFVIMIHFTL
FT                   YFQQNEFDTSNIHLKVLFNNASYTAIIFTGTYIIYLCNYVNIKIYSILQKNNISNKLIN
FT                   HNLSRLCSACIAYILANISMHVIAQLYPGNNINMVESSWIFTITIMIIDTFIYYFLNAL
FT                   KVRKA"
FT   gene            complement(48134..48832)
FT                   /locus_tag="BT0052"
FT   CDS_pept        complement(48134..48832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0052"
FT                   /product="tRNA (guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:BT0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17394"
FT                   /db_xref="GOA:A1QYK2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYK2"
FT                   /protein_id="AAX17394.1"
FT                   /translation="MNWILLFFYIKLYFVSNEILKRIEILSEFITQRRRERIDEVLSNR
FT                   TNYLTLVLEDIFQPQNASATMRTIEILGLSNIHIIETNNTYTLNPGVVLGASKWIDIIK
FT                   YQCVESAFDNLKGNGYKIVATSLDNEAIFLDDFPIDDKMAIFFGTELTGLSNTVLENAD
FT                   LHLKIPMYGFTQSYNLSVAVSIVFYSLISRLRKSSIKYLLNEDEKLVLKLDYYRKIVKK
FT                   YQTIEKLKLF"
FT   gene            48870..49541
FT                   /locus_tag="BT0053"
FT   CDS_pept        48870..49541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0053"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17395"
FT                   /db_xref="GOA:A1QYK3"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYK3"
FT                   /protein_id="AAX17395.1"
FT                   /translation="MEVKIEESWKEMLKGEFCKSYFKRLVNFIKNEYKTKKDKIFPSPK
FT                   LIFNAFDSLPFKDIKIVILGQDPYHGKGQANGLAFSVNSDIKIPPSLQNIFKEIERSLK
FT                   IKTIPNGDLTRWATQGVFLLNSILTVEEGRPSSHKDIGWEIFTNEVIKIISKNLNNVVF
FT                   MLWGNFARGKKELIDASKHLILETSHPSPYSAHNGFLGSNHFSQTLKYLKEHNKISIDF
FT                   Q"
FT   gene            complement(49605..49967)
FT                   /locus_tag="BT0054"
FT   CDS_pept        complement(49605..49967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0054"
FT                   /product="protein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:BT0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17396"
FT                   /db_xref="GOA:A1QYK4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYK4"
FT                   /protein_id="AAX17396.1"
FT                   /translation="MELFRLLIFVFFIITSFMIVLLVLFQDEQGDSIGGVFGGGSSSIF
FT                   GAKSSNIAIRITAFFITLFFIFVIALSFINTRRVDNSLLKDVKTNEKSSTFWNDDTNQN
FT                   EENEDVVNEDTLKKEK"
FT   gene            complement(49979..50743)
FT                   /locus_tag="BT0055"
FT   CDS_pept        complement(49979..50743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0055"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17397"
FT                   /db_xref="GOA:A1QYK5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYK5"
FT                   /protein_id="AAX17397.1"
FT                   /translation="MRKIFLAGNWKMHYTSMEAAGVAKQIVDGVKNIKDDVVVMITPPF
FT                   TSLCKVCEVTRGSNVLLGAQNMSYEDSGARTSEISPSMLLEFGVDYVILGHSECRTYLG
FT                   DTDEVVNKKVLAGLKHPFKYLILCIGETLEERENNKTLDVVLNQIRKGLISVSESDLKR
FT                   IILAYEPVWAIGTGKTATKEEAQEVHRAIRHEVELLYSVSAANNIIIQYGGSVNIDNVK
FT                   GLMGESDIDGALIGGASLKADSFLNIVNKVAK"
FT   gene            complement(50745..51923)
FT                   /locus_tag="BT0056"
FT   CDS_pept        complement(50745..51923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0056"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17398"
FT                   /db_xref="GOA:A1QYK6"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYK6"
FT                   /protein_id="AAX17398.1"
FT                   /translation="MSIKTIKDCDFAGKRALVRCDFNVPLKEGNITDDTRIRAALPTIE
FT                   YLKSQGARVILMSHLGRPKGEKNLKYSLMPVAKRLSELLGQDVKMLPDCIGDEVATTVS
FT                   CMKNGDIVLLENLRFYKEEEENCDAFVRKLSQNGDIFVNDAFGTAHRAHASTAGLAAYL
FT                   PAVGGFLMEKEDEFLGKILRNPESPFVAIIGGSKVSSKIAVLESLLPKSNVMVIGGGMA
FT                   YTFLKVEGYSIGQSLLENEYIDVASSFLKKAKELDVKVILPLDHVVASEFREDSIPEYV
FT                   DSVDIPNDKVGMDIGEKTLRKIEEVLVSAKTVIWNGPLGVFEFNSFSKGTAKVAEYVAS
FT                   CSGITVVGGGDSVAAVNKFNLSEKITHVSTGGGASLEYLEGKVLPGIKVLEK"
FT   gene            complement(51952..52959)
FT                   /locus_tag="BT0057"
FT   CDS_pept        complement(51952..52959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0057"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BT0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17399"
FT                   /db_xref="GOA:A1QYK7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYK7"
FT                   /protein_id="AAX17399.1"
FT                   /translation="MKLAINGFGRIGRNVFKIAFERGIEVIAINDLTDPKTLAHLLKYD
FT                   STFGIYNKKVEARDGAIIVDGKEIKIIAERDPKNLPWGKLGVDVVIESTGVFSSATSDR
FT                   GGYLDHVEHAGAKKVILTVPAKDEIKTIVLGVNDHEITSDLKAVSNASCTTNCLAPLAK
FT                   VLHETFGIEQGLMTTVHAYTNDQKILDLPHADLRRARAAALSIIPTSTGAAKAVGLVLP
FT                   ELKGKLNGTSMRVPVPTGSIVDFTVQLKKKDVTKEEINSALKKASESRELSGILGYTED
FT                   PIVSSDIKGNSHSSIVDGLETMVLLNGFVKVLSWYDNEFGYSTRVVDLAQKLVK"
FT   gene            complement(53033..55018)
FT                   /locus_tag="BT0058"
FT   CDS_pept        complement(53033..55018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0058"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17400"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYK8"
FT                   /protein_id="AAX17400.1"
FT                   /translation="MNLKRFLTMLLIFNLNFGSLIGDTTTAIKYYQKAQTYYLMQKYYD
FT                   AIDELLEAVKINPNYYEAYKFIAEIYYLLKIYNQAQFFIEKAYKMSNGDTKYKILYANI
FT                   LLKNNRTAQAKKFYSEVLAKQKNNIDALVGLASIFEEEGLLIAAANYYLSILEYNQTNY
FT                   NAFERLMSIYEKLNMNDKAQHLINKVRGNFTSLPDFHKRVAEFSIKTNSLGVAEKYAQN
FT                   YLMLVRTTYRDFGLVDAYRLLALVYLYQSKYEDATDFLQKAILVDQNSDELYYLLGYSY
FT                   LKLERVDKAVLNFERAKSMKKDLEFYDIALEESFFVSNFRSSFQKNNGTNIGISKRYEN
FT                   EGLKAFKNLNLDRAVFNVRNAIDIYPDNDSARFLLAKIYKFMKLDVMAYEELYYLIEHR
FT                   KVTDTKILDFYDVVAFDIRSSLFFKYGYKTIGDLNRLYNNQTVYRVGIFTQNENKVFGA
FT                   NDLILKYAERILDRNLNIEVVNYRFDYNKDKDYLVSSFSEEFSYARNNNLDLFLMFDLD
FT                   VDVFKNSANLRVDIFSGKTGVKVKTFDYNSGGVLYLSDILSSFSRDFNDYLPKKGEILQ
FT                   IKRDDVLINLGHVNDVKKGDVFLVLKEGALKYNSDSSSFMSYSKSDILGEISIEEIGDY
FT                   ISRGILKAPTLLRDYIQEGYTVFIKK"
FT   gene            complement(55015..55794)
FT                   /locus_tag="BT0059"
FT   CDS_pept        complement(55015..55794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0059"
FT                   /product="magnesium and cobalt efflux protein CorC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17401"
FT                   /db_xref="GOA:A1QYK9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYK9"
FT                   /protein_id="AAX17401.1"
FT                   /translation="MMFKFLSFKNKKIRDDDCKNIEEKSKFETSLLKNFNSLKETIVKE
FT                   IMIPRISVVFVDYSWSKDEILKVVTSSNHSRFPVYRETIDDIIGIIHTKDILLHMWKRD
FT                   FYEIDLRDIMRKVMFVPESKKIDSLLKEFQENHVHIAIVVDEYGGVAGLVTLEDILEEI
FT                   VGDIQDEFDNELDEIVPLDDGSYLCTARVLIEDLNEKLGLSLPDGDFDTLGGFVYDLFG
FT                   RIPLKNEKIKYNNLTFTIKNMHQRNIKVIKISQKEGL"
FT   gene            complement(55791..56237)
FT                   /locus_tag="BT0060"
FT   CDS_pept        complement(55791..56237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0060"
FT                   /product="hypothetical metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17402"
FT                   /db_xref="GOA:A1QYL0"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYL0"
FT                   /protein_id="AAX17402.1"
FT                   /translation="MIKEELNLWAEGVEFKHWDAYYNFILSVLDFLCIKEYELSVILCN
FT                   NEYIQKLNSQFRQKSEPTDVLSFNYLEESGQIDHKIQGDLIISLEYLEFSSLEFNVELY
FT                   DELQRNTIHGILHLIGYTHKTNDFQNEEMLIIQEKVLRETRRVF"
FT   gene            complement(56326..56679)
FT                   /locus_tag="BT0061"
FT   CDS_pept        complement(56326..56679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0061"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BT0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17403"
FT                   /db_xref="GOA:A1QYL1"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYL1"
FT                   /protein_id="AAX17403.1"
FT                   /translation="MAISLTKQEFIDKVFDYKNNKEWDFKGKKPAIIDFYADWCGPCKM
FT                   LAPIYDELSKEYGDRIDFYKVNTDKEQEISMALGVQSLPTIIFVPVGEKPRVSVGFIQK
FT                   DSFEDAIKDLFKV"
FT   gene            56753..57475
FT                   /locus_tag="BT0062"
FT   CDS_pept        56753..57475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17404"
FT                   /db_xref="GOA:A1QYL2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYL2"
FT                   /protein_id="AAX17404.1"
FT                   /translation="MNLILINPDELKNGLILNDSRVKHINEILKLKNNETFKFGIIGEE
FT                   HIYSCVYQKDVKLFFRKNHKIAKSNKLKKLKVIIGLVRPIAAKRIITHLGSMGISELIF
FT                   FNALLSEKSYSCSKLFKEREYEKYLIEGAMQGGITYIPKVNILNNLREVLKNTEYEGSN
FT                   TTKILLERESKNKLVDLNIKTKNTVVIIGPERGFITKEINLIKEYNFNAYNISSNILRT
FT                   ETATIVASAIITSKMNSK"
FT   gene            complement(57596..58636)
FT                   /locus_tag="BT0063"
FT   CDS_pept        complement(57596..58636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0063"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17405"
FT                   /db_xref="GOA:A1QYL3"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYL3"
FT                   /protein_id="AAX17405.1"
FT                   /translation="MSDNRPPHNKNLSSSNNLCEYNENFDSKVLTLPKHVAKGLILTIF
FT                   GSLIISCAIFFIFLKSNDIVVVPNLSELYLEDAITELQNKELIPYVELKFSSTSLDKGK
FT                   VIDQNPKAGTVLRLDSKVKIFISKGAVINKVDSFIGKNIDDVLINLKANSINNNRMFYH
FT                   LLKPIEIESTLPKGTIIRQEPSPGTKISSLVDLQFLVSKGQGDPPVKYVKNYIGLYYKD
FT                   AIISLLNDEIDFDVNLSSGNDFGSVIFQSLSPGSKIENLDKLTITINEPRSNDTGVFGF
FT                   LTYKLDMYPSSVDIMVKIKDPNGSSSLLYSFRSKGGLIKLPYEALKGSIIELYIYDRLV
FT                   NQTVVN"
FT   gene            complement(58673..59602)
FT                   /locus_tag="BT0064"
FT   CDS_pept        complement(58673..59602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0064"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17406"
FT                   /db_xref="GOA:A1QYL4"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYL4"
FT                   /protein_id="AAX17406.1"
FT                   /translation="MRIFFASSDSIALEVLRKVSDHYNVVGVLTAPDKPSGRGLFLKVN
FT                   DIKVEAINRNITVLDPVVLNSDVIGMVKKLKPDLMLVFSYGKIFRQEFLDIFPMGCINV
FT                   HPSLLPKYRGPSPIQTAILNGDTIGGITVQKMALEMDSGNILAQSQFEIKSFNTSADIF
FT                   RYVSLNSFNLVLEALSKLNKGHIGIVQDSNQATYCSFFNKQHRMLNFNLSAFEIKNKIN
FT                   ACNPWPLARAKLDKDEIIFHRADFIKTTDYSDQAIGKIVSFDPSKGILVKTEDGILLLL
FT                   ELQRSGRKVVDYKSFYNGNRDLIGKIFS"
FT   gene            complement(59599..60096)
FT                   /locus_tag="BT0065"
FT   CDS_pept        complement(59599..60096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0065"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BT0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17407"
FT                   /db_xref="GOA:A1QYL5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYL5"
FT                   /protein_id="AAX17407.1"
FT                   /translation="MKIVCYPNDLLRIKTKTVLNIDNELRNTAFKMVNLMDAKNGVGLA
FT                   ASQVGLDLSIFVVRENAMSKPLIFINPLITETSFELVLYKEGCLSIPGVYYDLLRPKSI
FT                   IVEAYDENGEFFKIESSGLLARIVQHEMDHLKGVLFIDYYEDKLRNNLLRSYMKKRRFV
FT                   KT"
FT   gene            complement(60120..60809)
FT                   /locus_tag="BT0066"
FT   CDS_pept        complement(60120..60809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17408"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYL6"
FT                   /protein_id="AAX17408.1"
FT                   /translation="MRFVSLFVIFIVFCFVHLFSLSSDIIFHDSYKDAMDEARSLHKNV
FT                   LILVGKDIKGNLIRDFLKSFEDDNLLKAIAKNNVFLIIDVNNEIFGEINLKKSPTLFFV
FT                   DSQSEQIKAAYVGSIRDTVQCNQEFLNYALGVSKLDDIIHKKNNYEINTLDDKVFFYKT
FT                   LDGHWRLRMNGQDKKLLPSKIELKEFLVFKDENEGKLYAFPKSRKGSIYFSEAENEEWK
FT                   LFGQIKL"
FT   gene            complement(60806..62584)
FT                   /locus_tag="BT0067"
FT   CDS_pept        complement(60806..62584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0067"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17409"
FT                   /db_xref="GOA:A1QYL7"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYL7"
FT                   /protein_id="AAX17409.1"
FT                   /translation="MEISTKIFSLRNLMMKSEIDAYLIASYDPHMSEYSHVRFNVREFI
FT                   TGFTGSAGTVIVTETEAVLFTDGRYFLQASSELKGTEFKLMKLGVKGYPDIFGYINANL
FT                   KGLRLGIYSEDVNIKFYNDLVQNCRYTDIEILHEDLVSKIWQDRPGLESNKIFELSGAQ
FT                   KIDKRTDKLDKVNAKLEEKAIDFCIISSLDEIAWLLNLRGLDVESSALFYAFLFIARSE
FT                   RYKNVLFVNIDKLDSELSERFEAEGFEIEDYSNFYSFLAEINHEGKFFIPVESNVKILE
FT                   SIGKPNAILGESIVNELKAIKSDYEISKMKEAHIIDAVSLIKFLYKFKSLNKDELSKLD
FT                   EVDVANMLLNFRTARDEFFSSSFNSIVGFKENAALPHYRPTKGAKNLDGNGLLLIDSGG
FT                   SYLELGTTDVTRTILIGEASCKEREDYTLVLKSFIALASLKFPFGTLGSSLDGIARFPL
FT                   LKQGLNFAHGTGHGVGFFLNVHELPVSISPLSSYSFKGSEIASIEPGLYRDSEYGIRTE
FT                   NLVFVKQSYSNEFGTFLEFENLTLVPFEKELIVTEMLSKDELDYINSYHEFIYSSLKEY
FT                   LSGDELKFLEILTNKI"
FT   gene            62706..63596
FT                   /locus_tag="BT0068"
FT   CDS_pept        62706..63596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0068"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17410"
FT                   /db_xref="GOA:A1QYL8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYL8"
FT                   /protein_id="AAX17410.1"
FT                   /translation="MKDIKAVISDLDGTLLLSNSQIGAFSEIVIKKLTKENKKFIIATG
FT                   RSKNEIISLTEHLNSHVSFFITLNGARVYNNQWQLISSYDLSSEIVNEILNLRENKYKD
FT                   IPHFLQKSEDIDEKLYADNTTKNAINNIFEKHELLRKHKYIEHELKDISIKYHEVNSFR
FT                   EIKNFNNIAKILLLHDEEPQLIKYEATILEKYRKEINAYLSTPHSLEIVNNRVSKGSAL
FT                   KDVLKSIHINLNEAIAFGDGFNDVDMLENVNKGLLMGNANYRLKKMLSYLEIIGTNDNE
FT                   AVAHYINDNILEEPV"
FT   gene            63610..64848
FT                   /locus_tag="BT0069"
FT   CDS_pept        63610..64848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0069"
FT                   /product="aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17411"
FT                   /db_xref="GOA:A1QYL9"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYL9"
FT                   /protein_id="AAX17411.1"
FT                   /translation="MKTDLIKYAELIILKGINLQKNQCVLITGSIENYEFLKILAQKAY
FT                   EYGAKYVELNIEDTDILKTRLKSSPEDLLEFIPDFKHKFFEEMINEKWAKIRIDNTENL
FT                   DTLKDNDSKKISKYFKALNIASRKVSSAIMNNELAWCIICAPGPKWAAKVLNKPESQKT
FT                   LEEFFKIQKKIMLLDSKDPIKAWEDHGKKLHQRCKILNKLKLEKIIFKNQKTNLEIYLL
FT                   ESSIWTGGSEKIRGTNIEFNANMPTEEVYTTPNYKKTNGIMYVTRPVTVLGNLITGIWL
FT                   EFREGKVINFGCDNEQSRNILKRHMETDMQAQYIGEVALVDCNSPIYQSGLTFCNILYD
FT                   ENASCHIALGNAYPSCLSNGQELKTDAEKLDYGCNVSLIHTDFMIGSNDINVIGIDKSR
FT                   KEHTIIQNGQFVI"
FT   gene            64866..65333
FT                   /locus_tag="BT0070"
FT   CDS_pept        64866..65333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0070"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17412"
FT                   /db_xref="GOA:A1QYM0"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM0"
FT                   /protein_id="AAX17412.1"
FT                   /translation="MIKELFTNDLFLSCFVSGIVAQMIKYIIQAMKTKKFKTNPKYLLK
FT                   SIFLETGGMPSSHSSTVTALATSILITEGIDTNFIIALAFALITIRDSFGVRYMAGVQA
FT                   EYLNALSEQLKMKIKIEPLKIKVVKGHKKKEVFTGILIGIISAWVICNRII"
FT   gene            65356..66825
FT                   /locus_tag="BT0071"
FT   CDS_pept        65356..66825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17413"
FT                   /db_xref="GOA:A1QYM1"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM1"
FT                   /protein_id="AAX17413.1"
FT                   /translation="MKLPKFLNILLILLLISCNMAKFGDYKPIYFKGEEDLKTANDYIN
FT                   SLGYKTISEYTTKVNILDFPDFKEITINKLIHLNDYDLRKDLFLKKLPNLFNIEKKKIL
FT                   YVESAFTSSDLRKLKQDQKIEAEMHSLNYKTKIKYFSSITFITIIILLLLLNIKYAPFI
FT                   ILFLISSCTIFIFSDEILYFYPLTILSYLLFTLIDNFNKNYNKIYLRDISFTVLIKKIK
FT                   IPIFLFLFIVFYFIVIINFLTTNLEALLIIFVSISTLCIFLIFTWIKTESNLKHTFLSL
FT                   IEIKEQKRETKILKFKILIHIMLFIASLMPFFYAQNILNAYNNFNYLYSKKLNYFDYLN
FT                   PNNIYLMVGHNEEIPNIVGYMYHIFYQNELKYKITSQYGKVNTHVKEDYFEIENNKITI
FT                   NQKTVYKVDKEFISKNLNKELPKLFLDNGNPILIYKETPANIAINKDNFTILFSLSLPF
FT                   FLLLFLFKAIRFTILLNMSEKSYRKYIRGNI"
FT   gene            66822..69128
FT                   /locus_tag="BT0072"
FT   CDS_pept        66822..69128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17414"
FT                   /db_xref="GOA:A1QYM2"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM2"
FT                   /protein_id="AAX17414.1"
FT                   /translation="MMSNSKTLKIKKQYKVNIDEIQMPECVLIPLETENAKSTIYIIEN
FT                   QRITEGQILSKNKNAELYTYSPISGTIEKIYTANLPGEHQLKSALIRFHGRIKNEQELS
FT                   VEEESREKTLEKLIRLGIPWFNEHSLFQYVSKCKKIDKMLFLINGKDPFTNISEILIKE
FT                   KLDEIIYGFETIDKIFKFKEILIVLSNYHLKKELEHLNIFQDKRLTIKLIPNTSYPYSN
FT                   HEVIMHFLYNEESIKNNINPNKNILLANVEDLYNVYSTLKTNSPYKEKFITINGNKKIQ
FT                   SKIIKVKIGTSIQQIINEDIDTKKYDIFINNPANKIKINNLNIPITRDIYSITILKKES
FT                   ILSKIKLLKTPSFSPRYMEEIILSKIKGKNNISNTQLQYLQYTETETEDEINKVKKEIK
FT                   EKILNLSLNNEPIYTENNLKDIYLTIILALIPSLIFSFTNNIKFLIDTLILTMISLCSY
FT                   ITIMLKSKHKYLSFFIYTSLIINIILPLNFSIILKIISLLFTFLVFFYFSKLSKFLVNP
FT                   ILISFMFLLLNFPSSFKHTYSKKLSEQEDIIPTWNKIMQQSSNIQNLESLKEFKRYENK
FT                   HIDMIEKFINDNILSNINIMIPRFHIENLLGLQNEKYLSPILIYIGFSFILGKFIINKL
FT                   IPLSFYISLLLIAYILKNLGLYSHISFDMLTLIMSPIPMILVFTMSTELQIAPPFKFEQ
FT                   ILYGITLSLVYFITLSYIPLETLAAVISIFILQISSTLIKRYSLTFQIKKILHHLSINQ
FT                   AKTIKYKNDNGEEII"
FT   gene            69132..69701
FT                   /locus_tag="BT0073"
FT   CDS_pept        69132..69701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17415"
FT                   /db_xref="GOA:A1QYM3"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM3"
FT                   /protein_id="AAX17415.1"
FT                   /translation="MKNSLIMYLLVNNLLLIHFIGIEDIKIKDNKTLSKKYLIVIITSL
FT                   LIYSSLFYLYKLFSEHNLLFIIPIIYITLIYILTIILKTLNNILIVYNNKSKYSNDFLL
FT                   SNSSLIAITFFSLDKSHNFLEGIKILILSSLSVLIALILITLTKKSFEKKLTSKILANE
FT                   TIYFFIMFILSLIPNIIMLINNIEGL"
FT   gene            69717..70778
FT                   /locus_tag="BT0074"
FT   CDS_pept        69717..70778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0074"
FT                   /product="bacterial peptide chain release factor 2"
FT                   /note="RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:BT0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17416"
FT                   /db_xref="GOA:A1QYM4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM4"
FT                   /protein_id="AAX17416.1"
FT                   /translation="MNFWNKLKMSGGSFDSNKIKVKLKEYEKQINDENFWNDNKKAQEI
FT                   LKNQNILKAKIEPWEDLICKLKDLRELCEIAESEEDTALLDQDINKLREQYKHLLTLSY
FT                   FKEDIDINNAFLTIHSGAGGTEACDWVSMLYRIYLRYSERHGYKTELIDLLEAEGGIKS
FT                   VTIEIKGEYAYGFLKSEVGIHRLVRISPFDAAKKRHTSFASVFIDPVIDDKIEITIKPE
FT                   DIRVDTYRASGAGGQHVNKTSSAVRITHLQTGIVTQSQTDRSQHRNKDLAMRVLKSKLY
FT                   EHYKILEQQKSKSKQEEKKDISWGNQIRSYIFQPYTLVKDHRTKFENPNIISVMDGNID
FT                   NFIEEYLKWKNLS"
FT   gene            70760..72166
FT                   /locus_tag="BT0075"
FT   CDS_pept        70760..72166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17417"
FT                   /db_xref="GOA:A1QYM5"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM5"
FT                   /protein_id="AAX17417.1"
FT                   /translation="MEKSKLIIILFLILTLKLAYPQSNIEYGFSYIINTQDENKNLQEG
FT                   IEQTLDKIYKTINEHIVNNNDKDFIRRIYINQNIVNKEQEISKLKEDMDKKKLQNAISS
FT                   REENKIEIKINELKKDIENIKIKQKEFEEYLINLKKMKTKYIKHKEKIHPSNLNTEFLI
FT                   SQELFFINYIHLKKIEKYYLVEISNITPQGVKVKKEIFHLSSSVDDIANKIAELSFEEI
FT                   LGREFIKIKINVINNLDAKIYINEQFVSKGIYNNDIWDISKLPNKEIIINIISTTYKPH
FT                   TVKQKVKSGDTINLNINLQKANYRKIPITSNVTSKVFKKGIFIGETPIEIEEPEGIESI
FT                   LLQAKGYKNMFKMISKEDKEINIEMLKDNKSELIIKRDQFYINLGIFTLSLIGTAFAIT
FT                   KYNESSELYNIALKNIIKRKITPQDLYNVKSEQMITTFLLGTGITLSVGSFIPLIIHLV
FT                   KYIQEASRGE"
FT   gene            72208..73062
FT                   /locus_tag="BT0076"
FT   CDS_pept        72208..73062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0076"
FT                   /product="cell division protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:BT0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17418"
FT                   /db_xref="GOA:A1QYM6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM6"
FT                   /protein_id="AAX17418.1"
FT                   /translation="MRILGIFDKIKNLFKNKEKTQIFEKLEDILLEADIKNDIVIEIIE
FT                   NIKKLKVKDEEETFLKLKDFLKSYINQQSLNLENKRLNILLIIGVNGVGKTSSIIKLAN
FT                   KFKNEGKNVLIAAADTFRAAAIEQIKIQSEKIGIKVISQNQGSDAAAVIFDSISSAKTK
FT                   NYDILIIDTAGRLQNKENLIKELQKMDNVIKKQMIKTDVNYKKILVIDSIAGKNINNQT
FT                   EIFNKAIEIDGIIATKFDSSSRAGGIINISKLFKKPIYFFTFGEQVEHIKEFNTDDYLN
FT                   KLL"
FT   gene            73059..74093
FT                   /locus_tag="BT0077"
FT   CDS_pept        73059..74093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17419"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM7"
FT                   /protein_id="AAX17419.1"
FT                   /translation="MTTKIVILFLIFIIPSTYGQNYFISDVFFNKYQEIYEIPQTGFYI
FT                   EYMKINEIEKFSLFKDLQLIKYKTQKTIKDDKKKLTFYNEKDIKTKEEIYDNLNNKIQE
FT                   IKYSPKGIILESVNYFYKNNDLIYKEIKILNQKPKTLHYMKDSNGKLLKITGSDFQVWN
FT                   YGINGEIKSTYFDIKKSKTKVIQYDDQKRHLESIILDNNKIKSREKNQYLDDNEVINTE
FT                   EKEEGNIKIISKYKGPNLIKKEIYKNNEITEISDFEYNESGNVIVENVIVKENKKEHNT
FT                   KTKYEYNSDNRLTSKTIYENNLILLKTDYFNDHEYEQEIYYDGNPIFKVRYKNDEIIEE
FT                   IKRY"
FT   gene            74105..75352
FT                   /locus_tag="BT0078"
FT   CDS_pept        74105..75352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0078"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:BT0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17420"
FT                   /db_xref="GOA:A1QYM8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM8"
FT                   /protein_id="AAX17420.1"
FT                   /translation="MGLNKFLLKRLILDEQNSLSLTIVIILSIVLGQIIIIITISIMNG
FT                   FQNDFFTSISTLESGNLKIESQLNDQELNALKEIKEIIQINKIYETQGIGIENYYYPSI
FT                   LNIIALDTKDIIEDKNFILLTGLTQSELQLNDDEIIIGDVLSYNLGLLEGDIIGLILSD
FT                   EIKNLQTLKNEIKYFKIKAIFKSNYAKINESTIFMNINYFYKKQIIKDSDIKYQIKTQN
FT                   LYPSKSLINKIKNINPNIQFKPWNEYNKEFYKALKIERNTMLIILTSIFLVIAVNTYYL
FT                   QKRIIINKSKSISIILSLGLKSQKIRKIFLIHSVIICILGGIIGLITGIIISSNINEIL
FT                   NVIDILINSLINTINYILKLKLENIEIKIVKNTITPKIFLSDLMFTLFFACLFTICSSL
FT                   KVTKKIKYVDKINGAS"
FT   gene            75353..76033
FT                   /locus_tag="BT0080"
FT   CDS_pept        75353..76033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0080"
FT                   /product="lipoprotein releasing system ATP-binding protein
FT                   LolD"
FT                   /db_xref="EnsemblGenomes-Gn:BT0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17421"
FT                   /db_xref="GOA:A1QYM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYM9"
FT                   /protein_id="AAX17421.1"
FT                   /translation="MKNIICITEIHKTYTKNKTKIKVLENLNLNVKDGDFISIQGKSGC
FT                   GKSTLFNIISGIDKMDSGDIISCGISLKDANEKTLSLYKNKKIGLVFQNHNLIDEFSVF
FT                   ENIILPKIIEGKDNLETINRKALRLMKILEIDKRGDHYPSELSGGEAQRAAIARALINE
FT                   PNIILCDEPTGNLDINTAKTVESLLINTAKTFHKTLILVSHNPEFSNKADIKYEFKEKT
FT                   LKRI"
FT   gene            76030..77280
FT                   /locus_tag="BT0081"
FT   CDS_pept        76030..77280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0081"
FT                   /product="lipoprotein releasing system transmembrane
FT                   protein LolE"
FT                   /db_xref="EnsemblGenomes-Gn:BT0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17422"
FT                   /db_xref="GOA:A1QYN0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYN0"
FT                   /protein_id="AAX17422.1"
FT                   /translation="MMRPNIKELTKIAYIIFINSKNKKALIGSGMSLSLVMIPLIIVYY
FT                   MSNNIMNSTIEKYIENEGFSVQIEYNEIQKDTYLKSKLEKLKKEYQHDELRYFFERRTY
FT                   GIIGNNKKQGVLIRAVENKFIDENKHIKLIDGKKSFNKNEILISKQIKDRLNLNINESI
FT                   YIVVPNNKHQKIFPKAKKFNISGIIETGLREIDKNLVLISLQDSNIMSEEFSKSIIGIS
FT                   IKPNTKEKTDNLKKNIKKEFQEYKIKTFYELYLNKYTNLDISKKLLIFIMAFIVIFASI
FT                   NISSSLCMLILENKKKIAIFKSIGMNNSSLKLIFILIALVLSSISCIIGIIIGNYITIN
FT                   IEHLINIIDIIINTILKIFGTDNTELLNSDYYISEFNIKISYKFSLIILLSYTLISITT
FT                   TLIPLNIISKFKEKEIL"
FT   gene            complement(77310..78593)
FT                   /locus_tag="BT0082"
FT   CDS_pept        complement(77310..78593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17423"
FT                   /db_xref="GOA:A1QYN1"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYN1"
FT                   /protein_id="AAX17423.1"
FT                   /translation="MSKTSEERIKIYLSKLSKYKNKILKENSIKDIIERADISDADIEN
FT                   IEMRFSKIYDRARRLEEMGELSDSLRELETIYLYSLHNKSIFASFFNFYKRLIKRIDSK
FT                   NLNKKLIHVSLQAREFGIVSGINLKDYDEAERLKHRVLILLLSFVLIAIIAFITYTIMH
FT                   SFIGGYEKLDEVKDVHRTTFQGLPSVTRASDLVVESVNLAAGPYVLYHVEVEDAKVLVF
FT                   EDAHAYQLKAGVVSAKDPIKRIYYGVTVYDDLGRPILNKVFEKTSDFPNKWSKGVYAPI
FT                   DFIYSISKEINGHPKKMVLDIRLVEFFSEVDNLSSVNLETSSSILNFKYLGSYFNESFG
FT                   IYEANSLIEVYNDSKDNIKDLEIEVTYVSKDSQIIRSLQRKLISESNSFLKPYSRQSFS
FT                   LKTIFPKEIYPNIKEELSSIKIVNVFVR"
FT   gene            complement(78586..78903)
FT                   /locus_tag="BT0083"
FT   CDS_pept        complement(78586..78903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17424"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYN2"
FT                   /protein_id="AAX17424.1"
FT                   /translation="MKEIIYRFEKAEDYKLVPINNIYGSVTNTGEIFCDLVFESTEIPE
FT                   EIVYTKTKEGVLEEISGEFKGSKEKIILINSFVGISITKDTAKNIAYWLLKKVDELEDN
FT                   E"
FT   gene            79100..80368
FT                   /locus_tag="BT0084"
FT   CDS_pept        79100..80368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0084"
FT                   /product="cysteine desulfhydrase"
FT                   /EC_number="4.4.1.-"
FT                   /EC_number="4.4.1.16"
FT                   /note="selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17425"
FT                   /db_xref="GOA:A1QYN3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYN3"
FT                   /protein_id="AAX17425.1"
FT                   /translation="MDLNLIKDTNETVKILRKDFPILNKTINDKKIIYFDNAATSQKPQ
FT                   SVISSIVEYYTNYNANVYRSGHELAIQSSLKVAKVRKIVKNFINAESCKNIIFNSGTTD
FT                   GINTVVNSLLFSKLLKKNDEIITTTLEHNSNLLPWINIAKFLKLKIKLAKFNEMGIIQP
FT                   EQIKNLITNKTRIIAISSINNILGTIQDLETIGKLARDNKIILFIDAAQMAPHMNIDVK
FT                   KIDCDFLVFSGHKMLAPTGIGVLYISDKIIDKLNSSKLGGNTIEDIFMKNGELNFKTLE
FT                   PPNKFESGTPNIAGIIGLGKAIEYINNVSMEFIQEHDRALIEYCVAKLKEIDEVEFILN
FT                   KDIKRKSIISFTVKDIHSHDIETYLDTMGIAIRSGKTCAYLAFFSENIKKDHLLRISFY
FT                   LYNTKEEIDTFISCLKSTIKAFY"
FT   gene            80539..80943
FT                   /locus_tag="BT0085"
FT   CDS_pept        80539..80943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0085"
FT                   /product="NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17426"
FT                   /db_xref="GOA:A1QYN4"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYN4"
FT                   /protein_id="AAX17426.1"
FT                   /translation="MFSEETKKELIRFSKIKKYYFKTDKNQSSVYHQSKCGDQITFKIN
FT                   ESNKKIRLKYNAYGCIIFLSSAYILTKLCDNKPRKEILEIITKTINKNFENLEEIDKSL
FT                   KNFENFLYTNRKDCFMLPYKALKEILNTIK"
FT   gene            80966..82495
FT                   /locus_tag="BT0086"
FT   CDS_pept        80966..82495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0086"
FT                   /product="magnesium chelatase subunit ChlI-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17427"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYN5"
FT                   /protein_id="AAX17427.1"
FT                   /translation="MKIYSHSSIGYEGELIEIEVDIRKGISGIDIVGLAGSEIKESRER
FT                   VKSAIKNSEFTFPKDRILINLAPAGIKKIGTAIDLSIATSIITIKENQNNNLEVLILGE
FT                   LQLDGQIRAIKGVLPAISLAKKRGIKCIIIPFDNLEESLLIENLNIWGVKTLKEALEII
FT                   SNLNNNIFPAKHTINFKTEYNEEKFEYDFKNIKGQHRTKRALEIAVAGGHNIMLFGPPG
FT                   SGKTLSIKCVQSILPPLTNKEIIETNRIWSVAGKLIDTKIIRQRPFRQPHQTASKEGII
FT                   GGGSNALPGEVSLAHNGILFLDEALEFQKSILQSLREPIEDKMISIVRASSKSFKYPAN
FT                   FQLMIATNPCPCGNLGKNDTECFCSQQEVSNYWKKLGAAMLDRIDIRVPVKPVDNAKLF
FT                   QEDNESSCEIRQKIIKTRNIQSKRYANIENIHKNSDLKPEHIAIFCELDKILREEMIYI
FT                   LNKLNISSRATHSILKLARTIADLKEENHISRESLLEAIEHRKHGERLLEE"
FT   gene            complement(82518..83468)
FT                   /locus_tag="BT0087"
FT   CDS_pept        complement(82518..83468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0087"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:BT0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17428"
FT                   /db_xref="GOA:A1QYN6"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYN6"
FT                   /protein_id="AAX17428.1"
FT                   /translation="MLKRNKVVLVGAGGVGSSFAYALTIDNSLVHELIIIDLAQDKAKG
FT                   EVMDLNHGQMFLEKNIKIEFGNYDDCSDADIVVITAGLNQKPGETRLDLVGKNTKIFKE
FT                   IVTSVVSSGFSGIFVIASNPVDIMTYVTMKYSNFPTHKVIGTGTTLDTSRLRYFLAERF
FT                   NVNTQNIHSYIMGEHGDSSFATWDETKIAMKSLSEYLAEGKVSDAELDEMHKNVVNAAY
FT                   EVIKLKGATYYAIGLGIKKIVNAIISDQNLILPISSYINGQYGNFVKDIYIGAPSVVCK
FT                   DGIKEVLDFTISDRELEKFKISASQLKSYIDKIEF"
FT   gene            complement(83651..85456)
FT                   /locus_tag="BT0088"
FT   CDS_pept        complement(83651..85456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0088"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17429"
FT                   /db_xref="GOA:A1QYN7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYN7"
FT                   /protein_id="AAX17429.1"
FT                   /translation="MKISSYKKNFCIIAHIDHGKSTLADRFIQKAKIVSDREFKSQILD
FT                   SMDIERERGITIKSQAVTIDYKCSDGNTYELNFVDTPGHVDFSYEVSRAISSCEGALLL
FT                   VDASQGIEAQTVSNFYMAFEHNLEIIPVINKIDLPSANIDFVKEQIEHDLGLDSNIAVP
FT                   ISAKNGIGIDELLEAICKYVPSPKGSVKSSLKALIFDSHYDSYRGVIVHFRIFEGQIKT
FT                   GNKIKLMHADREYLVEEIGIFRIILERKEILEAGDVGYFIAGIKNISDVKIGDTVTLVD
FT                   NPASAPLEGFKEVKPVVFSSIYPVDANQYDDLLKAMDRLKLNDASLTFEKDASAALGHG
FT                   FKCGFLGLLHLEVIQERIEREFDLNVILTSPSVRYKIIPKKGNSYFIESPEQFPGNENI
FT                   EVSLEPYIRANIIVPTEFLGNVMSVCLLKRGVQENLIYLDTKRVEVIYKMPLAEILFDF
FT                   YDKVKSVSRGYASFDYVLLGYEETDLVKLDILVNGDRVDALSQLVFKDGARAKALSICK
FT                   KLKDEIARQQFKIAIQGAIGSNIIARETISPVRKDVTAKCYGGDITRKRKLLEKQKEGK
FT                   KRLKMIGNIEIPQSAFLAILKSDDN"
FT   gene            complement(85497..86510)
FT                   /locus_tag="BT0089"
FT   CDS_pept        complement(85497..86510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0089"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17430"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYN8"
FT                   /protein_id="AAX17430.1"
FT                   /translation="MRKFNIFIDMLRPFLLLFIFSFIFNLNSSGVKEFPYWILLEKGRQ
FT                   FIYSKEGFIKSNLTSAINYLQEALLRKGIYPEANYYLSIAYSMIGNVVFEKLHLQKALE
FT                   DKDYLLDKSFEKNILFSLAKIAEIEDNYVDMIDYLNEILSKFSSSDDYYNYHYVVQKYE
FT                   NTTGSTGNKFNMSFYLHSYLKQVRGTSGLDFTFNLYRFNKYNIIDTHQSLSKVYLKIGA
FT                   YELAITHGLVAAIGILTKMYDCVSYYEPLYEFKNLRSFVQKINEYTDVKTSFESTDFWE
FT                   IVYTIAYATYSYDDHKHTLRAIDTWKLIVDLAPKFSPYVLKSKIHIRNFLLNKSVY"
FT   gene            complement(86547..86981)
FT                   /locus_tag="BT0090"
FT   CDS_pept        complement(86547..86981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0090"
FT                   /product="V-type sodium ATP synthase subunit K"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BT0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17431"
FT                   /db_xref="GOA:A1QYN9"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYN9"
FT                   /protein_id="AAX17431.1"
FT                   /translation="MNIGLIGVNSALAIAAIGSALGMGAAGSAAIGAWKRCYMQGKPAP
FT                   FLLIVFVSAPLTQIIYGYILMNTLAGIMTQADPWLLFGAGFGGGLAISISAFAQGRTAA
FT                   GACDAFAETGKGFATNLLVLGLIESVALFVMVFLMIFKFV"
FT   gene            complement(87003..88823)
FT                   /locus_tag="BT0091"
FT   CDS_pept        complement(87003..88823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0091"
FT                   /product="V-type sodium ATP synthase subunit I"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BT0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17432"
FT                   /db_xref="GOA:A1QYP0"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYP0"
FT                   /protein_id="AAX17432.1"
FT                   /translation="MIVKMSKVLILTLLKYKKESLEILRELGVVHINFCNRVSESLEKV
FT                   IEERGILVQALSLLGDDSEVKLLSSSNENFLDVAKSIISLGSEIKDLRDMQQSLLHKRD
FT                   IISFWGYFSLELVNKLRESNIYVQFFKSGIAEYKKLLACSETKVALINNYKGTAYFVAI
FT                   NYSKQTIDTAEEYEFEFDLDFIENKLRFVDEILDQKLTQLSILNKYRDVLRDEIKEYDQ
FT                   IVEFEQVMADMDVACDNFVYITGFVPEDKREDLKNLKGKFVVQFAEPDDDVVPTYIKRR
FT                   GIAKLAKPIFDVLDTIPGYKERDVSCVFMLFFFMFFGMIIGDAAYGIIFLLVGIFLSLG
FT                   NFIKGKPLTSIHALIFYLSTSAIIYGSMTGTWFGSNPFILELFPILKSLKLGYLTGTNG
FT                   MQNIMFICFTIGVLQISLAHIWNFVQKVKEKPHIHSIAQIGWLIIMPGLYYLVLNLILG
FT                   KDRFPMHSIILNMIYGGVILVFIFEKQDGSNFFMCVLKSFGGIIEQFLATVSGFADIIS
FT                   YIRLFAVGLAGLAISDSFNSMSAALLKSSNIGLIISGIIVMLFGHILNITLSLLSVVVH
FT                   GVRLNMLEFSNHLGQEWNGYSYRPFRKIKN"
FT   gene            complement(88834..89454)
FT                   /locus_tag="BT0092"
FT   CDS_pept        complement(88834..89454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0092"
FT                   /product="V-type sodium ATP synthase subunit D"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BT0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17433"
FT                   /db_xref="GOA:A1QYP1"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYP1"
FT                   /protein_id="AAX17433.1"
FT                   /translation="MASKKGLAMPKVKLTKNELKKQKDSLKMLGRYLPTLQLKKQQLYL
FT                   EIRKVEALKRARKLEQDRLKRDIKSWIALFGEKFTFQDWIQIKRVVRSFANIAGINIPV
FT                   FDFVEYEDIKHDLLLTPYWVDRGIEVIKSMIQINAELEVLDDQIRLLESELNTTSQRVN
FT                   LFEKVMIPAAKINIKKINIYLGDQQTAAVVRGKMAKASLIKNR"
FT   gene            complement(89433..90734)
FT                   /locus_tag="BT0093"
FT   CDS_pept        complement(89433..90734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0093"
FT                   /product="V-type sodium ATP synthase subunit B"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:BT0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17434"
FT                   /db_xref="GOA:A1QYP2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYP2"
FT                   /protein_id="AAX17434.1"
FT                   /translation="MKRVYSKIESIVGNVITVMAQNVKYGELAIVRSKDSSSLAEVIKL
FT                   DRDKVSLQVYNGTIGISTADEVKFLGHPMQVTFSENLLGRIFDGAGNPKDGGPRLEDDL
FT                   IEIGGPSANPAKRIVPRNMIRTGIPMIDVFNTLVESQKLPIFSVSGEPYNELLIRIALQ
FT                   AEVDLIILGGMGLKNDDYLTFKDYLEKGGALSRTIFFVNTANDPVVESLTVPDISLAVA
FT                   EKFALQGKKVLVLLTDMTNFADAMKEIAITMEQVPSNRGYPGDLYSQLASRYEKAIDFE
FT                   GAGSITILAVTTMPGDDITHPVPDNTGYITEGQYYLKGGRIEPFGSLSRLKQMVNGKTR
FT                   DDHRTIMDAMIKLYASSKESIEKKAMGFNMTEWDEKLIKYSGMFESKLMDLSVNIPLEE
FT                   ALDLGWEILFSCFEPKETGIRTELVEKYWPQKKD"
FT   gene            complement(90744..92474)
FT                   /locus_tag="BT0094"
FT   CDS_pept        complement(90744..92474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0094"
FT                   /product="V-type sodium ATP synthase alpha chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BT0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17435"
FT                   /db_xref="GOA:A1QYP3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYP3"
FT                   /protein_id="AAX17435.1"
FT                   /translation="MEARGKVVGVIGNLVTIEIVGTVSMNEIVFIKTGGRSLKAEIIRI
FT                   RDGEVDAQVFEMTKGIAVGDDIEFTDKLLTVELGPGLLSQVYDGLQNPLSELAAQCGFF
FT                   LERGLYLSALDRSKKWSFNATAKVGDIVVAGDYLGFVVEGTIKHKIMVPFYRKDSYKIV
FT                   EIVSDGNYTVDDKIAVIENDAGGRHVITMSFHWPVKVPITSYKDRLIPSEPMVTQTRII
FT                   DTFFPVAKGGTFCIPGPFGAGKTVLQQVTSRNADVDVVIIAACGERAGEVVETLKEFPE
FT                   LIDPRTGKSLMDRTCIICNTSSMPVAAREASVYTAITIGEYYRQMGLDILLLADSTSRW
FT                   AQAMREMSGRLEEIPGEEAFPAYLESVIASFYERAGIVVLNDGNVGSVTVGGSVSPAGG
FT                   NFEEPVTQATLKVVGAFHGLTRERSDARKFPAINPLESWSKYRGVVESEKTGYARSFLA
FT                   KGNEINQMMKVVGEEGISIGDFLVYLKSELLDACYLQQNSFDSVDTAVSPERQNYMFDI
FT                   LYDILQSDFKFENKLEARSFVNELRQNILDMNLNPFKEEKFNKLENTLKDLVRSKKLDF
FT                   "
FT   gene            complement(92486..93031)
FT                   /locus_tag="BT0095"
FT   CDS_pept        complement(92486..93031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17436"
FT                   /db_xref="InterPro:IPR024492"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYP4"
FT                   /protein_id="AAX17436.1"
FT                   /translation="MLSPYYYVMSSLPYLDLKIGKGGSISGFFDNIEIALSREDFLCLK
FT                   DLSESRFARGNLKVIDQFLEFEEMMRYTLATIRAEKLGFSRDVYLESSYFSSYYLGILK
FT                   PLCLKENPFEVELGLDMLKWQFLTELEVGNDFNFEKLVIYLLKLMLVSRRSLFIEEIGE
FT                   KNFDDICQKLSMQMSKNF"
FT   gene            complement(93042..93638)
FT                   /locus_tag="BT0096"
FT   CDS_pept        complement(93042..93638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0096"
FT                   /product="V-type sodium ATP synthase subunit E"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BT0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17437"
FT                   /db_xref="GOA:A1QYP5"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYP5"
FT                   /protein_id="AAX17437.1"
FT                   /translation="MQFEVKDLINKIKKDGLEEAEKLANEIILNAKRDAEAIVLKAESD
FT                   AKDLKMQAEAEANEYKRYSLEASRQAVRDLIIGTEKNIKSLFKTALKDSVSRVYDDNFL
FT                   RDLIIKVVDIWSKNDKIDIMLNESDFSNLLSVLRAKIGNRLDDAIEIKPFKGISKGFTI
FT                   QQRDGNLYYDFTSETVADILFEYLNPRFKEVIKLI"
FT   gene            complement(93749..94144)
FT                   /locus_tag="BT0097"
FT   CDS_pept        complement(93749..94144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17438"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYP6"
FT                   /protein_id="AAX17438.1"
FT                   /translation="MGISRFEEFENALFKICLDVDCVLEDEFGNSYKVHPSRLSRGKAA
FT                   NGLLDGLFRVTTSFTLGYGSKFGRGYLVIIEIITLDMVDIEFSNRVIERGIKVFGEKLK
FT                   ERFPGKKLFIVHDINVYKIIGDFFSGV"
FT   gene            complement(94145..96505)
FT                   /locus_tag="BT0098"
FT   CDS_pept        complement(94145..96505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0098"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:BT0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17439"
FT                   /db_xref="GOA:A1QYP7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYP7"
FT                   /protein_id="AAX17439.1"
FT                   /translation="MSLRDIRVMQEKYLEKIDFYQILSSVASYVAISDTLNLLGEQQIL
FT                   KTEEEINRVCCFVKLIKNLIEVYDEYPNSCLESISDSIILLLKEKSRISIEEIKNIIFF
FT                   LREVLRIMLFLDRNEFKIQDEVEILKELLFVDPSLKHLLETLCKYIDLDELKIKRGVVK
FT                   NYDEIDFEIRNLDKKIEKQLKQIISLNSQYLTSTLIYYKSGKYTIALKSSFKNKIKGNI
FT                   ISISSSGETFYIEPNDIVSENNRLGFLGFEKTRIVLKILQELSDEIRRHIVLLKSLYNK
FT                   FLYYDSLKARAIYGIRNQGVFPRFDSNINIINARHPLIQHAKSINFCPLNNKVVVITGP
FT                   NAGGKTATLKTVALLSAMFQFGIPVPVDESSTFKIFDNILVDIGDDQSIANSLSTFSSH
FT                   MNNIAYILKYATRDSLLIFDEFCSGTDIEQGQALAVAVLEHLININSCVIISTHYNALK
FT                   YFAYTHEFVVNASMQMDLDKMEPNYNLMFSVPGESFAFSVASKSSIDANIVLRAKEIHS
FT                   SNKTGVNEILERLTKKEQEIHLLEEELKDKLKLIELKEIEINNIRNNIILKEKDLEERL
FT                   INEQKEFLKNSRKILENLVREIKEGSVCTTKNKEFISNITDNIITKTTKIRLLNQEIAT
FT                   KIEFRVGDKVRVAGSNASGEIIGVTKKGFIVNTGVFKITVSSSNLEKILDDKKSKNDRD
FT                   KNFSFSFENQDDELSLTVDIRGMRVVEAIDFLNRKIDNMLLRNVCKFEIIHGKGEGLLM
FT                   EGVHAFLRDVKFVKKYYFAHPSDGGVGKTIVEF"
FT   gene            complement(96453..97394)
FT                   /locus_tag="BT0099"
FT   CDS_pept        complement(96453..97394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0099"
FT                   /product="GTPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17440"
FT                   /db_xref="GOA:A1QYP8"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYP8"
FT                   /protein_id="AAX17440.1"
FT                   /translation="MNDLRFEILWGVNNIYSIVNVNTNEIYEGVIKGKVLNTQDKEYSP
FT                   LVPGDFVCGDIYDEGKVYIKERLKRKSVLWRYNKKAALRQVIVSNIDNVLIVSSANLPE
FT                   IKNSFIDRALVVAEEQGITPIILINKIDEGISTKVDTLIKIYENLGYRVIKTSAITLQG
FT                   IEEIKEIIKNSRASFVGQSGVGKSSLINEVDLNAAQAINEISYKYSRGRHTTVYAMAFH
FT                   SDNGVVIDTPGIKEFGIESLEPLKLRYYFREFKDLNDFCRFNSCLHANEPNCFIMNQIG
FT                   FRISEVRYNSYLKIINELKRYKSYAREIFGKN"
FT   gene            complement(97391..98155)
FT                   /locus_tag="BT0100"
FT   CDS_pept        complement(97391..98155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0100"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17441"
FT                   /db_xref="GOA:A1QYP9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYP9"
FT                   /protein_id="AAX17441.1"
FT                   /translation="MSNLKNVIVIFDSGVGGLSYFEYISKRFVKRNYVYVADNKNFPYG
FT                   EKSSDFLLKEILELILKLEQMYNVAAIVIACNTASISVYDKLNFSFPVIYTLPSVCLVE
FT                   ELAYKRVILVATHATINSKFIQREKDCHWDLILKPASELVNFVEYGDRFKEDALKYLNF
FT                   LKLEVKASRRDMVFLGCTHYLHIKDMIENFLGIPVYENRELVTNELIKELKSIESRDDC
FT                   FTRYFYLTQDENLYFYKNFCKKYGLHFKGIIN"
FT   gene            98298..99683
FT                   /locus_tag="BT0101"
FT   CDS_pept        98298..99683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0101"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BT0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17442"
FT                   /db_xref="GOA:A1QYQ0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ0"
FT                   /protein_id="AAX17442.1"
FT                   /translation="MHKSIKEILNNPILDSIITVKGWIRTKRSNGKISFVEINDGSNIK
FT                   GIQAIINEEDHQFEKKELKKLTTGASISLTGILILSPAKGQTYEIKTTNFNIIGEADQE
FT                   TYLLQKKRHTFEFLREIPHLRIRTNTFGAVARIRNQISYKIHEYFQKNGFLYIHTPIIT
FT                   SNDGEGAGEIFRVSTLDFNNITNGKEVDFKDDFFGKQAFLTVTGQLHGEAYAMALSKIY
FT                   TFGPTFRAENSNTTRHASEFWMIEPEMAFFTLEDNINLAENFLKYILKETLNNCNQDIE
FT                   FFDNFIEKGLIKKIEDVINSNFEVITYTQAIKQLENATKTFEIKPYWGMDLQTEHERYL
FT                   TEEIIKKPAIVIDYPKEFKAFYMKMNEDGKTVKGMDILVPRIGEIIGGSEREDNLDKLN
FT                   KRIKELNLEIETLNWYLDLRRFGSTPHSGFGLGLERLIQYITGMANIRDVIPFPRTPKT
FT                   LYF"
FT   gene            99707..100285
FT                   /locus_tag="BT0102"
FT   CDS_pept        99707..100285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17443"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ1"
FT                   /protein_id="AAX17443.1"
FT                   /translation="MKIKILCQITLTLSALMLFSNEKFENNLKIFSNVEKEITGKKSNY
FT                   QYSKEKPRINKSNKINYPHKKEDYHHNIIKKKDTNLQIDKTNKKQDVQKPINNIVKIRK
FT                   SNKIYYPQDKNNIQTSKSKKNIWYNIKVYSTHTKDRFKKIKALNKINTQIENNFALIGP
FT                   ILEDYLGEITKALHVIGYSELEYIKVEQN"
FT   gene            complement(100282..100872)
FT                   /locus_tag="BT0103"
FT   CDS_pept        complement(100282..100872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0103"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17444"
FT                   /db_xref="GOA:A1QYQ2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ2"
FT                   /protein_id="AAX17444.1"
FT                   /translation="MKKFVSYEEIRINGLKLAYKIYKNGFIPDIMYVSLRGGAYLGNII
FT                   SEFFKFIKLEKPLLYAAVVARSYDISNKQKKIMIDGWTYDPKYLRAGDNVLFVDDIFDT
FT                   GRTIIHLREEVLKRGIDSQNVKIAVYDYKERGYVDYKPDYYVNKYSSEDELNTWIHYSN
FT                   HELIGLSEDEYKLSFLNLDDELNDILKFLSSKL"
FT   gene            complement(101226..102683)
FT                   /locus_tag="BT0104"
FT   CDS_pept        complement(101226..102683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0104"
FT                   /product="protease Do"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17445"
FT                   /db_xref="GOA:A1QYQ3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ3"
FT                   /protein_id="AAX17445.1"
FT                   /translation="MEVYKMKKNFISVFLASFLALTIGFFVGIHYLGSDKNTIVFAQEK
FT                   GDAGESLQDSFRKVSKKILPSTVEIYATGIVKTRDLFHLFFFFDIPGLNLEKKAQWGGS
FT                   GVIIGRDSKKTNLFYALTNSHVVDNAIEFEVGTYDNKTYKAKLVGKDDKKDIALVSFEA
FT                   NDAAIEIAELGDSDMLEIGDWVIAVGSPHNFSFSVTAGIISGLHRSVNPNLKARNSFIQ
FT                   TDAAINRGNSGGPLVNIKGEVIGINTWISASPSGGNLGLGFAVPINNAKSIFDVLMSGK
FT                   KSESAWMGVDLHRLRSKDPELLKSLGYEDNFESLAIIAGVYDGTSAFRAGLKAGDVISK
FT                   INDVSMNFFYDVKQYINDFYAKEKIKVEILRGKEKKNVEIELDVKPKISNEKEYISELK
FT                   LMPGFTVYPLTKEVRTQLGLRNWTNGVVVDSVDPTLGTNPKISTGDIIMVVNSKSIKSL
FT                   RDFYDAVEHGKNTYTVLRDGQTFKVSF"
FT   gene            complement(102727..103479)
FT                   /locus_tag="BT0105"
FT   CDS_pept        complement(102727..103479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0105"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:BT0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17446"
FT                   /db_xref="GOA:A1QYQ4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ4"
FT                   /protein_id="AAX17446.1"
FT                   /translation="MKLRLKSRAEIEKIRASARLLAQTFLEIEKNIVPGINTKTLDLIA
FT                   SDFITKNGAKSAFKGYAGFKGTICASINEEVIHGIPGTRELKDGDVISIDCGVILDGFY
FT                   SDMAKTFKVGKVSPRVNKLLEVTEAALYRGIDEMKAGNRVLDISKAIENYIKPFGFGIV
FT                   RDYTGHGVGFALHEEPSVPNYYEPFFKNVRIQEGMVLAIEPMVNLGGHKVSVKNDDWTV
FT                   FASDFSCSAHFEHTVAVVDGLPLILSKI"
FT   gene            complement(103484..105136)
FT                   /locus_tag="BT0106"
FT   CDS_pept        complement(103484..105136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17447"
FT                   /db_xref="GOA:A1QYQ5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ5"
FT                   /protein_id="AAX17447.1"
FT                   /translation="MKANKVLLFFILFLVLFISIFVYLSLNPYVLYMLKGELDFNEILV
FT                   EVDGYLLNENLESAENAIRFYSYYADTEYKWLSLIKRAKLYSVKIKHYLLMRDILDLSV
FT                   KSLPGNLKLRALEVYSKLKVGAVLEAYDIAKQYLLGYKEYKHLYDEAFIKSLILSYDVK
FT                   DIKSFLIKMERERDALAFETIGLNLQNNAFLIDAMLLYIEKKDLDSAKRILLKIKEDKD
FT                   FSKELAYISYGLDNLDFTIANLKLNNSNEPSLMFLLADAYLKKGDINNAKIEYLKLYTD
FT                   FPDYSMMVYLGLAFIAKKENDLKRAIAYLNKANENFKENEMVNYYLANIYFEANDYFNA
FT                   NEIAKKYRDSPLFFKLYFVLNYANLKYEAKKSFLWRLFYRSNYSTDIAQLLAWNLLLYS
FT                   DLKDLDLFFKIYDSVDEVQDWYYFYKFYYFFLKKDLSVAEKIIIENQVGKYLYGFYYNL
FT                   GVLKLYQKNYKESEEYFSKTVSLLPFTLDDKSKITLREREDVAKVYLKRGINYLYLGEF
FT                   EKGREAILTSNFFYETNEGKLYMNMIEILKERN"
FT   gene            complement(105123..105563)
FT                   /locus_tag="BT0107"
FT   CDS_pept        complement(105123..105563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0107"
FT                   /product="N utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BT0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17448"
FT                   /db_xref="GOA:A1QYQ6"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ6"
FT                   /protein_id="AAX17448.1"
FT                   /translation="MVMDLRHKARVLAFQKIYSIDINCKAKDNIYDIFNLEDHGLELEE
FT                   NLKLFYSVLVNGTYDNLEFIDKLISDISLNWRLDRMDKVDLAILRMSVYSLKFQNLDVP
FT                   KRVIIDEAILIAKKYGSKNSYKFVNGILDALLKNMESSFESK"
FT   gene            complement(105583..106617)
FT                   /locus_tag="BT0108"
FT   CDS_pept        complement(105583..106617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0108"
FT                   /product="basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17449"
FT                   /db_xref="GOA:A1QYQ7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ7"
FT                   /protein_id="AAX17449.1"
FT                   /translation="MIDIKVIFMGNVLCFLLFFVVGITSFAQNTPVVIINLHSNEIITK
FT                   TEFDSKVNTLKKTQGRDLSNAERKQVLQILIADVLFGQEALKQGIKVEDAEVMQTIRTQ
FT                   FGLLNLTDEQIKQMVESQGTNWNELLSSMKRSLSAQKLILKMAQPKFSEIKIPGEKEVV
FT                   EYYEANKTKFVNPDIARISHVFFSSKDKKRSEVLANAKDIVNQIKSKKITFEEAVRKYS
FT                   NDEGSKVKNGDLGFLARGDQNAQNVLGLDFVKEVFMLKKGDISQPISSKEGFHIVKVTE
FT                   MYSQRFLGLQDKISPNVDMTVKDAIKNNMVNIHQQQIVARVQQEIYDKLNKSASIQILD
FT                   SSLK"
FT   gene            complement(106688..107893)
FT                   /locus_tag="BT0109"
FT   CDS_pept        complement(106688..107893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0109"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17450"
FT                   /db_xref="GOA:A1QYQ8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ8"
FT                   /protein_id="AAX17450.1"
FT                   /translation="MGFCMRKIAIIDGLRSPITKFGGVLKGMNIVDVSSDIVKALLARN
FT                   NIDKVDEVIVGNVISAGLGQNIARQIALKAGLGEIIPAFTVNKVCGSGLKSLELAFNSI
FT                   ALGNSEIILAGGVEDLSNAPYLLPRGVRFDGLKFGDFKIEDSIYKDALVDTPSSTVMGL
FT                   TAENLAEMYEITREMQDQFAYNSHMKATAARDSGYFNDEIYPLSVFDKKTKLKSVICSD
FT                   EEIRDSLSLEKLSSLKPVFKEGGTVTAGNSSSLDDGACFLILASEDFVCKMGLQPLAYV
FT                   GGFKSVGLNPLHMGFGAFLAIKEIIEKFNLTPSEIDFIETNEAFAAQSLSVLKALRQKY
FT                   DVRDSIINVNGGAIALGHPFSVSGSRILLTLARLIKINNKSKGIASLCIGGGQGIAAFL
FT                   YR"
FT   gene            108057..109412
FT                   /locus_tag="BT0110"
FT   CDS_pept        108057..109412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17451"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYQ9"
FT                   /protein_id="AAX17451.1"
FT                   /translation="MYLAKLNLKMIIIMLAINSYAYNHLIKYQNDRVDKYHFNNLNDGL
FT                   GFALCDFFDDLRSGSLIFIHESKYNFMINAEAHMLTFRGNKDSPEQLRTRVDLLEIGFM
FT                   YYFPFSIKTKTQYFGNIDIGIGIKNLIYGNWGGALIQQAVHFTLRQLRPIPKNYENYNY
FT                   RGFLSTAINYSYMKFFNLENYIDLSYFADYFFKTSIAMDFKNESIGIETKLFYQTQSKI
FT                   NSIETYSKTQEAETGIGIQYRLHSKNFFTINNLNLNNFSTKEKFFSVGGFGIIFTEEYD
FT                   NTLEDNLYLLNQNFSFGFDIMIPFQTRNLIYYIIIPSLKYYFAIATNYDINLAEFNSRT
FT                   NRFSSGLMYELFTKNRFILYICSGIFVSYNKDKKDIKAIYRPLKIKDTLQAGLEIEPGI
FT                   LIETLKYNKVKYNAKIFTKINYHPIVYNTTNYNLETHKLNFNYLGIGITINI"
FT   gene            complement(109514..110899)
FT                   /locus_tag="BT0111"
FT   CDS_pept        complement(109514..110899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0111"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17452"
FT                   /db_xref="GOA:A1QYR0"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYR0"
FT                   /protein_id="AAX17452.1"
FT                   /translation="MAFTSVSTASTLLFNEGAEKAVISSIFYNPGKVEEALLYLKPDDF
FT                   YSQNHEMIFKAMISLYEKRENIDPITVFEEVSSLTPKSQLLSNFKALTGLQDYLSFLSG
FT                   YLPTDKTINVYAKIVKEHRIRRDISKISRELNDLANDSTKKVEQFVEEAQRHILSIELD
FT                   CSSKNLNHAKIIAERVHAEIYERSMKKREVNFGIPSGFKKVDSLIGGFRESDFIIIGAR
FT                   PSVGKTAFALNIASSIALRNDKKRKVGFFSLEMTSDALIKRIIAAQANIDSFKIQNSIL
FT                   SGHEIKAINDVVNDISNSEFYIEDTANISLLTLATQARKLKRFSDIDILFVDYISLISL
FT                   EARNVPRHEQVASISKALKELARELKIPIVALSQLTRDTEGREPSLASLRESGALEQDA
FT                   DIVILLHRDKDLKSGSDDERVISAIDTKIIVAKHRNGPTGRADILFLPHVVKFVNKEHE
FT                   NDY"
FT   gene            complement(110916..111413)
FT                   /locus_tag="BT0112"
FT   CDS_pept        complement(110916..111413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0112"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17453"
FT                   /db_xref="GOA:A1QYR1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYR1"
FT                   /protein_id="AAX17453.1"
FT                   /translation="MMRVILKEDFINLGKEGDIVDVKDGFARNYLLPKGFAVFSDKHNI
FT                   DIFNQKRRSILKRQETRKKAALELKEKLDKINLEFVMQSNDSGKLFHSINSLNIADELL
FT                   KLGFEIERRKIDIHHGTLKTFGIYDVTIKLYEGINSVIKVEIKREEKKHSLKKSKSVEK
FT                   EV"
FT   gene            complement(111420..111713)
FT                   /locus_tag="BT0113"
FT   CDS_pept        complement(111420..111713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0113"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17454"
FT                   /db_xref="GOA:A1QYR2"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYR2"
FT                   /protein_id="AAX17454.1"
FT                   /translation="MYKDIDSHQRDSRTDGHQDGFKKNPNFRFFKKKTCRFCDMDRVPD
FT                   YKEFDFLKKFVTEQGKILPRRITGTSAKHQRRLALEVKKARYMALLPFVKKY"
FT   gene            complement(111726..112163)
FT                   /locus_tag="BT0114"
FT   CDS_pept        complement(111726..112163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0114"
FT                   /product="single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17455"
FT                   /db_xref="GOA:A1QYR3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYR3"
FT                   /protein_id="AAX17455.1"
FT                   /translation="MADINSLVLSGRLTRDSELTYTEAGMAILKFGLANNRRVKKNDEW
FT                   MDYAQFFDCTLFGKRAESLASFLKKGKQVVISGSLRYESWQDKNTGDKKNRCSVLVDDI
FT                   QMFGSLITTKGANDVGFESYKKPDSFTDIGFDDGFNEDIPF"
FT   gene            complement(112175..112576)
FT                   /locus_tag="BT0115"
FT   CDS_pept        complement(112175..112576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0115"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17456"
FT                   /db_xref="GOA:A1QYR4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYR4"
FT                   /protein_id="AAX17456.1"
FT                   /translation="MIKKYEACFLFKSEELEYKAALEEVKKQLTVFNASDFAENSLGER
FT                   ALEYPIRKQLRGRYEIIEFKMDSENLKELEIQLKLIKNLLRHMILVKINKKVSVKKVKR
FT                   RNFREFKDNRDIKEKESSEFNSNVDVKVD"
FT   gene            complement(112908..114617)
FT                   /locus_tag="BT0116"
FT   CDS_pept        complement(112908..114617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0116"
FT                   /product="PTS system, glucose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BT0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17457"
FT                   /db_xref="GOA:A1QYR5"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYR5"
FT                   /protein_id="AAX17457.1"
FT                   /translation="MERSRVINFLKVFRFANLQKFSSAVRLPISVVTIFCLMLGIGSAL
FT                   LNPSNLFYVDNFVVKLVLGLIKSTSNIIILNIPLLFVIGITVGVARAQKGPAALSGLVG
FT                   YLIFNITENYFLDVFARLVDPNLMSSVGQVNILGIQTLNTGILGSLSVGLLVGYLHNKF
FT                   YCIELPGPLNFFSGFRFVPIVVFPFCILLGIIFVLIWPYFNELITSFGFFIAKFNYLNS
FT                   FLYGFLNRLLIPLGLHSILTFPFNFTSLGGTEVIDGQVVGGIQNIFYAQLADPYLVRFS
FT                   PSISRFNSGFYLSIMFGLPGAALGVYRGIIHDDKSKIVPLLFSGAFAAFLTGITEPLEF
FT                   LFVFTAPLLYFIHAIYTGFALLIANVLDIAVGVTFSAGFFDFLMFGVLQGHAKTNWLYL
FT                   LPLGFAFFALYYFTFKWVYNYFDFQIFGVDEPFFAGSEGEVEGMGIAHLIAQGLGGLDN
FT                   IQEFNVISTNLMFVVFSPELISEDFLKKTGALNIVTIDNTIKIDYGTNVYYIKQAIKNY
FT                   SPERLFKASAIVASDNVKHGIKAYIEMKEDDKLERQGSTGKVYKLNKDDEDN"
FT   gene            114845..115531
FT                   /locus_tag="BT0117"
FT   CDS_pept        114845..115531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0117"
FT                   /product="conserved membrane protein"
FT                   /note="hemolysin III-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17458"
FT                   /db_xref="GOA:A1QYR6"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYR6"
FT                   /protein_id="AAX17458.1"
FT                   /translation="MFEKNKKYTSYNEPIPKNELFSSISHLFGIILSIIGTTILITLST
FT                   HSKKYLHAVLFLIYGSSMTLLYTMSTLYHIFTKGSKIKQLFRKFDHISIFILIAGTYTP
FT                   PCLILMPNAYGKIILITVWGFAILGIIFKSIYVNSPGWLNGCIFILMGWSIIFGIRLIY
FT                   NILPIQGFLWLALGGILYTLGGIIYSASKKLNPIANMRMHDFFHILILFASFAHFWFMF
FT                   KYVLPY"
FT   gene            complement(115576..116859)
FT                   /locus_tag="BT0118"
FT   CDS_pept        complement(115576..116859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0118"
FT                   /product="membrane metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BT0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17459"
FT                   /db_xref="GOA:A1QYR7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYR7"
FT                   /protein_id="AAX17459.1"
FT                   /translation="MMYIFLSILAFTFIIFIHELGHLFFAKLFKVKVEVFSIGIGPSLF
FT                   KFKIKDTEYRFSPIFLGGYCKLKGAEHLENELRLNRQLEADKDSIFGISNFKKILIYFA
FT                   GPLFNLIFALIVFIAIEMIGIVYPDYFNKIVVINNSVLSKFRDGDVILSVNNSGIRYFS
FT                   DLNKVVPLKDSRVTFIVLRDSKTISFEDYTSFDKLLKEIGPWINLIISKVKTNSSAEVA
FT                   GLKPNDKIISINDVILNNNVELNNLIEKLDSNVVDIKYERNGEILTSRLVFQDTNKSLG
FT                   VYLLPGLERVVKSDNLGIAIKNSFNKVLNILGHILYSIVALFTNFKNNAKNVTGPVGMI
FT                   NIFIDSFSAGILSWFNTIAIFNLLIAGMNLFFVVIPMLDGGQILISLIEILRGKRFRAK
FT                   VIYYFYIFGILLMLSLFILGFFNDLRNL"
FT   gene            complement(116873..117829)
FT                   /locus_tag="BT0119"
FT   CDS_pept        complement(116873..117829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0119"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:BT0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17460"
FT                   /db_xref="GOA:A1QYR8"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYR8"
FT                   /protein_id="AAX17460.1"
FT                   /translation="MNLFFQVFCGQSIPFRIMIKTWNVLKIGRGILGDKSLFNLRSKKL
FT                   AFVARLGTFLFFVPLVLFLIFLEFNNYLFINILIFMFSGVAAKEVNDLLRVKSSSISST
FT                   LSFFLGIAPPILTYVHCNVFDLGINIIFYLVITLVFSNWIVNLVFIKENEIVNFLSQAT
FT                   SIIFILIYPGVLMSFVVAITTLPRAPILLLILFSMVSGNDTFAYLVGYFFGKNSYRPTI
FT                   ISPNKTIMGFLGGILFSVIVAIVVVCLGLINLTYGEAMIFGVLIGFFTIIGDLFESGLK
FT                   RSAGVKDSGNIIPGRGGALDSIDSYLLTGPIFYLYLS"
FT   gene            complement(117726..118418)
FT                   /locus_tag="BT0120"
FT   CDS_pept        complement(117726..118418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0120"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BT0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17461"
FT                   /db_xref="GOA:A1QYR9"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYR9"
FT                   /protein_id="AAX17461.1"
FT                   /translation="MNNNSLPMHVGIIMDGNRRWALKRGLSLFEGHKEGLKRAKEIVKY
FT                   SLKLGIKYLSLYVFSTENWNRTKSEIKHLMFVIADYLSSEFEFYSTNNIKILVSGEIEA
FT                   LSKEVRKSIIDAIDFTKNFDGLVLNLAINYGGRNEIVRATKKILGSGLQCETLDEIVFS
FT                   KFLDNPELCDLDLLIRTGGDMRISNFLLWRIAYCEFVFSSVLWPEYSVSHYDKDLECFK
FT                   NRKRNFGR"
FT   gene            complement(118423..118977)
FT                   /locus_tag="BT0121"
FT   CDS_pept        complement(118423..118977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0121"
FT                   /product="ribosome recycling factor"
FT                   /note="RRF"
FT                   /db_xref="EnsemblGenomes-Gn:BT0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17462"
FT                   /db_xref="GOA:A1QYS0"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYS0"
FT                   /protein_id="AAX17462.1"
FT                   /translation="MEEYKALLDEKMSKVLLSLESEYKSLRTGRINSSLFDKVLVDYYG
FT                   EKTPLTRVANVSIPEARLIVIQPWDKSLLSKIEQAILSSDLSMNPSSDGAVLRIKVPVL
FT                   TVERRKEIVKQAKKIAEEYKVAARNVRQELNSKAKKQEKDSQITEDDLRRILDDIQRDT
FT                   NSYIKKIDEIFDLKTKEIMEV"
FT   gene            complement(119014..119850)
FT                   /locus_tag="BT0122"
FT   CDS_pept        complement(119014..119850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0122"
FT                   /product="protein translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17463"
FT                   /db_xref="GOA:A1QYS1"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYS1"
FT                   /protein_id="AAX17463.1"
FT                   /translation="MSISPQEVKKLRDVTGAGFGDCKKALDAVGGDFELAKKKLREMGI
FT                   ASADKRSGRDAKEGRVFSYVNKERVGLLLISCETDFVAMNSDFVTFGNSLIKQLVESGK
FT                   DSLDKQQELEIKNLAATIKENIHVSKIYISNIASNELVKNYLHGEQSKIGVFIKLKVDD
FT                   VLKMEDESLNNLAMDLALHVAAFAPLYLSVGDICSNYIKEQEEMFTKQMEASGKSEAVI
FT                   KGIVSGKLKKHLGEIALLEQGFVKDDKLTVKEKIEEISKSILTKIEIVDFKYLSVG"
FT   gene            complement(119868..120632)
FT                   /locus_tag="BT0123"
FT   CDS_pept        complement(119868..120632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0123"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17464"
FT                   /db_xref="GOA:A1QYS2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYS2"
FT                   /protein_id="AAX17464.1"
FT                   /translation="MAVITMKSLLEAGVHFGHQVKRLDPRMKRFIFSERNEIHILDLQK
FT                   TLQGIKDSYELVQSVIKSGKKVLFVGTKKQASEIIEQEARRSDMPYVNNRWLGGMLSNF
FT                   NTIKKSVQKLKKLEKMEIDGTFEMISKKEVSQLNREKLKLSKNLTGIKDMEELPGAVFI
FT                   IDPKREQIVINEARKLGIPIISVVDTNCNPDVIDCPIPGNDDAIRSVALFTKIISDAIL
FT                   ESDKEVGIQIVENLNEEDLMSEIAVKDEKKEL"
FT   gene            complement(120668..121267)
FT                   /locus_tag="BT0123A"
FT   CDS_pept        complement(120668..121267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0123A"
FT                   /product="septum formation protein Maf"
FT                   /db_xref="EnsemblGenomes-Gn:BT0123A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17465"
FT                   /db_xref="GOA:A1QYS3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYS3"
FT                   /protein_id="AAX17465.1"
FT                   /translation="MIYKENFEIALVSNSFARAEFLEALKIKFLSLSVDIDEGSIMKSG
FT                   EIGVTKRIAVLKLTNAIEKYGKDKCLITVDTLLKNDSIYVGKLSDEKEAFSKIMGYSHK
FT                   LIEVETSFCVFIPGKEKIIKACEVSFIKFRELTPDIVYHYIALGHWKDKAGGISLKNGV
FT                   ADILIEYINGSYSNIIGLPIGLFYDILIRENVISTI"
FT   gene            complement(121257..121535)
FT                   /locus_tag="BT0124"
FT   CDS_pept        complement(121257..121535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17466"
FT                   /db_xref="GOA:A1QYS4"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYS4"
FT                   /protein_id="AAX17466.1"
FT                   /translation="MVTFFFHLILTNIIISFVVSFFVVFFGILRFGFLLVYLISFLGSV
FT                   LFLFFIPLFYSDYYNRQVDVLFYLFPVIGSIVLISLLGFSERSKNDL"
FT   gene            complement(121550..122338)
FT                   /locus_tag="BT0125"
FT   CDS_pept        complement(121550..122338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17467"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYS5"
FT                   /protein_id="AAX17467.1"
FT                   /translation="MFFCFSMKKFDNNIILLIVFLLVVSCGLEDIVIVDSPLVIDSRAS
FT                   RDTLAFALPSWYFGNNHNSRVRGFDIYYKFYPEGSNYHFRGFAESVQKDFNALKSVFNN
FT                   VNEFNRRGFYKINLDGDRFSGKPTLKLDKSWIQGNFPLYFELNFENLRKSTPGSVFINI
FT                   RKGNSSSAPLIRSIKTVYRSYVVNDLYREFSEALKKSKVTNSTNRPFDLKHISDSFFTK
FT                   DVSPKYNLVIFVMAVGNAIEDDLYSVIVNLGSLHGFELSS"
FT   gene            complement(122345..122953)
FT                   /locus_tag="BT0126"
FT   CDS_pept        complement(122345..122953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17468"
FT                   /db_xref="GOA:A1QYS6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYS6"
FT                   /protein_id="AAX17468.1"
FT                   /translation="MLMFKNKFFIGIFAVIVFVGIVVYFYSSMDVDYVKAGGEVVENLE
FT                   RDLNLYLRAKNIEEKLELESKIEESINKRDDVAYEFLSRFYLARSTYFQSKGLYKEALE
FT                   DLDIVIGSKWIERELAYLNKAVIYEKMGQVDNALIIYDNLIKQTKLDFIKIRALLGKAV
FT                   LIETRDKKLAIDIYSEIANFSYENNLYVNLAKNKLLQLR"
FT   gene            complement(122940..124607)
FT                   /locus_tag="BT0127"
FT   CDS_pept        complement(122940..124607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0127"
FT                   /product="SSU ribosomal protein S1P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17469"
FT                   /db_xref="GOA:A1QYS7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYS7"
FT                   /protein_id="AAX17469.1"
FT                   /translation="MRMENQEDLQENYLKVLEKVELGSSVSGVVINVMKDYVLVDIGYK
FT                   SEGFIKIDEFETIPSIGDKLDAIVTKVGGELGLVLSVAKLDSLNLQDKIDEYISNRKVL
FT                   KGKILAELSSGYKVQINENVIGFMPSYLSSKFRDEKLKRGLVVEFYVVQADKTDGLRLI
FT                   LDRRTLERERELVKKKELVSSYNEGDIVDGVVERITDYSAIIKVKNLVLGVLHKRNIAF
FT                   NRVENIEDFIRVGDKLRLKIIKLNVNAVKMELSLKALKTNPWDSVEAKYKVESIVKGKV
FT                   VKILPFGAVVELDSEISGFIHISNFSWVRVIKSPQELVKVGQIVEVKILEIDKENQKIS
FT                   LGIKQVNENPWNNLAQRCAVGKVVQGVVKNITKTGAFVSIEEGIDAYISKFDISWIDEV
FT                   NPEEYFKLGSSISGKVIELDAKKQNIKLGIKQLEENPWDDFSKSYKKGDTLEVEIVEKK
FT                   SKGVQVRVYGKIMGFISKIQLGDTKESSLETFENLNIGDKLKVIITNIDFKNKLVLLSY
FT                   RAYKEQKSSEEISSYLFKEDDEESYKPFANLLKRNADV"
FT   gene            complement(124604..125272)
FT                   /locus_tag="BT0128"
FT   CDS_pept        complement(124604..125272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0128"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:BT0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17470"
FT                   /db_xref="GOA:A1QYS8"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYS8"
FT                   /protein_id="AAX17470.1"
FT                   /translation="MVIAIDGPSASGKSSIAKALGMRLGFKFISSGYFYRIITLIAQRF
FT                   SLNEYDLLSESKILELVSQNDIKFNGFDFLLNGTNVISHILNERIDFQVSLYSSYIGVR
FT                   NIVNKKLREIVKLKDDNYIIEGRDITTVVFPEAEVKIYLDASVKVRALRRYNQRSDNVT
FT                   LNELEQALERRDEIDQNKEYGKLKLDKEVFYIDTSYKCLDDVCNIIIKTFNLKKKVIER
FT                   "
FT   gene            complement(125273..126016)
FT                   /locus_tag="BT0129"
FT   CDS_pept        complement(125273..126016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0129"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BT0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17471"
FT                   /db_xref="GOA:A1QYS9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYS9"
FT                   /protein_id="AAX17471.1"
FT                   /translation="MTNTNSKGLRVHVFLAEKGVGSRRFCEDLIRKNSVRINNTLAKLG
FT                   DKVFLGDRVECRKQVFVFRDCKVESKIYIALHKPKNYLCSNFDPEGRQLAISLVQPLFK
FT                   ERLFSIGRLDFKSSGLLLFTNDGQFANNIVHPRSKVEKEYIVESKRAVNENLLINFKHG
FT                   IKIGREIFKLKSYVMLGNNSVKLVLTEGKNREIRKVFLSKNIFLKKIHRIRIGNIKLDD
FT                   LKEGQIKVLSLAKINKFKTQILGEY"
FT   gene            complement(125988..126803)
FT                   /locus_tag="BT0130"
FT   CDS_pept        complement(125988..126803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17472"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYT0"
FT                   /protein_id="AAX17472.1"
FT                   /translation="MKLVRLMLKKIKNRMTNLDDYLIVCNDFKGGIEIFFDYIRNKREI
FT                   LKTFNLNKIIEDFLVFSESIEIDVKELIKFYSFSTSLLYLKTQILYPVKLKDKKLVERE
FT                   MVKKLINFSEKYVKSKSSTRNLKDEKCLNVSKSSFLRENSIFFESVDNVQNYMVGINKV
FT                   KSKVSRISKKQDDILRNIKFRSNVILGIYDAKIFDKKTKIIALLTKEDNFIFEFLLNFD
FT                   DKFYFFERFCYFLIVLEYKMSNIIDLVYLNDKLVLRKGKSIDEYKQQRA"
FT   gene            complement(126763..127854)
FT                   /locus_tag="BT0131"
FT   CDS_pept        complement(126763..127854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0131"
FT                   /product="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17473"
FT                   /db_xref="GOA:A1QYT1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYT1"
FT                   /protein_id="AAX17473.1"
FT                   /translation="MSKLKDKIDDSLNDRLNREKAIELARIQIEKDFGKGSLIKMGESP
FT                   VGKGIESISSGSILLDEAIGVGGYPRGRIIEIFGPESSGKTTLTLQAISEVQKNGGIAA
FT                   FIDAEHALDPVYAKALGVNIDELWLSQPDTGEQALEIAEYLIRSGGVDLIVVDSVAALT
FT                   PQAEIDGEMGDCQIGLQARLMSKALRKITGILSKSKTCIMFINQLRMKIGVMFGNPETT
FT                   TGGNALKFYSSLRLEVRKIEQVTGSSADDVVGNKVRVKVVKNKVAPPFRKIELVIYFGK
FT                   GISREASILDASIKYKLIQKIGSWYSIGDDKLGQGRESAIIYLIKEKELTNELEIKLRK
FT                   IIFEGLSPDSIEIGPPNVKKDKE"
FT   gene            complement(127865..130567)
FT                   /locus_tag="BT0132"
FT   CDS_pept        complement(127865..130567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0132"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17474"
FT                   /db_xref="GOA:A1QYT2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYT2"
FT                   /protein_id="AAX17474.1"
FT                   /translation="MSNITIERLDNILQEDKWTRIVVNNYSLAKIRELDELIDSIISEN
FT                   LTEEALDICGKHLKDVKKSIAGLYISGMLIYSRRPLNDMSLLTVVDLFSQNLKWSLVEH
FT                   ICHKMLLTSENKHALYTLAKIYSQNNENDKLPGIWMRIVEADVDDTVCVRQLATHYENI
FT                   DLQKSIYFFRKAIYRFIDKKQMSGIREVWSKLIRYVSDDFDSFLLILQKVEKELGFKKV
FT                   VVLYEDLYEHYSVSENIDETIEILKGILKLDNKNQKARENLVIFLREKYKDVKNIEEYL
FT                   EKSDLENLDKNFIDVYSDFEKYLFFAKGNFVYHQTWFVGIVKDVNEQGIVVDFVSKRRH
FT                   FISFDMAMSALSPLKKEDIRVLKAIKPKEELVENLKRDVEWALRIIIKSYKSIDLKGIK
FT                   RELVPSLMTQSAWNAWSVKAKQILKDNPHFVMASGKADCYIYNERASNFNEKIYDKFKV
FT                   EKDFYKRYEIFMHYCTAGGVVKDLHVEEEMLNYFLIYVNNFAKVDHYVISSYVILKSLK
FT                   NSERGGAFKINIEKDINLDVLLKEYSKNIVDLFDSILNAEIKKELVSLIKDELVDWVVY
FT                   YKQLFPCYVNKKLIDSLYKEDIKETAHLFNYIIKNYKVYKDAYIWLLKHYTSYSLDLDY
FT                   SDSELLINLIKILTDSVVKINNKNNSVANKRIYKMVMNLLIKDKYLSIVLNNVMDEELA
FT                   KRIYMTCFYIRDFPPKDLLHIKTAIRSVFIDLEFEDEKMQSSGDKVEIGFLTILSSLSK
FT                   KQKELQYLKDVEIPENSKEIGKARELGDLKENAEYHSAKERQQFLTKRLNSLMSEIDFA
FT                   KVIDTKELQSSVVGFGTKVTMINKDTKREESYLIFGPWESNPDEGIISYKSPFGENLLD
FT                   AKEGDNLDFVINDTHFQYYVKKIEPAKIN"
FT   gene            complement(130604..131548)
FT                   /locus_tag="BT0133"
FT   CDS_pept        complement(130604..131548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17475"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYT3"
FT                   /protein_id="AAX17475.1"
FT                   /translation="MSSEKIAELIKDIYLSFRKGDFKTALMKSEEAHSLDFDNIEILTA
FT                   LKSSVYWNGQVESLDRIDKDYEKAEFLIREWNNFARRYLKKMNFDFIQGRNSIKYFVFQ
FT                   LCLEIYKNIYKLQPENLDILIKIAKSYKGMGNYERAITVFLQILGDTKDNADVVAELAD
FT                   SYALIDEIKEAKVLFREAFFINPQKIDIDALESEMILKLIEAIKSDRNISDTLVKEWIP
FT                   VYGALNGVFNIKRELRPIELGHLKQSVYSLRNELKEKSYRSINESILLPRLINKYFWLI
FT                   DHYVRIKEDRVRIDEILSYIKEIDIGIYQQYVN"
FT   gene            131729..132874
FT                   /locus_tag="BT0134"
FT   CDS_pept        131729..132874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0134"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17476"
FT                   /db_xref="GOA:A1QYT4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYT4"
FT                   /protein_id="AAX17476.1"
FT                   /translation="MAMEPNKLINKSISYYNSQKYSDVVKLLEKEIFLYKNYYFYHYIL
FT                   GMSYLRMGNLGTAQTYLKKAYTLNPTEPDVKQSIAILLAAQGKEDKAIQIWLKMIEENQ
FT                   EIQRSEFSLETIRKNPIQGALFLNKNKIYAKLFPEIKVETGQNLSKLIRILLIIASLAF
FT                   LLIAIFLLIHSKETIKLSLSNSKIKEKKAINNIAAYIDDIKINDKEKIENHEGQFVFIL
FT                   TETEIKNSFQKIKTHLKQGKDNFARIEINKILNSNASESIKLKAKNLASFISRPNFITF
FT                   DDYLVLKEIKKNPLIYSNVYVKWEGIANNIEKKDNITYFDFYVGYNKNALEGIITTKTT
FT                   FDIDINFKDYVEILGQIDYDYNTNILTLNAITIRKIEKQKN"
FT   gene            complement(132920..134290)
FT                   /locus_tag="BT0135"
FT   CDS_pept        complement(132920..134290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0135"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BT0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17477"
FT                   /db_xref="GOA:A1QYT5"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYT5"
FT                   /protein_id="AAX17477.1"
FT                   /translation="MDVRTLKGFRDYLPKEALIRTHIIKQIYSVLVSYNFDLIDTPILE
FT                   YSEFLLRKSGDEVEKQTYRFKDNGDRDVSMRFDLTVPFARFMASNRSKLKFPFRRSQIG
FT                   KVFRGENTQRGRYREFMQFDFDIVGEDTFRSDAEILSIVYCGLEEIFLNFIEGINRKFV
FT                   IHFSHIGILNAYIDKLGLKDKATFILRNIDKLDKMGIESVRENLLVQINEEHVDLILEF
FT                   INLEGAFWDKLETLKGVLENNDAVKRIEDVFVHLSALGIQDAFNFNLKIVRGLDYYTGI
FT                   VFEAEMIGINMGSICSGGRYDNLLSLFSSSLQKVSGVGGSFGIDRIQDIIEIEKFNYIK
FT                   LFVVKASSRVLIVNIDDSLQDYYYKLADKFRRHDYSKINNIACEVYPKSKEGKNIKVQI
FT                   EYALNKAIRFLIFVGQDEYREDKLKVRDLTKKEELLLSFDEAIKFIKGNDKFLCTPF"
FT   gene            134433..136310
FT                   /locus_tag="BT0136"
FT   CDS_pept        134433..136310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0136"
FT                   /product="division specific D,D-transpeptidase"
FT                   /note="cell division protein FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:BT0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17478"
FT                   /db_xref="GOA:A1QYT6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYT6"
FT                   /protein_id="AAX17478.1"
FT                   /translation="MHKKFASSLRLNIILIIFLIITLLTIYKYFVLMSSKDIQYFSQNI
FT                   NHISRRGNIYDRNGKIIAFSSKSHSVGTDPNKIKNIVNTSETLGAILKIDPQILKKKLS
FT                   LKKGFIYIKRKITREESELIKRIQSEGRLKDIILYPDYTRIYPFKELTSNITGFVGTDN
FT                   IGLTGIELSLNTILNEDLTKQKSINEKLSTNNIYLTIDIDLQKSINQIAQKHFKENKPE
FT                   NMIAIVMNAKNGEILSMLQFPQYDANYYAKYPKEIWNNFATSLTYEPGSINKIFTVAIL
FT                   LDSGLLKSNEKFLDNGIYQKKFKSGEVVTIKTLNPPYGYIDPSGILIYSSNVGIAHITD
FT                   KVSNEYFHNKLIDFGFGKRVGFPLPGETKGLLTHHSKWSGRSKATIGFGQEIGVSAIQI
FT                   LQAASALSNEGIMLKPKIIKRISNEMENTIQEFQKEEIKKVISKHTAKEVLKMMREVVN
FT                   KGGIPKLKMKNLSISAKSGTSQVIDKNTGKYSDEDYTSSILVIYPTEDPQYIIYIVYRY
FT                   PKKIIYGTRIAAPMAKEIIELIEHRNNKNEYNEIKISSKISIPKPIIKYEKTETLPNLT
FT                   GISKRDLMKILKNYTNIKIKIKGNGFVYKQSKPPNTKLKHIDELEIILK"
FT   gene            complement(136312..138204)
FT                   /locus_tag="BT0137"
FT   CDS_pept        complement(136312..138204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0137"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17479"
FT                   /db_xref="GOA:A1QYT7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYT7"
FT                   /protein_id="AAX17479.1"
FT                   /translation="MSIVKNFFEIAKKRGNGVAQIYRSNKDYFNVTYEDLKNNVLKFAA
FT                   FLKKMGLGYQDKVFICSENRIEWSVIDFAILALGAVDVPKGADVTLFEAEVIINNVLPN
FT                   IIIVENLNLLDSVVQINFKVDPIIVIIDDLDEKDKIQFGNFKIYTYKECISIGDKSRRD
FT                   EEIIEILSNINPDDMATIIYTSGTTGNPKGVMLSHANFLYQVSSFSRMINTSEGQIFMC
FT                   ILPIWHSFQRSFSYNIFLKGMTCLFSSIVPRNMLDDMKNVNPHYIAAVPRLWIAIKQNI
FT                   FKEVAKKPFFSKLLFKIFVKSACLNDICYRIILGLYPDNGFDLLFPMKKLLGILGLIFF
FT                   FPLRVLGDLIVFKKIKKVLGNNFVVGITGGGSMSLSVVRFFNSIGIELANAYGLTEASP
FT                   GVASNEHEKIMIGTCGRILPETVAEIRDENGNKLKTPGKGILFIKGPQVMIGYYQDEDA
FT                   TRQVIGSDGFLNTGDIVKLSKDNVVQIIGREKDTIVLNNGENIEPAPIEIKLEESLLIE
FT                   KAVVVGQDQKFLGALILPNFEEINKYLESMGQKILDAHNRRQIIANNIVLKAINDEIKK
FT                   LINRANGFKPFEQILRFVLLEKPFEVGKEMSIKMDVKRNYILSFYKNEIKNLFS"
FT   gene            complement(138360..138665)
FT                   /locus_tag="BT0139"
FT   CDS_pept        complement(138360..138665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17480"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYT8"
FT                   /protein_id="AAX17480.1"
FT                   /translation="MGGYVYRAEIISNLSLELDLHEHMHRIEKDLGECIYYSKIYNVQG
FT                   KGRTGEKQGNEIWPEENFILVVYTDNLFIIEKLRNAVEMLDQEYPTEGIRFFVIGN"
FT   gene            complement(138759..141944)
FT                   /locus_tag="BT0140"
FT   CDS_pept        complement(138759..141944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0140"
FT                   /product="acriflavin resistance plasma membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17481"
FT                   /db_xref="GOA:A1QYT9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYT9"
FT                   /protein_id="AAX17481.1"
FT                   /translation="MRLIMLVKKIVGKPITMLILFSLLMMLSIYTFSRLKIDLLPNIGD
FT                   SYITISTQYSGSSAKEVEEKVTSLLEGNLSLVKNIKTITSSSFKGHSSINLQFYHGTNL
FT                   DLALNEIRDALEISKRILPKEASLPRIYRGSLGSSPIISFVMYADRPVLELKRYADNIL
FT                   KPRLERLNGVGRVQVIGGGGKHILIEVLQNRLEAYGLTLSEIVPFISSQNVEFSVGNML
FT                   DNDLEYQVQVSGKFNSIKDLENVVIAYRKPSIYSLGDNSFVQVRLRDIASVKSVAQDVE
FT                   DYAYYNDKPSIVISIQKQSDANSVFVSDAVNAEVEKIKLALPKDIFLDISYDDAEHIKK
FT                   AISSVANSAYSGAVLALCIIFFFLRSFRATIIIGITIPLAIVLTFCLMYFANISLNVMS
FT                   LSGLALSVGMLVDCSIVVIENIYKYRQKGAKLISSAILGTQEMILPIMTATLTSICVFA
FT                   PMLIFKAELGVIGDFVRDFAFTIVISLVASLFVAVFLVPVLSSYYVGLYTTSQKPIKNK
FT                   LIKRIDDFLYGIYFVGERFYVKLLNYVLTWKLACSLIILFIFILSLVLFPLLNVSFLPY
FT                   ERSSLIRFDFKFPHKTSLKIAKFYSDKILEIVKNEIKVYKSIVSEINSNGFIFNVTLPL
FT                   KEEADGEFVEDEEDIRYRVYKRVEKLYPDFNSNASSRGGFFGASPIEIKIIASDFGYAR
FT                   EYGEFLVSLLKKKFPSLVNPRLNIREEMQIDIEIDREKAYFYGINMETLSREIRANIGG
FT                   ISAGNYIEDGVSYDILLRLDRDNIASFKDLDKISILSASGVQVPFSSIVRLKKTKGIGE
FT                   ISREDQSLVVKLTAGIAPGENLALITANVVDFVTNKVPQRDGVLVKFEGEYSEFTSSMQ
FT                   QFGVIMFMAVLLVFGVMAAQFESFLKPFVILFTIPLTLIGVVPFYFISGEKVSVFTAIG
FT                   MLMLIGVVVNTGIVLVDYINLLLKRGFNLKDAVLEAGRSRFRPILMSALTSIIGLFPLA
FT                   FSSSSESNLVKPIAFTFIGGMVASTFLTLLFIPMIFEIFYKLSINAFISFKSRGPVDKI
FT                   DLQGGSRGFSDKI"
FT   gene            complement(141948..142925)
FT                   /locus_tag="BT0141"
FT   CDS_pept        complement(141948..142925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0141"
FT                   /product="acriflavin resistance periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17482"
FT                   /db_xref="GOA:A1QYU0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU0"
FT                   /protein_id="AAX17482.1"
FT                   /translation="MNSIFNMRGCFKYYLLLLVLLFVLSCNEGTESEVQGDINTNNTTS
FT                   DFTNEPYRFPVVAMRVRQGALSNYISLNGDVDTKVKVEVFPNITGEIVSLNMKLGAYVK
FT                   KGQIIATLDPSKPGFLYLKSPVRAPISGYVLAINYKIGETVGTQTSIALIGRMDLIQIK
FT                   TYVSEKYILDIKVGNDAIIELESYPNEKFKAKISEVSPVLDFKSRSVAIYLEPIGDNAR
FT                   KMIIGMFAKIKLITKHLENVIKIPSHAFVEREGKLCVFRLNPDTKTVERVFPVIDFEID
FT                   NIMSIRDGINEGDLVVIEGISSLSDGAYVDIVDIRDGLDVEDNV"
FT   gene            complement(142938..144218)
FT                   /locus_tag="BT0142"
FT   CDS_pept        complement(142938..144218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0142"
FT                   /product="outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17483"
FT                   /db_xref="GOA:A1QYU1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU1"
FT                   /protein_id="AAX17483.1"
FT                   /translation="MGVNIKRLILIFILSFSSYAEVIKISVEDAIRMALENSLESRDAE
FT                   YREKIKKLYKDNSWNLLIPNLGFSSNFSRQNSFMPNVEGRGEWNLNFGVAADLSVSPSI
FT                   VNNIRLTVFNYEAAKIDREKVIKNIRLNVLKMYNELLAFKSILEVLESQFENSKLKFEQ
FT                   VKISYHNGLISEIDYLDAKLKHIKFQPSLDEQIIKFEETKERFKLLLGLDVLQDFETTG
FT                   ELSDEILDISLFDEVINIDGYLEVRELNNLTKIMQTTLESLWLDAFLPRFSFSVSYNPG
FT                   SISFSDGLSGSFKQGLHFSLGLTYSFTEVLPFSKSFTEIWERDYRLKFLENQIENKIRE
FT                   FKSNIIQKRKSVRLYKSILDNSKINLEMSKKNYQVAFDSFNVGTIDLIKLNDIEASYKQ
FT                   SDLQFIQDKLNYANAILEYKDLINKLD"
FT   gene            144332..144625
FT                   /locus_tag="BT0143"
FT   CDS_pept        144332..144625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0143"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17484"
FT                   /db_xref="GOA:A1QYU2"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU2"
FT                   /protein_id="AAX17484.1"
FT                   /translation="MHIFKKLFIIFNLILILLIKIYQNTLSKIVGFHCIYEPSCSNYAL
FT                   ECLKKYNIITALILITLRLLRCNALFKGGSESLPTEKPILNSLKIFKTRLIK"
FT   gene            complement(144614..145510)
FT                   /locus_tag="BT0144"
FT   CDS_pept        complement(144614..145510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0144"
FT                   /product="glycine betaine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17485"
FT                   /db_xref="GOA:A1QYU3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU3"
FT                   /protein_id="AAX17485.1"
FT                   /translation="MKGLLISVFISFILILFSCDKNDNSKDNGFKSVRSVKIAYVNWIG
FT                   ETVATNIMKVVFEKIGYNVEILPVTTSIMYQYLASGQVDGMVSAWVPTADKFYYEKFKD
FT                   KFVDLGANYEGTLQGFVVPSYVTISSISELKGRGAEFKNKMIGIDAGAGTQLSVEETLK
FT                   RYGLDKEYELISSSESVMLASLESAIKKHEWILVPLWKPHWAFTKYNIKFLDDPLLSMG
FT                   GPESIHSLVRIGLEDADPDAYYLFDNFYWGDDLLLPLIEKNYKEPGHEYGNAVEFVDLH
FT                   KEYVKNWVPDKYKDLFN"
FT   gene            complement(145547..146446)
FT                   /locus_tag="BT0145"
FT   CDS_pept        complement(145547..146446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0145"
FT                   /product="glycine betaine transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17486"
FT                   /db_xref="GOA:A1QYU4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU4"
FT                   /protein_id="AAX17486.1"
FT                   /translation="MNRDFIVANIDKAFNFLVDNFSDSNGIGFAKIVIFFYDNLKKLFL
FT                   LINPVFFIILICVLSFLFLKKRLALLIMLGFCFILYFNLWEVSMDTISIIFVSVFFSVI
FT                   WGILIGILGGYYSKFYVFLKPLLDLMQAMPPFIYLIPAIPFFGMGTSSAIFATIIFAMP
FT                   PVIRYTRLGIIQVPGEVIEAAKSFGSSNIRILFQIQLPLALQSIIEGINQSIMMAISMI
FT                   VIAAMVGSSGLGRSVIYSVERLHFGEGLISGLAVVVIAIILDRIMQAIFIKFSYLNTDN
FT                   YGVKKENKFKRFLEMYNK"
FT   gene            complement(146453..147571)
FT                   /locus_tag="BT0146"
FT   CDS_pept        complement(146453..147571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0146"
FT                   /product="glycine betaine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17487"
FT                   /db_xref="GOA:A1QYU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU5"
FT                   /protein_id="AAX17487.1"
FT                   /translation="MSKASVKVRNLYKTFSYNKNKKQIVKAIKSYESGKDRSDIYKESS
FT                   VFIANANISLDVYENEILVIMGMSGCGKSTFVRCLNGIHKIDSGSILVDNIEMNDINQK
FT                   ALSALRKDKFAMVFQNFGLFPHMNVLRNVTYGLEVKNVPKKIRIQRALDILKLVGLEDS
FT                   EYKYINELSGGMKQRVGIARALVVNPDILLMDEAFSALDPLIRGEMQCELLRLVDKLKK
FT                   TVVFITHDLIEAFKLGNRIAFMKDGEIVQVGRPLEILRDPKTDFIANFIKNLPVLNILK
FT                   IKDIIKMDFTLNGDTDKCNVILEKENNNFNLYDLSVNKKCNNLVSLNLGLDDEIKSVVK
FT                   YLNKLDYLIIKGEQDDIIGYIDLGEIAGLLAR"
FT   gene            complement(147701..148705)
FT                   /locus_tag="BT0147"
FT   CDS_pept        complement(147701..148705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0147"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:BT0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17488"
FT                   /db_xref="GOA:A1QYU6"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU6"
FT                   /protein_id="AAX17488.1"
FT                   /translation="MIINHNTSAINASRNNSINAANLSKTQEKLSSGHRINRASDDAAG
FT                   MGVAGKINAQIRGLSQASRNTSKAINFIQTTEGNLNEVEKVLVRMKELAVQSGNGTYSD
FT                   ADRGSIQIEIEQLTDEINRIADQAQYNQMHMLSNKSAAQNIKTAEELGMQPAKINTPAS
FT                   LAGSQASWTLRVHVGANQDEAIAVNIYAANVANLFAGEGAQVSPAQEGAQQEGVQAAPA
FT                   PAAAPAQGGVNSPVNVTTTIDANMSLSKIENAIRMVSDQRANLGAFQNRLESIKASTEY
FT                   AIENLKSSYAQIQDATMTDEIVASTTNSILTQSAMAMIAQANQVPQYVLSLLR"
FT   gene            complement(148827..150827)
FT                   /locus_tag="BT0149"
FT   CDS_pept        complement(148827..150827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0149"
FT                   /product="flagellar hook-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:BT0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17489"
FT                   /db_xref="GOA:A1QYU7"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU7"
FT                   /protein_id="AAX17489.1"
FT                   /translation="MSSGFFVPGVDNKYNTKEIRESMLKPDKAKIDSSVKKLENLEQEK
FT                   RAWQMINKKISTLNSLARQITSLNSPFNYMSGNSSNNDVLSLSARYGAKNETYKIDVNQ
FT                   IASSDIFLSANFKQKEISIPSGDYIFLVGNKEIKIRNNGDIESLVKDINNRGKGFLSAK
FT                   VVRSDSAGNSRLILRSLKEGENNKLVMKGEALNLAKQIGILSELTTNFSPNLTEIINSQ
FT                   QSSSNKIFLDKDDIVLEPLSEISISIPENIEVSSRSKIKFEIKYYDSDDKGILNEIVFN
FT                   PGEATFEDAKVEGEDSIINLESDHKLPLKERKYIQMNMIKIHSGTNSLELPPINVASDF
FT                   EKVEVEIGSLLDLKEINIENKVNNKVFVIRNIEIFDPKNRDGFLPINAKSFAENAKVKF
FT                   DGVDVERDSNTVNDLIPNVTLNLKQASDDTIVVRVEPDYEGIKKLLLDFLVAYNQVLAE
FT                   INIVSSNESNLEGQKSDVLEEWSYFSDEEREEAYKNLGILRTEFALKNLRSRLELIMFN
FT                   SYRTNDPNFSIINQIGVFTNSMSSSGGLSRYLGLDEKKFNEIIQSNINSVKELFAVDFN
FT                   DDRIYDDGLAKMLGDYLSPLISSGGFIYNKIRNYDLKIPNQKNVVEDYKKKYEEREQKV
FT                   EGELNTLDFTVKRMKEQEEILKSLNLQRQNR"
FT   gene            151003..152208
FT                   /locus_tag="BT0151"
FT   CDS_pept        151003..152208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0151"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BT0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17490"
FT                   /db_xref="GOA:A1QYU8"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU8"
FT                   /protein_id="AAX17490.1"
FT                   /translation="MPNFCLFNSKSVLTGNDKIDNSAVLIKDSKIFDIVTADRLEKIDL
FT                   QNYEMIDVKGNYITPGLYDNHIHGFHGYGTDQCSTNSIIKMSQYLAEYGVVGFLPTLYP
FT                   RPTEEMIETIKACTAAIGKEKGAKILGLHLEGPFFSPEKKGAHPTSYLQQPSIEVMKKF
FT                   IDAAGGTFTDSFGRKRTNIATMTVAPELKGMRELAMFCMENNITLQAGHTNAKYENMIE
FT                   GFQVGILHTTHFFNAMSKLDHRNPNAIGATLIHGDVSCEIIADGHHIHPKLVLMLRKLK
FT                   DISKLVLVTDGLTPTLQPSGKLIANGEEVYLNDDGLFHIVESDTIAGSALTMIQGIKNL
FT                   VEFGYSLSDAIQASSYNPIRIINLEKKGLICHGYDANINVLDKDLDLKLTMIESKIIFN
FT                   KL"
FT   gene            152205..153044
FT                   /locus_tag="BT0152"
FT   CDS_pept        152205..153044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0152"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:BT0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17491"
FT                   /db_xref="GOA:A1QYU9"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYU9"
FT                   /protein_id="AAX17491.1"
FT                   /translation="MILFIYKYKEQQMRLIIRSNYNDISKWAANHVAMRIKKFSPTKEK
FT                   PFILGLPTGSSPIGMYKHLIEMNKLGKISFENVVTFNMDEYIKLDKNHPESYHSFMWSN
FT                   FFSHIDIKKENIHMLNGNATNLINECEEYENKIKSYGGIMLFVGGIGPDGHIAFNEPGS
FT                   SLSSRTRIKTLTQDTIIANSRFFENDINKVPKSALTVGVGTIMDSKEIMIIVNGHNKAR
FT                   ALKHAIEKGVNHMWTISALQLHKNAIIVSDEAATYELKVGTVKYFNDIERDNFNNDI"
FT   gene            complement(153137..153829)
FT                   /locus_tag="BT0153"
FT   CDS_pept        complement(153137..153829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0153"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17492"
FT                   /db_xref="GOA:A1QYV0"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV0"
FT                   /protein_id="AAX17492.1"
FT                   /translation="MGGMNPVIVAVKRNIKIVMEKAKKEDFMFKLPELGYAYDVLEPYI
FT                   DAKTMEIHHSKHHNAYTVNLNSVLEKTEINYSQDIESILKNIQRFPKEFQAAIRNNAGG
FT                   YSNHTLYFRILRPGNKDNILENFEEHVNATFGSLDNLKMALRDSAINVFGSGWAWLVLH
FT                   ASKELQIISRPNQDSPLMEDYKPILGIDVWEHAYYLKYQNRRVEYIDAFFKVLNWEEVS
FT                   RVYNEIVE"
FT   gene            complement(153762..156470)
FT                   /locus_tag="BT0154"
FT   CDS_pept        complement(153762..156470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0154"
FT                   /product="protein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17493"
FT                   /db_xref="GOA:A1QYV1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV1"
FT                   /protein_id="AAX17493.1"
FT                   /translation="MIPDMLRAIFEATIGSKSKRDLKSYFPVLRTINKLESWALSLSDE
FT                   DFAMETEKFRDELKEGKTLEDILERAFALSREAARRRLKERPYDVQLIAGLALHQGKII
FT                   EMKTGEGKTLSSVQAAYLNSLTGDGVIIVTVNDYLAERDSNWMKPVFELLGVSVGVVLS
FT                   NMDSARRKVEYDKDITYVTNNELGFDYLRDNMCFDLSQKSLRNFNYCIIDEIDSILIDE
FT                   ARTPLIISGSTEGDTSAYLEVNSLVSLLKECSKDPKTGDYPLEIDELDGDYTIDEKGKR
FT                   VSFTANGLNNLEQILVSKGIIKGSMYVDSNFNYVHYMTQALKAHLLFLKDREYIVGDSG
FT                   VEIVDEFTGRILKGRRYSDGLHQAIEAKEGVKVASENKTMATITFQNLFRMFKKISGMT
FT                   GTADTEAKEFHRIYNLDVIVVPTNKLVARIDEDDIIYYTEEFKFKAITDEVYEAYKKGQ
FT                   PVLVGTVSIEKSEILSNMFKNKGIKHEVLNAKNHFREALIIAEAGAKHSVTIATNMAGR
FT                   GTDIKLGGNLEHRVRKKFGTGMSLEEFQKAMQSEREQYLEDYEEVKALGGLYVIGSERH
FT                   ESRRIDNQLRGRGGRQGDPGRSRFYVSLEDDLMRLFAGDNLRALMGKLGMATGEPIAHS
FT                   LLTKSLVNAQKRVEDRNFEIRKHLLEYDDVITKHREFIYSQRNLILVDNNIKERVLLSL
FT                   REYLDFLFDQVKGEVVTSSVLNEINSIFAYMMESVGSIETMNIVDLKNKLMEIARANLD
FT                   AKEELIGVEFFNEFLKHEYLRNIDSKFQDHLANLDSLRESVYLRSYANKNPITEYKEEG
FT                   FAIFSELVKDIKVETLRRTLQVRVDVDSSGYKNKKPKNVRATHKEFSGIASADKGNTVG
FT                   VQIIRSTPKIGRNEPCYCGSEKKYKNCHGKS"
FT   gene            156522..157655
FT                   /locus_tag="BT0155"
FT   CDS_pept        156522..157655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17494"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV2"
FT                   /protein_id="AAX17494.1"
FT                   /translation="MKKFYKIHLNLLFMIISCNIKTLNELGEQQFKIPFGTLPGEITPL
FT                   VNKFTNSSFDIKTYNGLVYIVEAKANKLMIFNSYGKLIQTYQNDIFKTNSDLKIKKVDF
FT                   ENIKAIYPSKDFIVVSDKLNNKKSKFDEKENIAYSTRIFILNKDSSVEVLGQEGRNGTL
FT                   FPQVYDINIDDKNNIAIITISNEGYIIYSYDKELSPLYKIYVNTNILQIPEEEKKKYNI
FT                   SIDKVFFEVNKKIIYVKTTHYENIRTNENINDLGVRIKNQYFYTMLLNKNKEFEIKNKI
FT                   TLPQNLLDDQQESFINIIGIQKDKIIASTNMRNLSNTLIWKLDNKGKIKEQMVLIEPPN
FT                   LKFLAESLSKDGILSILYGEKSGVSVYWWNLNTLLKL"
FT   gene            157678..158103
FT                   /locus_tag="BT0156"
FT   CDS_pept        157678..158103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17495"
FT                   /db_xref="GOA:A1QYV3"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV3"
FT                   /protein_id="AAX17495.1"
FT                   /translation="MRNKNCKSKIQNNHKQRLKKNLTLGIIFVIMLIIIKIVFIPKLQK
FT                   LESKYRPTITIEHKIKNENLYIKINIKSQNIKNLGKANIEVYLDNKLIENNMIYIDKIN
FT                   YTLYTNVAYRKEGLLNIVLINQKGDKAYFSKRLDLGG"
FT   gene            158107..158523
FT                   /locus_tag="BT0157"
FT   CDS_pept        158107..158523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17496"
FT                   /db_xref="GOA:A1QYV4"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV4"
FT                   /protein_id="AAX17496.1"
FT                   /translation="MLQIYFISVLLNILGGIVLAFPILGERFKCLIIFEEFINLINNNK
FT                   NVRSIFGTTFLIASIFEIIIPYDLPIIGNLFPAISLFFIGFILFLSQKIPTSLQNNKEY
FT                   GKFKSLIESNKKVIGILALIIGIIHFFAPRVPFL"
FT   gene            158669..159769
FT                   /locus_tag="BT0160"
FT   CDS_pept        158669..159769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0160"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17497"
FT                   /db_xref="GOA:A1QYV5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV5"
FT                   /protein_id="AAX17497.1"
FT                   /translation="MIKNKEIIINLKNLEYNLTAIKNHIQKRELVATLKADAYGHGLIQ
FT                   TFKFLKEKGINYFGIFWIDEALKIKKIDKRANVLLYINTDKSAIKNLVKFDITPFVADS
FT                   QYLSLIEQECRKQNKKIKVHLKVDVGMNRYGIKIENALNLAMQIQNSKLVEFEGVCTHL
FT                   PTTENRKITQAQIEKFVHFINELKTKNIKPKFIHASNSEHITNYPISEKFNMVRPGLIL
FT                   YGYHPNSNSLNNNLQLKPVLSLYSKIIFLKKIKKDEQISYSGLFTAKEDMQIGLLPVGY
FT                   FDGIPQNTSNNFYCIIRDKKCFIRGKICMNISIIEIPKDLKINIGEKVEITSERLSLDI
FT                   LSKESGMSKYEILCSIGKHEKKKYLY"
FT   gene            complement(159761..161404)
FT                   /locus_tag="BT0161"
FT   CDS_pept        complement(159761..161404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0161"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17498"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV6"
FT                   /protein_id="AAX17498.1"
FT                   /translation="MYNKFIKIRLIDQGMTMFLVMFFVSCVLFSEEIYYRFADYDVNYR
FT                   IIGKYEISKENAEEECGYKFTYDDGRLVFIDYVGKLSILIPSFFGANQIKIEYSDDIER
FT                   RLFLNGGFAAKNLKDVYVEQVEYFPNGRPKSIFNYNKSNEIIRDKYGIAYYHFIYNDDS
FT                   SFYVYRFSEVGFQIKDLNNVYYTKIIYDDSDRRKTVLYYDDNNYNIKAKNGIYGFRLTY
FT                   DSSHNIIREEYLDPVASLYANPFSVAIKTYRYDFDGKLIEILNYDIKNNLTPDENNVAI
FT                   YRYEYNLKEKDYFYKEYNYDANNNLTVSQNGYAMRKTIFYMQNNEKRVINHSNRINKNY
FT                   NSDIPASYEEKYEIMNNFKGIAVYSYKYDNKFYLIENLFFDKNFNLISDSNGVMIYKYA
FT                   YNDDGLLKSQEHYGDFDNPIDDFAGVFRYKFAYDVNGNLILKSNYSKSGVLVADRSAIF
FT                   EYAYEYDKQNRLISQKNFGNLGQLQDDVHGVSVYKYEYNKFGKISKKTNHGPDLRLRDD
FT                   IGGISVYKWIYDSKGNLVDFQKFDSLGNLI"
FT   gene            161431..161598
FT                   /locus_tag="BT0162"
FT   CDS_pept        161431..161598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17499"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV7"
FT                   /protein_id="AAX17499.1"
FT                   /translation="MAKISKNAQRSGSKELLSRWGGKIIMKSKFENGKIKHYAECQTSK
FT                   NTARRPKDLF"
FT   gene            complement(161602..163350)
FT                   /locus_tag="BT0163"
FT   CDS_pept        complement(161602..163350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17500"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV8"
FT                   /protein_id="AAX17500.1"
FT                   /translation="MKKLPEIFYLNDKEVDILISQIGISSDTQKMILRIILEHKHNIID
FT                   YANFIEDYSVKIRALKGELDFLFRKLYEVKRGIIINQSTSNGEMVPYKIIITDENSYDF
FT                   YYYAIEDLFLKHYVGIELFSTLLTIKNIDKNLLVFEKEFVILSNSDINLKYFQENSSSK
FT                   KIFVLDSLIIPSGKALYFIEFMKRILFGIASNRIVKDVFMRAKNVKLSEYDRMLDEGIN
FT                   GVGVAYNLLLGILENKEEILNKKGVNISKHYFTFLEVLNIYITNEKNLEELKNLESIKI
FT                   DETLKSIEKTIEFKPRFINIEEFKNILQEHAEVLSDSEYFLKTANEYFFESSIKGSLPK
FT                   IFSIKSGMYLYKPCAYSMFLKEFDQILVDIRDKLRNDFVKVFNSGKNSSTILTEEGLEK
FT                   TLIEFIANYDINDYCLKNKVAFLDFIVSHYKRVSKTQNIQTHLKDIIKTEAAKYFKNSN
FT                   TFLPLYKIYKVDLSNLLDSAYRDLPLLKRLVLFLTGRQQSYKEALSRLNSKIVVKDHAE
FT                   LFDPNERVKRQLDKRRKQREELREQIRSSYVRKGKTPKEATFNRAYTKSEQDEAWLKFE
FT                   DKLNKK"
FT   gene            complement(163422..164420)
FT                   /locus_tag="BT0164"
FT   CDS_pept        complement(163422..164420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0164"
FT                   /product="sodium-calcium exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:BT0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17501"
FT                   /db_xref="GOA:A1QYV9"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYV9"
FT                   /protein_id="AAX17501.1"
FT                   /translation="MFVGGDFLAHIHLFCVIFGIFLLYLGGNYLLNSSVNIATYFQVPN
FT                   LLIGVVIVSLSTSSPELFTSLIASLKGKNEIIVSNIIGSNIINMLLALPLTGVFLRIKT
FT                   DFKRLKFSFIILFLLMFLLLLFSFDFGTLSFFKVPYHRTSSLVILILFLSYLFLFYKEE
FT                   KKYNSVPKNLENFNCNYGFNFLFLNTLLLLLSIYFLYFGSKLLIDSSIYIAHNVFNISE
FT                   KVIGIIFVAFGTSIPEIVVSLFAVIKKESDIALGNIIGSNIFNIGFILSSSSFVNPVLM
FT                   SDIYLADFSIMFVVSLMLLFIVRFRGAFSRGPAILFLCLYILYNSFLFGVF"
FT   gene            complement(164422..166272)
FT                   /locus_tag="BT0165"
FT   CDS_pept        complement(164422..166272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0165"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17502"
FT                   /db_xref="GOA:A1QYW0"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW0"
FT                   /protein_id="AAX17502.1"
FT                   /translation="MKLNTCIMLLYIICLLFSYFFLCFHLHSLDETKYFKNSDLFFINK
FT                   GALYKKHNDVIFKVEPKGLETRWIYPFARPVSKRITSIYEDFYSSNSLLTTNDSVYVSH
FT                   NYFKSFIKLVDNEKFNKNSYITSSALSRGEYKRIAVGTSNSGIYLSVNDNLDFKSLNSL
FT                   ISKTYLGAGYYDMVSAIEFSRNNANELYFSCGIYGDIILINTTLGVVRKLDFPFKKQIV
FT                   RIIDLSDAKIEKLLVRTYDNHFYSYVDGKWTFDGQFSVYGENSIEKLERMHLASNKGSI
FT                   YLTAYTLRSKTAIDERFEFIKRLGMNAVIIDFKDDSGILTYASKLALPNKIKAVKNLID
FT                   VPYILNKARELGIYVIARVVVFKDAKLYFYNNYEYALWNKKTNQPWANLVKVEHGDSFK
FT                   FVQKEHWVDLFLQGTWDYNLSIAKEIQSLGVDEIQFDYIRFPTDGPVSLITSRFNKYKM
FT                   RAIDALESFLIMARKNISIPISIDIYGNNGWFITNSIGQNISMIADYVDVISPMFYPSH
FT                   YTNDFLKNELYYTTRAYKIYKEGSNRAAVFSSGKVIIRPYVQAFLLGSERRVSKEVYLK
FT                   YFFHQLRGVKESLGNGFSLWNASNIYYMVKSDLSEFLNFS"
FT   gene            complement(166360..167841)
FT                   /locus_tag="BT0166"
FT   CDS_pept        complement(166360..167841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0166"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BT0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17503"
FT                   /db_xref="GOA:A1QYW1"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW1"
FT                   /protein_id="AAX17503.1"
FT                   /translation="MKRKSGILLNISSLPSKYGIGDLGRGAYKFIDFLADSSQGYWQIL
FT                   PYSPPSFLEFPYSSYSAFAGNINYIDLNAIDRFIDIDLGTFECLEDRYVDYDKLKAKEV
FT                   ILRNAALNFLHRATIDEIHAFEKFKKSAAYWLLDFSSFVAFKEYYSKFQSSQAFNLLFS
FT                   REILKRDAKALAKLRETLEVEINIQQVLQYFFFSQFKALKKYANNAGIKIVSDIPIFVS
FT                   YDSADVWAHQKYFKLRFDASKDKVTGVPPDCLFSKKYLWGNAAYNWKALRKDDYVWWIN
FT                   RIDFLRKYVDIVRIDYFRGFVSTWEVSAEESLLFGGQWVKCPGKDFFKQILNEINDLEI
FT                   WVEDLVKDRGDTFRLRDYFGFPGTKMMQCAFDFDSANIYLPHNYIRNCVVYTGTHESNT
FT                   IRGFINSVDNEHKKYIFDYFNTSENAIVWDMIRGAMASVANSVIIPMKDYLDLVADFSM
FT                   NISDAMLNNFRILSGDLSDDLSKKISDITKLYGRT"
FT   gene            168002..169159
FT                   /locus_tag="BT0167"
FT   CDS_pept        168002..169159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0167"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17504"
FT                   /db_xref="GOA:A1QYW2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW2"
FT                   /protein_id="AAX17504.1"
FT                   /translation="MNIKIVILLFLANTLAFSSEILEFKYTKGAKFRIETTDNQEIYLN
FT                   GRFNSKTKTNIQVSSEVKDVKNNFADIKSYFRVLKRDNESDVYLLKEEFEGNFSINKQG
FT                   EYKINNAQKRPSVRGIPRFPKTPIKVNETWTYPAEEYIQASEISQEIKDFVTKFDVNYV
FT                   YKGKEKIDGKYYDIILSNYKSKYNVKNILFSQKVNQIIYFDSKLGNIYKYNDTYEFQMQ
FT                   NDNNNIKMTGNSFGKIISIELPNDNIIEHEVKEYISTKQIDSINIEKNENGIKLSLDIE
FT                   FYPDSFQIIKKEYNKLKHIANLLEKFKDNNILIEGHTAKFGTEQEMQELSEKRAHSIGN
FT                   YLLKMKVKNKNQIFFKGWGAKKPKYANSSPLASKNRRVEITILNN"
FT   gene            complement(169163..169546)
FT                   /locus_tag="BT0168"
FT   CDS_pept        complement(169163..169546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0168"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17505"
FT                   /db_xref="GOA:A1QYW3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW3"
FT                   /protein_id="AAX17505.1"
FT                   /translation="MQKSNFEHEFVEKMRNFLLESKKEILNSIRSVEDSKREIINNDMH
FT                   LKDIIDIAFDNMDGNNLEALSSVEKKKLHLINQALYRISQNTYGNCLACDKSITRERLV
FT                   AIPYAFLCISCQTKKEKKGKRSI"
FT   gene            169714..169935
FT                   /locus_tag="BT0169"
FT   CDS_pept        169714..169935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0169"
FT                   /product="bacterial protein translation initiation factor 1
FT                   (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17506"
FT                   /db_xref="GOA:A1QYW4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW4"
FT                   /protein_id="AAX17506.1"
FT                   /translation="MNTKEEAIETEGIVKESLPNTMFRVELKNGHLVLAHLSGKMRKHF
FT                   IKIVPGDRVKVELSPYDLTKGRIVYREK"
FT   gene            complement(169983..172028)
FT                   /locus_tag="BT0170"
FT   CDS_pept        complement(169983..172028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17507"
FT                   /db_xref="GOA:A1QYW5"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW5"
FT                   /protein_id="AAX17507.1"
FT                   /translation="MGNKVRRTNCVFTRRLVISLVLFFINFEIYSLSGTDYLVSTKVLQ
FT                   GSKVVHVIRLNLSQDIDESSLKFEISKDIKDNTEIASISKVPDGNNIVTEIKIEYGFDK
FT                   LGFVKIPSLKIVYLGEVYLSSEFEVVVLKEDESQFFGLPVRLYWDFDKEEIYEYQSIGF
FT                   VLRVNWLVNNNLKSIASSFNAVKDAMIDRTPIFENIKYRTFNSKEILDVPLYNFILTPL
FT                   RGSKGIVIPSVSFNIGENVARMSPGISLKIKPIPDEVKSLAVGTFKIDYEFPNSTLINQ
FT                   DTFTVLIKITGQGNLPHIRFPEIETYNSKVIYNKKNYNFEPSKDGYKGSISKIYTLKPD
FT                   NKGNLFLNIGDFTYLNPDDGKVYKLDGKRLKYEYYGEFKNNNDSGQELLSDFSLLSYHD
FT                   ILKHRNKTFLFFVPVYYLILIPGILFSLAVFIRYKKFFIASGCGLVILILTLAVSLNAM
FT                   NDGSLSEDNINDLIEDYKSKNYDNALNRVDNILKKNPSYSGLWLNRALILNKMDRYFDA
FT                   IYSAYKAFFTSPSNDTFYKVIDFIEAKNGVNENIRNNSFVWSNIFFIISLILINSLIVI
FT                   ISYKFYAKNLKRIILFLLLSVTCFTLFQTYYFYVDQQSEIGIIKGDLVSLYKVPDNFSR
FT                   SWRFLNGNISVYVLNRKDDFVLIQTSHGLQGWIYKNFIVSVKDSLI"
FT   gene            complement(171977..172564)
FT                   /locus_tag="BT0171"
FT   CDS_pept        complement(171977..172564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0171"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17508"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW6"
FT                   /protein_id="AAX17508.1"
FT                   /translation="MGRNFLICFLMSLMFASFLSCSNIRAMSLMAIGNYEYIRGDYQGA
FT                   ISTYYDLVDDKQGTSWGYYNLGIVYYSLGEYESSLRMFSYAKRDNDSFLNFNINYNEGI
FT                   IYYNQGLYRKAEVAFKEALRINPASYNAKYNLELAIIKKRSIPDDLDSLSVKRSQNFIE
FT                   NNENFLRYIENLERVLWVTRSEEQTVFLREDW"
FT   gene            complement(172546..173535)
FT                   /locus_tag="BT0172"
FT   CDS_pept        complement(172546..173535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0172"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17509"
FT                   /db_xref="GOA:A1QYW7"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW7"
FT                   /protein_id="AAX17509.1"
FT                   /translation="MSIGNYYAFYLFIILFLVLFLYIYNFRKALPLFKTLSLMYVNNAY
FT                   IKNYYIKKILMMFFFVLSLGSLIVSILDISWGQKATEDKRSNLRISFVVDISRSMLTFD
FT                   EEKSINRLESAKNFISLILNNFENVEYSLTIFKGKSLLVLPFSKDKASLHKILNYIEPN
FT                   LISSPGSFLGEGVFSAIQGIKDDSYYNFLIILTDGDEWGENNYYTFPKLIDALNVTSFV
FT                   VGIGSDKPSPLIDNNLSVKDKDGNVVKAVLDEDNLYLLTSSLKGSYYNLYLKGTNYVIN
FT                   EIRNDIMKKSSSDILLIGILRYKLFLAISFLFIVLYLFVKVIKWDETF"
FT   gene            complement(173532..174557)
FT                   /locus_tag="BT0173"
FT   CDS_pept        complement(173532..174557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0173"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17510"
FT                   /db_xref="GOA:A1QYW8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW8"
FT                   /protein_id="AAX17510.1"
FT                   /translation="MKNLIEVIMLTFNEPLYLFLLIILPFIIYFGHFFKRRGGKVKFPI
FT                   SIYGNLGSIKLRDYGLNLLYFITYAFFYLAMTVMILTLAGPSISKKKTTYLSSGADIVI
FT                   VLDISPSMGAIEFSSKNRLEFAKELIKYFVYQRENDNIGLVAFAKEASLIVPLTIDRDF
FT                   FSKKLDDIYIMDLGNGSALGLGISIALSHLKHSEAPKRSVIVLTDGVVNSDEVYKDQVI
FT                   NLAQGLNVKIYSIGIGSSEELSVGFKLRSGRFYQGTLREIYDPSMLFEISGKTGGLFYS
FT                   VGDDFSFKLAIQDFSKKENVERKVKIAVDNDDIYNEFLLVIFFLLILYFILSKVFLKEV
FT                   L"
FT   gene            complement(174520..175419)
FT                   /locus_tag="BT0174"
FT   CDS_pept        complement(174520..175419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17511"
FT                   /db_xref="GOA:A1QYW9"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYW9"
FT                   /protein_id="AAX17511.1"
FT                   /translation="MKNIIVFIMSFLSFYLFSYEIKNEIFIPTRYYVGDTVELKFSLIL
FT                   GENEKFIPAEFEEIKNEFVEVNSLLYRPESGEVIIYFVSFYVGSNTLPRIYVGDIISND
FT                   KSFKLILNNVKINTSKLIADDDVLKIQDIEGVLFLPGTSTYLVIFILALVVVPYFFIKF
FT                   LKLVKHLLVFLIMKHNLRKPYKVFQKQMIILSNYIKSDEEHVVFYNLLNSSLRVYLSKK
FT                   TGFDFNAITTTEISEILQNFNVPYEIRSTFVNMLRLSDFSKFSGMNLSGGNLSLVLDDL
FT                   REAAFNFEEFNRGDNVNI"
FT   gene            complement(175416..176297)
FT                   /locus_tag="BT0175"
FT   CDS_pept        complement(175416..176297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0175"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17512"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYX0"
FT                   /protein_id="AAX17512.1"
FT                   /translation="MQYDNESNASTKNKIKALKFFSRKMLLELNFGGYRSIFKGLGLEF
FT                   HEFRPYEETDDARLIDWNVSSKTDSIFSKVFREDKGMNLHLLVDNSLSMSLGSLTSKKE
FT                   IQDLLVSIFAHMAFFNNDKIGITFFSSETDKFISSRKGHSHLGRILNETINRRIKRGSN
FT                   LTYVFKNTAEYYKKRSLIIIISDFKASDYFKSLTVLSKRHNIIAIRLTDFFDENLPQYG
FT                   VLTYEDIETCEDFLTSGFSKTILNSYKNYWTLDKIKWRKECIKRGINFIEISTKDDVFR
FT                   KLKALLKKENDI"
FT   gene            complement(176313..177305)
FT                   /locus_tag="BT0176"
FT   CDS_pept        complement(176313..177305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0176"
FT                   /product="MoxR protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17513"
FT                   /db_xref="GOA:A1QYX1"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYX1"
FT                   /protein_id="AAX17513.1"
FT                   /translation="MKSSFQIDSEVENALGLINKFRREVASRILGQREMIDAILMGILT
FT                   EGHVLLEGVPGLAKTLTIQTVSDVLDLGFKRVQFTPDLLPSDLTGNMVYKSTTGTFKVR
FT                   KGPVFSNIILADEINRAPAKVQSALLEAMSERQVTLGDETHKLPDPFFVLATQNPIEQE
FT                   GTYNLPEAQLDRFLLKVNVKYPSIQDEIKLLKIFSVDGGLENIKVAKIMNAYSLADLKR
FT                   TIGKVKVDDKIMLYIVTLIAASRENDKKTYPFTKYIEFGASPRASLSLLKCARVNALYE
FT                   GRLFVLPEDVKAVAYNVLRHRITPSYEAEVEEMNTDDIIKILLSAVALP"
FT   gene            complement(177376..177999)
FT                   /locus_tag="BT0177"
FT   CDS_pept        complement(177376..177999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0177"
FT                   /product="methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17514"
FT                   /db_xref="GOA:A1QYX2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYX2"
FT                   /protein_id="AAX17514.1"
FT                   /translation="MMNDFELSLKSLGVSFTSKSIDKLRFYIEKVLLFGTRFNLVSNND
FT                   RNFDAVLLHVLDSVAGLPIIKDKNPRQVLDVGSGAGFPGIVLALFDNFRKYILLERSNK
FT                   KATFLRMISLELGLDNIEVLERDVDKEQNKYEFITIRAFRDIREYARILKLILKDGGLI
FT                   VAYKGKLNKIKFEVSHIESLFNKIEIKSSTMNDGKERNFLLLYK"
FT   gene            complement(177996..179882)
FT                   /locus_tag="BT0178"
FT   CDS_pept        complement(177996..179882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0178"
FT                   /product="putative tRNA
FT                   (5-carboxymethylaminomethyl-2-thiouridylate) synthase
FT                   subunit GidA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17515"
FT                   /db_xref="GOA:A1QYX3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYX3"
FT                   /protein_id="AAX17515.1"
FT                   /translation="MFRKIDIDMDFDAIVIGGGHAGIEASLALSRLNFKTLLITQNLDT
FT                   IGKLSCNPAIGGLAKGNMVREIDALGGEMGCLVDFSMIQFRILNKSRGPAVQAPRAQAD
FT                   KLVYQVKAKETLERQINLDLFQDTVSDFLLNSMRNRIEGVVTERGNKFTSRVVVLTTGT
FT                   FLRGKIFIGEYRACMGRISEPAAYGLEKILLELGFEMGRLKTGTPARVHRKSINFAKTE
FT                   IQFGDSDIIPFSFSNTKIDKVQLSCYITYTNKKTHAIISDNMHLSPLYSGEIIGNGPRY
FT                   CPSIEDKIVKFKDKDKHQIFIEPEGLSTEEMYLNGLSSSLPEDVQKRLINSIDGLENAV
FT                   ITRPGYAVEYDYINPIELYASLETKRVKGLFVAGQTNGSSGYEEAAAQGLMAGINAALK
FT                   LQGKDPMILPRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKWGY
FT                   EVGLVSEEKYSRYFFKEKQVEEIKELLRQRRLKEREASTLQLKKHISKDFYHIIKDPYI
FT                   NLSDLIDIDPKLNASKVILEQVELDIKYEGYINRQKDLIRKMNNLELIKLPLDFDYEID
FT                   GLSREAREKFVKIQPANLAQASRISGVRNTDIQVLLIYFSSPKNKVVLNLAL"
FT   gene            complement(179867..181261)
FT                   /locus_tag="BT0179"
FT   CDS_pept        complement(179867..181261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0179"
FT                   /product="tRNA (5-carboxymethylaminomethyl-2-thiouridylate)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17516"
FT                   /db_xref="GOA:A1QYX4"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYX4"
FT                   /protein_id="AAX17516.1"
FT                   /translation="MSNLFQREDDIVALATPLLSSALCVIRSSGISSIEKFSKMFSDPK
FT                   RLLEASGHTIHYGYLIDKEICEKLDEVVVCIYRAPKSFTGQNSIEVMAHGSPIGIKRII
FT                   GCFLKVGFRMAEPGEFTLRAFLAGKLDLTKAEAVNELISAKTNKTHSLAVNKLSGSLFA
FT                   KIDLIKKDILNFLSALSVHLDYETSEYEVAIPFEIISKSRDELKRLVDSYNTARKLDYG
FT                   IALVLAGSVNVGKSSLFNLLLKEDRAIVSSYAGTTRDYIQASFEFDGILFNVFDTAGLR
FT                   ETTDFVEQLGIVKSNSLIKEASLVLYVIDLSARLTNDDLKFIDSYKGHSKVIFVLNKMD
FT                   LEPNRQTVEFFNSGNINSSNLVKISTKTLFGIDSLYDKIRSLTCFDYIDIDAYDVIVSS
FT                   SRQAELLKKAYTLIIELLNKIEKDISYDMLAFDVYEVLNFLGEITGEVTSEDVLNNMFK
FT                   NFCLGK"
FT   gene            181397..181891
FT                   /locus_tag="BT0180"
FT   CDS_pept        181397..181891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0180"
FT                   /product="flagellar protein FlbF"
FT                   /db_xref="EnsemblGenomes-Gn:BT0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17517"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYX5"
FT                   /protein_id="AAX17517.1"
FT                   /translation="MKTKLETELKNTLQEEVLLVEDIYNMYLNIKRYLDEKNEKMFKEA
FT                   INKTNIYLHKFKDIEHKRDELWKNFTDLEKFESTYMAIEKLCLVYKKEIYNYFHRLRIG
FT                   ILNIQNLNYLISSYTETSLGILDLIFKDAQESVDNITYKNPYGPKSGSLNETSVLINKK
FT                   L"
FT   gene            181910..183793
FT                   /locus_tag="BT0181"
FT   CDS_pept        181910..183793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0181"
FT                   /product="flagellar hook-associated protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17518"
FT                   /db_xref="GOA:A1QYX6"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYX6"
FT                   /protein_id="AAX17518.1"
FT                   /translation="MDSTFSGIEIGKKSLFAHKDAMNTIGHNLTNTSKPGYSRQRVIMK
FT                   TEIPIYAPQLNRANKVGQLGQGIMVQSIERVRDDLLDIKIAEESHRLGYWSSKDKFISL
FT                   LENVYNEPEEQSIRKRLNDFWDSWQDLSKQPQGLAERNIILERGQSFAEVVSNRFHSLK
FT                   RIYTMANDEVKITTEEINNYLRNISDLNRQIAKAIAMKDQPNDLMDERDLIVDKLSNLI
FT                   SISIENKRDPNEFLIYVEGKHLIQGAIANEFILEAANGPTGTKWNVLWNNGEPANINTG
FT                   KLGALINVRDNEIKNEINEIDNMAINITELVNEVHVSGHGLDQKNGRIFFDQEYKLTDE
FT                   RGRYDSNGDGQFDSVHIFKINSTNEIFPEENLGFSGILKFQAINKNDFIEIPYNTTDTV
FT                   QDVINKINNSNSQVTARINAEGKFEIKAIKEEENDSAIFRIRYIEDSGLFLTTYTGILN
FT                   ASGTEGAYNYQDVNTTNQLINTVSYSIAPLKNPAAWLKVSREIAEDPSKIASGIKTPTN
FT                   NAPIGDNKAALRIASFVNSQIMIGKNATLNDYFANTASNIAIKGQTAEITKNSQEQILK
FT                   NLTDLRLSISGVNKDEELANMIEFQQSFIAASKFITVSAELIDTIINKMGV"
FT   gene            183797..185071
FT                   /locus_tag="BT0182"
FT   CDS_pept        183797..185071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0182"
FT                   /product="flagellar hook-associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17519"
FT                   /db_xref="GOA:A1QYX7"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYX7"
FT                   /protein_id="AAX17519.1"
FT                   /translation="MINRVSHPLTYDNLKTSSTDKEVKITKLLGSLYQGGKRITNLRDD
FT                   PTGVTHAIRLDSDIFKLNTYVKNINSAKGKLRYMEGYLQSLANILTRAKEITVQGASGT
FT                   YKTDDKKIIAKEINAILEDVLAIANVKGADGYSIFAGTKIDNEAFKVIRENRINKLTQD
FT                   KAETQIVRIDYNGNQAEQTTEIYNGIYIPTNYPGSEIFFSHNHYITSSKNVNGFIVKEN
FT                   TKIYIDNIEIALTAGDTAADIIAKINESSAPVEATLDRILNSMVIQTTIPHQIWITEEE
FT                   GSTVLKELGILTQNNETKEPPYNIANNTEVRNRTIFDSLIELRDNLEENREEIIGSRGL
FT                   AEIDASLNKIFATLADLGTKENRLDRSYERISKEIMDMKDDMVKYTDLDVTKAITELNM
FT                   TSLAYQVSLGVSARIMQTTLLDFLK"
FT   gene            185073..185465
FT                   /locus_tag="BT0183"
FT   CDS_pept        185073..185465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0183"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17520"
FT                   /db_xref="GOA:A1QYX8"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYX8"
FT                   /protein_id="AAX17520.1"
FT                   /translation="MKNEISIKFNFPEGILGFEEIKEFIIKDSEHKPFSIMQSINGEIN
FT                   FLVTSPFNFLEKYLPNIEEEDWLDIQTENEDEKVILCIINMHVKNYKEITANLKAPIIL
FT                   NKKKLIGKQAISTNEEHYLRYRVFKE"
FT   gene            185468..185704
FT                   /locus_tag="BT0184"
FT   CDS_pept        185468..185704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0184"
FT                   /product="carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BT0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17521"
FT                   /db_xref="GOA:A1QYX9"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYX9"
FT                   /protein_id="AAX17521.1"
FT                   /translation="MLVLSRKANESIKIDSNIEISILEIKKDSVKIAIKAPANIKILRS
FT                   EIYDIIKEENKKSILQDKNNIHKIKNLFDYLSK"
FT   gene            complement(185689..186351)
FT                   /locus_tag="BT0185"
FT   CDS_pept        complement(185689..186351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0185"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:BT0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17522"
FT                   /db_xref="GOA:A1QYY0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYY0"
FT                   /protein_id="AAX17522.1"
FT                   /translation="MNTLAIEYSHKTLLIHFEINGEVFSIIKSKDNINYTLSIPKLFND
FT                   FVLEYGIDLKKLDLLINSSGPGSFTGLRISLSFIKGLSLGLSIPFVNVPTFDVFAKLVN
FT                   TSADTLTLSFTAGKYFLGCYKNSKFCGKIFCFSESELFEYLDSLDLKFVIVGNGIEFIY
FT                   EKLKNKFEIIIDMDSFGSVLTELGKFKYVENRQGDDILSGPFYVRLSDAEIKSYLLR"
FT   gene            complement(186332..186760)
FT                   /locus_tag="BT0186"
FT   CDS_pept        complement(186332..186760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0186"
FT                   /product="ATP/GTP hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17523"
FT                   /db_xref="GOA:A1QYY1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYY1"
FT                   /protein_id="AAX17523.1"
FT                   /translation="MTLSFETEKEMINFSKSFFNPLPIGKIFGLCGDMGTGKTTFLKGL
FT                   ALNLGISYFTSPTYNIVNFYEFVDFKFYHIDLYRLNILDEFQLIGGMELLLDMSAIIAI
FT                   EWPEIIIDVLPKNRLMFLTFKIKNTSRILEFSDEYPCN"
FT   gene            complement(186757..187071)
FT                   /locus_tag="BT0187"
FT   CDS_pept        complement(186757..187071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17524"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYY2"
FT                   /protein_id="AAX17524.1"
FT                   /translation="MKIFLCWLLGILFKGILFVKFISLDNISKQDSHIYYRRVYFADAF
FT                   YEYKGSSETKQVKFTIEVTPLGEKHITIDFVDPLNYPVLSLMVAIKRHVIDLDIKGELP
FT                   "
FT   gene            complement(187221..187568)
FT                   /locus_tag="BT0188"
FT   CDS_pept        complement(187221..187568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0188"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17525"
FT                   /db_xref="GOA:A1QYY3"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYY3"
FT                   /protein_id="AAX17525.1"
FT                   /translation="MARVKNGIVHVARRKKILKKTKGFWGTKKSNYKKAKDTLRKGMMY
FT                   ATRDRKTRKRDFRSLWIVRISAALTGMGINYSKFFESLKKSNIKLNRKILSNLAIEDIE
FT                   TFKKIVYEIKN"
FT   gene            complement(187590..187787)
FT                   /locus_tag="BT0189"
FT   CDS_pept        complement(187590..187787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0189"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17526"
FT                   /db_xref="GOA:A1QYY4"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYY4"
FT                   /protein_id="AAX17526.1"
FT                   /translation="MSKMKTCKSAKKRYAFTSKGKIKYKKQNLRHILTKKSSKRRRKLG
FT                   KSGLVSSFEVKRIKTLLPYA"
FT   gene            complement(187804..188364)
FT                   /locus_tag="BT0190"
FT   CDS_pept        complement(187804..188364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0190"
FT                   /product="bacterial protein translation initiation factor 3
FT                   (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17527"
FT                   /db_xref="GOA:A1QYY5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYY5"
FT                   /protein_id="AAX17527.1"
FT                   /translation="MINRSSGKDRDRSRSGDKELRINHKIKAREVRVIFDNGTQSVLPI
FT                   EDAIKCARDAELDLVEISPNSVPPVCKIIDYGKYKFHQEKRQKEQKRNQKIIKLKEVRM
FT                   QPKIDTHDLDFKYRNILGFLKEGNKVKVTIRFRGRELAHTHLGYGILESILERVGESNY
FT                   VLESPAKMEGKTMFLIIAPKSKK"
FT   gene            188542..189204
FT                   /locus_tag="BT0192"
FT   CDS_pept        188542..189204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17528"
FT                   /db_xref="GOA:A1QYY6"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYY6"
FT                   /protein_id="AAX17528.1"
FT                   /translation="MNIFLLISLPLVFKIYMIINHPQLKLIKQNYIHATSILFAMTIFS
FT                   LLYLIEEFILYKSLLINYQTKFSLAYSIFIKEQIYYYVFPLFIFTFFFTFNPNSLLKKN
FT                   PIFLIYFAFGLILSKNLALIITNSKVFGTYEYIKIPLLHILELIFTAIICEKGIRLHIT
FT                   QNINGYQLIFVPILILEAIITFLKVLILTNAQIYALITLIILLGITIVNKKAIGTVK"
FT   gene            189204..189950
FT                   /locus_tag="BT0193"
FT   CDS_pept        189204..189950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17529"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYY7"
FT                   /protein_id="AAX17529.1"
FT                   /translation="MIHTIKTFIITIILILCFSCKNNKITDKNFSYIIIFSDTTEYFFK
FT                   IKNSPFIQDKTLFINEKDIEIIKDKLNNVKKILLTHKSNNEIFNINKIKKKTFYLSKVK
FT                   FSLKKAIDFIFSDPSIDLTTSLIMKDNTLNQTDSEHLEKSAKEQNINITTINDKNILYL
FT                   KNLITPKITKVILFSMRNNHVFLKKLSESSFFKKIEFILIGSNKKNLKEINTKYIISMN
FT                   ELDLIEITKKINKDFQYEFNIYEKTI"
FT   gene            complement(190041..190838)
FT                   /locus_tag="BT0194"
FT   CDS_pept        complement(190041..190838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0194"
FT                   /product="sec-independent protein translocase protein TatD"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17530"
FT                   /db_xref="GOA:A1QYY8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYY8"
FT                   /protein_id="AAX17530.1"
FT                   /translation="MNLNFERSIFLKKLIDTHVHFNELKKNSIDIHYLINECLKNGFSY
FT                   FLDIGLHPSDFYERKQLLDTYPNISLTVGIHPLNKALRDDFELIESILENENVVAVGEI
FT                   GLDYLKGDNKSEQIEALNIQLDLASKYKKPVILHVREAYDDIYNIIKSSNFISRGILHC
FT                   YSGNYEYAKKFIDFGFKISFAGNLTFKNSEPLRGVLKKLNIEDILIETDSPFLAPVPLR
FT                   GKINAPCFLGYTCLEIAKIKNCDVDSVIIALYDNFKDLFNDLI"
FT   gene            complement(190835..191977)
FT                   /locus_tag="BT0195"
FT   CDS_pept        complement(190835..191977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0195"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17531"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYY9"
FT                   /protein_id="AAX17531.1"
FT                   /translation="MLDKKLLGEFGDISQISDNELLDVTEKSKRGYQLIKEERLPEAEA
FT                   LFNDILQKDYDNNYALVGLGDIERKKRNFDKAIIYYQKCLAKHSNNNYALFGLGDCYRS
FT                   LGDYKKATDVWEEYLKYDPENITVLTRVASSYRKLKNFQKSRQSYLRVLEFVPDNDYAL
FT                   VGIGHLYYDFKEYKEALKYWLRMYEINQVKIDVRVLTSIGNCYRKLKEFSKGIYFFKRA
FT                   LEISPNNFYAIFGLADCYRGSKEYHEALKYWLTIIDKDPKNNLVLTRVGDTYRYLKEYE
FT                   NSQIYYKKALDVDFDMFAILGLALLQKEQGQYEEALSAIKNLIKTNPKNSILYVNAAEC
FT                   YEALGQIESAVDILSSFLQLGMKNVTIIDYINNLKKKMDA"
FT   gene            192275..193348
FT                   /locus_tag="BT0196"
FT   CDS_pept        192275..193348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0196"
FT                   /product="bacterial peptide chain release factor 1"
FT                   /note="RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17532"
FT                   /db_xref="GOA:A1QYZ0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYZ0"
FT                   /protein_id="AAX17532.1"
FT                   /translation="MFLERLSPIESKIKILEEKLQDTNLIKNQKEYAKVIKEYNYLEKI
FT                   KEKKDEYENIISQIDENQKILSEEENLEMKELIKQELTHLNLKKDEIEHTIKILLLHQD
FT                   ENDNKNIIIEIRAGTGGEEAALFAHNLYEMYTKYSEKKKWKTELINFNETELGGFKEVS
FT                   FEIKGKEVFKKLKHESGVHRVQRVPITESNGRLQTSAATVAVLPEVEETDIEINEKDLR
FT                   IDVYRSSGAGGQHVNTTDSAVRITHLPTGIVVQCQNERSQHKNKDQAMKILRARLYKFE
FT                   DLKKQEQRSNDRKQQVGSGDRSERIRTYNFPQNRVTEHRANISLYKLEEIMQGELDLLL
FT                   DTLALKLQEQALKDNPI"
FT   gene            193358..194191
FT                   /locus_tag="BT0197"
FT   CDS_pept        193358..194191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0197"
FT                   /product="peptide release factor-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17533"
FT                   /db_xref="GOA:A1QYZ1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYZ1"
FT                   /protein_id="AAX17533.1"
FT                   /translation="MTINEAIKKSKQHNLNTLEILLLLEKILKSRKELILANINKNLTK
FT                   QEEHKLSCQINRIRSGTPINYILKTKEFMGIEFYINKHVLIPREDTECLVEEALIQIKK
FT                   HNLNKILDLCCGSGCIGLTIAHYLKCKVTLSDISNKALKVSLKNTQKLKLENYIEIQYS
FT                   DLLKYINKEFELIITNPPYLNKDELKIKEKLIKEPRIALLGFGKDGLEIPKKIIRQAKH
FT                   KLAKNGLLIIEMAPWQTKSLKDFAIQEGFDYLKTIYDIESRERALVLRIKNDTSL"
FT   gene            194175..196178
FT                   /locus_tag="BT0198"
FT   CDS_pept        194175..196178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0198"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /EC_number="3.1.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:BT0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17534"
FT                   /db_xref="GOA:A1QYZ2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYZ2"
FT                   /protein_id="AAX17534.1"
FT                   /translation="MIQVYEIAYLLKINDIDKLKNIFRKTVNNIYQDDIQKKLIFKALE
FT                   ISEQLHYGQYRESKEPYVIHPIMVSLFLIKFQLDFKTIIAGLLHDVLEDTSVKKEEIIK
FT                   EFDQEILSLIDGVTKIHDLHNKTRAIKEANTISKMFFAMTHDIRIIIIKLADKLHNMAT
FT                   LSHLPKNRRERIARDCLATYVPIAERLGISSLKIYLEDLSLKYLYPKEYKEIKNFLSAT
FT                   KIEREKKLYKGKLIIEKELKKIGIDVTITVRSKHFYSIFRKMKTRNNNISQIFDTLGIR
FT                   IICKQQKECYEILEIVHKVWKPIPGRLKDYIAIPKENKYQSLHTTVRIPEDNQLIEIQI
FT                   RTEEMDKIAKYGVAAHWLYKEQVELKADDISFINRIKKWQQESVNKNQYSMHDIHKELL
FT                   NTFIYVYTPEGEIVELPFGSNSIDFAYTIHTDIGDQALYAKINGKISSLTKPLKNEQIV
FT                   EIFTSPEAKPDVIWLNSVRTKKARSKIRSWLNKNDNTIFVDNNIIAYLIGENKEQKRLF
FT                   SLFKSLTKSKIKSITIAPDCNPLTGEDIIGIIQKDTIVVHKEHCREIAHQKKSHLVEVE
FT                   WEATPTRKVYHIIIFLKNLKGLFNYLDNLFTTFDVRLISEKIEDCGNGHGIINIIISSN
FT                   AKNVSMIFTSLKENPNVLQIMQVEEDIKNYDN"
FT   gene            196168..198411
FT                   /locus_tag="BT0199"
FT   CDS_pept        196168..198411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0199"
FT                   /product="pili chemotaxis protein CheA-like PilL"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17535"
FT                   /db_xref="GOA:A1QYZ3"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYZ3"
FT                   /protein_id="AAX17535.1"
FT                   /translation="MIIKTLLLILIQTLISHKIIKADEIEQCGKQIRKHITKINELNRS
FT                   LEKIKRIENTYDYIKKYFLENKIQHKEHSLQEIGFIGYSQKTIHVKIKGTEKTNYNIIV
FT                   PIEAQHDLKNNLAIAIVITLINNFKNKEIKNNLNIYFIEDDSHKQISTISSRLLLNNNA
FT                   LDKNINTIYLMLNEDKENNLIEFKNQSNIINSKTSLGFLENFIKTFENHKVNFNVSKIN
FT                   DKHINGIYNLYLKEEIPILIISNNKECSLLKHVKNNNLCDIYKSIEETVKAKKNNQSEN
FT                   ELHYIIINMPFKKWIINENTLIIIIYAICNFIILVFITKFKKTSIILRKTKENYHKIIK
FT                   LFFILFLSTYISTLITNKMLTAYENFIDYKIINPIYLVNFFLTLFNFNIISYFTYNFKI
FT                   HLSLKELKYLAISISIIELIIMLYIKIEFILIIILKNILILIIPNKTKILKKIVIMLIW
FT                   ITNLMLITSIQTTLMTTRPIALSYFISISLFSAILTNIVEHLKHKTETIRQEFTKFEKI
FT                   ESIILFLIIAITIISHDIEKISTIKIDQIISFPEKTNKIRVEYLQDNRNTIQISTKDFN
FT                   LSLEKNKKYAEKEIQTQENLIDLFFQKIDVAERTIYDIKITTKKITKQINLFLKNASEL
FT                   IIYQSNTPYKIASNNVIFTINNIKSNTTNITFTVKSQEKIQYDIFAYSDINTNYVKIYD
FT                   QKTKKEVKNINIDYSYAIKYSGILPKSAKYNQNPFFKLQNDKEIENLKNLKLN"
FT   gene            complement(198408..199505)
FT                   /locus_tag="BT0200"
FT   CDS_pept        complement(198408..199505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0200"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BT0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17536"
FT                   /db_xref="GOA:A1QYZ4"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QYZ4"
FT                   /protein_id="AAX17536.1"
FT                   /translation="MMKKNLMLIFGGVSFEHEISLRSACGIYSALMKLDKYNVFSSFID
FT                   KITGVWYLLDSVPDDPKLIKKDSSAIISLIPGYGIFVNNKDLKIDVVFPIVHGRTGEDG
FT                   AIQGFLKIMDIPCVGSGILGSAISINKYFCKLLLKSFNIPLVPFIGFKKYDYLLDKEGI
FT                   KKDIKQSLDYPVIVKPAMLGSSIGISIAYNETQIEKCIEEAFAYDLTVVIEKFMRAREI
FT                   ECAVIGNEQIKIFTPGEIVIQDFVFYDYDAKYSTAPGNSVVFNIPAHLDTKHLLDIKEY
FT                   AFFTYKCLELRGMARIDFLIEKDTDLVYINEINTIPGFTDISMFSKMCEHDGLDYGSLV
FT                   DKLIALAFQSYAKRKERIDFHRLEN"
FT   gene            complement(199507..201027)
FT                   /locus_tag="BT0201"
FT   CDS_pept        complement(199507..201027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0201"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--L-ornithine
FT                   ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17537"
FT                   /db_xref="GOA:A1QYZ5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYZ5"
FT                   /protein_id="AAX17537.1"
FT                   /translation="MNMNKKMLNNVLSKLDKNFVKEIKGSCEVEILGLTYDSRCVLSHF
FT                   VFFALPGLHFDGQEFINSAIEQGSNVIVHTNDINFYDPNVTYIKIDSCNIKKFMSNFAH
FT                   IFYNEPSKNLKIIGVTGTDGKSSVCFYIYTLLKSMGVKVGFISTVFFEDGSGTLVKNPY
FT                   RQSTPESTEIHLVLSKMVENNVEYAIVESTSHGLDIRTSRLIDIAYFVAVLTNVSHEHL
FT                   EFHGTMQHYLNAKLNLFSSADANGGFGIINMDDKNFSTFLNTINRAYTYSLENKNADFF
FT                   VSKINEQMGFTEFEFYHKNVKYDARVNLTGSFNVENVMAALIVVSQVMNVDVSELIDKL
FT                   VNIEGLFGRMQGVDFGQDFSLIIDYAHTPGAFLKIFPIFKRLSKNRLISVFGSAGERDV
FT                   LKRKLQGEIADRYSDIIILCDEDPRGEDSMQIIRDIAEGISGKTLNRDLFFIPDRKSAI
FT                   EKAINIAHTDDLVVTLGKGHENSIIYKDRSIFWDEQAVVKDIISRNRS"
FT   gene            201169..201241
FT                   /locus_tag="BTT0002"
FT   tRNA            201169..201241
FT                   /locus_tag="BTT0002"
FT                   /product="tRNA-Cys"
FT   gene            201335..202576
FT                   /locus_tag="BT0202"
FT   CDS_pept        201335..202576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0202"
FT                   /product="magnesium and cobalt efflux protein CorC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17538"
FT                   /db_xref="GOA:A1QYZ6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYZ6"
FT                   /protein_id="AAX17538.1"
FT                   /translation="MLELTIILIFIILSAIFSASETAYTSLSLIQLQDIKKKGKLGTVV
FT                   YNLAQNPSKLVTTILIGNNIANITASALTTKFVLDKYGNNALALSTGIITIIVLICSEI
FT                   FPKQIAILNNESIVLSTSILLKILTIIFTPAIYVINGIVKILLSLCKIKASQKMTKDSI
FT                   KNMLFLAEKLGILENDDRIFMQKMLNIGEVRASEVMTHRTEVFSLSSTSQLKDKIKLIK
FT                   KEGYSRIPVYKGQNREQIIGILITKDLIEISKKKLEQNIIKFVKPAVFVQQNKRIKDIL
FT                   DIMRQKQKIMAIVIDEYGGFAGILTIEDIVEKIFGAIFDEYDFEEQKQLITKKDENIYL
FT                   ISGETTFDEIEETVGIKIQHKDYINTIGGYIMDLLDKIPTGGEQVSTEHGEYLIEEIQN
FT                   HKIKKITFTKLDKE"
FT   gene            202602..203534
FT                   /locus_tag="BT0203"
FT   CDS_pept        202602..203534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0203"
FT                   /product="protease activity modulator HflK"
FT                   /db_xref="EnsemblGenomes-Gn:BT0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17539"
FT                   /db_xref="GOA:A1QYZ7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYZ7"
FT                   /protein_id="AAX17539.1"
FT                   /translation="MLNDILKFFNKTYEYMIILIVLVIILLITIANIFVVGPSDEAIVL
FT                   RLGKLNRILEPGIHIKIPLIEEKLIVPVKIVQEVKFGFNTNNNTGPNLNEDDGIIITGD
FT                   LNIIKVEWLVQYKISDPYSFMFKVEDPAKTITDIAKSSMNRLIGDNTIFEIINDNRVGV
FT                   TEGVKASMNEIIKTYDLGIDIVQVQIRNAMPPKGKVYEAFEDVNIAIQDKNKFINEGRK
FT                   KFNQIIPKIRGEALKLIEEAKGYKENRINTALAETAIFNAILNAYIKDPEITRERIYNE
FT                   AMKEILESKDNIEIIDKNLNNFLPFKEVK"
FT   gene            203536..204507
FT                   /locus_tag="BT0204"
FT   CDS_pept        203536..204507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0204"
FT                   /product="protease activity modulator HflC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17540"
FT                   /db_xref="GOA:A1QYZ8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYZ8"
FT                   /protein_id="AAX17540.1"
FT                   /translation="MKYILKFLFSIAKILAFTLIFGLISLAIMQPLYILKENEISITTR
FT                   LGKIERTENTAGLKYKIPFIENVQIFPKNILRWDGEPQRIPTGGEEKQLIWIDTTARWK
FT                   IVDINQFYTAIKTMNRASTIINAAIEPAVRGVIAKYPLLEIIRSSNDPIQRLSDGVLTP
FT                   QEITDNTTYKITKGRKIIENEIIEVSNKNTKDIGIEIVDVLIRKIGYDPSLIDSVHNRM
FT                   ISERQQIAEEQRSTGIAEQTEILGSIEKEKLKLLSEAKAEAAKIKAEGDHEAAKIYANA
FT                   YGKNVEFYKFWQALESYKTTLKDKRKIFSTNMDFFRYLHNKK"
FT   gene            204839..204911
FT                   /locus_tag="BTT0003"
FT   tRNA            204839..204911
FT                   /locus_tag="BTT0003"
FT                   /product="tRNA-Phe"
FT   gene            205033..206661
FT                   /locus_tag="BT0205"
FT   CDS_pept        205033..206661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17541"
FT                   /db_xref="UniProtKB/TrEMBL:A1QYZ9"
FT                   /protein_id="AAX17541.1"
FT                   /translation="MIKHRIKFLTRAFNCIRQQYLKLLRGLSMIFKEIKKVEDLTEKDI
FT                   IFSNIGNMAKLSTRVNEKIITFLNKGNVLHIPVINNYENIPHDKLINTINEEILNNEIN
FT                   SLKEELIEALKDIYKPFSEKDKMFTISGRKTLINLNTLMEKEPDPIYLKEIIEGSFKIL
FT                   PKHKIISIQKILLKIYDYFDFQKIIDKDNLNNTKTIKKLYLHSIRRDYEFCREQVKTEG
FT                   DSILIHAIDTTIYFLTTIAQLNKERAAKDAPRSTSKFFIDKSHYTEFTEFFYDNDIILQ
FT                   AALGVLLHPIGLMHITILQKLREKISLKNKDTKEKYMSKIEILEKSINISKNLFRMRED
FT                   ISAITKMIINGQKSYLNIKNRAETATKKFTHELIRIFCIIDTYDEMVNPIIIKEPVNPL
FT                   EAIKFLTENSEQYYWTKDNPEEYLKNKKFDVEMLKNFLKVLAPFDHGTIVDVYIKDCNE
FT                   PLFKAVVLKYTIGILPIMSIIKHKDKSYKIGDILLNLESREIIIKGQNGEIKTSPFKNT
FT                   DQFELRHNIEELKSDEFQLLTSMQD"
FT   gene            complement(206667..207212)
FT                   /locus_tag="BT0206"
FT   CDS_pept        complement(206667..207212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0206"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17542"
FT                   /db_xref="GOA:A1QZ00"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ00"
FT                   /protein_id="AAX17542.1"
FT                   /translation="MHVSAGKYKGWKVAFPKIGGVRPVMAIVREAFFSIFLNQILGSNF
FT                   LDVFAGTGIMSLEALSRGANLAHLVDCNKFSKNVLIKNFEVVSEPYKFFFRKAELFLKK
FT                   SDLFYDFIYLDPPFGYSFKENLLRIISENESLNKDAKIIIHYPSRENLDNNILRLSKYD
FT                   FRKYGGSKLDFFKVKSYV"
FT   gene            207298..208128
FT                   /locus_tag="BT0207"
FT   CDS_pept        207298..208128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0207"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17543"
FT                   /db_xref="GOA:A1QZ01"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ01"
FT                   /protein_id="AAX17543.1"
FT                   /translation="MKGIILAAGYGTRFLPITKTIPKEMLPILNKPSIDYIIEEFTSSG
FT                   IKEILIITSRRKGVLDNYFDREIELETVFTKECKKDLLEKIKLKDINISFIRQNEMMGT
FT                   GHALLHAKPWIGTDNVIVAYPDDLHVGSPSLTTQLIELHKKTGKNILSVIENPKDINRY
FT                   GVIKLNKDNIHVKDIVEKPEVGKEPSNKASIGRFLYTHEFFKFLEEGFKIHQKGEYHHI
FT                   YALKKLMSENKVLYKEIEGERLDIGDIGGYLEAIIKIAKRDDKLLQIIKDSLRN"
FT   gene            208129..209814
FT                   /locus_tag="BT0208"
FT   CDS_pept        208129..209814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17544"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ02"
FT                   /protein_id="AAX17544.1"
FT                   /translation="MKIAPKYQEFYNSLSILKKYININIEEKILRYSILSKLYKLNEEE
FT                   IQNLIKISQDYELKKNKINITLEEYYYEKIQDKKIKNWILEIIREKNSLQIKKETNLIS
FT                   KRSGITYKLHSTNFLKIIEIQNNSKYTQEKKELYKQLILNFSSNLKIENLEPTIDILIA
FT                   VKHRNKEKIKRILKYNQSFQRLFKSSLGKKQSRVIKLKKLLILTYWPVGCLSKSLFNKI
FT                   LTKNYRYIIDEVLTLKYDEILKYLKTIKTFSLNEIFYKGSNKNSNFNYFFSEFMKYTPN
FT                   DFQNTLKTYLFSLEKTAIKQYLEWFFKDKVPNEWEDFIFAIEYLETHKLLNLSSNIKDI
FT                   IIAKFKAEEFFVSFEKMNFNPYKSSKIFQNKNIKRIFLQNVINYIKDNSTKIDTYGWIA
FT                   FYIYADKNDKAKFSKDIKNFFENKNLEIQNQIFVYFLSFYPNIDKKHFEFISEIMIHLD
FT                   KDKISIPQEIIKMQEISPYRLNYRKSYIFVKSLILRTRVFKILHKNIKLELLFKIEEFK
FT                   TETLLPAICYITCYSKPNALKEEQTMSSEKKEEIMKFVTFLTKE"
FT   gene            209891..211579
FT                   /locus_tag="BT0209"
FT   CDS_pept        209891..211579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0209"
FT                   /product="mucin 2 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BT0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17545"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038787"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ03"
FT                   /protein_id="AAX17545.1"
FT                   /translation="MNKCLLLLKNLIVLLILLLNSNLAYSQRLIRIGQEEIKNKNYSQA
FT                   IKILSEAIQKYPKVQNGYYFLAIAYRENNQLTEAEGALLDGIAIGGDIDYKLYFELGNI
FT                   MFKRGEGYYNLAIKYYSNSVKNMPNYDKALLNRANSYVEQGKINFKEKNYKNAWDSYTM
FT                   AIHDYSQFITLRYESEKKNAILHMIALLRNKKAALEELDKSLKNRSEYIATEHQKDKEN
FT                   TQEHMNKKDNKNTQENMSKKDNKNTQEHMSKKDKENTQEHMNKKDKENTQENMSKKDNT
FT                   KTQEHMNKKDKENTQEHMSKKDKENTQEHMSKKDNKNTQEHMSKKDKENTQEHMNKKDK
FT                   ENTQEHMSKKDKENTQEHMSKKDNKNTQENMNKKDKENTQENMSKKDNTKTQEHMNKKD
FT                   KENTQEHMNKKDKENTQEHMSKKDNTNTQENMSKKDNKNTQEHMNKKDNKNTQEHMSKK
FT                   DNKNTQEHMNKKDKENTQEHMNKKDNKNTQEHMSKKDNKNTQEHMNKKDKENTQKHMSK
FT                   KDNKNTQEHEKKKTMLKDKFEDNLKTDSLIELDKINWQEELNIDE"
FT   gene            211572..213929
FT                   /locus_tag="BT0210"
FT   CDS_pept        211572..213929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0210"
FT                   /product="surface-located membrane protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17546"
FT                   /db_xref="GOA:A1QZ04"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ04"
FT                   /protein_id="AAX17546.1"
FT                   /translation="MNKRKNLPTLIILIILLIASFGGLGYYVYKERLNKNNQAIMLNEV
FT                   KNSVMDRNYKKAHSITKMLKDKYPQNTDIAMLENTLSELANNSPFESKDLQRDTANQIL
FT                   DKIQGKQQSIPINNENSEIAFNNRYIKDTTKIENYADRKDDTGIENEDILEFNQNTIPE
FT                   NLRKNINKIAKQQESTPNNDKSIENKKNLFNLKKLKENLNKELNQTKTTQFNTIKQVIK
FT                   THEQNEDKLIKKNTDDSRENKTKQIDKVIEISPSLKPKTKKETPNTKDAHKNQIIEKIE
FT                   RPYSYVIKKVLYEILDNINTGNPSLAKERLNELIKKGLSNKFNKINDLIDKLQTQEAAN
FT                   LLIRLIKQDIEPNSISIEKAPFKKELLKQKKPKEKNFPTKDQLTNNQIKMQEKPKTHAN
FT                   HLSQTSIDLQSLKMLASINEEQKDFKKAEAIYEKIANITNEAEDHYKVGIMKFKLKKYE
FT                   ESIKAFDKTISLNPKHKKAYTNKGTSLILSHKPKQAIEAFKKAITIDQNYDTAYYKKGI
FT                   AEEQNNDKQNAFLSFKKAYEITKNPHYALKTGIIANYIGDFKNSEKYLDKASTSIKEKN
FT                   DIMFYNLAIAKFENDNLNESLISINKALDINPEKSEYLYLKASIYLTKENYNEAIPLYN
FT                   SVILKNPENITAHINLARAYEKSGNEPKAIEILEKISNKNHLLALNNLGILYKNQGNYQ
FT                   KAIEIFQKAEAHSSLEAKYNLATALIAIKDNKRAMEKLKEYIKINPNNPEALHALGIIE
FT                   YNDNGNDKILKEVINKFPNYKQNKTIIKIIGK"
FT   gene            213926..215764
FT                   /locus_tag="BT0211"
FT   CDS_pept        213926..215764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0211"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:BT0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17547"
FT                   /db_xref="GOA:A1QZ05"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZ05"
FT                   /protein_id="AAX17547.1"
FT                   /translation="MNKIKFLDRSLVQKIAAGEAIDRPCSILRELLDNSIDSGADKIEV
FT                   FLEEGGIRRILITDNGSGISKEDLKICYLPHTTSKINEEKDLEKIQTLGFRGEALSSIA
FT                   ICSNLTITSSTTGEDSYQIEVENGTEKYFKKQSAINGTIVDVTNLFHNFPARKRFLKKD
FT                   SIETKMCLKVFEEKAVTHPGIDFKLSLNNELRKVYFKESLINRVQSVYGEIIENNKFGK
FT                   IETEYENVQMKIFFAPPNFSRKDRRNIKIFLNRRPVEEHNLSEAIIDGHSRILTNRNFP
FT                   ICYLFLEIDPRYVDFNIHPQKKEVRFFNLPFLPKQVSSNINEFFDRERKEILQDYHNII
FT                   IKRQITNDAHLLHPEDDPTNSDFQTYEIIQNESLILDKPQNNKITNIIEDKVKFESQNP
FT                   IQKDKPSFKSYIQNILLETSTIANDFQKPIAKHEFKYRGQLFSEFLIVEKDNEVFFIDQ
FT                   HALHEKIIYQTLINSEKITQKLLIPIEFQVDCEDTDKILASELEEYKKLDIIVTKIKEQ
FT                   TYQLESIPNICNKYENVIIQFFKTRKSKTIDSLETDLYATIACRQAVKCNDTISSEFSQ
FT                   FLINEFFNLKLKYCPHGRKIYHKISKFELEKSVNRK"
FT   gene            215785..216825
FT                   /locus_tag="BT0212"
FT   CDS_pept        215785..216825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17548"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ06"
FT                   /protein_id="AAX17548.1"
FT                   /translation="MIKDIKSKIQELSPQRDKKLVELGKALKNSNVIELKKLKSYTSLK
FT                   LIEKEISQLKASLNKIEDNESKLKELYKKIKDYKESKKHILKAYEKKLKKITEITINKY
FT                   PNNLSTILEYKMNFIKSTLEKHKYKTTEIIKLNEKINFFKRLIINIKLMLKDIINKINI
FT                   EKMSKEFEKKILKEHLFSDNLENLIDEFVENKDLSKAIVEEYRLMNEIQTEIVKINNEI
FT                   KHKSIKDNINSKNKIECAINAVQTNRELILKKIAEEFVEMSKTEKGLNKTGTINSLLET
FT                   IKNLNQQISKLNADLIKAIKIDEIVKVKSKMQQLIKNKESIEVKLNELNSKIEIIQNEI
FT                   NELDNQ"
FT   gene            216924..216997
FT                   /locus_tag="BTT0004"
FT   tRNA            216924..216997
FT                   /locus_tag="BTT0004"
FT                   /product="tRNA-Met"
FT   gene            complement(217000..217656)
FT                   /locus_tag="BT0213"
FT   CDS_pept        complement(217000..217656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17549"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ07"
FT                   /protein_id="AAX17549.1"
FT                   /translation="MLRELKSNILLLFFIFFCSCEMSYPDIREVDYVINYYFAKDKFDY
FT                   FMTFDFAVKVLNSNDVIKFFVENIDSKEFIEVAKDKYTSSFINSVLGKNVLYCKDLRFN
FT                   LFDKTFENFMAQVHLIDSGMRVYSREIVINLSLSEEELTLIHYYIYNSKDKLKLNEISG
FT                   NNLYLIKTPKDEIDFFYSIVKIEDLMNIQLDDDNLDVYLGFYYVGKHSNLFFRLN"
FT   gene            complement(217634..218212)
FT                   /locus_tag="BT0214"
FT   CDS_pept        complement(217634..218212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0214"
FT                   /product="protein translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17550"
FT                   /db_xref="GOA:A1QZ08"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZ08"
FT                   /protein_id="AAX17550.1"
FT                   /translation="MGTIKSGDIEKGTFLLFKGMPHIVLEREFSKMGRGGSIVRLKLKN
FT                   LKNKSVVKETLKGADTVEEIEVLEVASQYLYRENENLIFMDLETYDQFDVNLREISNIE
FT                   DKVMFLQEAGIYSLVKWDNEVIDLRLPPKVAFEVVDAEIAVKGDTVTNAMKNVTLHTGL
FT                   VVKAPLFINVGDKILVNSETKEYAERVKE"
FT   gene            218279..219184
FT                   /locus_tag="BT0215"
FT   CDS_pept        218279..219184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0215"
FT                   /product="phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17551"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ09"
FT                   /protein_id="AAX17551.1"
FT                   /translation="MTYLRLMILYIVVKGVNLMQAIKVLFTISIAFLFSNCTNKDKENV
FT                   IAIGGSTSTTSIMDEMILRYQKINNQLKVTYDAQGSSVGIKGLFDGIYKMAISSRDATE
FT                   EEIAQGAKITIIAYDALIFITSPDVKITNITEEDLVKILNGNIRNWQQVGGHDAKINFI
FT                   NRDSSSGSHSSIKELVLDKILKNPEEAQFRQDSIMVKSNGEVIEKISLTPHSIGYISFG
FT                   YARGAIEKGLHTLSINSIYPTKETITKDKYNIKRRLIAITNSISEDQNILDFINFMLSP
FT                   NGQDIVEEQGFIKVHTTENI"
FT   gene            219268..220176
FT                   /locus_tag="BT0216"
FT   CDS_pept        219268..220176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0216"
FT                   /product="phosphate transport system permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17552"
FT                   /db_xref="GOA:A1QZ10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ10"
FT                   /protein_id="AAX17552.1"
FT                   /translation="MKLTLKTKRNIVRLAFNCFIFTSAIISTLTILLLVLFIIKNGLAP
FT                   LLNNKIKIFNFLFSTNWDPTNKLQKSYGILSFIINSALTTFFSVLIALPIGLGFAIYLS
FT                   EKTKGIYQKTLQTIIELLAGIPSVVYGFFGSTFIATLIKNTFSREDNLGYNLITSVIVL
FT                   SIMILPTIISVSYTSLKAVPKSYKLASLALAATDWQTIYKVMIPSAGKGILAGVILAIG
FT                   RAIGETIAVLMVGGGSPLFIQNIFSPIRTLTVNIAIDMGYASGTHKEALFSTALVLLLL
FT                   VIIINSIKHFILSSSKRLKIK"
FT   gene            220173..221714
FT                   /locus_tag="BT0217"
FT   CDS_pept        220173..221714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0217"
FT                   /product="phosphate transport system permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17553"
FT                   /db_xref="GOA:A1QZ11"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ11"
FT                   /protein_id="AAX17553.1"
FT                   /translation="MNTIQTNKLFNKISFCIIRFIAYFLITLLFFLISYIVYNSLFFTS
FT                   KKQTLFLDETKHFLPFTLKNKIIKIAFIINKSIKAEEITTQDIYNIYNNKISHWGSISD
FT                   QSIDIVPIASSQSNLASTVVLQTFTKDNKFNNRYIKLVESNEKIIETVNKTTGAIGYLT
FT                   KEELEKLDFKKFSEIKSLKIKSMSILVGKKTLQKSENEIINILSLNQIKKLLIEKTNWN
FT                   NLISKNIKLNIIKYSDYDQNAIKTVEEHEGTIAVVPWHSFYKSDAPFLKLYYMKKDMPL
FT                   NLNFILSTPRNSGKYGGISYLIFNTFYVILLTAIISISIGIGTGIMLAEYTSNKIFYKT
FT                   VSMSVDILSSIPAIIFGLFGLIFFVPIFGMGILSGAITSSLMILPMIIKTTEEALKSIP
FT                   KSYKYASVALGANKTETIIKILLPASSPGILTGIVLAIGRALGETAVLLFTMGTNLGLA
FT                   SSLNEPSRSLTVHLLLLFQEGYLDKGFATASILIIMILLINLTSKFLINKLYRIK"
FT   gene            221715..222479
FT                   /locus_tag="BT0218"
FT   CDS_pept        221715..222479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0218"
FT                   /product="phosphate transport ATP-binding protein PstB"
FT                   /db_xref="EnsemblGenomes-Gn:BT0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17554"
FT                   /db_xref="GOA:A1QZ12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ12"
FT                   /protein_id="AAX17554.1"
FT                   /translation="MSQDKAIIKTENLNLFYTDFKALNNINISILRNSITALIGPSGCG
FT                   KSTFLRTLNRMNDLVEGVKIEGKVMYEGKSIYSNNFDVLELRRKIGMVFQTPNPFLMSV
FT                   YDNISYGPKIHGIKDKKKLDEIVEKSLIKSALWNEVKDKLNRNALSLSGGQQQRLCIAR
FT                   TLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFF
FT                   LNGYIEEESQTDELFFNPKNIKTEEYITGKFG"
FT   gene            complement(222480..223301)
FT                   /locus_tag="BT0219"
FT   CDS_pept        complement(222480..223301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0219"
FT                   /product="zinc uptake transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BT0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17555"
FT                   /db_xref="GOA:A1QZ13"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ13"
FT                   /protein_id="AAX17555.1"
FT                   /translation="MFKHLGDYLLTLHPIFLGFLGSTFTWFTTAFGAAAVFCFRKVNNK
FT                   IMDAMLGFSAGIMIAASFFSLIKPAIEMAEELGYIAWMPAVFGFLLGAFFIYIVDVFVP
FT                   DLDKLAFIDEDLTRHGKKDFLLFTAVTLHNFPEGLAVGVAFGALASSPDIHTLVGAMIL
FT                   TLGIGIQNMPEGAAISLPLRRGNVPLWKCFNYGQMSGLVEIVGGFLGSYAVYTFTRILP
FT                   FALSFSAGAMIYVSIEQLIPEAKRKDIDNKIPTIFGVIGFALMMFLDVSLG"
FT   gene            complement(223318..225099)
FT                   /locus_tag="BT0220"
FT   CDS_pept        complement(223318..225099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0220"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BT0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17556"
FT                   /db_xref="GOA:A1QZ14"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ14"
FT                   /protein_id="AAX17556.1"
FT                   /translation="MKLDELRKKYIEFFKSKGHCEIAGKSLIPDNDSTVLFNTAGMQPL
FT                   VPYLLGEIHPSGDMLVDVQKCLRTGDIDEVGDLSHLTFFEMLGNWSLGAYFKELSVKYS
FT                   FEFLTSPDYLNISKDRLYVSVFEGDENIPRDTKTASVWESLGIPKDRIFYLSREHNFWG
FT                   PVGNVGPCGPDTEIFVDTGKEKCSNECDITCSCGKYFEIWNNVFMQYKRDENGNYEELN
FT                   RKCVDTGMGIERTITFLQGKSSVYDTDAFKPIIDKIEKISGKIYGQNLEDDKSIRIIAD
FT                   HIKASCFILADNFAVLPSNVGQGYVLRRIIRRAIRYAKKLGMESHVLADLVDPVEEIYK
FT                   SFYKELTENKDFIKAELNTEEKKFFKTLRHGEQEFIKLIQHLSSKLIPGEIAFKLYDTY
FT                   GFPYEITEELATEYGFSIDKTGFEEHFRKHRKVSKKGGDKVFKGGLADCTYETTKLHTA
FT                   THLLHKALQLVLGDHVRQKGSNITAERLRFDFSHPYKMTDDEIKRVEDMVNLQIKNKLS
FT                   VNRTVMSLDDALAKGAMALFGEKYEEIVSVYEIDGFSIEVCGGPHVKNTSELGIFKIQK
FT                   EQASSSGVRRIKGILID"
FT   gene            complement(225099..226349)
FT                   /locus_tag="BT0221"
FT   CDS_pept        complement(225099..226349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0221"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:BT0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17557"
FT                   /db_xref="GOA:A1QZ15"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ15"
FT                   /protein_id="AAX17557.1"
FT                   /translation="MLVYWFLQILRESMQDPRISKYQDAKNWGVKTFKESEKKELHNDL
FT                   PEIQGSLLKSWVNLIKRGKREDFSNSSSLSKGVGKPGFIRKESKVSKIAKYFLAIGLEK
FT                   SSKIMAELDDADIIAITREITKIKYITPDDKKRIIQEFEDLVKSERKYLKIDDKFTYEL
FT                   LNKSLSKAKAKEIYIKVTGIDPFLPFDYLSGVEDEQLWALIKDENIQTLLIIYNYLTKE
FT                   QKKYVFSMLEKDIKKQFVKELAKPRQLNMDMIEIISDRLKSRFAMQGKLKTEKLDGSKI
FT                   LVDILSYMDSEDEKNLLSNIDMKVLNPVKDNEIKERIFDINVILRITDNDMHNILREFT
FT                   DNDIAIIIKDKSDEIRDKILFNVSRRRKTLILEEESFLKEVKKRDIKAMTTSFVNYIKE
FT                   LTLKGELMIYRKNEEFI"
FT   gene            complement(226297..227016)
FT                   /locus_tag="BT0222"
FT   CDS_pept        complement(226297..227016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0222"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BT0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17558"
FT                   /db_xref="GOA:A1QZ16"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ16"
FT                   /protein_id="AAX17558.1"
FT                   /translation="MLQGMVMEFLCSNKESDLKGRFFDFFLKNISRDDFTSIGVCGGRN
FT                   IISFLNVFDEQNYPIKKSHFFLVDERCVDLNSEYSNFRLLSEGFFSKMMKKNLICGSNF
FT                   HPFIYSEFDETSSIYNYNVEFNSRFTRLDLSILSVGEDGHVASLFPSRKLLFSEMEGYQ
FT                   YEYDAPKFPSKRMSLTPKSLLLSKASVLLFIGHEKKGALENFLSSEISLRECPAKIFKD
FT                   HARLLVLTNIEGVYAGS"
FT   gene            complement(227019..227720)
FT                   /locus_tag="BT0223"
FT   CDS_pept        complement(227019..227720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17559"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ17"
FT                   /protein_id="AAX17559.1"
FT                   /translation="MKIMFAKKLLFLLSSLVFLIASVIMSIGIKNIGIKNGNYITVKGL
FT                   SEKEVLSTSSSWNLRYELGGNTIDEINKLNNANFLAIRDFFVSYGFHEDEISMKNMDFH
FT                   IANYSDALYKYNAYISLGIYTKDIDKMEQVSKNIIKLYNKGVLFTGNGGPSYYFDKIND
FT                   VKPAMLADSIKNALDAALEFSRNSGAVLGKIKTANQGYFEFLPVDRSSENHERYSKKIL
FT                   RVVTTVSYYLD"
FT   gene            227792..228799
FT                   /locus_tag="BT0225"
FT   CDS_pept        227792..228799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0225"
FT                   /product="NIFR3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17560"
FT                   /db_xref="GOA:A1QZ18"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ18"
FT                   /protein_id="AAX17560.1"
FT                   /translation="MLINRKIAIAPMVAITDEHFRYIIRLLSKKVTLYTPMISAKSIIM
FT                   GKLNTIVKQTPTDSPIAIQIATDCENDAAKAIEILENKFNFDEYNLNVGCPSSRVQDAN
FT                   YGACLMQTPTQVGKILQAMKKNTNKPVSIKHRIGIRHNKREYHETNYRELKQFVEKIIE
FT                   YEIKNFTIHARVAILNGYSPKDNQNIPKLRHELVYQLKQDHKNIFIEINGGIISSNHIK
FT                   THLSYVDSVMIGRAAAKDPYFIAKISREFLEEKEKIPTREEVLLKMVEYIKEYNEHLSI
FT                   NTILKHIMRIVFAKDNARKFRQILSAPFPKNLKNHEILLSAIEHLREDTLKSNF"
FT   gene            complement(228789..230066)
FT                   /locus_tag="BT0226"
FT   CDS_pept        complement(228789..230066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0226"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BT0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17561"
FT                   /db_xref="GOA:A1QZ19"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ19"
FT                   /protein_id="AAX17561.1"
FT                   /translation="MMLDLKFIRDNLELIQKNIKDRGLELDIDLLISLDDERKKLVTKI
FT                   GELNAIRNENANAMKGKIDDSRRHSFIETGKVLKSEIAILEEKLSHITSKLLIEHKRIP
FT                   NISAPDVPVGEGEDGNIVLKVSGSIPNFDFKPKDHLEIGIDLDLFDFERAREVSGNKFY
FT                   YLKNEAVFLELALINFALNKLKPKGFDLFITPDIAREFIVDGIGFNPRGTESNIYKIED
FT                   TDKYLIGTAEITLGGYYYNTILDLKSPLKMAGLSHCFRKEAGAAGQFSKGLYRVHQFSK
FT                   VEMFCLCKSEDSDRIHNEFLALEEEIFTELEIPYRVLNVCSFDLGASAYKKYDIEAWMP
FT                   GRGDKGEYGEVTSTSNCTDYQSRRLKIRYKDDGQSKFVHMINGTALASTRTIIAILENF
FT                   QDARGGVRIPKNLVKYTGFDYISPKN"
FT   gene            230211..230927
FT                   /locus_tag="BT0227"
FT   CDS_pept        230211..230927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17562"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ20"
FT                   /protein_id="AAX17562.1"
FT                   /translation="MIKVSTAQKLFILTSLLMIFIGCTKKTKKINFNEIDTLYNEKDEI
FT                   IIQSILAEEENEFFEYKIRIPKVIDARTKNNKIKTFNDEVENYSNEIVNNLESAAQNIK
FT                   QESKKPSLNIDYEIYHGYGIYTIIVSATQTINDTSITNHRSYYISDNGDYIYNIDEIIN
FT                   VEEAFPYFTQRIKEKIEQTYPNKLLFDLQQAVIYFENKKIIIKFPFYVFNLDDIKDTEN
FT                   IFEFNEEEAQKYIKQG"
FT   gene            230940..233858
FT                   /locus_tag="BT0228"
FT   CDS_pept        230940..233858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0228"
FT                   /product="metalloprotease, insulinase family"
FT                   /db_xref="EnsemblGenomes-Gn:BT0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17563"
FT                   /db_xref="GOA:A1QZ21"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ21"
FT                   /protein_id="AAX17563.1"
FT                   /translation="MKRKKIFNLISKTYLEEYDTEGCYFKHESGLEIFELKNTTFKENA
FT                   FGIAFKTIPLNNTGVAHILEHTIFCGSNKYRIKDPFLYLMKGSLNTFLNAMTFPDKTLY
FT                   PAASTIQKDYFNLFKIYADAVFNPLLKKEAFMQEGYNINPNNFKLSGIVLNEMKGNYSN
FT                   KNSLINEIATNSLFSEGTYQYDSGGNPINIIDLTYEEFIEFYRKHYTLENCKIFLFGNI
FT                   DTNKNLNFIEKYIIRPYTKEKLNINYNIKKTTRWNKGKTLNFDIPKETENTLGVYAINW
FT                   LCTDIKNIKENIGLEILSEILLDSSCQFTINMLKSNIGDVIADVSGINTDIKECVFSFG
FT                   LQNVVPGKMEEFKNMVFNELKNLVKVKISEELIQGILFGYEFALKEEKGQGWPISLMIK
FT                   SFKGWLHGMHPTETLKINCHLDEIKNKLEKGEPYFENLIEKYLLNNNHYTLIQFNPSDT
FT                   VLKEMEEKIEKKLMDREIDIKKNPEKFAEFTKDYNQFKDYQKKEDLKSDITKLPMLKIE
FT                   DLPKEVEKSLILNETPELKTHTFELKKNNNIFNVHLFFKLNFLQKEDFMHLSLLKRAIQ
FT                   DLSTQNYSYVDLNNKIQNTLGQLNIHESYEEDIQGNMINLFNINFKSFNNKIQESFILI
FT                   KEILININFHDYDRLKEIVLSLKNDFKSILIPKGHIFATIRSESKLSQSKYLKELQVGL
FT                   TGREYWQKVKTDIESLRELASNLERLRDKIIFKDNLSSLLIGSTNDVIKRLESELFTLR
FT                   ESLSKKTYINNPITIQPSGNILTEIIIIPSKISFNSISFASYKITDENYPKINFLTHIL
FT                   KSGILWEKIRVMGGAYGAFASITNGIFSFASYRDPNFVKTYQAFETSLEELANNEIKNE
FT                   ELYTYLVGVIGLSTNVKTKSIEILESHKRKMLNISDQLRQDIRNSYFKITSTDIKNISE
FT                   QVLNQLKQKNSITSLVNHATYEDEKEKLEAFIGTNYKVKKIY"
FT   gene            complement(233875..234165)
FT                   /locus_tag="BT0229"
FT   CDS_pept        complement(233875..234165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0229"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17564"
FT                   /db_xref="GOA:A1QZ22"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ22"
FT                   /protein_id="AAX17564.1"
FT                   /translation="MKFRLNFYQIKRGIMKKDIHPVSNLVIFKDSSNGTMFLTRSTLTS
FT                   KETIKYSDNKEYPLITVEITSKSHPFYTGQQKFVDAAGRIDKFNKKYKKLK"
FT   gene            complement(234181..235725)
FT                   /locus_tag="BT0230"
FT   CDS_pept        complement(234181..235725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0230"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:BT0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17565"
FT                   /db_xref="GOA:A1QZ23"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ23"
FT                   /protein_id="AAX17565.1"
FT                   /translation="MDKKCAEFDLEDEMKRLNSSKELKIEDNSKKKIVKVVTKKESVAS
FT                   GLKNSNIDKLRESNGVSSGFDYDISDPDLENSIKTLEQSNIINFLGGKDFIVIDSLYDK
FT                   PITEIRKVVEGLGTNHTIAVTMKKTELIFLLVKILTEHNINVLFTGVLDVLSDGYGFLR
FT                   TASNSYLSGGNDVYVSPSQIRLFNLRTGDILYGQIRSPRDGERFFAMIKIKSINDQDPT
FT                   FAQNRIPFDNLTPLYPSSKLDLEYENCNISTRLINLFSPIGKGQRALIVSPPKAGKTTL
FT                   LQKIANAITTNYPDIVLMILLIDERPEEVTDMIRGVKGEVIASNFDEQASRHVQVAEMV
FT                   IEKAKRLVENKKDVVILLDSITRLARAYNQTMPTSGKILSGGVDSNALHKPKRFFGSAR
FT                   NIEEGGSLTIIATALVDTGSKMDEVIFEEFKSTGNMELILDRSLADRRLFPAINIKKSG
FT                   TRKEELLLSEEERSKILLIRKILGGVDDYEGVEALVEKMKKSKNNEIFLKTMSNGD"
FT   gene            complement(235814..236221)
FT                   /locus_tag="BT0231"
FT   CDS_pept        complement(235814..236221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0231"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17566"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ24"
FT                   /protein_id="AAX17566.1"
FT                   /translation="MPVNIKDSYKWDCKLDSSLIFRGKLKFEGALYLDSSFEGEIFSKS
FT                   GILFIGKNSKVITDVVICDTLIIEGILKGNINASNKVYLNSGCKIYGDVKTKKIFINDN
FT                   IVFDGKCEMIKSNESIDLFSFTVSQLKDTFQ"
FT   gene            complement(236225..236551)
FT                   /locus_tag="BT0232"
FT   CDS_pept        complement(236225..236551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0232"
FT                   /product="DNA-binding protein HbbU"
FT                   /db_xref="EnsemblGenomes-Gn:BT0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17567"
FT                   /db_xref="GOA:A1QZ25"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ25"
FT                   /protein_id="AAX17567.1"
FT                   /translation="MSFSRRPKVTKSDIVNQISLNIKNSNEKLEKKYIRLVVDAFFEEL
FT                   KNSLCLNNVIEFRSFGTFELRKRKGRQNARNPQTGEYVNVDDHHVAYFRPGKDLKERVW
FT                   GIKG"
FT   gene            complement(236563..236820)
FT                   /locus_tag="BT0233"
FT   CDS_pept        complement(236563..236820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0233"
FT                   /product="SSU ribosomal protein S20P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17568"
FT                   /db_xref="GOA:A1QZ26"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZ26"
FT                   /protein_id="AAX17568.1"
FT                   /translation="MGNNPSALKRARQNLKRNLRNVSVKSELKTIEKRCMNLIREGKKE
FT                   EALEFFKFVSKKLDTAARKRIIHRNKAARKKSNLSILLLR"
FT   gene            complement(236894..237715)
FT                   /locus_tag="BT0234"
FT   CDS_pept        complement(236894..237715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0234"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17569"
FT                   /db_xref="GOA:A1QZ27"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ27"
FT                   /protein_id="AAX17569.1"
FT                   /translation="MNEFFFYKIRLIFIFLLNLSFSVFYMLLYKNIFGIFVLFLILINL
FT                   FLIIFYLRYFYELDCKGDKIFYKKFYPKVNFTFNDILWFEKRLSGSILILGLNNKRKIK
FT                   ICFLRKKYLSNFFRKLKIMRSDLFIAKNEELPIRYYISGLYLLMFLCRILINMSVCYIA
FT                   FGSIIVFFFIFLIGIKVLIDDILVIKDLVIFYEFRKDSVYEKKIFSHKEYFYKFFNSIF
FT                   VHVSELSRDGYLSFVYNHRGTLKKVYINNEGMSYSMQKVFAYIDKYCRQCV"
FT   gene            complement(237733..238839)
FT                   /locus_tag="BT0235"
FT   CDS_pept        complement(237733..238839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0235"
FT                   /product="GTP-binding protein"
FT                   /note="probable translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:BT0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17570"
FT                   /db_xref="GOA:A1QZ28"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ28"
FT                   /protein_id="AAX17570.1"
FT                   /translation="MALNVGIVGLPNVGKSTLFSSLTASKSEIANYPFCTIDPNIGIVE
FT                   IPDERLSRIASLVVSKKTVPAVIEFVDIAGLVKGASRGEGLGNKFLANIREVSIIVHVV
FT                   RCFEDREVIHVDGDVNPQRDISTINTELCLADLDTVQKSILKNEKNVKSVDKKISENAK
FT                   KIVSMLKSLEKHLMDVRPVIEFEFDEFGYDFIKSLNLLTIKKVIYVCNVDENSLCGNKY
FT                   TDTVKNIALGEGNDYLILCAKVEAELIEIKDLRERREMLESMGINDSGLSNLIRTTYYA
FT                   LGLRTYFTAGEQEVKAWTFMDGMKAPEAAGIIHSDFQRGFIKAEVYSFNDLIEYQSVQG
FT                   VKEKGRFRLEGKDYLVRDGDIIFFKFNV"
FT   gene            complement(238865..240928)
FT                   /locus_tag="BT0236"
FT   CDS_pept        complement(238865..240928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0236"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17571"
FT                   /db_xref="GOA:A1QZ29"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ29"
FT                   /protein_id="AAX17571.1"
FT                   /translation="MFCITISNLYSICLSIKRMILIFNLFVLFFLSTFVLNSQGIVTNK
FT                   DAQEEFKLALNSYNNGLYDDALLSFKRVLSFDPSNLDYRFWIGNVYYRLGYVEEALREW
FT                   RNLQSQGYKAAYLRQLISIIEQRRGISLSNELDVERFIQVAFLNNSIYRRPNGYQITSL
FT                   KADQYGGYYAVNFVGNEILHFDANNNVSVLIKDGITSLKSPYDVIELGDLLYVTLCSND
FT                   EIGIYDKTFGIKRGSIGKKGTDPGELLAPQYMTVDERGYIYVSEWGNKRVSKFDAKGNF
FT                   ILHFGVKTVGYMGLLGPTGVTYLNGNIYVADTSKNSIEVFDTSGNHLYSIATSLEGIEG
FT                   LSSDFTGNNIIISSKYGVYKYSVLRKTFVKLLKADKIDSKISSSIIDVNNQVIVSDFDN
FT                   AQISVYKSDVSVYDSLNVDVRRVIRVGGPKIYVELNVSNRNGLPVIGLKSENFAIANEE
FT                   YYIVNPKIAYDINTSNDMNIAIVFDKSFAMKNYESEQIMGVNTLIKSRANKKFSFINAT
FT                   SVPLVDNIESLLSTIHKTNSLGAYDSNYVKTDVSLKLAGSELMSKSARRAVLYFSNGNL
FT                   SRSAFNRYSIDTILSYYKNNDIRFYLILFGNNPVDSKLQYLVNETGGAIIPFSSYEGVS
FT                   RVYDLMMKQKTGTYLLEYDYPGLQEPDGYYNLSVEVNFNQQIGRGEFAYLVN"
FT   gene            241028..242581
FT                   /locus_tag="BT0237"
FT   CDS_pept        241028..242581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0237"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17572"
FT                   /db_xref="GOA:A1QZ30"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ30"
FT                   /protein_id="AAX17572.1"
FT                   /translation="MKTRYFLLATFSGMLTTLAIPNEIKNMGYSSIGLVAYIPLFIALI
FT                   KVKDKKTLIGLTIFYFLVANSLQNFWLAFFHSFGLITFLGAVSGYIPYAFVLGYFLYYA
FT                   LKTFKNKTLTLAILFTFYDYSKSIGFAAYPWGFSAFMVNNFNDLIQVADIFGVFFVCFI
FT                   VYFFNAGIANFLIRQNKINTLNVLFSVLLVSTSFAYGIMKKIELNPILNKEIDTLNIAA
FT                   IQLNIDPWLPGNHKKGIQTSIKLTKQALRKHPDTELVLWSEGALALPFNSYKDYIYYDE
FT                   ELIELYDSVNELISNSKAHFVIGSPSKPDKRSLTHQNSVYAIKPNLKIENIYSKIFLVP
FT                   FSEKIPFYEYKFVRKFFRQNFNITGQINGNKLEIFKLKKFNLGLLICYDDAFPDLARNY
FT                   KKQNANLLLNFSNDSWSHTDSSEWQHFVVAKFRSIENGIKTVRATNSGITAIINEYGEN
FT                   VKSLATFKKGYLISRIKLPPRFTTIYEHIGDLFIYVLAIVIVIMTLRFYFIEKSTHLSS
FT                   "
FT   gene            complement(242545..243321)
FT                   /locus_tag="BT0238"
FT   CDS_pept        complement(242545..243321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17573"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ31"
FT                   /protein_id="AAX17573.1"
FT                   /translation="MEVSMKKLVLLFFSFAFISLFAKNGSVVDEQQKELAIFYYEVGQR
FT                   YIDVGKVRKGKIFQKKALEIYPRLKEEVNLKVAVEEIDSKIKLEGETNFLAFDDVKLDD
FT                   IPGIIHSKIEISEITNAPKIEYIANREREKYKEQAVKFQFSKFVRALLLQDLNLLDSVV
FT                   ADEVKVLGRIEPKTDFISSLELVSNDISKDDVSYLAVDDFYDLKSLNIIKNTDVSYSVR
FT                   VKAKKNDVTKNIPFWRDVQTLCFENQDDKWVLFSIK"
FT   gene            complement(243379..243996)
FT                   /locus_tag="BT0239"
FT   CDS_pept        complement(243379..243996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0239"
FT                   /product="deoxyguanosine kinase"
FT                   /EC_number="2.7.1.113"
FT                   /db_xref="EnsemblGenomes-Gn:BT0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17574"
FT                   /db_xref="GOA:A1QZ32"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ32"
FT                   /protein_id="AAX17574.1"
FT                   /translation="MEAGLVIVIEGLIGVGKTTLGHVLSKEFNIPFYSELNNEFTLSML
FT                   DKFYKDKSRWAFLVQINFLNERFKLIKSIFKTKGGILDRSIYGDRVFASLLNDSGYISN
FT                   DEYKIYLDLLDNMLEHSQKPVLMIYLDCSVDEAERRIKNRNRSFETGIPREYLEGLNEK
FT                   YLSWYDSYDLSPKLSFDYNSINIFDDKHKSKLIAFIKDKLVI"
FT   gene            244234..244650
FT                   /locus_tag="BT0239A"
FT   CDS_pept        244234..244650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0239A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0239A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17575"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ33"
FT                   /protein_id="AAX17575.1"
FT                   /translation="MNSKYNLNSQITLFKAIIKKSIKERCKKFFISKRFTNKIKELIKS
FT                   FNLYSTNHIILNDQKGNGHNWHKFITHNLIPLITKNLLMNKNLCYKNKYKEHINGLISS
FT                   FTNSKIMNIEISNEKRAISQHKKTSLKFSYLAII"
FT   gene            244795..245556
FT                   /locus_tag="BT0240"
FT   CDS_pept        244795..245556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0240"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17576"
FT                   /db_xref="GOA:A1QZ34"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ34"
FT                   /protein_id="AAX17576.1"
FT                   /translation="MIYIRFKEFIAEFLGTFILLALGTGSVAMTTLFPSNPSVTGEIIK
FT                   GGYTNIVLGWGLGVTFGVYTAARISGAHLNPAISIGLATIGRFPTAKLFHYISAQILGA
FT                   FSGALMTLIVFYPKWIEIDPAFENTQGIMSTFPAVPGFWPGFIDQIFGTFLLMFLVLVV
FT                   GKFIKGDTQNPFFPFIIGSIVLAIGISFGGMNGYAINPARDLGPRILLLLAGFKNHGFD
FT                   EMNVFIIPILGPIIGTILGAIVYEFTLEDKE"
FT   gene            245612..247111
FT                   /locus_tag="BT0241"
FT   CDS_pept        245612..247111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0241"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BT0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17577"
FT                   /db_xref="GOA:A1QZ35"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ35"
FT                   /protein_id="AAX17577.1"
FT                   /translation="MNMKYILSIDQGTTSSRAIIFDKKANIKGFAQKEFKQIYPYPSWV
FT                   EHNPNEIWSSILGVMAEALANARTFPNEIEAIGITNQRETTIIWDRQTGHPIYNAIVWQ
FT                   DRRTAQLCDELKARGQDKNFLKKTGLVLDAYFSGTKIKWILDNVAGARKRAEKGELCFG
FT                   TIDTWIVWNLTKGKIHITDYSNASRTLLLNIKSLEWDEELLQILNIPKSILPELKQSSE
FT                   VYGKTDSSILGTEITISGIAGDQFAATFGQACLQKGMAKNTYGTGCFVTVNIGKNPIIN
FT                   EQQTLLTSIAWGRKNSITYVLEGSVFIGGAVIQWLKDNLELFRKNSDAEALAASVNNNG
FT                   GVYFVPAFVGLGTPHWDSYARGTIIGLTRSSTKEHITRAALESIALQSFDVLTEMQNSI
FT                   QGFAIKELRVDGKASQNNLLMQFQADILQCNVVRPKITETTALGSAYLAGLAVGYWEST
FT                   EEITSLWKSDKIFEPSMENSKREDLIYNWHKAIKRAKDWIQ"
FT   gene            247216..248580
FT                   /locus_tag="BT0241A"
FT   CDS_pept        247216..248580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0241A"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BT0241A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17578"
FT                   /db_xref="GOA:A1QZ36"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ36"
FT                   /protein_id="AAX17578.1"
FT                   /translation="MKKLFDFLKPAPHIKRVHKEIEDSLYKKLRLQIFISIFIGYAGFY
FT                   LTRKIFSFAIPELEKEGFNKGQLGIALSGVSIAYGFSKFIMGNISDRSNPRYFLALGLL
FT                   LTAIITLLFGLFSWQLLDPTTAIMLMFILMFANGWVQGMGWPACGRTMVHWWAKKERGI
FT                   TVATWNLAHNIGGGAAGIISAWALIHFKEWQAIFYVPAILVLGIAIFILITLRDTPQSV
FT                   GLPPIEEYKNDYPDDYTEEAEKELNAKDIFIKYVLNNKLLWYIATANAFIYFVRYGVLD
FT                   WAPSYLSQVKNFSIKNSGWAYSLYEFSAIPGTIICGWISDKIFKGRRSETGIIFMTAAL
FT                   ITIIIYWQLPENNPTLTTILLAIIGFLIYGPVMLIGLHALDLAPKKAAGTAAGFTGLFG
FT                   YIGGSVTASAITGLVLQHFNWNVYFYLLITACIFSILFISLTLKQEKKINNTNKQ"
FT   gene            248654..249670
FT                   /locus_tag="BT0241B"
FT   CDS_pept        248654..249670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0241B"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:BT0241B"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17579"
FT                   /db_xref="GOA:A1QZ37"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ37"
FT                   /protein_id="AAX17579.1"
FT                   /translation="MKLIKTKLLMLTMNIFLIIACQNEKMSMTNKKPPLIIAHRGASGY
FT                   LPEHTLEAKAFAYALGADYLEQDIVLTKDNVPIIMHDPELDTTTNVAKLFPERARENGR
FT                   YYSVDFTLDELKSLSLSERFDLETRKPIYPNRFPLNEYNFKIPTLEEEIQFIQGLNKST
FT                   GRNVGIYPEIKKPLWHKQQGKDISKIVIEILNKYGYKSKEDKIYLQTFDFDELKRIREE
FT                   LGYQGKLIMLVGENDWDEAPTDYEYIKSQEGMTEVAKYADGIGPWIPQIIIDGKITDLT
FT                   SLAHKYNMEVHAYTFRIDSLPSYVKDANELLDLLFNKAKIDGLFTDFTDTVVKFVKQ"
FT   gene            249712..251274
FT                   /locus_tag="BT0243"
FT   CDS_pept        249712..251274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0243"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17580"
FT                   /db_xref="GOA:A1QZ38"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ38"
FT                   /protein_id="AAX17580.1"
FT                   /translation="MGKNKKKELRDIDNQDFDLIIVGGGATGLGIGIDSITRGYKTLLI
FT                   EKFDYAKGTSSRSTKLIHGGVRYLAQLNVPLVKEALYEKALLETNAPHLVSKCEFVTPI
FT                   YNILNIPYYYFGLSWYHNLLGKHKKSQYKTKLLSKSKTIEKMPNIKTKGLKCSVLYYDA
FT                   SFDDARMAISMLRTFTEKGGIAFNYTEPTNFIKKNGKISGAIIKDRMTKEQVIINSKCI
FT                   INATGIFADEIRKLDDTNAANIIKPSQGTHLVINKDKLHTEYAMLMPKTSDKRILFAVP
FT                   WYDVIVCGTTDIAINKIEEEPKRLESEIEFIIKNINNYLDIKITKNDILSVYSGIRPLI
FT                   VAPKEKKNTSKISRNDKIFVSDSNLITIAGGKYTTYRKMAEKVLKRAIEENLIPDSKSI
FT                   TENLKLHGYIEREEALKIPEYFRAYGSDFEHLSQMKDFNKKIHTDLPLNEAQITFAIEF
FT                   EQAKTVEDILSRRTRSLLFNAKATIESTPKVAEIMMHKLGKSKEWKTEQIKNFKEVATK
FT                   YLV"
FT   gene            complement(251360..251854)
FT                   /locus_tag="BT0244"
FT   CDS_pept        complement(251360..251854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0244"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:BT0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17581"
FT                   /db_xref="GOA:A1QZ39"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ39"
FT                   /protein_id="AAX17581.1"
FT                   /translation="MKINNLVAGVLNLDSKDYKAAKKKVNVNRANIFSSIFKAELVRED
FT                   KHFIVFENGEFNLELIKDMLDKINDVGEKLLSEPSRQNVIFYKKTIGEFLSIVLSFSIS
FT                   LKEQKGGNNGELKRPKYRIIRIINEKLDRLAYSVLQNQVSQIKLLSSIEEIQGLLINLL
FT                   K"
FT   gene            complement(251851..252393)
FT                   /locus_tag="BT0245"
FT   CDS_pept        complement(251851..252393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0245"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17582"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ40"
FT                   /protein_id="AAX17582.1"
FT                   /translation="MLNLLSIKKDKKISSSFIFADVKTIVGKGDFFKGELISNNFIRID
FT                   GDFLGTINSTKRVIIGEAGRVKSNINANEVVVSGIVLGNVQASNKIKIFQSGCIIGNIS
FT                   CKSIEVEEGAIIDGYMNIGIGSLSFSEKDVLIYTGSYKVDEDVLIEVNKEMSREESTKD
FT                   ACIDECDKYLFDDEQDR"
FT   gene            complement(252394..253422)
FT                   /locus_tag="BT0246"
FT   CDS_pept        complement(252394..253422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0246"
FT                   /product="cell wall endopeptidase, family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:BT0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17583"
FT                   /db_xref="GOA:A1QZ41"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ41"
FT                   /protein_id="AAX17583.1"
FT                   /translation="MMRDRKGFRILSFFKKLDKIFFTIFSSFLKLLSNVYSIFRQNISF
FT                   MIIPHVKGDVKNIKISFLTLFLFFLFFLFIFIGFVLLSINYVTLKSIVKSTEKNYALAE
FT                   SEIEDFRNTVVEINSVASNFSKVLDELNVSLKIKESNIDLNRSKLDGDLADFLDLQMLE
FT                   ANALKELNDLKNVKNTIEGSISPLKSIVKLLHSQNKLLNDIPSLWPIVKGDGIVSLHFG
FT                   PAIEPFTRQWYIHKGIDLAGVRIGTAIVAAADGEVIRASYQVTGYGNFVQIKHKYGLST
FT                   LYAHMSRLNISKGSYVRKGQVIGFLGQTGYSTGPHLHYEVRIGSQVVNPDMYLNLATGA
FT                   SK"
FT   gene            253649..254248
FT                   /locus_tag="BT0247"
FT   CDS_pept        253649..254248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0247"
FT                   /product="nucleoside-triphosphatase"
FT                   /EC_number="3.6.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BT0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17584"
FT                   /db_xref="GOA:A1QZ42"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ42"
FT                   /protein_id="AAX17584.1"
FT                   /translation="MKTLFFATTNINKINEVKQILDIPNIKIKIPKNFDVKETGKTFKE
FT                   NSLLKAKTLFESLDKKKPVFSEDSGLCIKALNLEPGIYSKRYDQYKLGKKLGTNEKNHL
FT                   IIDLMKDKENRTAYFICIVSHISIDGTITNFEGILNGTIALDIDCYKKNGFGYDPIFLT
FT                   ANNKRLSELTLTEKNKISHRGIAFAKFKKFLMQSLN"
FT   gene            254382..256154
FT                   /locus_tag="BT0248"
FT   CDS_pept        254382..256154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0248"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17585"
FT                   /db_xref="GOA:A1QZ43"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ43"
FT                   /protein_id="AAX17585.1"
FT                   /translation="MIERSKINEDDKWDLSSLFKNNEEYKETVEKIKLKLQDFKEYEKL
FT                   EFNLNIFKQALNDYYEIEEELERTVYYTQIQLETDVSNQTSNELRAININLETYASNST
FT                   SFFIPKILKTDTNQIREWLQDIELKDKKIAIEKILREKEHVLSKDEERILANYTSLYSS
FT                   YNDIFSVLTNADMEFGEIDGKPLSNATYSLFLQNENQEIRREAFLKFYQEYKKHENTLS
FT                   NLLIADINKNKFLAKTRKFKDTISMKLFQNNIDKKVYMNLIETVNENLSVLHEYYEFRK
FT                   NILNQEYLNHYDVYVPLTKNIKFKNSFKEACDKILKSLEILGSEYTEVLRKGLLEERWV
FT                   DKYENKGKRAGAFSAGSYNGKPYILMNYKDESIRDMFTLAHEAGHSMHSYFSIKNNPFP
FT                   QYQYSIFEAEIASTVNEQILADYLLKNENDIEKIKYIKLNQIDDLLATFFRQTMFAEFE
FT                   YIIHEMINKDEPVVKETLKQTYLNLLKKYFGPNFKLDENSSLECLRIPHFYSPFYVYQY
FT                   ATGITAALLIYKNIKNNKKDATKNYINFLKIGGSKYPLESLKVTGVDLSLKSTIKNTIN
FT                   IFKERLEDVKKLFE"
FT   gene            256166..256873
FT                   /locus_tag="BT0249"
FT   CDS_pept        256166..256873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0249"
FT                   /product="phosphatidylcholine synthase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17586"
FT                   /db_xref="GOA:A1QZ44"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR026027"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ44"
FT                   /protein_id="AAX17586.1"
FT                   /translation="MKKLLNLILAWSVHILTASGLIVSLYSIISIINTDYNLLLKLTIL
FT                   GLLIDGIDGTLARKLKIKEIIPTINGELLDNIVDYINYTFIPTIFFYYGNFISNEYKII
FT                   TCIGILLASAYQFSRLDAKTSDDYFRGFPSLWNFLIIFNIIFKLDQITNLSIILLCIIF
FT                   SFVPIKVIYPSKTKEFKYITLPVTVIAALSVILITFAKLPDTYLKIGKTLIIFYCLYLI
FT                   LMSIYLTYKTKKK"
FT   gene            256883..257491
FT                   /locus_tag="BT0250"
FT   CDS_pept        256883..257491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0250"
FT                   /product="alkaline phosphatase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17587"
FT                   /db_xref="GOA:A1QZ45"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ45"
FT                   /protein_id="AAX17587.1"
FT                   /translation="MHIILEFIDLNIAYSPIVFFGLLILAGFNIPISEDAIVIMGGILS
FT                   SRKNEYTILIFLGIFWGAYIGDIISFYIGKFLANKFLKQKKQTNKLIDKMNYYYKRYGS
FT                   LTLLFGRFIPFGFRNAIFISAGMGNMSTSNFLITDFFAAMISITTYFTLSFKIGESFKL
FT                   IFPKIRIISLIALIIITIIILIIYIIRKKKIKKVDKLFK"
FT   gene            257510..257593
FT                   /locus_tag="BTT0005"
FT   tRNA            257510..257593
FT                   /locus_tag="BTT0005"
FT                   /product="tRNA-Leu"
FT   gene            257736..260264
FT                   /locus_tag="BT0251"
FT   CDS_pept        257736..260264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0251"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BT0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17588"
FT                   /db_xref="GOA:A1QZ46"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZ46"
FT                   /protein_id="AAX17588.1"
FT                   /translation="MSEYNFTKIEKKWQNYWDKHKTYKVNEDPNIPKEKRIYILDMFPY
FT                   PSANGLHVGHPEGYTATDILTRYKLLNGFNVLHPMGFDSFGLPAENYAIQTGEHPKKIT
FT                   EKNIEKFKEQIKALGFAYDWDREIRTHDENYYKWTQWIFLKLYKKGLAYIKEMPVWYCP
FT                   DLGTVLSNEEVIQTPDGPRSERGFHKVQRKPLRQWVLKITEYAERLIKDLEEIDWPESV
FT                   KEMQKNWIGKSIGAEIEFSIKASKEKIKVFTTRPDTIFGVTYLVLAPEHNIVDKITKDE
FT                   LKTIIAEYKDKEILKSDLERTSLEKDKTGVFTGAYAINPITEEEIPIWIGSYVLGIYGT
FT                   GAVMSVPAHDERDFEFAKKYNLPIKQVVSQTGNNEILTKPFTENGISINTPEEFNNLKT
FT                   EKVKTKVIEWLTKNKKGQKKVNYKLRDWIFSRQRYWGEPIPIIIDDDLNEIPLEEDELP
FT                   LRLPEIENYKPSDTGESPLSKVQNWVNVKRNGKIYKRETNTMPQWAGSCWYYIRYLDPN
FT                   NEKEFASKEKINYWMPVDLYIGGAEHSVLHLLYARFWHKVLYDLGYVNTKEPFKKLINQ
FT                   GMITSFAYQDENGILIPNDEVKKRDNKFFSKTNNKELKQIIAKMSKSLKNIINPDDIIK
FT                   EYGADSMRIYEMFMGPLTDSKPWNTQGLIGIFRFLNKIWAIKNKELTKESAAKEIISGL
FT                   HKTIKKVTEDIENLNFNTAISSLMIFINELLKHDKNYLEIFKPLTIILAPFAPHLGEEL
FT                   WEYMGEQPSIFKNAKWPKYDPNLIIDNTREIVLQVNGKIKDKIILNKGINEDTLKDIAL
FT                   KNHKIMQNIQNKQIIKIITVKDKLINIVTK"
FT   gene            260275..262560
FT                   /locus_tag="BT0252"
FT   CDS_pept        260275..262560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0252"
FT                   /product="transporter, RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BT0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17589"
FT                   /db_xref="GOA:A1QZ47"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ47"
FT                   /protein_id="AAX17589.1"
FT                   /translation="MDLETLSIKYRVFILIIFTLITIFLGFFLKNIKFDSNILKLIPKN
FT                   KKTEKIIDIDKSNSLLSTIVMFKDKKSIFNKETFGKINKVANDITKILKVTPNSVTSIF
FT                   TYFPQFKKDVYTDEDITEIRNKVNSSSFIKNIFLNDDATLIYFIVISTTDDKTNFSRSL
FT                   KNELEAMEAAIKRYETDDLKLYLTGDLIVREKILNYMADDFKLLGPLATLVVILSLYFI
FT                   VKNVLGAILPVLIATFALIWTFGIKSIVMSPITVPETTMVVLLISIGCANAVHIINGIL
FT                   KRIKNEPFTEKTIITTIKTLRTPIILTSLTTAFGFLSLISSSIQAYKTMGIFMSTGVII
FT                   AMLMSLLVLPGILTYIPFKYKNKENKNAKNDFLEKLSLINQTVTQWILNNKYLSSIITL
FT                   IILLTSIIGLFKIEINFDEKDYFKENTSVKQTLNLMQKEIGGTSIIKIEINGTTGEFKN
FT                   EKNMKNLDLITDNLDKFTEKTQSSSINGIIRLMNFKFKKENPKEYRLPENQAILNKLIL
FT                   LISRSNSIKNMTKMYINDDWSQISIIVRTDQNSTEEIKNFANYASNLIEEYMPGHEYNF
FT                   SGAYDKILISKTMVVEQVTNIITTLSAITILLMLFFKSIKTGIIIVIPVAWSVFLNFAV
FT                   MKLFGITLNPATATIASVSMGIGVDYSIHFFNAFILNYQTTKDYKKALIKSIPNVFNGI
FT                   FANSISVGIGFLTLIFSTYKIIATLGAIIAFTMLTTSLASLTLLPLLIYLFKPTVKTLK
FT                   TTNEILTE"
FT   gene            complement(262619..265066)
FT                   /locus_tag="BT0253"
FT   CDS_pept        complement(262619..265066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0253"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:BT0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17590"
FT                   /db_xref="GOA:A1QZ48"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ48"
FT                   /protein_id="AAX17590.1"
FT                   /translation="MKLKEIKYSMEEVKNTVSKGKKRSKNSGGILPHFDKPVRVPLIAV
FT                   PSHPVFPGMFIPIVIVSDTDMKAVDYVIKGNGIISLFVLRDKFLEKSRTKNDKLIINYK
FT                   KDIYSVGITAKIVKKINLPDGGYNIFVSTIDRVKFVKVVLNEDFPIIEVDYLKQIPIKK
FT                   DDVQSKAIYSSILLRTKEIFSHRKMPEFQLNMVNIEDKGRLCDVVAGMISSSKDAHQEV
FT                   LETLSVKDRLKKVLELIYEELNLIEIQNKIAKGIQEKLEKQQKEFFLKEQLKAIKAELG
FT                   VGDEKSNEFLKLKAKIDSLALKGEALEAVERELEKFSFLEKHSSEYIVVRNYLELITNL
FT                   PWGESKVNFDKFNLQRAEKILDKTHYGMREVKDRIIEYISVLKLRKSQKGAIMLLVGPP
FT                   GVGKTSIGTAIAEVLKTKFFRFSVGGMKDESEIKGHRRTYVGALPGKIIQGLRITKTNS
FT                   PVFLIDEIDKVSASNYGDPFSALLEVLDPEQNINFRDHYLDLPFDISNVFFILTANSLE
FT                   TIPTPLLNRMEIIQLSGYVDDEKIEIARKYLIPKVLNENGVNKDSLKFQGSALVQIARE
FT                   YARDNGLRNFEKYLKQIVRKVARKLIEDKSVKAYQISKENLEEYIGIPVFRKEEFLHKV
FT                   MSPGMVMGLAWTNYGGSTLVIETVKTESKSPGIKLTGRLGDVMKESANIAFTYVNSISN
FT                   ELKLNKSFFEKYMIHLHIPEGAIPKDGPSAGITIASAFISLALNKVVRPHLAMTGELSL
FT                   TGNVMAIGGLRAKIIAAKRSGLEHIIIPKSNKVDLDDIPINIKNGINFHLVDNMREVIK
FT                   LLF"
FT   gene            265134..265820
FT                   /locus_tag="BT0253A"
FT   CDS_pept        265134..265820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0253A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0253A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17591"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ49"
FT                   /protein_id="AAX17591.1"
FT                   /translation="MQFNKVNAIITNLYHKKSYSLLNLFHSKGIIHTIIYNSTIKKFKS
FT                   NINNLVKANFEIVKEKNLCKIIEVNDEEFIMQDLIYEKLIIIYLWIKLINLSFDDGECF
FT                   KLFIEATEILNTTSLEKAQLIDLQYKTRFLIIKGFLYLSKLCFQCNKQIDKHYYYDIHI
FT                   NGFNCIKCTNNQNNYINTGSFKYLEYTTQKNIKETLNVNLISKSKELIKIMIKNKINTE
FT                   FEQTLL"
FT   gene            265843..267957
FT                   /locus_tag="BT0254"
FT   CDS_pept        265843..267957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0254"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17592"
FT                   /db_xref="GOA:A1QZ50"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ50"
FT                   /protein_id="AAX17592.1"
FT                   /translation="MKIWEKKEIDIKKENIINIAKKYNISILEATLLLRREIKEEDFLF
FT                   FIESSVNLMHNPFLLKNINKFIYRMNEAIAEKENVLIFGDKDADGITATIIMYETLKDF
FT                   GINVTYKIPSNGEFYGLTKEIIDKALEDKISIIITVDCGISNIEEANYARSKNIEVIIT
FT                   DHHLPNKEIDIENIIIDPHLKGDLSPFKEIAGCYVSFKACLALYLSTTNLYNKNMVFLF
FT                   LERLNNNITLHAIEINNYILKKYITLESNNDLQININKLEEFSQSKYIIVFNKDEQNQL
FT                   LNEFFNHKIDIETIDISENFVKKYPKFAKKTLKELMQITKYFKYREINIKEKLYYIFYN
FT                   IIFAINKDLLKNCLKRLKFVAIGTIADNMPIINENRIVVREGLKEIALRENISINYLLK
FT                   EANILTKPMITATDIAFKIAPILNSTGRLEKADITIQFLLTEDINQIENKFKEIKNINI
FT                   LRKRKEDISWNTHNENIIFKNDKFIVCYDKHTPKGISSRMATRLSTYYQKVAVFLTRQE
FT                   NIIKGSIRSNNKVNSKELISMIPNHLIINSGGHKAAAGFTLYESVLNEFIKELENALEK
FT                   IEYKELYEDSILIDAIIPKDFNKKELLKIINLFEPYGHGFREFVFMMENVYIQDLRTID
FT                   KNGNSKHISMKIKNNKDYYKAIYFNGTQNIQKLGIKDGQNIDIICTISEDLYNQNDKIL
FT                   KIIDIKKRQN"
FT   gene            267957..268895
FT                   /locus_tag="BT0255"
FT   CDS_pept        267957..268895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0255"
FT                   /product="cell wall endopeptidase, family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:BT0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17593"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ51"
FT                   /protein_id="AAX17593.1"
FT                   /translation="MINIKSLLFTFITGLLNINAVSNDTIKSYYKKETFQGDNIYFASN
FT                   KNFKKLSLLGTNQKPILSASPFKFNAGNREYHIALIGITPMIKEGKRKIKIEFEHKTYI
FT                   KEIEIKKLKFKKTTVKLNKNKSKLIKSQQSPKEKKQALTLWNIIGNIGDTTIYHYDTLV
FT                   YPIKDQYKITSPYGDQRIYMQDKKKISSHKMHNGKDYAPLKREKTPIFAAGRGKVVFAR
FT                   DREITGKTVIIQHLPGVFTIYLHLSKFGVKENTIVNTGEYIGHVGNTGISTGPHLHFEV
FT                   RINGVAVNPDFFLEQMLIDKNQIINNTKRIE"
FT   gene            268906..269124
FT                   /locus_tag="BT0256"
FT   CDS_pept        268906..269124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0256"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17594"
FT                   /db_xref="GOA:A1QZ52"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ52"
FT                   /protein_id="AAX17594.1"
FT                   /translation="MIFLITVNVDKNEGLEKALKRFKRMIEKEAIIREWKRREYYEKPS
FT                   TIRVKKEKAFKRKQAKKVRKLKQKIGK"
FT   gene            complement(269164..271506)
FT                   /locus_tag="BT0257"
FT   CDS_pept        complement(269164..271506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0257"
FT                   /product="cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:BT0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17595"
FT                   /db_xref="GOA:A1QZ53"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ53"
FT                   /protein_id="AAX17595.1"
FT                   /translation="MKNFYHYFHFLFFFMLAVISFSLFVALTPVGNIFIFFVFNLIGHM
FT                   LLNTFSFLSFYLILYPLVNWYAYRNNIFSKKFVFNWNYTVILFFTLTFWLRINSDLEGS
FT                   NFINWFLSNFGIMLGNFFVFLILILELVIWIYLNYVLFKDASFVLNTFHFIVFKLKILF
FT                   ESMFAFLPFLNTLKIKKNIKVYKDCDGNLDAAKTSDKGDNIINDEEYQALWSFKAFLRK
FT                   PNKPLDVNLDKTIFCQSEVSDDNLSEEQSFQDSQCDLNVTDDSKYKALTEFEDNKLVSS
FT                   GKIKVGDIRHKGIISNLVKIDYGNLLVGEGSDNYLIDISVFDQREPKSETEDIEYDREI
FT                   QKQSMILQETFKEFNINAKLIDVIKGPVVTMYAVRPDKGIKLSRITSISDNIALRLAAV
FT                   RVRIIAPIPGKEAVGIEIPNKRREFILISEIINSKEFQSDFKVPFALGKEINGSNVVFD
FT                   LINAPHLLIAGATGAGKSVCVNSLIASIIFSKSPDDVKLVLIDPKVVELKLFNDIPHLL
FT                   TPVITDVNRALEALRWCLDEMERRYVLLDNFLVRDINAYNKKILEEGLNEAPLPYLVII
FT                   IDEFADLILSARKDLENLISRLAAMARAVGMHLVLATQRPSVDVITGVIKANFPSRISF
FT                   MVASSMDSRIILGASGAEKLLGKGDMLYVNPTTPFPQRIQGGFLNEKEVYRLVEEVKKF
FT                   GTPNYIDDEIFIDSIVGADTVVLNPSDEPMFEEALEIIRSTKKASASYLQRRLKIGYNR
FT                   AARIIELMEEMGYIGPVNGSKPRDVFI"
FT   gene            complement(271520..272317)
FT                   /locus_tag="BT0258"
FT   CDS_pept        complement(271520..272317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0258"
FT                   /product="bacitracin resistance protein"
FT                   /EC_number="2.7.1.66"
FT                   /note="putative undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17596"
FT                   /db_xref="GOA:A1QZ54"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ54"
FT                   /protein_id="AAX17596.1"
FT                   /translation="MMENVLRVMILGFVQGISEFLPISSSGHLLLLKKFMHIDLPMVFD
FT                   IYLHFATVLVVVIYYRKRILELVVVLVKFVLRKTTKLDFVKLRLILLISIITLITAFVG
FT                   IFIENFKELFTLDLVLVNFILTSILLFLLEFKILIFDFKKNILFAGCLIGTMQGIGAMP
FT                   GISRSGITIFASVLLGFSRSESFEISFLSLIPIVFGSLLLKYKELFESDMLFSVFEINL
FT                   GAIIAFMVGLFSISLFVKMLKDSKLYYFSVYLIILVSLVYFLF"
FT   gene            complement(272330..274522)
FT                   /locus_tag="BT0259"
FT   CDS_pept        complement(272330..274522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0259"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17597"
FT                   /db_xref="GOA:A1QZ55"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ55"
FT                   /protein_id="AAX17597.1"
FT                   /translation="MQFMIVLFIKKKKLLNVKTVIMFKQIICLFLLSLFSCSFGKGSLN
FT                   SNIVKRNVDNFDLSHLNWLWNFDYAGKNFDEYFGIDSNSYVYIAYLFKKIGYDEKFKEY
FT                   MYKAIKSSNDIASQFAGIKLLEYYNARREYFEAELVGRKLYKRYDNNKFIILGYFKSLY
FT                   WQKKNDEALLVLNKLEKMNFAQSQENENLLFKAVLYFNASDINSSLIYFSKLFEDLPAE
FT                   YLHVRAHDYLVLEERSNLLSSVFFNLVKFKSLVANGDLKGAISILNDDFKKYYNNFVFL
FT                   NDVYKAFLGSGYISKALSFFSSLNSVYKDYYLGLINLRLKKDVGFFTIVKYLENASLEN
FT                   EPYRLEILNEIFGNLIFLQNTRNYFAQNVARFYTDKDRNNLGFIKILDEYILEAVQLKD
FT                   YDNLYALYHNGQNIIDGAVLSRLAFINARLIYHKFIASKSRNEYDELLRSSIKYNRISY
FT                   ASFMSKYLLNQSINDFFENDLNIHYDQSDYERFLEGFLKFNLHSYVSAFVASDFNNGYR
FT                   FSPNFYRNLYDELVRHEYYYESTLAINYLVKQDNSALSRDDYKRLYPCLYNDLIRYWSK
FT                   RRKLEPSLVFSLIKAESSFKGNAVSKPGAIGLMQIMPLTSVDVSREIKYYDYDLKQPKD
FT                   NVIIGTYYLSKRIKMIGEVYKALASYNGGIGNVRKWERDYGHLPKEFFIEAIPFGQTRN
FT                   YVKKILVYCVLYDALYESKGMDFIIEYIMGEFPKSF"
FT   gene            complement(274452..275735)
FT                   /locus_tag="BT0260"
FT   CDS_pept        complement(274452..275735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17598"
FT                   /db_xref="GOA:A1QZ56"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ56"
FT                   /protein_id="AAX17598.1"
FT                   /translation="MNIVLIILYYCYSLIIYKFVFYKRTKRLEFLKGFLAIRLSNDEYF
FT                   SILSLDDTAVKRVVLGKIADEPNVKLDFYISEHDDFSNSVIIGSFFLDNLRKESANINV
FT                   YFKIDSMMLYVYGECDGIANKSKFDLSLINLAVDSEEINDLESAKSSDLPVGFSGVERE
FT                   EEFVKEFGSVAGQYDSLDGDLDNFNDLPNSQNLSADEKLFSNENNFNLLSDSLNSDNGT
FT                   LVSENLDSDSDLNLENFDFGLTGDGFENNIDEGNDLEEHVLNDKDTVSRDDFDLDNISV
FT                   DISDSSAASDNSAANAVKLVEDKDTDFKSVNVYTLQDSYSDNWDVEDIITDLDNGLGES
FT                   EFDDVALDFSKEDFATDIEESRLDLDSEEGLIQTSMLYLSLISLFLLIFFSLFLIFSKV
FT                   LNPRNFAIYDCPFYKEEKITKCENSNYV"
FT   gene            275835..277205
FT                   /locus_tag="BT0261"
FT   CDS_pept        275835..277205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0261"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17599"
FT                   /db_xref="GOA:A1QZ57"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ57"
FT                   /protein_id="AAX17599.1"
FT                   /translation="MLPLFIILSSAAISLLIFLFFKIAISNTKIRKKGKHNKTKKLTDK
FT                   AANILKTNPNEISALQTLNDYYYSNKDFENGIKYAKKLCQLIEENPTNQRIDSFKAFLS
FT                   YGFYNLERNFNSEALVFLKKAYIMKKTDVDANYYLGIAFLRNAHYKEALHYLTKIYKFD
FT                   KNNKDALKYIGITLFHMENYTKAVGIFNSISKYIQNDVNALLAYAQSLSQLNQDRLAFS
FT                   IANKIRNKDGRIYEALLIESEINSKNNNLTKLEDNIREMMKIKPDLPTKTFLKLFYKLG
FT                   ELYIEHENYKKATEAFTRVERIDPHYQKITEKLEFSKRLNENLALRIYLRSPKEKFDNL
FT                   ANAIILKLYKNKFQVRDKKINEITSQFIDINFQLSNNQWEENLIVRFVRTDQKNFGELF
FT                   LKDLIAKTKESKLKGLCIAPATFSDKAKQIIEGRLIDLIEGKKLIQILKTLDISKYV"
FT   gene            complement(277207..278472)
FT                   /locus_tag="BT0262"
FT   CDS_pept        complement(277207..278472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0262"
FT                   /product="cell wall endopeptidase, family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:BT0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17600"
FT                   /db_xref="GOA:A1QZ58"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ58"
FT                   /protein_id="AAX17600.1"
FT                   /translation="MSHIMIIPKKDQNVLKRNRNFLFDRAIKGDFELRDFGNIRNFHRK
FT                   KRKKFFRFMNIPNKLLDVIKLLFLTLFGRMVIIDNYKYRSSYNKIRLKMINDYDINLTY
FT                   IFIFRFNAIIFVLVLVFYLNIFSYYGSYIFLSRLSFPKDYFIDTFLYYSDQDLSQINNH
FT                   LFGVDTNSYEATVRKPFVLKVVKHKINPGETLSHIAARYSITSETLISYNDIKDVRSIR
FT                   PNFVINVPNMKGVLYTVEKSDSLSSIAKKYKIPKVDILDANNLDNEVLYLGQKLFIPGG
FT                   KMAKELLRNALGETFLFPTQGVITSGYGYRPDPFTKIISFHNGIDIANVANTPIFATKE
FT                   GIVVTAGFSVGGYGKYIIISHNNGFQTLYAHLGSFAVKVGQRVSRGQIIGRMGSTGYST
FT                   GNHLHFTIFKDGKTGNPMKYLR"
FT   gene            278525..279028
FT                   /locus_tag="BT0263"
FT   CDS_pept        278525..279028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0263"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:BT0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17601"
FT                   /db_xref="GOA:A1QZ59"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ59"
FT                   /protein_id="AAX17601.1"
FT                   /translation="MIKTHKQVLIPIILALLLMIAIIKISLSFHLVKGSSMSPKILEKH
FT                   WIINNKLAYGIRLKNSKTYIILWGLPKKNEMVLIKDPITKKISIKKIFAIPGEKFIKLK
FT                   QNVISIHNLNFNIDKEHLKILENIYIPKDYYLVVGENKKVSLDSREYGFININDIIGKI
FT                   IYCL"
FT   gene            complement(279074..280585)
FT                   /locus_tag="BT0264"
FT   CDS_pept        complement(279074..280585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0264"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:BT0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17602"
FT                   /db_xref="GOA:A1QZ60"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ60"
FT                   /protein_id="AAX17602.1"
FT                   /translation="MMEKWIGIDLGTTNTVASYFDANSRVILNDRGERMTPSIVSFTDS
FT                   GIIVGSIARHQILVNPDKTFYNFKVDIGTEVSYEVGNNTYRAEDIASYLLLNVKMNAEK
FT                   FLGTEICDVVITVPAYFSEIQRRGVVEAASLAGLKCRAILNEPTAAALSYAFEKQIDGL
FT                   FLVYDLGGGTFDVTLLEKQNDTYTVLAIKGENKLGGNNFNEVIERHVLTSFEEEYPDID
FT                   LDDIVILEQIRDKIEEAKKSLSIMDEVSIVLPFLDGKHLNYKLKRNDFNSMIKEFIEKT
FT                   ISLTNECIADSGVDLERISKIILSGGSTRIPLVKERLKEIFPKIEVLDSLNQDEVVANG
FT                   AGIHACSLSNNSTLIDFKDVTPYSLGIETCNDGFFTLIKRNTLLPVCERKIFTTTNDYQ
FT                   EEIEIHVLQGEYKKASLNYSIGRFFFSNIQKALRGMPKIEILFSLDESGILSISAKDLD
FT                   THVSKSIQIRMTSSSFDSGFENEGVLASLEDMRSSRVLEDSIELT"
FT   gene            complement(280582..281079)
FT                   /locus_tag="BT0265"
FT   CDS_pept        complement(280582..281079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17603"
FT                   /db_xref="GOA:A1QZ61"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ61"
FT                   /protein_id="AAX17603.1"
FT                   /translation="MFVVFCFILIIFIFIYFHIYISLKIKSNSILRKFRSEVDKTIIEI
FT                   NQATDRNINIIEIKIESLNRIIKEVDERIEILDQRLLGFNAHSISMGSNNFSMKGDSSV
FT                   YKSNLDYSIPTIEKNIIKEGYNIRQQVISLYEQGMSLEVIAKKLKLDLGEIELIVSIHR
FT                   GT"
FT   gene            complement(281101..281412)
FT                   /locus_tag="BT0266"
FT   CDS_pept        complement(281101..281412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17604"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ62"
FT                   /protein_id="AAX17604.1"
FT                   /translation="MDINGSSEVVKIITQGAFKASEISNEDLRKKKIRENKNLSLNQSK
FT                   SYHVDSEINSIYPADESMDGNVNFITMSKIKTAKRNSPGIYDINFHDPKIGRNIDIER"
FT   gene            complement(281437..283335)
FT                   /locus_tag="BT0267"
FT   CDS_pept        complement(281437..283335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17605"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ63"
FT                   /protein_id="AAX17605.1"
FT                   /translation="MATISDFADFRNRIKNYLERENRINLIEVESDTLEEALNDASLEL
FT                   SVPYKDLNYEVLVRGNNGLFGYGKKNWKIVAYKNSYSKFGVTDVLSSQSEFEEVASLDG
FT                   KFFIRRTAKGVFLKVTPAQGDGSVVKFKDVMDKFASYSNIKDLDENFVRSVIEDANGKY
FT                   EQVSVFEADLVESVTMMVHISEDSMSVTVEFTVPGPNGAEVLEKDIYSILKKYGVSDRA
FT                   LLKNKIKEFVDYPFYGEPVEMARGVNPVKGRDAYINFIAKSKSSGEYGAVGNEFRNVNR
FT                   GDELAEIIPLSEGIEGYTVFGKILRAEHGRELDLILGDNTFMEGNKIIAGCDGYISISN
FT                   GIISVHDVYVVEGDVGPGTGNIVNNGMVLVKGSVLDGYNVMAKSGIEVNGLVGRCNLRT
FT                   DGSIVLRSGANGKGGSEIYAKKSIKSKFLENVNVRCEGNIEVVRGIVNSFVSCTKKVLC
FT                   IGKKSKIVGSDVRAREEVRAYSIGSEGNAETSICVGCDPEIKVLLSRFTEYLVKIEKRL
FT                   EVLTKDISALKKNIQLTVDKAEKSLKIDSCNELINERDILILEIKMVKDKQESLQDALE
FT                   DSKIDGKIFVEYIAYTGVKLHIKDAYYELPRDYNNITFVEDDNIIKMLAYVPFKSK"
FT   gene            complement(283338..283823)
FT                   /locus_tag="BT0268"
FT   CDS_pept        complement(283338..283823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17606"
FT                   /db_xref="GOA:A1QZ64"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ64"
FT                   /protein_id="AAX17606.1"
FT                   /translation="MLFTKRRKYVLLFSAFAFVLAVILGIFARVPFITVLFRAVFQFIV
FT                   FFCIGLLLEFIYKKYLYDLFKDDSLSNDTRKKDIDENSNCKPETDDKNSFSKNIHLDNN
FT                   KSGDNDNYSLSDKLSKYDTVAKESKLSSKLLDQISHVENTDPKIVAETIKSLINKKE"
FT   gene            complement(283829..284719)
FT                   /locus_tag="BT0269"
FT   CDS_pept        complement(283829..284719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0269"
FT                   /product="flagellar synthesis regulator FleN"
FT                   /db_xref="EnsemblGenomes-Gn:BT0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17607"
FT                   /db_xref="GOA:A1QZ65"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ65"
FT                   /protein_id="AAX17607.1"
FT                   /translation="MIEDQAQSLRDIMRLNNRASFVVDDKIQNNRTRFIAVTSGKGGVG
FT                   KSNIAVGLALKYANLGKKVLVFDADIGMANINILLGVIPKYSIYHMIMQGRGIKDVITK
FT                   TEYNIDLLAGASGTTELLDLSETEMNQFIKELLKVYEYDIVIIDTSAGISRQVISFLFS
FT                   SDDVVIVTTPEPTSITDAYGIIKVLSHKMENLKNLRLVVNRVANVSEGKGVAKKVIDIS
FT                   SQFLNLNIDYLGYVYEDQNIRNSVFKQRPFILLNPNSKASYCLDSIVAALEEITLDNKK
FT                   RRGVIGFISKFFGME"
FT   gene            complement(284729..285910)
FT                   /locus_tag="BT0270"
FT   CDS_pept        complement(284729..285910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0270"
FT                   /product="flagellar biosynthesis protein FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:BT0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17608"
FT                   /db_xref="GOA:A1QZ66"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ66"
FT                   /protein_id="AAX17608.1"
FT                   /translation="MKSSIMVQYFTERGPTYNEVIETVKKKYGKNARVMTYKTIAHGGI
FT                   FGLFSRDWIEVSGYVRYDIGQQQINVEEEKRKILQSIKKEESSSIEDVIKEVKSLKNEL
FT                   AHKKEEINHPTILKIEDILRSNDFSESYIRDINDFIKREFSLSDLDDYDKVRDSVIIYI
FT                   AKTIKCSGSIIDNLKKRIFILVGPTGVGKTTTIAKLAAIYGINSDDKSLNIKIITIDNY
FT                   RIGAKKQIQTYGDIMGIPVKAIESFKDLKEEITQSKDFDLVLIDTIGKSPKDFMKLAEM
FT                   KELLNACGRDAEFHLAVSSTTKTADIKEIFHQFSPFSYKTVIFTKLDETTCVGNLISLI
FT                   HEMRKEVSYVTDGQIVPHNISIAEPLTFIKKINGYRISDDIEFIRKLKGKSYY"
FT   gene            complement(285900..287990)
FT                   /locus_tag="BT0271"
FT   CDS_pept        complement(285900..287990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0271"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17609"
FT                   /db_xref="GOA:A1QZ67"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ67"
FT                   /protein_id="AAX17609.1"
FT                   /translation="MLDARKNSVLVYFGLNNKADLVVSVGLILVVASFILPLPAFILDA
FT                   LIAVNLVISLLVMLIVLYSKRSLDFSVFPTLLLVMTIFGLVLNISSTRLILIKGISFDG
FT                   QMIRAFGTFVVGSSGTQGLFVGFIIFLIIIAVQFIVITKGSTRVAEVAARFALDALPGK
FT                   QMAIDSAYSSGNLTEEEATRQKNDLQAEVNFYGAMDGASKFVSGNVKVGFLITLINILG
FT                   GLIIGVTLQGLSFSDAVNNYVSLTVGDGLVSQLPALLISTATGLIVTRSISKNSFGVEI
FT                   IEQFTSYSGIYWIVSGFLLFLAFLPGFPTLILILLGMLIAFLAYSLSNLDRNRELHEKQ
FT                   KAEEQILSYADKEIAPVVPLDPLALEIGYNLVPIVDDSKTSELLDRIVKIRREIALELG
FT                   IVVPKIRIVDNMRLEPNEYSFKLRGVEIGHGEIKLGKFLVINVGSDSGIEGDLTKDPSF
FT                   GLPSLWVNDNGREIAEKLGYTVVDPPSIIATHMTELIKRHACEILTRQDVQNILDIFKK
FT                   DYGAIVEEVLKDFSVGEIQRVLQGLLKEQVSIRNLVTIFETIADFTSITKDTFFLIEKC
FT                   RQAIGRQIVSGYLNSNLELNVITINPEFEQKIIDSRFETNNDLISSLDPNLKTKFIYEL
FT                   FRLVNEVQSQGYYPVILSSESARPVIRVLTSRELPDIVVISVLEVPKNVKVNVLKTVEV
FT                   EE"
FT   gene            complement(287999..289120)
FT                   /locus_tag="BT0272"
FT   CDS_pept        complement(287999..289120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0272"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:BT0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17610"
FT                   /db_xref="GOA:A1QZ68"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ68"
FT                   /protein_id="AAX17610.1"
FT                   /translation="MNTRNEFLSKNWYIPLNFFASEDEGRTELPTEQKKQKAREEGQVL
FT                   KSTEINMAVTLCILFAVFFFMLSYFAYELMDVFRWQAGKLPEIMSISIYSLGFAYIRSM
FT                   LGYVIVFLLISFIVVFLINVVQVGFLITFKPIVPKWDRVNPNFSKWIKNSFGSFDAFFN
FT                   LFKSLSKIAIISFIYYIMLRSNIGKISRMFEYSLEDGISVILSLAYRICFFSVIVLMGI
FT                   SILDYLFQRTRYIENLKMTKEEVKQERKEMEGDPLLRSRMRERMREILNANLKVTVPQA
FT                   DVVITNPEHFAVAIKWDSNTMLAPRVLAKGQDEIAFVIKQIARENNIPVMENKPLARDL
FT                   YANVDVNEEIPREYWEIVSKILVKVYSIAKKFN"
FT   gene            complement(289117..289905)
FT                   /locus_tag="BT0273"
FT   CDS_pept        complement(289117..289905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0273"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:BT0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17611"
FT                   /db_xref="GOA:A1QZ69"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ69"
FT                   /protein_id="AAX17611.1"
FT                   /translation="MNMNFLVLKSFVILPVFVRIFLFLRFSPFFATIRMSYLNFFFALI
FT                   LSIIVVDKINVVYPLDNLIAFTLILAGEAILGLIQAFFVSIIFSVFHLLGFFFSNQMGL
FT                   AYANIFDVFAEEDNLVISQIFTCLFLLLFLSNNVLLRFFMIGVHDSVLNVRVENMVNIK
FT                   NYEFIELMFYSFVILFEKALIISLPILGVLLLLYLILGILSKTAPQINLLMISFAVSLG
FT                   LGLIILYIGFPSLVMSVKRVIELALESMRNALNLFSETLK"
FT   gene            complement(289921..290184)
FT                   /locus_tag="BT0274"
FT   CDS_pept        complement(289921..290184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0274"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:BT0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17612"
FT                   /db_xref="GOA:A1QZ70"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ70"
FT                   /protein_id="AAX17612.1"
FT                   /translation="MTTGQIIYLIRISIENIIILSAPMLITALIVGLLISIFQAVTSIQ
FT                   DQTLSFIPKIIIILLTLVIFGPWILKKLMLFAFMVFSQIQNI"
FT   gene            complement(290194..290964)
FT                   /locus_tag="BT0275"
FT   CDS_pept        complement(290194..290964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0275"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:BT0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17613"
FT                   /db_xref="GOA:A1QZ71"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ71"
FT                   /protein_id="AAX17613.1"
FT                   /translation="MNLSKKLSFFLFFGVINFAFAQTKSLQTTTGLNFPFVDLVNSVGG
FT                   GIIFPLQLLLILTIITLSPAFLVLMTSFLRIAIVLDFIRRALSLQQSPPNQVIMGLALF
FT                   LTLFTMWPTFNIIYKEAYLPLQDSKIGFNEFYDRGIAPLRNFMYKQMSNSKHEEIRLFM
FT                   SISNYPRPKNFSEVPTHVLIASFVLHELKVAFKMGILIFLPFIVIDIIVAAVLMAMGMI
FT                   MLPPVMISLPFKLMLFVMVDGWTLITSGLVKSFM"
FT   gene            complement(290968..291612)
FT                   /locus_tag="BT0276"
FT   CDS_pept        complement(290968..291612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0276"
FT                   /product="flagellar biosynthetic protein FliZ"
FT                   /db_xref="EnsemblGenomes-Gn:BT0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17614"
FT                   /db_xref="GOA:A1QZ72"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ72"
FT                   /protein_id="AAX17614.1"
FT                   /translation="MSRLTLFKFVFLIIFIFFFKNLFAQENGVDLDISSSSLENEVNLP
FT                   IFEGDKANLNNKDIQNISLFNISDLVTIFLFFLFFLICIFLFKKMILNHKKVKNSYKSN
FT                   FIRELAFYEIDNKNSVRVINILGNVYVFLVSSNSSILLREIKQGEELDNLKFELDKAKS
FT                   LSDITSFKSIFNKILRKNKKDELSFDKTEYAALENDIETSLKSKQDRLKKF"
FT   gene            complement(291605..291949)
FT                   /locus_tag="BT0277"
FT   CDS_pept        complement(291605..291949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0277"
FT                   /product="flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:BT0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17615"
FT                   /db_xref="GOA:A1QZ73"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ73"
FT                   /protein_id="AAX17615.1"
FT                   /translation="MAIDDKSDIGEEKPEIKGVKLPDLIDTLPEGVDPSNFGLLMDVSM
FT                   QVTVELGRTERKIKDILGMSEGTIITLDKLAGEPVDILVNGKVIAKGEVVVIDENFGVR
FT                   ITEIIKIKNE"
FT   gene            complement(291999..293057)
FT                   /locus_tag="BT0278"
FT   CDS_pept        complement(291999..293057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0278"
FT                   /product="flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:BT0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17616"
FT                   /db_xref="GOA:A1QZ74"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ74"
FT                   /protein_id="AAX17616.1"
FT                   /translation="MAGNPGALSQDDIDSLLESINSSDNLSSDDSLSNIISSPMGKKQK
FT                   IKVYDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFI
FT                   RSIPNPTTLAIINMDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTIKDKSRDLTEIEQSV
FT                   MESVIIRILANMREAWSQVVDLRPRFGHIEVNPQFAQIVPPTEMVILVTLEVKIGKVEG
FT                   LMNFCLPYITIEPIVSKLSTRYWHSLIGVGTTSENLDILREKLENTDMLLVAEIGEVKL
FT                   KVREILSLAKGDVLNLENSPIDKDLILKVGTKQKFKCRMGLVGNKISVQVTEKVGEVED
FT                   FDLLKELTEEVE"
FT   gene            complement(293077..293610)
FT                   /locus_tag="BT0279"
FT   CDS_pept        complement(293077..293610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0279"
FT                   /product="flagellar protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:BT0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17617"
FT                   /db_xref="GOA:A1QZ75"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ75"
FT                   /protein_id="AAX17617.1"
FT                   /translation="MPERDDGSIDVGGADSKRMGLLPDVIIKILQILAIGLFTVVIMII
FT                   VAYFVSKMVVSQSGAPNNFPIFSNEYLGKPPMLIWYESIDEIRGTTQDTPPKTFVIKLA
FT                   LGYAENNVNILSELGRQKVRLKDIIREYFSQRTGQEIKNESQIKAEIKARINSILRNGE
FT                   IKEIALTQIDIFDM"
FT   gene            complement(293652..294440)
FT                   /locus_tag="BT0280"
FT   CDS_pept        complement(293652..294440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0280"
FT                   /product="chemotaxis MotB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17618"
FT                   /db_xref="GOA:A1QZ76"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ76"
FT                   /protein_id="AAX17618.1"
FT                   /translation="MMSLRDRKKRSKCAEGTPEYMLTYGDMVTLLLVFFVTMFSLNDII
FT                   LKENVLKIMSASFTGSGFFKGGKTLDINKLSYLSNSFMSLPSTEKNKQASQASKNKSII
FT                   EFIEKIQSNRVIVRHYERGVVVSLLADAFFDSASAEVKLDDNRETIQKIASFIGFLDNQ
FT                   GYNFKIEGHTDNVDVNINGIWKSNWELSSARAVNMLEQILNYTDQSKIQSIESKFEVSG
FT                   FAGSRPVATDDTPEGRAYNRRIDILITSDASLSSTKGINH"
FT   gene            complement(294437..295222)
FT                   /locus_tag="BT0281"
FT   CDS_pept        complement(294437..295222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0281"
FT                   /product="chemotaxis MotA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17619"
FT                   /db_xref="GOA:A1QZ77"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ77"
FT                   /protein_id="AAX17619.1"
FT                   /translation="MNLASIVGWGVGFGAILISMAFTPTGLGVFWDLSSVFITVVGSFS
FT                   ALVASSEIPTVKRIPTYLGLFFKKSSFGKVFIIKTLVELSEKARKEGLLSLDDELDQIN
FT                   DPFFKSGMRLVVDGADPEIIRTMLYLELDQMQERHKIGADLFGTWAKLAPAFGMTGTLI
FT                   GLIALLGNLEDRSALGSSMAVALITTLYGTIMANLMLLPIQIKLESIDIEEASVKTMIV
FT                   EGILSIQAGDNPRILEQKLVTFLTPKDRSQLGSGILGGE"
FT   gene            complement(295219..295440)
FT                   /locus_tag="BT0282"
FT   CDS_pept        complement(295219..295440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0282"
FT                   /product="motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17620"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ78"
FT                   /protein_id="AAX17620.1"
FT                   /translation="MIYVTKLNGDGYYLNPCHIESIEANPDTTILLMNGKKLIVKEDVV
FT                   EVVDKIKMCRREIALLDRIIQENKGVEL"
FT   gene            complement(295458..296786)
FT                   /locus_tag="BT0283"
FT   CDS_pept        complement(295458..296786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0283"
FT                   /product="flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:BT0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17621"
FT                   /db_xref="GOA:A1QZ79"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ79"
FT                   /protein_id="AAX17621.1"
FT                   /translation="MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMI
FT                   SQSISGASRPTDGRGGVNPKQVGLGMSVATIDTIHTQGSFQSTQKASDLGISGNGFFIL
FT                   RDGNNSFYTRAGAFDVDSNRCLVNPANGMRIQGWMAKSIGGEQVINTSADVEDLVIPIG
FT                   DKESAKATEHITFACNLDKRLPIIEEGASEVDVARGTWVVNKTIYDSFGNTSVVELRVV
FT                   KDTTTPNLWNATVLVNGETNSNFTIGFNNEGALLSLNGQAGQPGDLLEFPITFGVVNAN
FT                   AGEVGEQQTINLRLGNVGSYTDSITQFADASTTKAIIQDGYGMGYMENYEIDQNGIIMG
FT                   VYSNGIRRDIGKIALASFVNPGGLAKVGDTNFSETSNSGQARIGETGLAGLGTIRAGVL
FT                   EMANVDLAEQFTDMIVTQRGFQANAKTITTSDQLLQELVRLKN"
FT   gene            complement(296791..297225)
FT                   /locus_tag="BT0284"
FT   CDS_pept        complement(296791..297225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0284"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /db_xref="EnsemblGenomes-Gn:BT0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17622"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ80"
FT                   /protein_id="AAX17622.1"
FT                   /translation="MGRVDYIDNLVGIGRAKEISNSKVQRGVKGNNLGRDDFLKLLITQ
FT                   LKYQDPTDPMKDKEFIAQMAQFSALEQMTNMSKSFESLSSVLGINKDLDLLGKIVEFEH
FT                   VDGEIIKGKVTNIKTGIVPQIMIDGKYYVYNNILSVGLEE"
FT   gene            complement(297238..298407)
FT                   /locus_tag="BT0285"
FT   CDS_pept        complement(297238..298407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0285"
FT                   /product="flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17623"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ81"
FT                   /protein_id="AAX17623.1"
FT                   /translation="MDNVSKIIVSLPSLNKDFNFVNVGGIFSQAKKGVFSDLISSEIQN
FT                   LSKFRDSILDFLKFLKSNGLISKDFKNISLKKPFAFEKFSDNGFVSDLKSLIKKVNNLF
FT                   DFDSLKVLSESLSFDSELSDKIKILKNFEKVLSDLNILFDNVTSLFNFDVLSVDLNSNH
FT                   RDLNIVKREREKNVIGIDVKNFKKNDSVKEFFNSGFRFRLIDSENCVRKYGLKETFDGL
FT                   TESIGDLSSFNAKPVKGSFIGHIADNLMSEWNLKINHNIVNKAKIVLKSNDTGEIRLIL
FT                   KPKRLGSIRINLNLDSNNNLLGKIIVDNHNVRTLFEQNMYSISKMLNDNGFNTSLNLSL
FT                   AGSGSGFFSGNFEDDVESQSSSLNKNNIFKIEDNVEISGDLEKSINFIV"
FT   gene            complement(298411..299025)
FT                   /locus_tag="BT0286"
FT   CDS_pept        complement(298411..299025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0286"
FT                   /product="FlbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17624"
FT                   /db_xref="GOA:A1QZ82"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ82"
FT                   /protein_id="AAX17624.1"
FT                   /translation="MNDCLSFLLRFFLWLFLVIFFLVFSFFLVDLFGIYQTRDYLPVYI
FT                   RALLFKGDAQPPEYTHISLEEIRMIKEKEAIYIKGQQVEKLREELKKREDSLNKLEAEL
FT                   NQKQKDLDLKQKVIDDIVNKYKDEDANFAQAALYLINMPPKDAVKRLEELNDEIAISYM
FT                   RKVEDIAKKEGRASIVPYWLSLMDSKKAAVLIRKMSVSSLE"
FT   gene            complement(299022..299450)
FT                   /locus_tag="BT0287"
FT   CDS_pept        complement(299022..299450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0287"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17625"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ83"
FT                   /protein_id="AAX17625.1"
FT                   /translation="MNDLIFKKKIFEKILSIRTYDRKSSENALVNVNNKISKIEEFLEG
FT                   ISAGLNKLNNMDVFSKGNYLDYLTYRKGKELKKLEKLKHEYDKYHDIYLKKYGEEKKVD
FT                   ILIKTLNDTIIKEKVKSESLFLDEYVNYRICKKLGNNQ"
FT   gene            complement(299447..300757)
FT                   /locus_tag="BT0288"
FT   CDS_pept        complement(299447..300757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0288"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BT0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17626"
FT                   /db_xref="GOA:A1QZ84"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ84"
FT                   /protein_id="AAX17626.1"
FT                   /translation="MMDIFFEGYSKMLDDVEPISLIGKVRKIKGLLVESLGPKCGIGDL
FT                   CLIEQRSGKKIYAEVLGLNGSFVNLMAYEGFDGIEIGDQVCSLGKKLQINLSDELLGRV
FT                   IDSLGRPIDNKGQFFCNYYKELSFSNINPLSRGVFSEQIVTGVKVLDGFLPVAKGQRVG
FT                   IFSGAGVGKSTLLGMIAKNSKADVNVIAFIGERGRELNEFIKYDLGEECFKRSVLIVST
FT                   SDASPIARYKGAYTATLIAEYFRDCGMDVMLLFDSITRFANAKREISLSMGEPPATKGY
FT                   PPSVFVEIPILLERSGLNSKGSITGFYTVLVEGDDFTEPIADNMKAVLDGHIILDRDLS
FT                   DRGIYPSVNILSSTSRSLHRIVNFEKQKLISKIRNLLSIYKSYEDLIKTGIYIKGSNKE
FT                   VDLAVAKYPKIIDFLSQGIQEEFDFENLDSELREILA"
FT   gene            complement(300771..301697)
FT                   /locus_tag="BT0289"
FT   CDS_pept        complement(300771..301697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0289"
FT                   /product="flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:BT0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17627"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ85"
FT                   /protein_id="AAX17627.1"
FT                   /translation="MYLPKVLYKSKEVVNAVKLEFVEITNPIFKSLEIKRKENELCDID
FT                   SRSIKLRNELEDLMNQRAKLQEEIEREHEFAKKEIDAECSKILEEAKEQANKIVSFASE
FT                   RAEALQKEAENKKGAIEQESNLEIEKIVREHEERLKRELETEMARGRNEGYDAGFNKGR
FT                   EDCDKILGKLNSIISSLVAKRKEILESSGEHIMNLVMQIAVKVVKKIIDSQTGIVIENI
FT                   NEALKKVKSKTNIIIRVNLDDIDVVSHQKHEFISKFDFIKNLEVVEDVNIGKGGCIIET
FT                   DFGEIDARISSQLDRIEEKFKNFSSIF"
FT   gene            complement(301706..302752)
FT                   /locus_tag="BT0290"
FT   CDS_pept        complement(301706..302752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0290"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:BT0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17628"
FT                   /db_xref="GOA:A1QZ86"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ86"
FT                   /protein_id="AAX17628.1"
FT                   /translation="MIIYMEEQKEKEILGVSTLTGKQKAAILLVSIGSEISSKIFKYLS
FT                   QEEIESLTFEIARLDVVTSDLKDSVLLEFKELMMAQEFIQKGGIDYARELLEKSLGTQK
FT                   AVDIINNLGSALQSRPFEFVRRADPANILNFIQQEHPQTIALILSYLDPQKASFILSSL
FT                   PTEIQTNVARRIALMDRTSPEVVREVERVLEKKLASLSSEDYTSAGGVDNVVEIINMAD
FT                   RKTEKFIIESLEEEDPELAEEIKKKMFVFEDIVLLDDRSIQRILREIDGQELAKALKSV
FT                   DAPVQDKIFKNMSKRAAGMLKEDMEFLGPTRRKDVEEAQQKIVSLIRKLEEQGEIVISR
FT                   GGEEDVLV"
FT   gene            complement(302756..304462)
FT                   /locus_tag="BT0291"
FT   CDS_pept        complement(302756..304462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0291"
FT                   /product="flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:BT0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17629"
FT                   /db_xref="GOA:A1QZ87"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ87"
FT                   /protein_id="AAX17629.1"
FT                   /translation="MNNFITKFFASVNKKFQKASMVQKVAFGVIALFIILAFIFLIGFS
FT                   TKKQGVALFGVGIKDQYLLDRIVQRLDRESVEYIITADGKIYLSDENMSKKMRAILVRE
FT                   ELVPVHMDPWSLFDIDRWTITDFERNVNLRRSITRAVEQHIVALDDVDAVSINLVMPEK
FT                   ALFKESQEAVKASVRITPKPGSDIVTNRKKVEGLVKLIQYAIEGLESDNIAIVDNKGTV
FT                   LNDFSNLDGIDRIDLAEKERKLKLKYESMLRDEIDSALSKVLSVDRFMIARVNVTLDTS
FT                   RQTTESKEYAPIEIEPQDPKVSYNTRKVSDSTLLSSQVHKREYEGQGYSPWGPPGQEGN
FT                   TPPEYRDLSDIIGKSNEFKEIKNVALNEKKSLNEKEPARIAGISLGIFIDGVWDFVYDE
FT                   SGNFIIENGMRKREYKPISDEALKNITDVLQSSFEYKPERGDSIAIRNVAFDRVNEFRK
FT                   IDEDYFSTEKFKFLIFTVSIIFALLILIFTVFFIVSRELERRRRLREEEFSRQAHLRRQ
FT                   QALMDSDDIGVDDVVGGIREEDELQSNAELLAREKPEDVAKLIRTWIVKNV"
FT   gene            complement(304476..304805)
FT                   /locus_tag="BT0292"
FT   CDS_pept        complement(304476..304805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0292"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:BT0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17630"
FT                   /db_xref="GOA:A1QZ88"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ88"
FT                   /protein_id="AAX17630.1"
FT                   /translation="MEVDSFFTDNNVYLVRKNPLHFDKSFSVFDVKREVKAESFKDLFL
FT                   NLISDVNNSQLDVSRMSQQAILQPNSVDVHDITIAMAKANMNLSITKAVVERSIKAYQD
FT                   VINIR"
FT   gene            complement(304821..305279)
FT                   /locus_tag="BT0293"
FT   CDS_pept        complement(304821..305279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0293"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17631"
FT                   /db_xref="GOA:A1QZ89"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ89"
FT                   /protein_id="AAX17631.1"
FT                   /translation="MGLFSSINTAATGLTAQRLRLDVIANNIANVETTRTSEGGSYRRQ
FT                   RIVFSPRVVSPYWKGPFVPDYLDNGIGQGVRVAGIERDKSPLKLKYDPTHPDAIKSGER
FT                   KGYVEFPNVNAVEEMVDMISASRAYEANSTVINSSKAIFRSALSILQN"
FT   gene            complement(305305..305718)
FT                   /locus_tag="BT0294"
FT   CDS_pept        complement(305305..305718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0294"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:BT0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17632"
FT                   /db_xref="GOA:A1QZ90"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ90"
FT                   /protein_id="AAX17632.1"
FT                   /translation="MSLNIFDRSIDLAHRYLDVLSLRQSVIADNVANVDTPNFKRSKVT
FT                   FESELERAIFNEGASSLSLRRGNGKHLDGFKELGYLDVKPRRMLDYLSTLNNNGNNVDI
FT                   DSEMKNLAQNQMMYSLFTNIQAHHFKSVNIVIK"
FT   gene            complement(305746..307101)
FT                   /locus_tag="BT0295"
FT   CDS_pept        complement(305746..307101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0295"
FT                   /product="ATP-dependent hsl protease ATP-binding subunit
FT                   HslU"
FT                   /db_xref="EnsemblGenomes-Gn:BT0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17633"
FT                   /db_xref="GOA:A1QZ91"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ91"
FT                   /protein_id="AAX17633.1"
FT                   /translation="MMDKTENQNIVPKEIVAELDKYIIGQVEAKKLVSIALVNRYIRSK
FT                   LPKEIRDDVMPKNIIMVGSTGIGKTEIARRLSKFIKAPFIKVEATKYTEVGYVGRDVES
FT                   MIRDLMSIAVNMVREEMYDSVREEASKRAEERIIDKLLKTSEGSENDNTSEEERKIRDK
FT                   LRNKFRKQLRSGDIDDNLIDIYVSGKMPVSTIEIFSGSNFEEIDMSIGGLINNIFDRKK
FT                   RRELKIKKAREIIISEELEKLVDHENIVEVAKSRVENMGIVFIDEIDKIVTKNRTGNDI
FT                   SREGVQRDILPIVEGSKVNTKYGIVDTSHILFIAAGAFNLSKPSDLIPELQGRFPIKVE
FT                   LKSLSVNDFKNILKHTKNSLIKQYIAMFKVYNLTLTFSEEAIDRIAELAFDMNYEGENL
FT                   GARRLHGVMEKILADLFFEAPGSKLKKFEINLDYVNEKIKINEQKDLNYYII"
FT   gene            complement(307098..307640)
FT                   /locus_tag="BT0296"
FT   CDS_pept        complement(307098..307640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0296"
FT                   /product="ATP-dependent protease HslV"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17634"
FT                   /db_xref="GOA:A1QZ92"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZ92"
FT                   /protein_id="AAX17634.1"
FT                   /translation="MSFKGTTVIAIRRGGKTVVAADGQVTFGYTVLKSNAIKIRKLFNG
FT                   KILAGFAGSTSDAITLFEKFEEKVKAREDGIIDIKRAAVELAKDWRSDKILHKLEAMML
FT                   VADSENILLISGTGDVVEPEEDVISIGSGGNYAYSAALAYMENKKLSAADIAFKSLKVA
FT                   ARVCIYTNSNIVLEEIS"
FT   gene            complement(307652..308596)
FT                   /locus_tag="BT0297"
FT   CDS_pept        complement(307652..308596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0297"
FT                   /product="Smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17635"
FT                   /db_xref="GOA:A1QZ93"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ93"
FT                   /protein_id="AAX17635.1"
FT                   /translation="MFKLLYVDNLRFLKGEEKLRIFNDFDLSCLCKLSLRDISNYLSRV
FT                   FRRDYKLPDLKLIEMQQKIINKTSARIAVFGSKDYPLKLKRIYNPPFAIYYKGNLPDSN
FT                   SLSWAVVGSRQISRVLADKIKELSSHLAKNHVEIISGFAIGADIAAHFGAMNEKKRTYA
FT                   VIATDIDNIYPKQNRKYVACLLENGGGVLTETLPYEKIQNYFFAKRNRIVAGLSDVVFI
FT                   TCAPRKSGALITAELGLDLGLDVYVYNIDYSGDGSRVLYDSGAQEIKSVSDLYKILNVQ
FT                   YNEPEISDNSKVCCICKDTSSMLINKLLNEISK"
FT   gene            complement(308602..309291)
FT                   /locus_tag="BT0298"
FT   CDS_pept        complement(308602..309291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ94"
FT                   /protein_id="AAX17636.1"
FT                   /translation="MKRWIPIFLFLVISCGDESKEKVNLGLRIREIEIAGGGSLEKIEV
FT                   YKEFIDKEEQNILKIINSIDKKARFFSLIGLELIRLGQYGPAIEYLNKNLEYGPDNHLS
FT                   HFYIGVSSYNLAKGIETKEKVREYFILAEGSFLKSISIKDDFKEAIFALSTMYVYDLDK
FT                   QLEAKGYLSRLESMGEDYFEFFMLRGANYYSLGDFDNALLFYKKAKDKALTQEQIDGVD
FT                   RIMNNFK"
FT   gene            complement(309292..310533)
FT                   /locus_tag="BT0299"
FT   CDS_pept        complement(309292..310533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0299"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:BT0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17637"
FT                   /db_xref="GOA:A1QZ95"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ95"
FT                   /protein_id="AAX17637.1"
FT                   /translation="MVFERVVLTSHGGSLMKDYNIIDSHSKRFDSATNPTVLKVIGAGG
FT                   GGSNAVNRMIEYGVRDVEFIVANTDLQALQTSIAPIKIALGAKVTSGLGAGGRPEIGQA
FT                   AAEEDIDIIKNHLAGADMVFITAGMGGGTGTGAAPVIAQVAKELGILTVGVVTKPFKFE
FT                   GPKKMRLAEQGINNLRKSVDTLIIIPNQKLLTVVDKRTTIKDAFKRADDVLRMGVQGIA
FT                   GLIIEHGEVNIDFADVKSIMQGQGDALMGIGYGKGENRAVDAATSAISNPLLEEVRIEG
FT                   SKGLLVNITGGEDFSLLELEEIMGIITASVDDEATVIYGHAINSNLDDEIYVTVVATGF
FT                   SSKKQKDLSGAVENNTLSSKEFDSLMSGSQDVSGSVYEANDNFIAKSKNVNYFEDDIDV
FT                   PTFLRNLNKKNSDN"
FT   gene            complement(310509..311750)
FT                   /locus_tag="BT0300"
FT   CDS_pept        complement(310509..311750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0300"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17638"
FT                   /db_xref="GOA:A1QZ96"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ96"
FT                   /protein_id="AAX17638.1"
FT                   /translation="MSRDLIVGLDVGTSKICTVVAEVNLNNQLEIVGIGTSVSRGVRKG
FT                   VLINIEAALDSISSSIEAAELISGCDISALSVSMSGSSIEGTNSRGVVAINSKTREIDN
FT                   EDVERVIEAAKAIVIPMDREILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIITGSS
FT                   SSSQNLVRCVNRAGFSVDEVVLGSLASSYATLSKEEREMGVLFVDMGKGTTDIILYIDG
FT                   SPYYTGVIPIGANRVTLDIAQVWKVPEDIAENIKITAGVAHISALESQVESVIIPNLGT
FT                   RPPQEKSRKELAIIINSRLSEIFEMIKAEIMKRGLYNKINGGIVLTGGGSLFPGISNLT
FT                   EEIFKYPSRIGFPMNINGVGEEYIGPKFSSALGLVLYKHEQQKFNKLKKGNNKSKRQSK
FT                   ISSKLKGWFLKEWF"
FT   gene            complement(311750..312493)
FT                   /locus_tag="BT0301"
FT   CDS_pept        complement(311750..312493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0301"
FT                   /product="DivIB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17639"
FT                   /db_xref="GOA:A1QZ97"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ97"
FT                   /protein_id="AAX17639.1"
FT                   /translation="MLIYRKFLIIYIYVIISLILLEIVFIIFISPYFLIRYINFNDSIH
FT                   ISKEEILSISGIKPNTYYYDADVSAYEKNIMRDRRVKNVTVKLKFPNTISINIERRVPI
FT                   VTAYENVDGSFIYYFIASDGLILEKCKDLIYDLPIVSGLNLNGNEVGDFLEDRMLAIIK
FT                   NLNYVKINQNTLYNLISEINFLKLNFYDYKIFLYIKNIYNKILITTDMDLISVMHKVFM
FT                   ISDLLKGRSDTVDLRSGNIILLGED"
FT   gene            complement(312533..313636)
FT                   /locus_tag="BT0302"
FT   CDS_pept        complement(312533..313636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0302"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:BT0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17640"
FT                   /db_xref="GOA:A1QZ98"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZ98"
FT                   /protein_id="AAX17640.1"
FT                   /translation="MIFMFVERTSLRKCYLLVLWSLIAYGLVVFYTSSFFLSLELTGEP
FT                   NFLFLMRLKYLFLSFIVFFVFERISLDFLKKIVSIILLVTFTLVLATFFSPSVSGTQRW
FT                   IFLKGVSIQPSEIFKVSFTIYLASYLSRFRLKSDNNISYWIKPMLIFGIFWLLIILQND
FT                   YSTAIYFAMLFFIVLFVSGMSLGYVFAILFTFVPIAMLFLIFEPYRVARIFAFLNPYDD
FT                   PLGKGYQIIASLNAFKSGGLGGRGLGMGEVKLGRLPEANSDFIFSVLGEELGFFGICLA
FT                   IVLFFLLFYFGYFVALFAKTRFRFFIAFIASLTIFLQSIMNILIAIGLLPPTGINLPFF
FT                   SSGGSSIVVTMALSGLISNVSRDVEGE"
FT   gene            complement(313644..314699)
FT                   /locus_tag="BT0303"
FT   CDS_pept        complement(313644..314699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0303"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:BT0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17641"
FT                   /db_xref="GOA:A1QZ99"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZ99"
FT                   /protein_id="AAX17641.1"
FT                   /translation="MFCLLGLRLLKYITFRTAYATIFAFLLALIFGPFIILRLKKLKLD
FT                   QILRKDGPKRHLSEKIGIPTMGGILIFFCVLVSLFFWIDFWNIYFLIILFVMVSFACLG
FT                   FMDDLLKIKRKNSDGLNPRFKIYGQILFSCISVTMLYYFGDEHVSIIYFPFFKSLKLDL
FT                   GVLYIPFGMFILISASNSFNLTDGLDGLAIGLSIVVTGALVIIAYLASRVDFAFYLNIP
FT                   NIKGAEELVVFLGALLGGSFGFLWFNAYPAKIMMGDTGSLSIGAVLGMTALILKSEILF
FT                   AILAGVFVVETLSVIIQVVVYKHTKKRVFKMAPLHHHFEELGWSEMQVVIRFWIIGLIF
FT                   AIIALSTLKIR"
FT   gene            complement(314717..316111)
FT                   /locus_tag="BT0304"
FT   CDS_pept        complement(314717..316111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0304"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-L-ornithine--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17642"
FT                   /db_xref="GOA:A1QZA0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZA0"
FT                   /protein_id="AAX17642.1"
FT                   /translation="MVHIKIEDILDSLKDIKFVGYASSMQKIVSFYSLDSREINAKNSS
FT                   ASLYFAYKGDRVDGFSFVEYLIDIGVKCFVCSKDCESLCLEYLNRDENLVFLLTSNVVI
FT                   LLQNLAAHFITRTSFKRIAITGSNGKTTTKEMLYSILSERYKTCKTWGNLNSDIGLPLS
FT                   ILRTEGDEEYAVFEVGISYIGEMNLLAEILNPEIVIVTNISYAHMQAFEDLEIVTAEKG
FT                   KIMTKSTQMVILNESCPYHLHLRVMAKSINPGINIFYFDFHSLQIRSFAFVNDKFFYDF
FT                   TYKGFDYSILLPGQHNIFNAISCIHLALLLGLSENEIRNGLLHADFQKGRAELLRVKDY
FT                   LILNDSYNGNLGSFMALKEMILGLEIKGKKFIILGAFKELGKFAYEVHKTAIREVVLMN
FT                   FDKGFLIGEEFQEVKKIENLALDNLFYFSNFENFIDYFVKNLESECFIAIKGSRSNRLE
FT                   RILDYL"
FT   gene            complement(316127..316408)
FT                   /locus_tag="BT0305"
FT   CDS_pept        complement(316127..316408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17643"
FT                   /db_xref="GOA:A1QZA1"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZA1"
FT                   /protein_id="AAX17643.1"
FT                   /translation="MSKMGKIEVRLYFLLILILTIIICLNIYLNFRYVVKLREFEGLND
FT                   EQSNIIDENLRLLTIIYELQSIDRIEELSKDYLNLEKKDNKDINVIKR"
FT   gene            complement(316401..317294)
FT                   /locus_tag="BT0306"
FT   CDS_pept        complement(316401..317294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0306"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17644"
FT                   /db_xref="GOA:A1QZA2"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZA2"
FT                   /protein_id="AAX17644.1"
FT                   /translation="MGNIFHIPVLLEEIINLLEASNISDGFVFVDCTLGEGGHSSAVLK
FT                   KYQNINVIGIDRDDVVLNRAKESLIEFKGRVSYFNTWFDDFFSEYPLSSKINFILADLG
FT                   ISMFHYKMSGRGFSFFEDERLDMRLYPGAGGLSAYDIINTFDKKRLENLIYELSGERYS
FT                   RRIVKSILEYRKIKKIETPRELQDIVSKAYPRIKLKINPATKTFQALRIYVNDELFRLK
FT                   RSLPLWVESLSNNGVLAIVTFHSLEDKIVKEFFKGLSKDQYCILTKKPIMPRCEEKRFN
FT                   SASRSAKLRVIKKLYE"
FT   gene            complement(317287..318120)
FT                   /locus_tag="BT0307"
FT   CDS_pept        complement(317287..318120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17645"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZA3"
FT                   /protein_id="AAX17645.1"
FT                   /translation="MMIIAVLFFFNFFNLYAFLEFGKDEKFDLVSDFGELRNDTLSIGI
FT                   KLRALDTHFSIFSNNYKILYSKNKVSEYDGSILIIFDKDLGFNLEFFGDFIYKDGKIFL
FT                   KNDNKVFDVVVVDHYSGHIINPLFVIKNRNNLNINSSFLLSNILLKGKDDTMFELKENI
FT                   DLDLELGDYGLVLNFLKKDIGVAKAINGIYYFEVFLNNNSIFRADFQSMSLNGNSYVVF
FT                   DNKDYNLDLFNIKRDNGNIEINNLEFTSGHNEIKIKYGDVYNTENSLTYRFTLNG"
FT   gene            complement(318123..319190)
FT                   /locus_tag="BT0308"
FT   CDS_pept        complement(318123..319190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17646"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZA4"
FT                   /protein_id="AAX17646.1"
FT                   /translation="MNLCKENSTRFRKIKNFLLSIFLLIFIVLVDSILKSTIDISIFYK
FT                   FNHFKKSDNLVDIVPKRNVFINDQILNLDFNKYDYHVVSDRLVSFSDYYYVLNRFKNNY
FT                   SVFSRKTDKFLFSLAYKDFVFTKDNVVFALNNLHKALEVYGADGSRILSFKFIASILSI
FT                   DYNDDVLALGLSDGKTYVYKRGKMVYGGDLLGVGLPIICLKLSLNNKYLCILRGNEEYS
FT                   IEVFNLEDGYNQFLYLKNLKIKDFNPFFKIDKFYNLFVETANSFLILNINSGKTFKVDN
FT                   KNSVLKASYDPFSRVYRVYFYDLSGSMINIRTYSVDSYSLFDNIFFKDKVNSYVEFDEG
FT                   ILYFNDNSDLNYLGL"
FT   gene            complement(319216..319974)
FT                   /locus_tag="BT0309"
FT   CDS_pept        complement(319216..319974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17647"
FT                   /db_xref="GOA:A1QZA5"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZA5"
FT                   /protein_id="AAX17647.1"
FT                   /translation="MDLVHNENYQKILFIDDLILQTLKDIKGIKKSGKLALDSGVTVNF
FT                   INLNLNVLSYIASLNYFYTKPRLKVNYDFRVNLFSFISDFSLFVSPVLLISFGELMDNE
FT                   SVLNLNPEERFLIVRKLGYLIDLGMYFSKGDSKAILFLEDIYLKFIVLVKNFIDFKNLS
FT                   KNLVIDSPFYKVQLAHLIKSLDLLEEGAFLLRSRYEVNGAYGLSEQILSYIQAGKTLAT
FT                   VTSQKSIAEKFTKFYEVWSVKFQSDLSKSR"
FT   gene            complement(319990..321666)
FT                   /locus_tag="BT0309A"
FT   CDS_pept        complement(319990..321666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0309A"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:BT0309A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17648"
FT                   /db_xref="GOA:A1QZA6"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZA6"
FT                   /protein_id="AAX17648.1"
FT                   /translation="MKFCMLVELFVKNFVLIKELSIKIGTGLVALTGESGSGKSLLLSS
FT                   IYYLFGGKIKSNIIINGEQECVLLAKFRVNGDVRDYLSSKAILASDCIIIKRVIIFESS
FT                   ETLLSNYYINNEPISSNILKPIFNMLIEVHSQNQQYLILKNPSSNLKILDNYANLNSQL
FT                   EKYRLVYEEYIQYLNDYDDFVSKEKLHKDSKEECEKIIDEIDSFNPKIGEEEILKTRLD
FT                   ELKNHESLCNALSSLKSVLSLNNNVSALSKIRNVICDAEYLSGVNNNYFELENRLKSSY
FT                   YELEDIGQAYSRYLFDKTYDEKEIESVENRLHDLSRLRKKYGPSLEDVIVFRKRCDDII
FT                   DLSLNFETERLGKEQMLNDLFERVKKLAFDISSVRKAAALRFASGVTKILHKLNMGDAE
FT                   FFVSVSEGKIKSTGIDEVEFLISSNTGLKAQPIYRIASGGELSRIMLAIKSVQNVDESK
FT                   LIIFDEIDSGIGGESGMSLGKYLKGLSENMQIFVVTHLANIASLSDYHILVKKEYIEDR
FT                   PYVQACLLLGNDRVLEVARMLSGNVNDISFQHAEELLKGNN"
FT   gene            complement(321701..322579)
FT                   /locus_tag="BT0311"
FT   CDS_pept        complement(321701..322579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0311"
FT                   /product="ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:BT0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17649"
FT                   /db_xref="GOA:A1QZA7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZA7"
FT                   /protein_id="AAX17649.1"
FT                   /translation="MTRANLHGFHIRRIMKSKVLIYVNYSNLDAEVLACEIQKYLEHKY
FT                   GVLSLFAGIDKSSEVLTEDNLILAITLGGDGTVLLASSLLLKNDIDIPIISINLGKVGF
FT                   LADIKPIDFKEVIDKFFDNSLVIHSKYLLSISAYENGNNVFTKYALNDVIIRSSVINKL
FT                   IYVNLRVNSEDFLSYRSDGIIFATPTGSTGYSFSAGGSILESDLQAFILTPISPHSVYN
FT                   RSFIFSSGSKLSLSFQKGYALNSASIFVDGVNIGKFGVNIIFELGLDNKSLRFASFCTD
FT                   TFVRRLKNKLL"
FT   gene            complement(322527..323057)
FT                   /locus_tag="BT0312"
FT   CDS_pept        complement(322527..323057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0312"
FT                   /product="chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:BT0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17650"
FT                   /db_xref="GOA:A1QZA8"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZA8"
FT                   /protein_id="AAX17650.1"
FT                   /translation="MFMKEKIMEKKSHLQVACFKIGKESYGVAIDHIREVIKVPLEGIY
FT                   AIPNVPDYITGIYNLRGSVIPLINLNIRFKIPSVYVTEEDKLLTGYLIVNIKDKLLGIF
FT                   VDKVLKVISFDTSKVQEPPATLQTLDRKYISGVVKIENEENFESEYLILIDIERIFDKG
FT                   EFARIPYKENNEE"
FT   gene            complement(323098..323733)
FT                   /locus_tag="BT0313"
FT   CDS_pept        complement(323098..323733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0313"
FT                   /product="23S rRNA Um2552 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17652"
FT                   /db_xref="GOA:A1QZA9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZA9"
FT                   /protein_id="AAX17652.1"
FT                   /translation="MHNNNYNKKYNGLSVLQSIDMYNVVDEYSRRAKKEGYLARSVYKL
FT                   IEIDKRFSLFSSGNILDVGASPGSFSQYAYGNLKDGVLVAVDLNDIDLNFTNNFYFIKG
FT                   NIYIDEVCQKIETFAPYSLIISDAAPKTTGNRLVDTSNSFNLNMRIIELASRILVKGGN
FT                   LLLKVFQGGEEEQLFYKLKSCFKIVKKIRPKAVRKNSFEIYFLSKDFN"
FT   gene            323728..324774
FT                   /locus_tag="BT0314"
FT   CDS_pept        323728..324774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0314"
FT                   /product="dimethylallyltransferase"
FT                   /EC_number="2.5.1.1"
FT                   /EC_number="2.5.1.10"
FT                   /EC_number="2.5.1.29"
FT                   /note="geranyltranstransferase; geranylgeranyl
FT                   pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17651"
FT                   /db_xref="GOA:A1QZB0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB0"
FT                   /protein_id="AAX17651.1"
FT                   /translation="MQNKSFLDKIEKNINNIFSQDHFLNLFKDKDLKLKLNIQKNTIKT
FT                   IKAPAIEIINRGGKRIRPMLMILLAYALGYNKKNTENLYKLSMLLELPHSGSLIIDDIE
FT                   DGAIKRRGKPAIHLIYGLDNSINTANLIYFLPAKLIQTSKLKKSQKLLIYENFFTTLSN
FT                   LHLGQGIDIALHNGTYIPNLDEYISLVELKTSCLFGMAGFLAGILTNNESKAKNLYNTF
FT                   LKLGTCFQIIDDIKNIKDGINGKDFGDDLIEGKKSLPIIYFLKEKLLDEQIIQELSAIK
FT                   NKSINESKKEILKFSNMINSSSAIQNSTNLAMSYLNKFTEELNSYALINKYKDMIMNIV
FT                   KKIKEENL"
FT   gene            324771..325454
FT                   /locus_tag="BT0315"
FT   CDS_pept        324771..325454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17653"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB1"
FT                   /protein_id="AAX17653.1"
FT                   /translation="MKKYVIMLIWMNITTFIYATIPTEDINKIDELYTKSMLLKELKKY
FT                   NQSKALLMQIINTDPKQVDAYLLIAELEYLMNNWLQAIEQTKTYLQIIDFKDTKNYLDI
FT                   SWAYFLMGESRNSMDYIMQFIQDNKELLNTNIYILIDTILKKGFYHFIQDEDLIFNLII
FT                   NTLFQIETYDDTIFTIFLNNLDIIKQMPFYKFNKIKIKDLELQIRALKKLKNSTNDIAK
FT                   TGWFF"
FT   gene            complement(325432..326238)
FT                   /locus_tag="BT0316"
FT   CDS_pept        complement(325432..326238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0316"
FT                   /product="nucleoside transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17654"
FT                   /db_xref="GOA:A1QZB2"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB2"
FT                   /protein_id="AAX17654.1"
FT                   /translation="MFGIFLHSIVFAYLALGILYAERVGLLNISIEGISFLSVFLTSFF
FT                   IYLGYGIFASVVMTIFISLIFGFFLSFIVINGYNIFITGIGINILCYFLVRVLMKANFN
FT                   FIPGFSLNISNNFAIIFFVIFFFVFLSFSIYILNYSRVRVVFEFIRSNDYENILGERTS
FT                   NYFKSFAIFVSVISSSIAGSFLAINFNVYSYDLGLNNGWLAICILYIAFANPWLIFPSA
FT                   FLMIFIEYEFFNFQDYVNSYFALSLPFYMAILINIFVSLFRKTNLF"
FT   gene            complement(326239..327171)
FT                   /locus_tag="BT0317"
FT   CDS_pept        complement(326239..327171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0317"
FT                   /product="nucleoside transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17655"
FT                   /db_xref="GOA:A1QZB3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB3"
FT                   /protein_id="AAX17655.1"
FT                   /translation="MRAFRREYILLIFSLSVLSISYFFDGFFSFSYMKVMLWNFMLLLL
FT                   IATGISTCAKSNSLTLGDEGQVYFGAFLSYIFCEFCGLTYFNFVLIIILSSFLVGVIGI
FT                   IPFLLTFFCGVNGMLTGLLMSYGNQRLVDGFISKLLGSNGLLNQTKSIDKIFVIDTAFP
FT                   YLLLFSILVWGCYVFIHKRTILGLRLEILSDRKPLSKFFGINEFKYKFCTVFTSAFLNG
FT                   LVGSIFLIFFKNYLFLGLTAGLGWNGFVVAVVSGFNYMYVLCFSLFFAMLNEFNNYLKI
FT                   NYSFKFEFIGLYQAISIFISLFLINAGKK"
FT   gene            complement(327168..328625)
FT                   /locus_tag="BT0318"
FT   CDS_pept        complement(327168..328625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0318"
FT                   /product="nucleoside transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17656"
FT                   /db_xref="GOA:A1QZB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB4"
FT                   /protein_id="AAX17656.1"
FT                   /translation="MVEFKNIVKSFPDIEKPILDSVNLRIEESKILTVIGRNGEGKSTL
FT                   SKIIAGFIRFDSGDVFVNNIRQKNWNVDVAKSNGIYIVSQIPKLDMNLKVWEYLSIYWF
FT                   DSQFFMPMNKSHTYRYYKWLRQFYNIAFDLETRIQDLNIKEIYFLLIISSLKKNAKIII
FT                   FDESVSYFSQKEAKEFIKLLQALKRAGITSLFITHREIGDAIKFSDEFVILKEGKCFRT
FT                   TNKEIILSKLEIPADKFISMSIRRGGPNEDFIKFNLFFEDFWKYDISFSLKKRGVLGII
FT                   AEEAVIKTWEKLFLGEIPFVGCIKMNGHRYEYINFYELKAGFLPLGIGNLFSDNMTILD
FT                   SFLAKIMSFENEIFIKQSIINDLKKFFKSDMEYCDSKILKTFYSKSLSFSGGTLKKLAL
FT                   FREKYITKSFLICFSPLSNLDYRAYSETSNFIRNFSNEKPVLLITPNLDELLLLSDDVL
FT                   AIKAGEVVLRLKREHINKEALKEMLFI"
FT   gene            complement(328629..329729)
FT                   /locus_tag="BT0319"
FT   CDS_pept        complement(328629..329729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0319"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17657"
FT                   /db_xref="GOA:A1QZB5"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB5"
FT                   /protein_id="AAX17657.1"
FT                   /translation="MPFCSHSIKFYFMRKRCFISVSKALFFRIFCVFVSLICLFLFVYI
FT                   NFFRIREPRSSSNRKIALFIPGIISGSPSYKAMYDFLIEFKKNKSDIEIRLFEAGFNQH
FT                   EWIELLEKLLNSNNYDFLITTNNAMQGIIDRVSPNYPYTKFLLFDSLVKNINPQVYSLS
FT                   YNVAEEAYILGYYVGLFLKSSNLHNKNVALIAGQEYPVMNNYIFPYFKNGIREVLDSEV
FT                   FFRTLGNWHDSNRVKVLSDSLILDLGVSVVLPIVGTAIKGVLSSVREHGVFAVLFDGED
FT                   YLNNKDNIIGSGVTNQRFYLEKVLGKALKGELKYGTYKVLGFRERGVSFNLLNKFYLEK
FT                   TDSKLKKKLEEKMKEMNNTEIKINLE"
FT   gene            complement(329994..331085)
FT                   /locus_tag="BT0322"
FT   CDS_pept        complement(329994..331085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17658"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB6"
FT                   /protein_id="AAX17658.1"
FT                   /translation="MIVKSYVIILLLLLLQVTLFSQVASIKEMEGQINIIRNAIPVKLN
FT                   LGDEIFEYDFIEVGDNSKIKIGLYGINGIASDLTLYSNTHSLICYSSLKDMQDAKIYLF
FT                   KGSLEVFIYEVVQGSSFSVDLNNYFFMTDAPAKFYVNCEYFNNYFVSVFDGVLKHYNKD
FT                   EYWISAGTSILLWDNNSFLYKTSDSVSQNVIENLKEMSRKNFVSLNNSRLTYIFLKYIE
FT                   DSFRFDFVYDYLVRDPKFNTIYSKWSLEDKNYTLGNRVDMINYVNYLRGRIGILFNNFI
FT                   YLANVFFFIEDIVKHSSDVFDKVSIHGAILKYLENYKKNRSSLTKKFFKTVHSFKMYLI
FT                   RTNGDIPSNLSVNEFYLLKPREF"
FT   gene            331604..332725
FT                   /locus_tag="BT0323"
FT   CDS_pept        331604..332725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0323"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17659"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB7"
FT                   /protein_id="AAX17659.1"
FT                   /translation="MIKKSKLLFLMLSVFALPLISCKTPPEDTKNANSKISTKETGDIK
FT                   RDIEDIKKGVLRERGNLFYSKEFNETEKIEKEMHEKFAKGMIKEGNEIALKVLERYRNI
FT                   ARDTTEKKEQINYLKENIEKYLNDAEANEAYIWIPLEIDEVNNLYFEATRKYKMYDIES
FT                   SLGMYSKTFNKAQQAAKKAKEARALKETEERMYKQLKALEAASELPVYRNNKLIKPSPW
FT                   NGRALLKDKGERINLLNPQDETYLLGQMDSLILAYEEKAEEVKTPDPNKFKTLQLIEKA
FT                   RQLWEQGLEAKNLNNLRLANELFLDSARYLKAYQSHSSKELYIIKIGNTLWGISKKLYN
FT                   DPYLWPKIWFANRQKIQNPDLIHENWKIIIPSK"
FT   gene            332821..333189
FT                   /locus_tag="BT0324"
FT   CDS_pept        332821..333189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17660"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB8"
FT                   /protein_id="AAX17660.1"
FT                   /translation="MKKLVLTSILFFSCYTVAHLNKQLTKDTPYSIYLREAQKATNVND
FT                   YQSALKIYEKMIKNYKENESIVAIGKYEIAFIYYVTNKNNTAKKLFEELIQSNVQTPKW
FT                   IIPLSQKIIEKIKNQQKK"
FT   gene            complement(333217..334332)
FT                   /locus_tag="BT0325"
FT   CDS_pept        complement(333217..334332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0325"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17661"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZB9"
FT                   /protein_id="AAX17661.1"
FT                   /translation="MKKAYFIISLFIVFNLFSSINDHLSINIDDVYVEAHEDGFHLFIR
FT                   KKPNIKSVILTESFEIPDKSKDVSTYSFRTLEYNRINGDEIRILNGRVIQNRRLLSLTS
FT                   STPVQNRRFGQAFHILIPKKLRYGFPNFLTRSGDIDLEVLKRKKDPFWFSIRTFEKKYN
FT                   DYLGQYKDNAYELFFGDIQRESTSENNDLKKEFSRFSDNVVVAKKGLDLVDKIKNILEE
FT                   SEDPLADLDLVFVIDVTDSMKNHIEILREHLFSMIEPQLSQYRSYRVGFVFYKDYLEDF
FT                   LTRSFDFNNKEYLNNVLEDISVGGGGDYPEAVFEGINSAVTQFDWKADNRFIIVLGNAP
FT                   PHEYPRGPIVYEDVIRSAKEKDITIYGILLK"
FT   gene            complement(334397..337258)
FT                   /locus_tag="BT0326"
FT   CDS_pept        complement(334397..337258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17662"
FT                   /db_xref="GOA:A1QZC0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC0"
FT                   /protein_id="AAX17662.1"
FT                   /translation="MPDIEKINKFKRELLDNISDERAQKERFGIKMDIEPPKDGESIVP
FT                   WENQEEVFDLEEEPDDELDLDAMLGELDSEEDQNDGSNENDIAILKDSKKVDIDPEFNE
FT                   LDNDFDVLSSHLEENLEKVLDDNSISLDDAINFDLDNNADSLQNLDIENDLDSDLLNSD
FT                   ESIDNEIDANNLSQESLNDSNDDFDLENMISGLKESDETNNSLEMPYSDESFSNENSEN
FT                   LSDGEEDNWSNLSDDFEFLENDQKEPLGKHNFKINYPLFFKHLDSYPRNLRIAIAEALM
FT                   LENVSRYKIEALIDLVEQNKKGLKFIAKFVGDIVGRSVKLPVMYYKAEECSKLEKKFSY
FT                   RLSKALTPIFKIASLFVILTFLSFYFLVDVMFFYIASDRKYKEGISYIYENKRELAKAI
FT                   FRDAYYMKPNKKWFLTYAKVFEDVRDFDSAEEKYEELFTIDPFSVGASKRRRKNFDRDG
FT                   YISYAFMKMRLGEYADANAILDEVISYSIYDYEALMAKGDNYFQWAQRDPAYYKDSINN
FT                   YTILLSKYGHKKEILFKLFNAYIEAGAEREAEDVNAFIKVNKELDIDEVVYTKYAKKLI
FT                   DKYVEFTVYNKRINALSRNLKYFSAQMNLLNKEFSSFKAGNGKSISNALNDINLNSEIE
FT                   YILRRILFKNPDYDKALFESGRYFYYMGDLKKSEGYLLTALNSFRQEDSIENSSEKIVA
FT                   YRILSDIYERNNDALKASNIVSLALNEYDFYKKNGLVKSSRELALIYEKQGDILRTLNG
FT                   FKSAISSYEMAINEGVNSPDVYYKLALLNYKENNYKDALTYLFRVQNMSGFANSNKVLN
FT                   SIASVLYKMGDFEAARSYYLRVLQNLESEKSSILSFKPQGNDHHKALLIKEIEIYNNLG
FT                   VVEIRASLGDRIESGVVRNNNLFDSGIANLTESSRIFDILNRDDDMVKSVKKDLASLNL
FT                   RGIFKNDFIGSKILFYDNLADNL"
FT   gene            complement(337274..338167)
FT                   /locus_tag="BT0327"
FT   CDS_pept        complement(337274..338167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0327"
FT                   /product="glycerol-3-phosphate o-acyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BT0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17663"
FT                   /db_xref="GOA:A1QZC1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC1"
FT                   /protein_id="AAX17663.1"
FT                   /translation="MFIRNESFNKYFKGIENEFFSRFKAIEKINYLNNSYHEADSVSRS
FT                   LVDTMIKRLLKSSSTIVGIQNILKLYEKSKSGKSSIILMEHYSNFDFPCFQFLLNQMNC
FT                   KEVSEHIVPIAGVKLFKDNLLIKSLSLGYSVIFIYPPHAFVGVDHETIRARRVFNANSM
FT                   RCIADKKSSGYMILIFPTATRYRKGRPETKKIISEISSYFKLFDYFIMVGVNGSILEVS
FT                   SNEDMSCDVFKEDTLVYNATEILDILEYKNLILEQLNQEGLEPTKEILGSRIADDLEKR
FT                   FEVLHEEGAKIYSGLI"
FT   gene            338367..339962
FT                   /locus_tag="BT0328"
FT   CDS_pept        338367..339962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0328"
FT                   /product="oligopeptide-binding protein OppA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17664"
FT                   /db_xref="GOA:A1QZC2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC2"
FT                   /protein_id="AAX17664.1"
FT                   /translation="MKYKTIILLSLLIIWLTSCSGDEHKDKITFRVTNEAEPDSLDPQL
FT                   ATSVQAFNIIINTFAGLTTRNTQTGGHKPGLAQSWDISADGLVYTLHLREGIMWSDGVP
FT                   ITAEGILKSYLRVLNKETGSQYVDIVKSTIKNAKDYFEGKIPESELGIKTIDNSTLEIT
FT                   LVAPKPYFLDMLAHQTFIPVPVHAIEKYGQAWTNPENIVVSGAYKLKTRIPNEKIVLEK
FT                   NDKYYNASNVEIDEVIFYQVQGNTAYNMYINDELDFLTKVASEYLDEARIRNDYYSHPI
FT                   NRVAYMAFNTTIKPLDNVKVREALTLAIDREALNKITLKGQSKPTRNLTPPFEHYSYGK
FT                   QLKLFDPQRAKQLLAEAGYPDGAGFPTLKYKTSQRNGMAITAEFLQEQLKKTLNINIEI
FT                   EIEEWNTFLNNRNKGNYQTSYMGWTGDYSDPLTFLESLFTTENQGFGAYGYSNKKYDNL
FT                   IEQSNFAQDPIQRQDILRQAEALIIEQDFPVAPLSILKSYYLFRHDKWTGWIPNVSEAY
FT                   LYEEIKYKRENINN"
FT   gene            340384..341970
FT                   /locus_tag="BT0329"
FT   CDS_pept        340384..341970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0329"
FT                   /product="oligopeptide-binding protein OppA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17665"
FT                   /db_xref="GOA:A1QZC3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC3"
FT                   /protein_id="AAX17665.1"
FT                   /translation="MKIKKYTFIIFFLTVILSCSKENSKENLSFKISMGGEPKSIDPQL
FT                   TEDKIGATIVAQMFSGIVDGDPKTGGYKPGLAQSWDISDDGTIYTFHLRKDIVWSDGVP
FT                   ITAEGIRRSYIRMLTKDTASNYVGMIKSTIKNAQDYFEGKIPESELGIKTIDELTLEIS
FT                   IITPKAYFLDMLVHQSFIPVPVHAIEKYGKNWTNPENMVVSGAYKLKERNPNEKISLIK
FT                   NDKYFNAANIELQELIFYTINDASTAYRMYENNEIDMLIHGAIPPDLIKEIKLRNDYYS
FT                   SAINGLYYFSFNTQVKPLDNVKVREALTLAIDRETLTKKVIDNGSIPTRSISPKFNHYS
FT                   YGKPLELFNPQRAKELMAEAGYPNGEDFPQLKLKYNTNESHKKIAEFVQNQWEKILNIN
FT                   IVLENEEWASFLETKQKGNYEIARSGWIGDYSDPLTFLSLFQKEFAYFSSYKYFNKEYE
FT                   NLINQSDREQDPIKRQNILRQAEEIIIKKDFPVAPIYIYAGNYLFKNDKWTGWVPNISE
FT                   RFNFSEIKRIK"
FT   gene            342202..343122
FT                   /locus_tag="BT0332"
FT   CDS_pept        342202..343122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0332"
FT                   /product="oligopeptide transport system permease protein
FT                   OppB"
FT                   /db_xref="EnsemblGenomes-Gn:BT0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17666"
FT                   /db_xref="GOA:A1QZC4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC4"
FT                   /protein_id="AAX17666.1"
FT                   /translation="MLKFTMQKILETIPTLIVIIFLCFLIMKLAPGNPFDSEKPIDPQI
FT                   KEKLMQKYHLDKPFYVQAYYYITNIFKGDFGPSLVKKDLNVNQYIKLGFPKSFTIGIIS
FT                   LIISLTLGILLGSLAAIKKNTRTDYIIRIAAICGISVPTFVTGPLLQYLLSVKLKLFYT
FT                   SGWISERGGLTNLIMPILTMSLPWIAIFTRIIRGSMLEILKSDFVRTAKAKGLSFNVII
FT                   RKHVLIGSILPLVSYIGPAFAGIISGSMVIEQIFRIAGMGTFTVESSLNRDYPLLMGSL
FT                   LVYSTILLISILASDIAYKKLDPRT"
FT   gene            343132..344184
FT                   /locus_tag="BT0333"
FT   CDS_pept        343132..344184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0333"
FT                   /product="oligopeptide transport system permease protein
FT                   OppC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17667"
FT                   /db_xref="GOA:A1QZC5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC5"
FT                   /protein_id="AAX17667.1"
FT                   /translation="MNEHENQDTYVEIHTANKRAWLRFKENKLAFISIFIIGFYILIAI
FT                   LRPILPIYKYHTQVVEHADLPPSLKYAGELWYEKELHFIKRLSAKEKREINKEEKAKLE
FT                   EIKRKIETEVQTIDGKEIKIHKRIYLLGTDNLGRDLLARIIQGSQISISVGFIGALISM
FT                   IIGTIIGAIAGFFGGIIDRIITKIIEIFYVLPTLLVIIILMTVMERNIIGVFIAISIIS
FT                   WLTIARIVRGQVKSLARSEFIQAARTLGATNTRMIFKHLIPNSFGMIVIITTMNVPSFI
FT                   MLESFLSFLGLGISAPMTSWGELIKNGIPTFIEYPWKIFIPATVMTIFLLFMNFLGDGL
FT                   RDAFDPKDNL"
FT   gene            344156..345073
FT                   /locus_tag="BT0334"
FT   CDS_pept        344156..345073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0334"
FT                   /product="oligopeptide transport ATP-binding protein OppD"
FT                   /db_xref="EnsemblGenomes-Gn:BT0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17668"
FT                   /db_xref="GOA:A1QZC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC6"
FT                   /protein_id="AAX17668.1"
FT                   /translation="MHLIQKTTFRRHSMKEDYMLDIRNLSIEFKLKHTTIYPVSNINLK
FT                   MKKGEIRAIVGESGSGKSVTSMAILKLLPEITTVYKTGEILFEGQDLLKLSEKELQNIR
FT                   GNKIAMIFQDPMTSLNPYLRISTQIEETIMLHQKLDKKTAKQKAIEMLKTVGVINAEER
FT                   IEHYPHQFSGGMRQRVMIAMALSCHPSLLIADEPTTALDVTIQEQILLLIKSLSKKFNT
FT                   STILITHDLGVVAEVCDTVSVMYQGKFVEEGTVQEIFKNPKHPYTIGLLKSILTLDKDP
FT                   NEKLYSIKDNPIGTITNKMEGDFK"
FT   gene            345070..346059
FT                   /locus_tag="BT0335"
FT   CDS_pept        345070..346059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0335"
FT                   /product="oligopeptide transport ATP-binding protein OppF"
FT                   /db_xref="EnsemblGenomes-Gn:BT0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17669"
FT                   /db_xref="GOA:A1QZC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC7"
FT                   /protein_id="AAX17669.1"
FT                   /translation="MKNEKDIILKVENLVQTFTIGENFLFWKNKRKVNAVNGISFEVER
FT                   NKTLGLVGESGCGKSTTLRTIMQLYTPTSGNIYFNGKDITKLSKRELLKTKKDMQMVFQ
FT                   DPHTSLNPRMTIKEIIAEPLVIYNENKIFPRTKQEIEKRVNELMDITGLAKSMLSRYPH
FT                   EFSGGQRQRIGIARALALNPKLLLLDEAVSALDVSIRAQILNLLKDLQKELNLSYLFIS
FT                   HDLAVVKYMSDKIAVMYLGVILEIAPREILFSNPKHPYTKTLIASIPEIDPEKIKNKTI
FT                   KLDEPSLTNIRNTSITPENATLEEVEKDHFVSKYLFDEMNNLINKNDT"
FT   gene            complement(346217..346972)
FT                   /locus_tag="BT0336"
FT   CDS_pept        complement(346217..346972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17670"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC8"
FT                   /protein_id="AAX17670.1"
FT                   /translation="MERILGWLFYFIFFFFNIFNICSQCYVIENFDLSLNEFLEVSTRK
FT                   DNLSPIVDSKRVIMFYPSNKGIRKIFAAFDFDGYAKKYLFKKNKYGLFFVKINLPHGVG
FT                   SIKYRLVVDGIWTNDEYNKNVVFNKDLIPFSIIDIGVDHSYVSLRNPIDSSDGREVEIF
FT                   YIGRPGQIVTIAGNFNNFNPFLNRLVEQEPYKGVYTIKLKDLPKGRIYYYFVDSGNKVI
FT                   DKNNVNRINLYLVEGIDNKMDFEVSYFDN"
FT   gene            347005..348399
FT                   /locus_tag="BT0337"
FT   CDS_pept        347005..348399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0337"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BT0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17671"
FT                   /db_xref="GOA:A1QZC9"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZC9"
FT                   /protein_id="AAX17671.1"
FT                   /translation="MQKYYTFVSFIIILKIYTKVNIQILTNKERKMGFHIYEIKARQII
FT                   DSRGNPTVEADVILEDGSLGRAAVPSGASTGTNEAVELRDGNKSVYMGKGVLKAVENII
FT                   NIISPELEGMSALNQVEIDKKMLELDGTPNKSKLGANAILAVSMATARAAAEHLGLKVY
FT                   QYLGAYKANILPTPMCNIINGGAHSDNCVDFQEFMIMPIGAKTFSDAIRMSAEVFHTLK
FT                   GILSKKGYATAVGDEGGFAPNLKSNEEACEVIMEAIQSAGYTPGTDIAIALDPATSELY
FT                   DPKTKKYVLRWSTKEKLTSEEMVEYWAKWVEKYPIISIEDGMAEEDWDGWKKLTDKIGN
FT                   KVQLVGDDLFVTNTSFLKKGIEMKVANAILIKVNQIGTLTETFEAVEMAKKAGYTAIVS
FT                   HRSGETEDTTIADLVVALGTGQIKTGSLSRTDRIAKYNQLLRIEEELGSIAEYHGRDVF
FT                   YSIKKQ"
FT   gene            complement(348450..348860)
FT                   /locus_tag="BT0338"
FT   CDS_pept        complement(348450..348860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0338"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17672"
FT                   /db_xref="GOA:A1QZD0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZD0"
FT                   /protein_id="AAX17672.1"
FT                   /translation="MAKSDVKGINLGMGTGRRKSSVARVYIREGKGDIKINNRDFDSYI
FT                   QLENLKTIALSPLVLTNTLGKYDLYINIYGGGISGQAGAIRHGIARALFDLDEEYKMVL
FT                   KSNGFLTRDSRKVERKKFGKKKARKSFQFSKR"
FT   gene            complement(348871..349320)
FT                   /locus_tag="BT0339"
FT   CDS_pept        complement(348871..349320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0339"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17673"
FT                   /db_xref="GOA:A1QZD1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZD1"
FT                   /protein_id="AAX17673.1"
FT                   /translation="MNRITNNKTIWVKPKCVEKKWCMIDASDKVLGRVATEAVKILRGK
FT                   HKPYYTPHQDLGDNVIIINASKIRLTGKKYSQKIYYRHSRYPGGLRSDTFRTLSERKPT
FT                   APLEIAIKGMLPKGPLGRELFRNLKVFAGSNHMLNSQNFYKLEAN"
FT   gene            complement(349400..350185)
FT                   /locus_tag="BT0340"
FT   CDS_pept        complement(349400..350185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0340"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:BT0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17674"
FT                   /db_xref="GOA:A1QZD2"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZD2"
FT                   /protein_id="AAX17674.1"
FT                   /translation="MYNRSLFSCFPIIKRARFFYLYDIHGNRYLDLYLNGGLNFLGHRV
FT                   QGLNLILKQTFSRGLTASYPSVFRKQFENVLFSFFKEAGFVCIFKFERDARDFLLSLTD
FT                   QCCFSSPWEEKQGIYEFKAGFNNFRYPMLVKIPMPGCMSINIAIVDNLSRKIEFRDSFD
FT                   ALTLAVARHMLTKILSYEKSTKINFNIFATPIFKLINRYMFPLYKSEYHNEIFNEYLKN
FT                   GYLISPFFDVPSLVPLKFSKGDLDGFHKVSLKLQDKFGC"
FT   gene            complement(350178..351635)
FT                   /locus_tag="BT0341"
FT   CDS_pept        complement(350178..351635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0341"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17675"
FT                   /db_xref="GOA:A1QZD3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZD3"
FT                   /protein_id="AAX17675.1"
FT                   /translation="MEYKLLVGLEVHVQLGLKTKAFCGCKNDFGGIPNSRTCPTCLGLP
FT                   GALPSINKELISSAILAGHATNSKIKNIIKFDRKHYAYPDLPKGYQISQNDAPICENGF
FT                   IFIETCSGLKKINIIRIHMEEDSGKSLHLLESENRSYIDFNRSGAPLLEIVSNPDINNG
FT                   EEAVAYLSALREIFRYLDLSDCNMENGSFRCDVNVNLLINENGVEYKTPISEIKNLNSF
FT                   KSVKLAIDYEKSRQKEEWILHRRTFESVGKHTMGFDDKKGITVLQRSKETVADYRYIKD
FT                   PDLPLIKLDDSYIESIKSNRMVELPFDTRVRLKEQYGLSDFDVVTLTADKNLVKYFEEA
FT                   AIASSDPKRVANWILSEVLSVLNDREMNILDFNLPPSYISELVEFIVNDRVSGKIAKEI
FT                   FLEMLERNVSSAIIINEKNLAQISDISFIESVVFEVLNENPKSIELYKKGKSHAIKFMM
FT                   GQIMRKTSGRVNPVLANEILMNKLRDV"
FT   gene            complement(351625..353070)
FT                   /locus_tag="BT0342"
FT   CDS_pept        complement(351625..353070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0342"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17676"
FT                   /db_xref="GOA:A1QZD4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZD4"
FT                   /protein_id="AAX17676.1"
FT                   /translation="MDFRGLSLIKIKELILARRCKIYDIVLFYKELYEANKDINGYIEF
FT                   FDDSLELAKKYDELLGKGEGQNLPLIGMPIAVKDNISIKNKALTCASELLQGYVSPYDA
FT                   TVIKRLKDSGAIMIGRTNMDEFAMGSSCEFSYYGVTLNPLNKEYVVGGSSGGSGAVVAA
FT                   NQAPFALGSDTGGSVRLPASFSSLIGFKPSYGGLSRYGLASYASSLDQIGFFANSIDDV
FT                   ALILKYTCGIDKMDATSIDLIQDPYPLLSKSLAGTKLAVIKELSEDLMEPEVACEFSKF
FT                   KSALLNRGVEIHEVSIEAVNFVLSLYYSLSPVEAASNLARYTCLHYGKRLNDELNLNDF
FT                   YYRHRSLFLREEVKRRIVLGNYLLSEGYDLQYYVKACKIVENVLIPKFNEIFNNYSYII
FT                   TPTSFVKPFKIGENFDNPIKMYYSDMCTVIANLIGAPALSIPFSQDDRGLPIGMQIIGQ
FT                   VKRDFDLLSFAKNVIEELGLNGI"
FT   gene            complement(353082..353366)
FT                   /locus_tag="BT0343"
FT   CDS_pept        complement(353082..353366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0343"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17677"
FT                   /db_xref="GOA:A1QZD5"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZD5"
FT                   /protein_id="AAX17677.1"
FT                   /translation="MRDIRDIRLEDSLKLSLLRLSKNEEREFAIKFEKIIGMLNKISEF
FT                   EIKDGIQKEACNFSVLRNDEILPSLAIESIKNFSNVFVDGYFSSPKVLG"
FT   gene            complement(353376..355469)
FT                   /locus_tag="BT0344"
FT   CDS_pept        complement(353376..355469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0344"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17678"
FT                   /db_xref="GOA:A1QZD6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZD6"
FT                   /protein_id="AAX17678.1"
FT                   /translation="MDKIEKFLFSLNSYQKQIVLDDTKNPILVLAGPGSGKTRVITAKI
FT                   AHLIKEMQLKPEEILALTFTNKAANEMNLRLNYLFDFNKALHIQTFHSFGAWLLRLYFK
FT                   EFDKNYDSNFTIWDTNDVVKFVKQIGLASTIELSKHVASFILKYKENCFLDNYCGLDEK
FT                   SYKDIKFYEQEKSKNNAFDFADLILKAVLMLRDCEDVKMRVQKKFKAIFVDEYQDTNYT
FT                   QFLFLKELYCKDMHFMVVGDEDQSIYSFRGARIENILEFEKIFDNVSKYYLVQNYRSSL
FT                   SIVNVANDVISKNRNRYEKVISTENKMGKKIRFFVFRNPAEEAEYFSNFLIENQLETAV
FT                   LYRFNYQSLQFEKSFFKHNIPHKILGSIRFYEREEIKDVISLLRLFVNKKDKISFLRVI
FT                   NKPARGIGKTTTNKIIAMLNDRNVNFDLILASRKVADSLKGKAKDSLVAFLNLYDKLAE
FT                   SIQKDVYVNLSEFIKNVVIRSGFWDYYQKFDGDEKSRNIDELISSGVEYSGSFEGLVIF
FT                   LENSSLSPLIHGDSKSSILLSSIHGVKGLEFDRVIISGLEKGLLPAEIEELTGERLEEE
FT                   RRLFYVAITRAKFELIVTMNLQRFFGGMLRNTAMSVFFQDISKDNYDIVFVPEYLKDNF
FT                   KYFFSKSGNKSFNIGDYITYNGENGIVVDKWYQNGEPFIKINLRNGRKAILSSSYIKGL
FT                   AKI"
FT   gene            complement(355469..356668)
FT                   /locus_tag="BT0345"
FT   CDS_pept        complement(355469..356668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0345"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17679"
FT                   /db_xref="GOA:A1QZD7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZD7"
FT                   /protein_id="AAX17679.1"
FT                   /translation="MERNNFIRFGDFIKKARIDKGLTLEMISDDIRISVKYLKALEDSN
FT                   IELFPNEVLALGFLRTYSEYLGIDVWYVSSLFKEYKRRLNSSYIGIKTEDQNGSLNFVN
FT                   EGRLGGQYLDLSKIAFPKMIQILVGLVSIILLILLISNFSGIKQFLGNFFKANHAAKRA
FT                   PEVHEVLFDKESFWNVALGDGDFLSLVYGNTIANYRVSFMNDDLVVTNDLKNGRYVFKL
FT                   GKFREIDLSDNVKVKIVYDNYSQGKVRKAHVSLESFMLNIEYVLETSLSSRFNVLNWGF
FT                   EVNGPKSRVISEYPTVYSSQDISNIDLMINFLNDTFLRYADESNIYGKSLLVSKGLPLN
FT                   LKFKKSLILFLSRLSDVNIILQGKDITSILKSYGREIMAVQFFWLKTPGGFDLKVSEVY
FT                   "
FT   gene            complement(356680..357333)
FT                   /locus_tag="BT0346"
FT   CDS_pept        complement(356680..357333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0346"
FT                   /product="outer-membrane lipoproteins carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17680"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZD8"
FT                   /protein_id="AAX17680.1"
FT                   /translation="MKKIILILCPCLIFAQVSANQYFENIYSNYQNIEDMQAKISLNIK
FT                   GLKQAGTLLYKSPDKFIVNLDSNNQVFVSDGEILTVYVPTLGTSFRQQLTMGKVGSGFM
FT                   NILSTEYSVSYTNSPNLEPLDESGGGNTENFIKLTFSRRLYKGAATIDSFMIAFTRNGV
FT                   IRRVIAYPTGGGREIIIDLLSVKFNVGIPDSRFKYDLPKTSNKVDNFLYDVKKT"
FT   gene            357499..358908
FT                   /locus_tag="BT0347"
FT   CDS_pept        357499..358908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0347"
FT                   /product="fibronectin-binding protein"
FT                   /note="fibrinogen-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17681"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZD9"
FT                   /protein_id="AAX17681.1"
FT                   /translation="MSLNYSEINILLKEVPLKNSFLRKIKQPNHKTLIMELYNKETEKK
FT                   NFNILISLDPKKTRIHKTNKKFENTKPPLRFFEFLKSKVQNGKILEAYQIKNERIILIK
FT                   VFKDKIIIFIFIKLWPSSPNIIATDANFKILDAYYRKPRSKEITGEIFTKAKEIIENND
FT                   ITDKKEVKLKDGYNNEISYSEFIENYYDNLEIKETQAHNIELLKQKYEKEKINLEKKIN
FT                   SLEKQINSIEKIEDQRKKGEMILSNINKIKKGMDEIILNNNNGEQIKIMLDKALLPKDN
FT                   ALKYFKEYKKNKNSLKIIQEQLEYAKTQYNTLISKTAYIDKTDCIIPTNEKTKKQKITK
FT                   KPSIGLHFISYGFEVVIGRNAKENDALLRNWAKGNDYWLHTRDYPGAYVFIRSKKDKTP
FT                   PLEVLIDAGNLCVFYTKPARQSGEADLYYTNVKYLRRIKGEKKGLVIPNREKNLNIKLD
FT                   NKILNKLKNKN"
FT   gene            359019..360452
FT                   /locus_tag="BT0348"
FT   CDS_pept        359019..360452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0348"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:BT0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17682"
FT                   /db_xref="GOA:A1QZE0"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZE0"
FT                   /protein_id="AAX17682.1"
FT                   /translation="MIQKLTKIVATISDLRCDPEHIKELYEAGVNVIRLNTAHQSHDDA
FT                   IRVINNVRKVSNKIALMIDTKGPEVRTANIENPITVKIGDKIIISTSPINESNALQTNY
FT                   DGFVNEVPNGSTILIDDGELEMTVIEKLTDRLICKVKNDGQIKNKKSINTPGISLKLQS
FT                   VTEKDKGFIELAAKQNIDFIAHSFVRHAKDIQDVKDILNAAGNPDVKIIAKVENQEGID
FT                   NIEEIAKASYGIMVARGDMGVEIPAEDVPLAQIKITKTCIKYGVPVITATQMLHTMIEN
FT                   PRPTRAEVSDVANAILNGTDAIMLSGETAYGKYPIEAVKMMTKIAIEVEKYREKTLFQD
FT                   EIFHSKRIIRNYIIKCAIDAIKIMPVKAIIVDSLKGRTARIMATYRASVPLFITTNNER
FT                   IARELSLSYGVYANLVDHNFKATTEFVVTSLEMLKTQKVVQDSDIVVIISGNPNRDTNK
FT                   GTEFMEINTVEEAIKGHNR"
FT   gene            360554..361210
FT                   /locus_tag="BT0349"
FT   CDS_pept        360554..361210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17683"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZE1"
FT                   /protein_id="AAX17683.1"
FT                   /translation="MISYGAYEFFLNNIALFKKVIAHNTKNVFIFSQTKENSQINISDH
FT                   QTWKFFNKTIDVNLDIINLIKNFEFTNTEDKIIENDHKIEIVLNFIKDITQDIKIIPII
FT                   LGKLKNQTLREFCTFLNPLITKEENSFIFLSHFISHSTHLNKSIQLSTTLKGLLSTPNL
FT                   NSSTLLEYYNARKIFPENINAIIIIHKLFHKFEFINQQIINNDNEYSIIENILIN"
FT   gene            complement(361231..361509)
FT                   /locus_tag="BT0350"
FT   CDS_pept        complement(361231..361509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0350"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17684"
FT                   /db_xref="GOA:A1QZE2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZE2"
FT                   /protein_id="AAX17684.1"
FT                   /translation="MGRECEITGKKTMFGNNVPRKGLSRKKGGGGQHIGVKTRRTFKVN
FT                   LINKKFFVPELGKSINIKVSASTLRSISKLGLSVFLKKNSKKIEDFI"
FT   gene            complement(361519..363159)
FT                   /locus_tag="BT0351"
FT   CDS_pept        complement(361519..363159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17685"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZE3"
FT                   /protein_id="AAX17685.1"
FT                   /translation="MYNFYSYFIILDLFENSRFYSERRVASLGLVDFLVSIFNRELTPE
FT                   QVKQRRLREVKNNLSKVGNFFNASKIQALPQFAKFIYNLYKAFMPFKFFVQRYRTSNKI
FT                   IHFVVEKYLNDNQKQALEYIYSFSSNDVVNFTPDISKNLDNNLNYLLNNITQEQIRLID
FT                   ETCGALDIFFDLASYQYYSIIKNFDSLFPENDFIYKPRFNTVSCGVILDDIKDFLECIY
FT                   SIRDVSIWRNLYDILLEVYGDRDNFPIKPNVWLKILTSIIEINKNKEILYLIRYVSGDP
FT                   DYLPISGVKKAKAKAKLFFNDLSKHVSNERAKIEILQKNSKSKLLAEKLFPGMTLVSLE
FT                   NYSERMHAKITSAIVNTTGYVYSDLLVYIKTHAVNFVKKELSDIINVLIIKGQWKDMEV
FT                   SREISNDIHSLVGVYSNLIDFDNNLGEQGTYGNRINSLLHRISVGDKSSEKLLLNIIAD
FT                   INKKALILLNEYYLVIKSLERRLNDCLEDYFKPASEKEFIYNWKELDIELVKSYGNNVN
FT                   FGSIIKNVVDSLNLFLKLMDLYLEKKNTV"
FT   gene            363202..364335
FT                   /locus_tag="BT0352"
FT   CDS_pept        363202..364335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17686"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZE4"
FT                   /protein_id="AAX17686.1"
FT                   /translation="MCIKKPILIIVFTLIFSCSRNDTITILTDNKIMPFYINQFNIQNK
FT                   TSFIIKYREHINMQTINEENAQVIISKNIDNININKNFKNIQQYYYSDYPILNNISEKF
FT                   AYRIVPLSFDVPILIYKNEYNIQKYIDIQNIKEIYKSFQKEKKIFISPYISENLFYTIS
FT                   EINDINFYFGNNKPEYNEKKMSDMINHFKSFIDTNELELHKNFTEKYKYLNLEKILLQK
FT                   KTILIAGLTNLTYYNSLNKDIKDKINFSYLTNKEKKSSICNINFMGVKEISTPIEKFIQ
FT                   WILNQEVQKSLIKLKEKAKFNEHFGFANGFTPYKGLNLKLKHIIKKIPLFIIDENYINK
FT                   NSYIITKEQIEKENRMINELFLSNINNTKANEDHSSL"
FT   gene            complement(364320..366122)
FT                   /locus_tag="BT0353"
FT   CDS_pept        complement(364320..366122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17687"
FT                   /db_xref="GOA:A1QZE5"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZE5"
FT                   /protein_id="AAX17687.1"
FT                   /translation="MLYMKRELYTFVSKFFILLLLFICFVFCYTYFFGADYLDKHVLIA
FT                   TLFDTILSVYHYFNGFFIFFVLVYFIFLAKHETRLYLRDYKGYLFKKLSPFMFLFFIIG
FT                   IVFMFVFNSIMSYVLTQRSEYKYNYERYNLLAGQANAIVNEVKSIDINLSSNKTLDVNE
FT                   LIEILQQKRKYLEELLRMYEKMRLISDNDELSINYYLTRSEYDRMPIYDVDLEKVRKTL
FT                   KLRLIKNLTKRDFQDIVNGFISKGDYSTANYFAYMGLVSTRDDEFAALLDLTFKAINEY
FT                   KNIEIEKKSLIFEEKQKNFLYLNTEKFKPAYYGFLRLHNLFPNDNEILSYKNKSLEKLK
FT                   DEYFFFDEIEKHYEHYGINDIFLFQPNSGNGTYDYIYMQKVVNTVSSYIKMIKNFELIR
FT                   FNRSGNIILHIKVPFATLKGNGVYQNVLDKKNENSDITATRMIVSLTDFDLSNTKIINI
FT                   NNDVNNLRLFANSGKDSIFLPIQVLLGAFNRVKTFNLILISVFSSSLFLMMSPILLVFF
FT                   GVMFTAVASKISFEFDSKLMIFLISLIIAIFSGIISLFINYLLLILIALFIQISVNIYI
FT                   SFILIFSILFFIVLHIIRVNYKEE"
FT   gene            complement(366129..367070)
FT                   /locus_tag="BT0354"
FT   CDS_pept        complement(366129..367070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17688"
FT                   /db_xref="GOA:A1QZE6"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZE6"
FT                   /protein_id="AAX17688.1"
FT                   /translation="MLSILRFIFLISFRFIVMFVIFSLMFVCTSYLKYKFLQANLSIVS
FT                   FELYYDAYLYAFPLSLVVTFMRIAYPFNVKTLRVSGGFYGIIFIFILLLSYFGFLASAN
FT                   FNSVFLDFHSRGEKIIKDGVVHFFDDKIVFYSDDVKSFGFKGVLKVEDNGFNEGDFKTF
FT                   SYDSDFSESDIMNFNANSFFTQKLYNDLINYVFSDLDTLNNFLFSLESFSLIFNIFGFA
FT                   LLLFSFSYVFNLIFSSGLSFFLYPIFIILFFKVYNIYAIEFPESLDLIMGENVVSNYVP
FT                   FIFCVLTFFATYLISFIFKYIRVSEGFDNSLR"
FT   gene            complement(367105..367590)
FT                   /locus_tag="BT0355"
FT   CDS_pept        complement(367105..367590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0355"
FT                   /product="CarD-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BT0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17689"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZE7"
FT                   /protein_id="AAX17689.1"
FT                   /translation="MAFVLDQAVVYPMQGVGKIKNIQNKEFNGEFIDYYEIYFPFNEMT
FT                   FMVPVSRADDLGIRALVSKEKVEEVFNIIKDFEEQIDQKKIKDGSHDFYKQSDILSTAK
FT                   LYKFLYTKSMQKELPFYEKRILNDFELILQHEISLALQISFEEAKQKIKEVLSMGKS"
FT   gene            complement(367637..368230)
FT                   /locus_tag="BT0356"
FT   CDS_pept        complement(367637..368230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17690"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZE8"
FT                   /protein_id="AAX17690.1"
FT                   /translation="MANLKDIYSKPDRIYFFGIPIDVFKSSDKLIGRFEYLVSYPYHSM
FT                   VIFIDCKSLLKFLFFKKFRNLVRNSSLVFSNSKLLRALCKFFKRIDIGCYDSNSILLVL
FT                   MSVLENTYKTCYIIDKDKIISKRNFLRLKESHKEINFIGYYDLKAVKRNKEMFFANINK
FT                   LTPSMIISFCSDSYLEDLFYANKFGIRTNLSVFL"
FT   gene            complement(368223..368951)
FT                   /locus_tag="BT0358"
FT   CDS_pept        complement(368223..368951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0358"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17691"
FT                   /db_xref="GOA:A1QZE9"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZE9"
FT                   /protein_id="AAX17691.1"
FT                   /translation="MKQIVLDDTCLFDNDIIIDDVKIYHYLVDVRRVKVGDTLNVLLGG
FT                   REVRFAEISSIDNNLIKLSTLKVEMLKKRDFEVSIFISSLKGRKLDLSLRQVVEIGVDH
FT                   INIVNADNSVARIDMDDLEFKSTRFLKLINEALKQSGNTQVPSLNFYKNFFSISYSPSV
FT                   NYYVAHKEGVLLGCGDDISVFGKIGILIGPEGCFSKSEIDFFKKLNFKFVRFNTPILRA
FT                   DTAVVYSLAHFKLLLEGNNG"
FT   gene            complement(368955..370385)
FT                   /locus_tag="BT0359"
FT   CDS_pept        complement(368955..370385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0359"
FT                   /product="carboxy-terminal processing protease precursor"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:BT0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17692"
FT                   /db_xref="GOA:A1QZF0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZF0"
FT                   /protein_id="AAX17692.1"
FT                   /translation="MKKKCLVFVYFVLALSISSSVIVESIFAQTDPSKGKMSASTYGQM
FT                   MMDAFNFIKRNYVEPVDDEAIFEGALKGMFKALNDPYSQYLTKEDLVEISKTTEGNYVG
FT                   IGVSIVKKNVPVKSDSSVLDASYVMIVTAFEEGPAYKAGVKSGDYITDIDGKSTTLMTI
FT                   EQVGSLLKGKAGTKVKISVLRDKDLKLEFELVREKVDIQTVKHDVINKSVGYIKILSFN
FT                   PNTNTYFKKAFEKLQAQNIKSLILDLRFNTGGYLQDAIEIADDILAEGLIVSTRARDSK
FT                   VPVEYKASSSHIVPLDMPIVVLIDKHSASASEVLVGALKDNQRVYVIGEKSYGKGVIQR
FT                   ILPFYTGGFKITNSKYYTPSGHSIHNIGIKPDLEVGEREFSETEVLAYRQILDKKLVED
FT                   FLNSRKNKKSITEKEIDAFVDKILKEHSIHNIDKDILGYYVFSQFYQDTHNEMPIYNLH
FT                   YDKPLRAAYEYLVKGTKN"
FT   gene            370446..370874
FT                   /locus_tag="BT0360"
FT   CDS_pept        370446..370874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17693"
FT                   /db_xref="GOA:A1QZF1"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZF1"
FT                   /protein_id="AAX17693.1"
FT                   /translation="MLKTNNSKTKRIITGLVLILQTVASILILLALYGFAERTIFVNNS
FT                   SIKFMIAFIIFSPELCISILTTNYILYEQFKILHNLIIITKTFQIVMVFLLIILGLSLD
FT                   LLYVYQPWIFMLLGIIITYTIFNAMILILIKIKDKITG"
FT   gene            370879..372012
FT                   /locus_tag="BT0361"
FT   CDS_pept        370879..372012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0361"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17694"
FT                   /db_xref="GOA:A1QZF2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZF2"
FT                   /protein_id="AAX17694.1"
FT                   /translation="MIIIPVASGKGGVGKSLFSTNIAICLANEGKKVLLVDLDLGGSNL
FT                   HSMLNIIPKKSIGTFLKTKIPFKDVIIESGIKNLSFIAGDSDIPELANIAIFQKKKIIN
FT                   NLKNLSYDYLIIDLGAGTTFNTIDFFLISNRGVIITIPTVTAIMNAYLFLKNAIFRLIA
FT                   KIFTKETKAYKLISDIKKDSSDLQRIYIPNLLLKIETYDPESYEKFMKKFSQFSPFIIF
FT                   NMLNKPDDIKKIKKILKSAKDYLNINLQSIGSIYKDELIDKALNHKIPITIYKPTSLTS
FT                   KSIKKIAKKLIELETIINDVELLSEDDLNESYHFVIQEAQDEYLEKYAYLESLLMNKTI
FT                   DNNAIIDIIKSQQKEIATLRKQNIMFKKKLFAQLKKD"
FT   gene            372023..372982
FT                   /locus_tag="BT0362"
FT   CDS_pept        372023..372982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0362"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17695"
FT                   /db_xref="GOA:A1QZF3"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZF3"
FT                   /protein_id="AAX17695.1"
FT                   /translation="MPNYINYPSWLHPEIIKGIPITWYSLSYIIIIIISYKFIWYQIQT
FT                   DKINIEKSDYEKLMFSLVMGAIIGARLTSTLIYDRSGIYYTHPWLIFLPFDRNWNFTGF
FT                   RGMAIHGGFFGVIIAPIIMINTKLKNTNIKKYFRKITDYGAIAFSSGYILGRFANFANA
FT                   ELYGRPMKGGIIFPNAELFKVSQKGVREFAESIGLEILPHDLFINLPRIPSQLIEGLFE
FT                   GTVTFLLLWFIFRKIKRYDGFIFGVYIILYGLFRFFIEYLREPDKEIGFVITYKKPESI
FT                   LDFSFLNISIGQIFSLILILSGIIWLSWAKTRSEKLKK"
FT   gene            373034..375025
FT                   /locus_tag="BT0363"
FT   CDS_pept        373034..375025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0363"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17696"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZF4"
FT                   /protein_id="AAX17696.1"
FT                   /translation="MKNPNAIVISEGTINDNDITKIKSIFKISQIVKSRKNISSEYIKQ
FT                   SNIKFAIIYNHKRPIDFSINMANDLKSINNIHSIIIDNKSIDEAIYRPNYIEILKNISE
FT                   LNDKNKLIQQKKLYYDNNNANLDFFLNLSELIQEIVIITNTDNDIIYINEKGSKELELP
FT                   IKIGGKTNKISDINIMDLEKNTKIDLSYNINDIPEFKNILITDCLLKIKNNKKLIVDLF
FT                   ISTIAQNNIDKLITIKDISELKSKHNIQDLTIIDQQTDLYNIKGLEKLLINQIESSYKK
FT                   IYLFDLDLHINTECKYKDKKANSDLKILKKITSRIMSFYSEYIFRLKDNNLIVIISTRG
FT                   GEQRLISIAEEIKKTISRELKKEGLIIFKFNIGIIEVNLKEDIETKISKLKIATKISDE
FT                   YKDSTPILYKDELPETILIKKQNKIFEYIVKAIKNDFFSLYYQKITPLKKDLKPKIEIL
FT                   TRLFDYTGTPIPNGNVFSLIDKYNLTVEVDKLVVTKALREYTNFVAKNGAHIFSINISP
FT                   YSLKSKNFRMFLKETLLTSHVPLQNICLEITETGILENFELINTYFNELKTFGIKLALD
FT                   DFGSGYTSLSYIKILPIDIIKIDGSFIQVINSSQTDLVIIKSIKDIADTKKIKIIAEFV
FT                   SNEEILKKINEIGIDYGQGFLWHKPEPI"
FT   gene            375197..376573
FT                   /locus_tag="BT0366"
FT   CDS_pept        375197..376573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0366"
FT                   /product="probable M18-family aminopeptidase 1"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17697"
FT                   /db_xref="GOA:A1QZF5"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZF5"
FT                   /protein_id="AAX17697.1"
FT                   /translation="MTKQNPWTSLNEEDRNNILEFTQKYKKFLSTVKTEREATNYATQR
FT                   AKEKGFINACEKQELKAGDKIFYTCRNKNIALVFIGKEPIENGMNFIVSHTDSPRLDAK
FT                   PSPITEENEFTMMKTNYYGGIKKYQWLSLPLSIRGIIFLQNGEKVEINIGDDKNDPVFV
FT                   IPDILPHLDRKVQRDKKADDIIEGENLKIIIGSLPIETKEKEKVKSATLKLIKEKYKIE
FT                   EDDFVSAEIEIVPAGEAKDVGFDRALIGAYGQDDRVCVYTSLEAILNLEETPSKTAICF
FT                   LVDKEEIGSTGSTGLNSRYLEYFVSDIIFKLEQNKYNNLFVQKVLWNSKSISADVCGAI
FT                   NPLFKSVHDEQNAPKLGYGISIMKYTGHGGKIMASDADAELVSYVRNLLNKNKIAWQVA
FT                   TLGKVDEGGGGTVAKFLAHYGIRTIDIGPGVISMHSPFEITSKFDIYTSYTAYQAFFKG
FT                   "
FT   gene            376570..376845
FT                   /locus_tag="BT0367"
FT   CDS_pept        376570..376845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17698"
FT                   /db_xref="GOA:A1QZF6"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZF6"
FT                   /protein_id="AAX17698.1"
FT                   /translation="MTNMNKETIKTSEHILECFGGIANIKQVDKDLTRIKILVDSNSLV
FT                   KRENLTEDHNIIGAIKSNEFTEIVMNFEIIDDVYSNIVYMMNKKIQ"
FT   gene            complement(376860..377912)
FT                   /locus_tag="BT0368"
FT   CDS_pept        complement(376860..377912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0368"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:BT0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17699"
FT                   /db_xref="GOA:A1QZF7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZF7"
FT                   /protein_id="AAX17699.1"
FT                   /translation="MKISIVGAGAWGTAIAKVLSDKFKDNVLIWSFEEDVRDSINNDHE
FT                   NVKYLKDIKLADNLVASSDLHDVVDQADYVFVVTPSLYTLNVLNKLKGMYTTKKFNLAI
FT                   LTKGFITIDGRPCTIIDVAESILSDYKDEITYIAGPSHAEEVGLGIITGLVAASKNRAN
FT                   AFEFINLFSDTSISMFYSDDILGVQIASALKNIFAIAFGILDEYKIENPNLIGNNTESF
FT                   LFSVSLNDMKNIAFKLGSCNAETFLFLAGSGDLDVTCRSIFGRNRRFGREIVSKNILEG
FT                   LAGINDLINNIHKIGYLPEGVIAANEVALLFKCLGSDSSYHNLASIVYKILNKELRPEA
FT                   VIDYIRNFKV"
FT   gene            complement(377937..380225)
FT                   /locus_tag="BT0369"
FT   CDS_pept        complement(377937..380225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0369"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17700"
FT                   /db_xref="GOA:A1QZF8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZF8"
FT                   /protein_id="AAX17700.1"
FT                   /translation="MYNRRALNNLFFKSFLFFMKRKHLVFTEEHIFYSLISDEKIKELL
FT                   SLCTLDFYSFNKILEKFFKKLPLRDSDISDYLFKMNDLYQEIVDTIFYYKKPYRLQEKD
FT                   LLWVLIRKRKNIILDALLKSGFSLTIFDKIIEVYDYLGSDLDLNSSENEKFIANDLFGK
FT                   EIDKDGGLSIFEEDYLKLEQSDDLSDNDNLVEDFLVNVIDSLEPSLDKNPLIGREEELC
FT                   ELTQVMLRKYKSNPIVFGEPGVGKTILLQGLAYMIKVGQVPQELVGYEVYSLDIGRLIS
FT                   GTRYRGDLEDRVNKLLDFLYLKKKVILFIDEIHMIVGAGATSFSNIDVSNLLKPILTLG
FT                   KVKLIGATTKYEYQKFFLRDKALMRRFHSIELKEPSFEDTYLILKGSKEQYEKHHNVGY
FT                   TDEAIWASITMSKYIKDRFLPDKAFDLLDGLGAKFKLEGNKKVITGDDVKIFVKSMIGT
FT                   NVFNFDDYDQNLLINLERKIRESMIIDENILSDLILNIKLLRIKFLLKNNTLGIFILMG
FT                   SSDVDKNKLSCILSEELKIPKLTLGMSEYGDFDGINRLIGPVYGSESYDEPTKFFKFLS
FT                   ESSSSIIVLSDFDKSSKRVIDFFFEGFNTGRLFDSLGRSVSLSDSIIILDIDIKHREFD
FT                   GIGFKTETIDGRSLLEKRFSTQLLDLVDHIFFFKPVGEDDFEKVIIEEMNSFIKILKNE
FT                   KVDVFFEENIVDYFQNKTYRSGLGIKSVRKIVLKEIGGLLVNDMISKKFKENDKIRVFL
FT                   DETIKYELL"
FT   gene            complement(380236..381456)
FT                   /locus_tag="BT0370"
FT   CDS_pept        complement(380236..381456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0370"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17701"
FT                   /db_xref="GOA:A1QZF9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZF9"
FT                   /protein_id="AAX17701.1"
FT                   /translation="MNLALEILEKRGFLKQCTNLEALSTLMDKERVVFYVGVDATSTSL
FT                   HIGHLIPFMVMAHLQRQGHIPIALVGGGTTKIGDPSGKDAMRKILSKEDIEKNVKAIRA
FT                   QLLRIIDFSHGYILDNSAWLDNINYIEFLRDIGVCFSVNRMLGFETYKRRIKDGLSFIE
FT                   FNYQLLQSYDFYMLNKIKNCKLQIGGDDQWGNIVSGVDLIKKKLGTEVFGLTLPLITRS
FT                   DGKKMGKSEKGAVYLDAELYSVYDFYQYFRNVPDLDVKNFLYLFTFLGDDEIEHMSSVK
FT                   GYLLNKAKETLAFEITKIVHGEDAALKASSAARAAFKGSEGDRADIPFFKLALDSLEGS
FT                   ILLIDLMVLSKVVSSKSEARRLINSGGVYIDKVRIGDQDYCLNKDNFINGEIELKIGKK
FT                   RILRVIL"
FT   gene            complement(381453..382799)
FT                   /locus_tag="BT0371"
FT   CDS_pept        complement(381453..382799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0371"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:BT0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17702"
FT                   /db_xref="GOA:A1QZG0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG0"
FT                   /protein_id="AAX17702.1"
FT                   /translation="MFNMIKIEDIISLAKRKGFVFQSSEIYGGLSGVWDYGPLGIELKK
FT                   NIQKEWWNTMVYLHENVVGLDSSILMRPEVWEASGHVDSFLDLLVDCKNCKNRFRIDSI
FT                   DLSNGCSSCNSIGTFTAPRSFNLMFKTNIGAVEDSSNEIYLRPETAQGIFVNFRNVLDS
FT                   TRLKVPFGIAQVGKAFRNEIVAKNFIFRTCEFEQMEMQFFVHPNQMSDWYYYWQQKRMN
FT                   FFIETLGIRSDNLRFKEHKGDELAHYAKAAVDIEYKFPFGFQEIEGIHNRGNYDLSQHA
FT                   KFCGKPKLFEYHDLTSGDKYIPYVIETSLGLTRSVLMTLCDAYAHEELEGEGKRIVLRL
FT                   HPKLAPYKVAILPLVKKDGLPELARKVFMQFSDDFYMFYDDNGTIGKRYRRQDEIGTPY
FT                   CVTVDYDTIENRTVTLRDRDSMAQIRIPIDDLYSYIRTEILNYKGVANR"
FT   gene            complement(382822..384345)
FT                   /locus_tag="BT0372"
FT   CDS_pept        complement(382822..384345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0372"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BT0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17703"
FT                   /db_xref="GOA:A1QZG1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG1"
FT                   /protein_id="AAX17703.1"
FT                   /translation="MIFQKRISFTKRGYVVNIRVRYAPSPTGLQHIGGIRTALFNYFFA
FT                   KSCGGKFLLRIEDTDQTRYFKEAEEDLYQSLEWLGIDFDEGPTCGGPYAPYVQSQRTEI
FT                   YQKYAKQLVELGSAYYCYCTPERLERIRKIQTVNKMAPGYDRHCRNLSESEVRDVLSLG
FT                   ITPVIRFKIPLDGETCFNDILLDKITWANKDISPDPVLLKSDGLPTYHLANVIDDHLME
FT                   VSHVLRAQEWISSGPLHVLLYSAFGWNPPIYCHLPMVMGSDGQKLSKRHGATALKQFID
FT                   DGYLPEAIINYITLLGWSYDDKSEFFTKDELRRLFSIERVNKSPAVFDYNKLDFFNSHY
FT                   IREKGNNELAKLIIPFLQKAGYIKEDINSFDEQKLILLVSLIKPRIRKLSESVTMLKFF
FT                   YEDIKTWNLDEFLGKEKTAGDICLLLEKIKPLLEGFETRILSENEKIFYNFAKENNLKI
FT                   GEVLLPIRIAVLGSKVSPPLFDSLQLLGKTKVFNRINQAQQFLRRHECK"
FT   gene            complement(384314..385093)
FT                   /locus_tag="BT0373"
FT   CDS_pept        complement(384314..385093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17704"
FT                   /db_xref="GOA:A1QZG2"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG2"
FT                   /protein_id="AAX17704.1"
FT                   /translation="MVDRILFIFNIIFFVAFLYFVYLLEIFKFSNFLDFIFLHCSFILT
FT                   FIVFIFIFNIVYSKFLYSRLYFMLNGIEHTYTFLKLKILRKTLKSVFDISLLLKIILIK
FT                   QDKKSLDEIYFYLKDTKMSNKTIIELYSICISFREKEKASGLIANHAYSKNKWLRYCVA
FT                   LNTIADEDYEKLSNEINFLKRYFLRGDPIFTVYFYYVLKRSNLEYQLVEKNRLEIRDKY
FT                   FKYKDRLNVKHTRLLNSNLFFVVFYYIYDISKKDIFY"
FT   gene            385224..386363
FT                   /locus_tag="BT0374"
FT   CDS_pept        385224..386363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0374"
FT                   /product="sensory transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17705"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG3"
FT                   /protein_id="AAX17705.1"
FT                   /translation="MQNFDNLAKDIKNFSYIIDKDFLVWPQNSLLQPVNTELIEKWDLK
FT                   SSLKIQRTFFNETLIRETKKLINVEYDEESIANYHMLINNLEEIYENCKKNKKIYYQDV
FT                   LPAVKKVMEFYKKNQQTFIKYMKLPKLLSDYHIVHSINTAILTVALGNEMNLNNHKMVE
FT                   LCTIAILHKIGFLFIPLQISEKKEKLSNEEFEIIKKYPVLGHKILSTTNFSQSICSAIL
FT                   NHKENLDGSGYPNKLKSENINIESNIIGAASAYSAILLDRTYKGALNSGASLIELIQDA
FT                   DKKFDKRVLKLIIKVLSQCPLDFIVELNDNSIAKITKINEDNINVPYIKYIIKDDKIVP
FT                   PSENKNYVKSIPKTETGIKKILRQDEIEFISKKYGLKEI"
FT   gene            386376..387089
FT                   /locus_tag="BT0375"
FT   CDS_pept        386376..387089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0375"
FT                   /product="5'-methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17706"
FT                   /db_xref="GOA:A1QZG4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG4"
FT                   /protein_id="AAX17706.1"
FT                   /translation="MILITSAMDEESIEINKIIENKEEIILDDYSGEKKIYKGEIAGHK
FT                   VISLTTGIGKVNAAMWNSYIISKYKITHIINSGTAGGLKESEDLKITDIIVSSETAFHD
FT                   FNLTKFGHKIGQVPGFPQKFKADENLLNKVVNIIEDKLKNISVHIGLILTGDQFIGDKK
FT                   QLEEIKNNFADALAVEMESAAIAQVAHTFKIPFIITRSVSDLPNIKDNHIDFNKFLQDA
FT                   SMNSAKIVKELIKLI"
FT   gene            387108..388277
FT                   /locus_tag="BT0376"
FT   CDS_pept        387108..388277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0376"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BT0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17707"
FT                   /db_xref="GOA:A1QZG5"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG5"
FT                   /protein_id="AAX17707.1"
FT                   /translation="MLNNNLTSTSEAVSEGHPDKIADQISDAILDEILKRDKMAKVACE
FT                   TLVSQNLIIIAGEISSKAKKEINIKEIAKQTIKNIGYTNIEYGLDYKSATIIDAIGSQS
FT                   IDITNAVEKKDTNDIGAGDQGIIFGYACNETKNFLPIAYELSNLILQKASKLRKSGQIK
FT                   WLRPDAKSQVTIEYDSNKNPIRVNNIVVSHQHDPGIPQDFLRQTIIEKIIKPILQSKSM
FT                   LDENIKYYINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSA
FT                   AYMARYIAKNMVAAGISKEFEMQLAYAIGIPNPISIKITTGINNNEYEKKILSFIINNF
FT                   DLTPNGIIKKLKLREPIYSKTCTYGHFGKNELEWEKLDFVDTIKKEFKI"
FT   gene            388226..388747
FT                   /locus_tag="BT0377"
FT   CDS_pept        388226..388747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0377"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /EC_number="3.13.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17708"
FT                   /db_xref="GOA:A1QZG6"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG6"
FT                   /protein_id="AAX17708.1"
FT                   /translation="MGKTRFRRHNKKGVQNMNKIPSFTIDHTKLKPGIYVSRKDIFDNL
FT                   TFTTVDIRMKAPNREPVINNAEMHTIEHIGATLLRNNKVWGDKVLYFGPMGCRTGFYLI
FT                   LLGNYESKDLIDLISWLFHEIANFQGNIIGATEKECGNYQDHNLNMAKYESNRYLAILA
FT                   NIKEENLTYP"
FT   gene            complement(388890..389321)
FT                   /locus_tag="BT0379"
FT   CDS_pept        complement(388890..389321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0379"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /EC_number="3.6.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BT0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17709"
FT                   /db_xref="GOA:A1QZG7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG7"
FT                   /protein_id="AAX17709.1"
FT                   /translation="METILSGCIFCKIVKNEMSCYKVYENELVLAFLDINPLNVGHTLV
FT                   IPKQHSNDALGMSDELNGQILKVCKKVALSLKKLGSNICNGINIYSAIGSDAGQVIFHT
FT                   HFHVVPRFKGDNFGFTRGSNIELSGDEFLDLSKHISQNI"
FT   gene            complement(389372..390733)
FT                   /locus_tag="BT0380"
FT   CDS_pept        complement(389372..390733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0380"
FT                   /product="Mg2+ transporter MgtE"
FT                   /db_xref="EnsemblGenomes-Gn:BT0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17710"
FT                   /db_xref="GOA:A1QZG8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG8"
FT                   /protein_id="AAX17710.1"
FT                   /translation="MIDVVFLRTLLEEKKYSDIKEELLKYDAFDISEALKKLNGSDLIL
FT                   LYRFLPKKVAVEAFSNFDQGTKNKLANSFTNREIREMIDELNLDDVIDLLEEVPANVVQ
FT                   RFLASSTEENREIINKFLSYSDDSAGSIVTIEYIELKDYFCVGEALDYIRRVAKTKEDI
FT                   YTYYITDEEKRLKGVIKIEDLMLSGDDVIISAIMRTSGFYIVKVGDEKEDVALLFQNHD
FT                   ISSVPVVDNEGRMIGVIIIDDILEVIQNLNTEDFQIMAAVTPLGKSYLDTSIFDMTKNR
FT                   IIWLLILMISSTLTATIITNYQHLVLSLVILTSFIPLLMDTSGNAGSQASALIIRELAL
FT                   GTLKVKDFFKVLLKEVCVSILVGSILAGINFLRIVFFVIPEHNEKFKIAFVVSACLMIG
FT                   LMVAKILGGLLPILAKFIRIDPALMAGPLITTIADVVTLIAYFNIARLVLTNYF"
FT   gene            complement(390788..392245)
FT                   /locus_tag="BT0381"
FT   CDS_pept        complement(390788..392245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0381"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17711"
FT                   /db_xref="GOA:A1QZG9"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZG9"
FT                   /protein_id="AAX17711.1"
FT                   /translation="MIDICFSEVRALNKSVFPKIYYYDQDFIDIYNKSLSWIRDKIVFP
FT                   QALERGRKDKNYYSENLEFIDQLQACLSSFFLVYSNGEYSPTSTIDKFYELQEASGAIR
FT                   ARYDRNNNIVHIEGNDDGIGLPIFAWVEYNLYHKTGNKKRICDVLPVLDKYYKWIEKKF
FT                   LKANGLYSIDMNKIFYKNSPRNDAYYPIDFNSLQVHSAYCIAKLADILNDKNLSLEYKK
FT                   RFFSLKAKINSLMWDEKDGFYYDLDINENIVRCKTIVGFLPLLSEIPSEDRIERMIFYL
FT                   KSHEHFGTPNPFPTLSANDPSFNLDGNGYYGSVYTYMNFFVIKGLEYCRRSNIAREFTI
FT                   RHLYYILDTLLPDGKVKGHVWEAYKPMKEGPAYLDVEKKILPEKDVICYLALFSISLMI
FT                   ENIIGLTISLPDKTVYWNIPALEVMGIESLSLKKNQTTIICNKGKRGWEIKMESEKLYY
FT                   FTINILNKKEKTLPIPSGRCSMLLDKL"
FT   gene            complement(392490..393503)
FT                   /locus_tag="BT0382"
FT   CDS_pept        complement(392490..393503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0382"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17712"
FT                   /db_xref="GOA:A1QZH0"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZH0"
FT                   /protein_id="AAX17712.1"
FT                   /translation="MKNLFLILCMLCCSCFNSKVNGNLAKIAVLVDGVFDDKTFNKGAW
FT                   DGAKKVEKEFGLEIVMKESNSNSYLADLESLKNNGSNFIWLIGYKLSDSAIIVALKNPE
FT                   IKYVIIDPVYDSDLVIPENLSAITFRNEEGAFLVGYIAAKISKTGKIGFLGGVDNVIVN
FT                   AFRYGYEAGAMYANRNINIDNKYIGSFVNINTGRNMANEMYVDKVDIIYHVAGLAGLGV
FT                   IEAAHNFGDESYVIGVDQDQSHLAPDSVITSSIKDIGRILNIIISNYLKINAFEGGRIL
FT                   NYGLREGFLDFVKNPKMISFKLEKELDDISEKIINRKIVVPNNESTYNKFLKEFVN"
FT   gene            complement(393540..394610)
FT                   /locus_tag="BT0383"
FT   CDS_pept        complement(393540..394610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0383"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17713"
FT                   /db_xref="GOA:A1QZH1"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZH1"
FT                   /protein_id="AAX17713.1"
FT                   /translation="MSNNLCFIILFILLFVSCFSSKESSSFVDRQIIMGIMFPGNFDDK
FT                   GYFQNAFEGAVKITNEFEIKLLPKVLTPYPVEGKRLMTASEVLEEDVYTLQKDGANLIW
FT                   FISAHFSDSALRLAHENTNTSYGIIDSFGYDDNILIPKNFLAINFKAEEGAFLAGYLAA
FT                   KMSKSNRIGFMTGVNIKYVERFLVGFRAGAFYAEPKTRMIVKRVLDEFSEASGKSVAEH
FT                   MYIEDGVDVIFPVMGPAALGVFSAAKKLGAGHYVIGINKDQSSLAPGHVITSVLKDVGK
FT                   TIYNFSLDAIKKHKFNGGRIIEEGVKEGVIDIVKDPNIIGNNLFDTMTKIQTEIVNGQL
FT                   IIPSTEHEFDLFKARL"
FT   gene            complement(394772..395818)
FT                   /locus_tag="BT0384"
FT   CDS_pept        complement(394772..395818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0384"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17714"
FT                   /db_xref="GOA:A1QZH2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZH2"
FT                   /protein_id="AAX17714.1"
FT                   /translation="MRSFYMNKFVMFIFVVLTFLGCDKKSLTSKSLAKPIISLIVDGTF
FT                   DDKSFGEDAWKGSQMLEGGFGVEIIGKASTSTAYASDLEDLKDKGSSIIWGVGFRLQEA
FT                   TEQAATLNKDVNYGMIDVTYEDDINLPDNFLGLSFKVEEASFLAGYLAAKTSKTGKIGF
FT                   LGGMEGVVINAFRYGYEAGAKYANKDIELNSQYLESFVDLSLARTIALKMYEDGTDVIF
FT                   VAAGLAGLGAIEVAKELGAGYYIVGVDQDQSYLAPDNVLTSVVKNVGNSIYEITKNYLN
FT                   TNDFDGGKVLKLGLKNGSVSIVKHDSIKDDIKVEIETIEDKIVSGDISVPSNLDEYNKF
FT                   LDIYNLLN"
FT   gene            complement(395846..396877)
FT                   /locus_tag="BT0385"
FT   CDS_pept        complement(395846..396877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0385"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17715"
FT                   /db_xref="GOA:A1QZH3"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZH3"
FT                   /protein_id="AAX17715.1"
FT                   /translation="MMRGIYMLKKVFLFFFILGCSGSRDQTSLSDTISVIVDGTFDDRG
FT                   FNESSSNAMAQIKEEFKVNIIRKESKVSDYLADIGILEEGGSSLIWGVGFKFTDTFLRK
FT                   SLENANVHYGIIEGAYSEDVELPKNLVNVNFRSEEGAFLVGYLAANASKTGKIGFLGGM
FT                   EGVVINAFRYGYEAGAKYANKNIELNSQYVGTFSDLSLGHLMASKMYASGVDIIFTAAG
FT                   LSGLGAIEVAKELGNGHYIIGVDQDQSYLAPDNVLLSYVKRVDLVMLDLMRSYLDFGKW
FT                   NGGDNLEFGLKDGALDLILNKSISLDLIKDYDFLSEIKNKIVGNEIKVPKDEKSYGDFV
FT                   VNL"
FT   gene            complement(396934..397407)
FT                   /locus_tag="BT0386"
FT   CDS_pept        complement(396934..397407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0386"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17716"
FT                   /db_xref="GOA:A1QZH4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZH4"
FT                   /protein_id="AAX17716.1"
FT                   /translation="MSRKSKKIKKKVFKDSKYDSQVIAKFVNRMMYDGKKSISEAIVYN
FT                   SIDLLAEKTEEVDKVAAFSKALDNVKPLVEVRSRRVGGATYQVPVEVREERREALAMKW
FT                   IIAAARKASGKSMQEKLGNELVNSYNSTGVAFKKREDTHRMAEANRAFTHYRW"
FT   gene            complement(397422..397796)
FT                   /locus_tag="BT0387"
FT   CDS_pept        complement(397422..397796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0387"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17717"
FT                   /db_xref="GOA:A1QZH5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZH5"
FT                   /protein_id="AAX17717.1"
FT                   /translation="MPTINQLIRKPRKSQKEKTASPALQNCPQRRGICTRVMTVTPKKP
FT                   NSALRKVARVRLSNGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGAKDT
FT                   LGVNNRKQGRSKYGTKKPKA"
FT   gene            complement(397859..401992)
FT                   /locus_tag="BT0388"
FT   CDS_pept        complement(397859..401992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0388"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BT0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17718"
FT                   /db_xref="GOA:A1QZH6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZH6"
FT                   /protein_id="AAX17718.1"
FT                   /translation="MKEIKDFEKIRIKIASPDQIRSWSYGEVKKSETINYRTLRPEKDG
FT                   LFCERIFGTTKEWECYCGKFKSIRYKGIICDRCNVEVTHFKVRRERMGHIELSAPVAHI
FT                   WYYKYIPSRIGLLLDITASNLNSILYYEKYIVIEPGDTDLKKMQLLNEDEYSEAKERYG
FT                   MSFSASMGAEAIKTLLENLDLDELSSKLRLQMIDKDDKTDKKLLRRLEIIENFKVSGNK
FT                   PEWMIMDVLPVIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLRKLLLLNAPEIIV
FT                   RNEKRMLQESVDSLFDNSHKRKVVKGTSNRPLKSLSDALKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELKLHQCGIPAKMALELFKPFVIRKLIESESVFNIKRAKSLIEQEVDEVWQ
FT                   ILDNVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCHAYNADFDGDQMAVH
FT                   VPLTPAAQAESWALMLSTNNLLNPANGHPIVFPSQDIVLGLYYLTMERKNVVGEGRKFS
FT                   NFNHVLLAINNKSLDYNARIYVKVDGEYIETTAGCVVFNEALPGKISFVNKTLSDYELQ
FT                   NLISEVYVVYGSSIVIEMLDIIKELGFKYATKFGCTISMSDIIVPEEKKVYVDKANREI
FT                   AKIQNDYTKGVITGEERYNNVVSVWSKTNEELTNKMMEILKKDRDGFNVIYMMADSGAR
FT                   GSRNQIRQLAGMRGLMAKTSGDIIELPIISNFKEGLSVIEFFISTNGARKGLADTALKT
FT                   ADAGYLTRRLVDIAQDVVVRIEDCGTINGIKVEALKNGEEIVEPLREKAVGSYSIERIK
FT                   SPITGEIILDVNEEITEDKIKLLETVGIDKLVIRSVLTCEAEHGVCQKCYGRDFSNNKP
FT                   VNIGEAVGIIAAQSIGQPGTQLTMRTFHIGGVAQAGSEDDKIALKNSFILNGLEGFNVQ
FT                   VDGGLLFTRKGTLRVINVIYEEDIKDIKEFKVLDSQKVIKGMPLFTSKDGIDVLSSHIG
FT                   YVRIKDNKLMIVSEEQEISLKTGTKLEVNVGDYVEAGRVIGTFDPFAEPIIAEVRGKVK
FT                   FKDIILGTTLKEEINLETGNIEKRITDQVFESLDPRILIINDRGIEIASYVLPGDAYLQ
FT                   VEDGQDIDIGDIIAKLSKGSEKTQDITGGLPRVNDLFETRIPKNLTEMAKVSGVVQFKA
FT                   IQKGKRLINVLDEYGVEHKHYIPAGKHLLVRDGDVVKAGDMLCDGRINPHDVLEILGGI
FT                   SLQEFLLAEIQDVYRKQGVSINDKHIGVIIKQMMKKVKIVSVGDTNFVYNQKVDKHTFY
FT                   EQNKRVIEQGGEPAVASPILIGITKASLNIDSFISAASFQETTKVLTDASIAGSVDDLK
FT                   GLKENVVIGHLIPTGTGMNLYKRVKVRENSSSEM"
FT   gene            complement(402007..405474)
FT                   /locus_tag="BT0389"
FT   CDS_pept        complement(402007..405474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0389"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BT0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17719"
FT                   /db_xref="GOA:A1QZH7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZH7"
FT                   /protein_id="AAX17719.1"
FT                   /translation="MIKRVHLGQGKAEEILDLPNLIEIQLNSYEKFLQLDRLKNNKPLL
FT                   NEGLESVFRDVFPMKSSNGEVALEYEKYYVEYDSLSFTEKECKRKGQSYEAVLKIRLNL
FT                   QFLTTGEIRQKDVYMGTIPLMTDRGTFIVNGAERVIVSQIHRSPGVVFYKEKDLYYARI
FT                   IPYRGSWLEFEIDSKKDYLYVKIDRKKRILVTLFLRALGLDTREKIIETFYKIKKIEVN
FT                   EDTKREITGQYLAVNITIKENMTYRAGDKITLQDIEDFLQNGVKEIDLIDFDGYDSVPG
FT                   KHFISSDVILNCFEKEDAYFSLKDGFKELSRESVMLAVYSVLLPGEPISIDNAENDLRT
FT                   VFFSEKRYDLGHVGRYKLSKKFGLNDLTTSVLTMTDIVNTISHLLRIYDGHDVLDDIDH
FT                   LGNRRVRSVGELLTNIYKGAMSRVEKIAKDRMSNKEVFNLKPQELISVKPIVSAVKEFF
FT                   ATSQLSQFMDQVNPLAELTHKRRLNALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPE
FT                   GPNIGLIVSLATYAKVNDYGFLETPYRKVINGKVTDEIEYLSAIDEEKKCIAQANAAVN
FT                   AESNYIDDLISVRVSGDYTTMIPKNIDYMDVSPRQLISVSSALIPFLEHNDANRALMGS
FT                   NMQRQAVPLLFPQPPIVGTGMERIVAKDSGVVIKAKRSGTVVLATSKRIVIRPDNADDE
FT                   HDLDEYELAKYERTNQDTSFNHSVLIKEGQVVNKGEIIADGPATRYGELALGNNLLVGF
FT                   IPWNGFNYEDAILISERIVKEDLYTSIHIKEFSIEVRETKLGPEKVTADIPNVSGKILN
FT                   KLDENGIVRIGTYVKPGDILIGKVTPKSEGDITPEFKLLTSIFGEKAKDVKNNSLKVPH
FT                   GTEGTVIDVQRITKNDVGNLPPGVDEILKVYVAKKRRLKEGDKMAGRHGNKGVVAKILP
FT                   VEDMPYLADGTPLDICLNPLGVPSRMNIGQLMESQLGLAGKYLSEYYDVPVFESATNEC
FT                   IQEKLKKAGFNETSKAILYDGYTGEPFENEVMVGIIYMLKLHHLVDDKMHARSTGPYSL
FT                   VSQQPLGGKAQFGGQRLGEMEVWALEAYGAAYTLQELLTVKSDDMSGRVKIYENIVKGI
FT                   PTNVSGIPESFNVLMQELRGLGFDLSIYDDNGNQIPLTEKEEELINKT"
FT   gene            complement(405560..405931)
FT                   /locus_tag="BT0390"
FT   CDS_pept        complement(405560..405931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0390"
FT                   /product="LSU ribosomal protein L12P (L7/L12)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17720"
FT                   /db_xref="GOA:A1QZH8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZH8"
FT                   /protein_id="AAX17720.1"
FT                   /translation="MALSKEDILTWLEEAKTSEVVELITAIEEKFGVTAAAVAVAAGSG
FT                   PASVDAEEQTEFDVMLMSFGDSKINVIKEVRAVTGLGLGEAKALVEAAPKAIKEGVSKA
FT                   DAEDIKKKLEAVGAKVEIK"
FT   gene            complement(406008..406505)
FT                   /locus_tag="BT0391"
FT   CDS_pept        complement(406008..406505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0391"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17721"
FT                   /db_xref="GOA:A1QZH9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZH9"
FT                   /protein_id="AAX17721.1"
FT                   /translation="MHAKINPKKVEMFNLLKEFLDGKDSVFFLDYRGLTVATLTELRNR
FT                   VENEKGELKVVKNNIMKRVLKDKHMEGLDSYLLGPTAVVTAVDEANVIAKIFYEFVKTS
FT                   SLKVKGGFVLGEVYDEAKLNAYSKLPTKKESISLFMNVLKAPISKLARTLKALSDVKDV
FT                   KV"
FT   gene            complement(406516..407190)
FT                   /locus_tag="BT0392"
FT   CDS_pept        complement(406516..407190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0392"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17722"
FT                   /db_xref="GOA:A1QZI0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZI0"
FT                   /protein_id="AAX17722.1"
FT                   /translation="MAKSGKKYIQALSKVDKLKSYSIDDAISLLKEIKFVKFDETIDVS
FT                   VNLNLKKNHTVRDTVVLPNQFMREKRILVFAKGDKAEEAREAGAVYVGDDDLINKVKGG
FT                   FSDFDVVVATPDMMKDVGKLGPILGKRGLMPNPKTQTITNDLKGTIASLKKGRTEFRAN
FT                   KNGVINFSVGKSSMDNNKVKENYDEFIKELLKRRPSDLKGTFVDSVYMSSTMGPSVKID
FT                   FV"
FT   gene            complement(407190..407624)
FT                   /locus_tag="BT0393"
FT   CDS_pept        complement(407190..407624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0393"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17723"
FT                   /db_xref="GOA:A1QZI1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZI1"
FT                   /protein_id="AAX17723.1"
FT                   /translation="MSKKKREIAWVKLQVPAAQAAPGAKIGQALGPHGVSGPQFVKEFN
FT                   ERTAKMEPGIIVPVIITVYADKSFSFIVKTPPASVLIKKAVGIETGSKKSNTEKVGTIS
FT                   KEKVMEIARVKMPDLNAKTELAAFKIIAGSARSMGVEVEK"
FT   gene            complement(407678..408232)
FT                   /locus_tag="BT0394"
FT   CDS_pept        complement(407678..408232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0394"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BT0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17724"
FT                   /db_xref="GOA:A1QZI2"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZI2"
FT                   /protein_id="AAX17724.1"
FT                   /translation="MSRAWYVLQTFSQYERKVEQEIKLLISEGVFGSNVLDVKAPIERV
FT                   EEIKNGKKRIRERRIWPGYILIELDLPEQEWKSTVANIIKIPGVVNFVGTNKEQKPFPI
FT                   SDEEVKSVFMLAGEIKADKSIFILYDFEEGERVRIKGGPFDSFEGVIGSIDYEKKKLKV
FT                   AVQIFGRSTPVEVDFQHIEKV"
FT   gene            complement(408242..408412)
FT                   /locus_tag="BT0395"
FT   CDS_pept        complement(408242..408412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0395"
FT                   /product="protein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BT0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17725"
FT                   /db_xref="GOA:A1QZI3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZI3"
FT                   /protein_id="AAX17725.1"
FT                   /translation="MFKFVKESVLELKKITWPKYGEVIGSGKQVFWLVVFISIFLGIVD
FT                   YIMYLAITYVF"
FT   gene            complement(408443..408514)
FT                   /locus_tag="BTT0006"
FT   tRNA            complement(408443..408514)
FT                   /locus_tag="BTT0006"
FT                   /product="tRNA-Trp"
FT   gene            complement(408525..408704)
FT                   /locus_tag="BT0396"
FT   CDS_pept        complement(408525..408704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0396"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17726"
FT                   /db_xref="GOA:A1QZI4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZI4"
FT                   /protein_id="AAX17726.1"
FT                   /translation="MGKKKGKGAVELIALVCEETGIRNYTTTKNRRNKQEKLELMKYCP
FT                   ILRKHTLHKEGKIK"
FT   gene            complement(408727..408799)
FT                   /locus_tag="BTT0007"
FT   tRNA            complement(408727..408799)
FT                   /locus_tag="BTT0007"
FT                   /product="tRNA-Thr"
FT   gene            complement(408885..409784)
FT                   /locus_tag="BT0397"
FT   CDS_pept        complement(408885..409784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0397"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17727"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZI5"
FT                   /protein_id="AAX17727.1"
FT                   /translation="MGLDRCLSGEKVGSFNVNLLSRLLSFLFLFYSNVSIVNDSLSKSS
FT                   IKRTIDWDTKIIYFDIIKPVDEDKFGRVGLDSTSRLVFSVNDFKDTLIRQSLFEMIIDS
FT                   DNTFKDYFDSDPHLILYFSGLDSILKRGYTKYSEDLKSITVRYELCLFPDFVNLFIAHS
FT                   KPYMAFYPLMDTSVDQFVYTGIIIYAGDDYQFSSGGVVKLTDAFFIRIYDEDIKLYFDK
FT                   KMVEPDALRKWGMLEYTNDISYKNKDRVGNYPLRLIAKGVYGKNHSDIILDKYSINKIF
FT                   SNKNNVNLLRQGKLVIIK"
FT   gene            complement(409748..410770)
FT                   /locus_tag="BT0398"
FT   CDS_pept        complement(409748..410770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17728"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZI6"
FT                   /protein_id="AAX17728.1"
FT                   /translation="MKLLIQAFGLMLVFSCCKIKQSEIQSLVSLLEESSKKGLDRFLIV
FT                   DRIVDIHMRNKDYQDALRSVNQEIAHYESREYYPLYFYLMGNIYSSIKEDLVAFTYYRY
FT                   VVDNFDDYIYENSSVKLDIAKRVINLNIEAGHKIRYYKLLLDDHAESLTNSDRGNYYYN
FT                   LALSLESIQNYDEAYFYYNKLLSIPRSDLRIDSIDYSGVITKVNYYNNPDFIIYRNLND
FT                   LIQDVKRYIFSGNTTKLLSIRDKHNFFIQSWDQRGGKSNSINTNSFLTTMIKLGSRRKN
FT                   GIQFASSFEADSSDDISYLGSSGWEHIWEWYFVFKKISYPKDPEINNGWAWIGVYLGKK
FT                   "
FT   gene            410795..412153
FT                   /locus_tag="BT0398A"
FT   CDS_pept        410795..412153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0398A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0398A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17729"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZI7"
FT                   /protein_id="AAX17729.1"
FT                   /translation="MYNKTYLRVNKNYQDFNMNKKLIYILLLILFLSCFNKNNKYGIVL
FT                   DSKNREKLPNGSLVKIEDANQEKKTVTINYNGIKFIVHKFTIEEFQTKKEAENFKLSIQ
FT                   PYVNKYAISKKDLLPLRTSPDSYRENIIYRISKESILKIIHIGKDTEVGSLKGKWLYVL
FT                   TKDGHKGYVFDYALEVFDNITGTILTNPLDQVSQNDIINTFNNIKYLRPLYYEKMIAYN
FT                   TYNTNLLREEYGLFFTPKNEIIINIPELSLHFKFDIVEEVKPNGFLFRSKTSEEDFILL
FT                   TKETQNYYKSIIKVKEHNFESKFVIIEQNVEKIILESKKQNQNLINRLISYGTLINTQY
FT                   GNIEFKSDQTFIWKVDKKIYNFPSSGTFEIIGLSPNLQISYKKAIKLMTKEREKYFCLL
FT                   DYTDNALQLIFISPKNVKDDLIIIDDKDKIAVILFNNAQSNQEIIKQQSQKTI"
FT   gene            412166..412822
FT                   /locus_tag="BT0399"
FT   CDS_pept        412166..412822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17730"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZI8"
FT                   /protein_id="AAX17730.1"
FT                   /translation="MKIIFILLLTQFITFLNANENTKIIKELSKTIYNLSNKEYEIDKA
FT                   KLDSFIESIDLNNTNILKELQKIKNDFLITSVYFQNIKGTLIALNLSAEINFQYKISPL
FT                   SISIINNDFQTTKTLIDYGIKINQIDETEYPSIFWAIYLNNEKIFNLLKEKGADLSLAL
FT                   KNGKTPIQAAIEIENINLIELLLKKNAYIKDKYKKEIKNLKNKNIKDILKKYKVI"
FT   gene            413248..414438
FT                   /locus_tag="BT0401"
FT   CDS_pept        413248..414438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0401"
FT                   /product="sodium:dicarboxylate symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17731"
FT                   /db_xref="GOA:A1QZI9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZI9"
FT                   /protein_id="AAX17731.1"
FT                   /translation="MNTKVKFSLIIPIGILLGLFFPSGAYNILSHIFIRLGYLSLIPFL
FT                   IFSIPLGIENIIENKKFRKLFGKTIYYGILVNIMGIIISIVIATIYLPQRIPILDKNIQ
FT                   NTYTFDQKVFLETFFPKNIFIIFTNNNPNLLSIYIVSIIIGASLYYAKQKGRIARELIL
FT                   SFSNLFYHANGIVVKILHFGIIFITAAYTTNLKNFKNYQYYIDSIIFLSLWTITIILII
FT                   IPMISYRLTKNFKLSYKNILISIQNIIFAGLTMDAYAPYSILIEDIKNERINIKKSIIT
FT                   NIPIINFISKSGTIFIATISFFIILKSYSSLPISIYEISYMSILAFLFIFAFPHIPNSL
FT                   IYIITMLCSTYTKGIELSHSNIIPILPILTSLALMIDFTSNIAIIQIIDFNELKDT"
FT   gene            complement(414465..415970)
FT                   /locus_tag="BT0402"
FT   CDS_pept        complement(414465..415970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0402"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BT0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17732"
FT                   /db_xref="GOA:A1QZJ0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ0"
FT                   /protein_id="AAX17732.1"
FT                   /translation="MSIMMNFSKRVRFMGNFISSKEEEFSKWYLDIVQKAKLVDYSPIK
FT                   GCMVIMPYGYAIWEQIKSILDNKFKETGHENAYFPLLIPYEFLEREKEHVKGFSPELAV
FT                   ITTAGGEELAEPLVLRPTSETIIWNMYSKWIKSYRDLPVKINQWANIVRWEKRTRPFLR
FT                   TTEFLWQEGHTAHETAGEALEETLFILNLYKRFIEDYLAIPVFCGQKTEREKFAGAVST
FT                   YTIEALMQDKKALQAGTSHYLGLNFAKAFDVKFQNKKGEMDYVFATSWGVSTRLIGALI
FT                   MVHSDSKGLILPPKIAPIEIIIVPIFKRDDEVNKKIIEYATTIFNILKEAKFRVELDRD
FT                   IKNSPGFRFAAVELKGIPIRIEVGSNDILMDCVTVARRDQDKNSKYQVSVKELPSKMRH
FT                   ELETMQCELFNRALKFRNLHTKEIIGFKENDYDTFKTYINEHLGFVLSSWCGNEVCEES
FT                   IKNDTKATIRCIPEDFQNRSLNNLTCIYCNTTAKHLVLFARSY"
FT   gene            416518..417117
FT                   /locus_tag="BT0405"
FT   CDS_pept        416518..417117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17733"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ1"
FT                   /protein_id="AAX17733.1"
FT                   /translation="MKTLLKLIMVFLTSLSVATTINTSNLNKILNKQQTQFRSFGIGFG
FT                   IGNPITNIIINFPYVDIDIGYGGFNGLHPNNFIPYIVFGTDILFKEEIYQSIMLTGGLG
FT                   IGIDLSQIKPDEQNSSNIKQENTQDKQEEFSIASSNNRLGIVFRLPIILEYSFLTNVVI
FT                   GFKAITTIGGTMIFQPTSMEGIRFGFFGFGFIKIYI"
FT   gene            417125..417955
FT                   /locus_tag="BT0406"
FT   CDS_pept        417125..417955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17734"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ2"
FT                   /protein_id="AAX17734.1"
FT                   /translation="MMKNNTQKIFILLLIFNLHHFAFSKSNNNYSIRCKQEDDGTTCIT
FT                   NDKPIIEEPKLTLEEPKLTLEEPKPIIEEPKPIIEEPKLTLEEPKPISEEPKLILEEPK
FT                   PIFEEPKPQIITNFHAIHREKNPYSFAAGIGTGNPLINLLISVPYVDIDIGYGSFLYFN
FT                   PTNFKPYNLIAIDLIFKQQIGEYLIVGGGVGIGTDWSQANLTSLGTTQPSPYDRIGIVT
FT                   RLPLSIEHKIIKNLSLGFKVYPTLGPTIFLTKPKIVFEGIRFKFFAIGFIRVFM"
FT   gene            complement(417995..419110)
FT                   /locus_tag="BT0407"
FT   CDS_pept        complement(417995..419110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0407"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BT0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17735"
FT                   /db_xref="GOA:A1QZJ3"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ3"
FT                   /protein_id="AAX17735.1"
FT                   /translation="MRSDNIFLMKNKIKEYDWGGTSFIPSLLGQREDGLPKAEMWLGAH
FT                   KTFSSKILVDGQYVFLCDFLENHKELLGCESELSFLLKVLSAQKPLSIQIHPSKDIALK
FT                   GFELENDKGIDINDSKRIYKDKNPKIELVYALSDFYALKGFLPIFEIKSIYKKLKLDFH
FT                   FATHKEFIKIIFSLQKFEIEDAISRVKKNLSFINDFRAYWFNEIYEIYGADIGLLVFLG
FT                   MYIFKLSPGEVLYTESQEVHAYLQGDCLELMTNSDNVIRAGLTTKYIDKDEMLKVGRFE
FT                   EGVFSLLRGKEIDGFNVFKLPDTNLSLFQRNINEKICFKKDGVMILLVMNGEIQINNGV
FT                   CLKRGESVFIGNYDEKLLICGNGEIFIALSL"
FT   gene            complement(419107..420975)
FT                   /locus_tag="BT0408"
FT   CDS_pept        complement(419107..420975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0408"
FT                   /product="PTS system, mannose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BT0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17736"
FT                   /db_xref="GOA:A1QZJ4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ4"
FT                   /protein_id="AAX17736.1"
FT                   /translation="MFLKFLKKELIFISDKINSKEEAINFLVDQVSKRGYTHDKTRFLQ
FT                   GLFERENIGDTSWENGVAIPHFIGDVVKSSFISLLYIKGDGIKWSDDNPPVNLIFLICM
FT                   SKSQQGNDHIKSIAFIAKLFESDDFKNILKVMKSTDEIYSYIENVERSSTDDTTSVSKS
FT                   EKIVAVCACPVGIAHTYIAAKKLEVEAKRQGYILKVETQGSIGIDNPLTETEIKDADVI
FT                   ILAVDKDVDEERFDGKRVYKVSTAKAINNVENVIKEAFSAPILNYKNVHSIKDKSGSSR
FT                   TGFYKYLMSGVSPMIPIVASGGILIALGISLAGIGSDGPNFDKYPFYKTITDIGGVAFG
FT                   MMLPILSGFIAMAIADKPGLAPGLVGGVLARDVKAGFLGAILVGFMAGFVAKWIAKRKI
FT                   PEWLRPVMPIFVIPLISTVIVGFFMIYVGVYIGQFMALLENGLKSLQNNSETYGIIGKL
FT                   FLGLILGAMVAIDMGGPFNKVAFLFGVGMIPQVPQIMGMVASAIPVPPMAMGLATLIMP
FT                   KLFEEEERESGKISFLISFIGISEGAIPFAASDPARVLPSIVLGGAVASIIAAFLGVAD
FT                   HAPHGGPIVLPVVDNKLGFIIAIAVGVVVATSLVIFLKSLKVKESK"
FT   gene            421079..421738
FT                   /locus_tag="BT0409"
FT   CDS_pept        421079..421738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17737"
FT                   /db_xref="GOA:A1QZJ5"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ5"
FT                   /protein_id="AAX17737.1"
FT                   /translation="MNLIMKKLIEFCFLLLCASLYSSNNEGHKKNEINNKKSILLKEKS
FT                   TNHENDFFSVKRGFIYSTGTGLGTGFFLNSKVNHIIFRPYYIFAINNFDFLVVCMILMI
FT                   KEYNISKKVKYSSSYIGTGINWHIINLSKKMKYLSSTTGIGGRLYLSTNLIGDFKFYDK
FT                   LPYVIEPYIFFEFSTKKATPYLNIYSKIECLFLDTFNISFDFGIRYNLKNSNEVNS"
FT   gene            421735..422616
FT                   /locus_tag="BT0411"
FT   CDS_pept        421735..422616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0411"
FT                   /product="endonuclease"
FT                   /EC_number="3.1.30.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17738"
FT                   /db_xref="GOA:A1QZJ6"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ6"
FT                   /protein_id="AAX17738.1"
FT                   /translation="MNKRLKILFCFYILILLGFLFLYQNPKILNNIKEIAYNYLSKLKD
FT                   KIYEPEISTELKEEYLLPKGYLTTQIIHKKYYSLGYAESARQSEWVAYQLKREMVELAL
FT                   TLLREKKITRSKNFFEDQDIKGIAPKLSDYLKSGYDRGHIVSSADMSFSKDAMLDTYFL
FT                   SNISPQQREFNSGIWLKLEQLVRKWAILKEKIYIVSAGILTENKGFIGKNKILVPKNFY
FT                   KIVLSLNNNNFYDILAFIIPNEKAQDLELRNYVVNVNLIEEKTKINFFAKLDAEIKKII
FT                   KMKKDVRSWKFR"
FT   gene            422601..423377
FT                   /locus_tag="BT0412"
FT   CDS_pept        422601..423377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17739"
FT                   /db_xref="GOA:A1QZJ7"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ7"
FT                   /protein_id="AAX17739.1"
FT                   /translation="MEIQMKTLFAKLNIFLLTTFVLGIIIISIFMYYINFNINFYTYII
FT                   KIYNKNLLILVNKFFIFSIGIIGSIWTCINYKRTNNIQFVFFYCFILSYILEPISIFKY
FT                   YFLSNILSLEFYYFMKFYHLITVFSLLNLFFLSLYICDFQIKSITYAIYLIFTFAMVYN
FT                   SLAPINAYEYTKDFLSPTANNRFYVYLFLLLIPINFLVSCLRKKNLSYFLLFISISLIV
FT                   SGIYLNFIEITYAFIPISIGAPMYLKESGKVFFYWL"
FT   gene            complement(423381..423977)
FT                   /locus_tag="BT0413"
FT   CDS_pept        complement(423381..423977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0413"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17740"
FT                   /db_xref="GOA:A1QZJ8"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ8"
FT                   /protein_id="AAX17740.1"
FT                   /translation="MFDQVFYNENVKYELYRKFFHISTLVFLFFYKLNFWVGLVSSLFF
FT                   MFAYLILEIFRIMEINLFFLRGISEIIIKSREVSSYKISLSPIFLVVSIFCTYFLIDKP
FT                   FSYIGIFSACLGDGLASLVGKLIPSFKLVNNKTFSGSVAVFLVAFIVCYYFFPNFIIAS
FT                   VVGMGAVLVELFDFEKYDNLFLPLGVATLSFVLIA"
FT   gene            complement(423977..424996)
FT                   /locus_tag="BT0413A"
FT   CDS_pept        complement(423977..424996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0413A"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BT0413A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17741"
FT                   /db_xref="GOA:A1QZJ9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZJ9"
FT                   /protein_id="AAX17741.1"
FT                   /translation="MKRCLLYFLLILMLITCDSKRKDLVEKKGIFALIDTNKGNIEIEL
FT                   YYKIAPLTVMNFIGLSEGTIKNSVTSQPYFENIIFHRVVDEFVIQTGDPTGTGTGGPGY
FT                   VFPDELNKNLSHNEPGIVSMANSGPDTNGSQFFITLADNLTYLDLKHSIFGKVVAGMDT
FT                   VRNIRQGDKIEKVRIIRVGEDAKAFKVDNEEFLKLKKSYEARKIAEVKKYMASQLEIID
FT                   KDYKDFQKDESGILYKINKQGNGKNVKSGNIVKVDYEGFLLSGIKFDSSIDRGKPIEFV
FT                   VGSGQVIEGWDVMLSDMCEEEERVVIIPPNLAYGERSIGNVIKPNSFLKFNIILRKIS"
FT   gene            425143..426003
FT                   /locus_tag="BT0414"
FT   CDS_pept        425143..426003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0414"
FT                   /product="pili chemotaxis protein methyltransferase
FT                   CheR-like PilK"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:BT0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17742"
FT                   /db_xref="GOA:A1QZK0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZK0"
FT                   /protein_id="AAX17742.1"
FT                   /translation="MLNISNELLLKFCNFIYENSGIRFDEKNKVVLQGRINDAIHELEN
FT                   INTPEQLYDLINSDKFQKEYFLDLVTTNLTRFFRNEAHFATFERFIIPNLINIKTQEGK
FT                   NRIIIWSAGCSTGEEPYSLAFVLKHNLPKNFDFIIIASDLSLKSLMIAKEGYYSVKKCE
FT                   HIPIQYKIYIKPHMNGYKVIDDIKKHIRFDYHNLNFESGFSEMDVIFCRNVLIYFDEKS
FT                   KIRVLKKFYSSMAMKSYLFIGHSESLFGLNLPFKFLRTPWAIIYEKDDKDVPKKKFQFK
FT                   NKYKL"
FT   gene            426039..427175
FT                   /locus_tag="BT0415"
FT   CDS_pept        426039..427175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0415"
FT                   /product="protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BT0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17743"
FT                   /db_xref="GOA:A1QZK1"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZK1"
FT                   /protein_id="AAX17743.1"
FT                   /translation="MQIKIYVLVIEASSVNRKTISDIINSSLKLEVIATAANTDFALKK
FT                   LKKHPDVILLSLEEETIKEITLIKKKENINNKLPVIILSSNKDIAKNAILKGADDFIIK
FT                   TDNKLESIKDKIIDLLSIYGNKTIKNKIITDINFKFKTNQYLINNKVNKENSNTTKATD
FT                   KNENTNLNQEKIIDEKDLKKLKNRKFEIVVIGISTGGPAALKTILPEIPKNFPLPIIIV
FT                   QHMPKGFTTEFAKSLNNICNLTVKETSNKEILQKGFIYISSGGYHTRINKINENYQIEV
FT                   FDAENVNGHKPSIGVLFKSISENVKDKAIALIMTGMGSDGSREIGEIKKAGGLTIAQDE
FT                   KSSVVFGMPKIAIEENNIDYIVSISHVVKLLKAILLDG"
FT   gene            427199..428407
FT                   /locus_tag="BT0416"
FT   CDS_pept        427199..428407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0416"
FT                   /product="pheromone shutdown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17744"
FT                   /db_xref="GOA:A1QZK2"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZK2"
FT                   /protein_id="AAX17744.1"
FT                   /translation="MDITKENTEDCFLHVSTLDTDHDKIYVLGTAHVSKKSSQDTATLI
FT                   ETLKPDFIAVELDEARYHAILKTDENEKWRNLDIYKVIKQGKAFLLIVQIILSNFQKKL
FT                   AKEQGINPGEEMKTAILKAKEHNIPLILADRKVETTLKRAWNCVPTFEKVKIISSLFSF
FT                   SDVKVTQDEIEKLKEQDVLSNMMEELAKEIPTVKKVLIDERDEFIASKILEGSGTILAV
FT                   VGAGHVKGIIANLKEIKENKKIVNIDNLNTIPKNTFSVSKLISYFIAISIVILMASSFY
FT                   FKGFDFAYKNLEFWIICNSLFAGLAALLLRANIITIITASIGAPIFSLIPFIGTGMVAG
FT                   LVEAYINKPKIKDFEKLQEDLENIKGYFKNKVTKILLIVFFVNIGSAIGTIVGFKFLLN
FT                   IFS"
FT   gene            428445..429077
FT                   /locus_tag="BT0417"
FT   CDS_pept        428445..429077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0417"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17745"
FT                   /db_xref="GOA:A1QZK3"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZK3"
FT                   /protein_id="AAX17745.1"
FT                   /translation="MKLVFLGPPGSGKGTIAKILSGKLNYYHISTGDLFRANISNATPL
FT                   GKEIKQIVENGQLVPDSITIKIVEDKINTLANKDNFILDGFPRNINQAKALDTFLQNIQ
FT                   IINFLLDEAILIKRLSGRRICQSCGGIFNIYTLPTKEKGICDLCKGSLYQRKDDVEESL
FT                   KIRLQEYHLQTKPLIDFYSKNNRLNNINASKDIDGVEKSLIEIISKY"
FT   gene            429150..430205
FT                   /locus_tag="BT0418"
FT   CDS_pept        429150..430205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17746"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZK4"
FT                   /protein_id="AAX17746.1"
FT                   /translation="MRKYFMEERIYMIKKLFMVLIFLQTILIYSKENQDEMGYFYVNSQ
FT                   MAYYPSHALGTSGSKFSPSFISPQFKSVSPNNQISPSSWGSIKLISNLGYYKFFKILKN
FT                   PDPHSLLLQNTGIDVDFKIGLSPVVALLKGNIGFTPIAFINLYTGIEIGIGWQGFGFKG
FT                   IGIHVGNGRYSSKPELYSEVTMGGRLQFDLNAVFGGDWTHIITVVGNNILHIKNPHAKD
FT                   NQLWKYKADEGKNINGFTINPYALLAYKMPIPLNIIGLLYEGQTYIGHARNVSTTQNQG
FT                   WGSDFFYHNFSLISKIEIIENLTLDMQFKFSTAPIYTVNTMGMADISKRISTNNSYIYY
FT                   DSIGFSLTYKI"
FT   gene            complement(430208..431140)
FT                   /locus_tag="BT0419"
FT   CDS_pept        complement(430208..431140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0419"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BT0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17747"
FT                   /db_xref="GOA:A1QZK5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZK5"
FT                   /protein_id="AAX17747.1"
FT                   /translation="MTKGMILDNFEEISVEPQKLLLVDDTPTNLDLLIDILQHKYEIRV
FT                   ALNGFDALKQVEIASPDLILLDVLLPDVSGYEVCKRLKNDPETKDIPVIFISSSDSTDA
FT                   QLEGFSVGGVDYILKPFNGRIIDARIKTHLELKRLRDYFKNLARIDGLTQIPNRRFFTD
FT                   KFAKSWMQALEHKKNVIVGMLDIDYFKKYNDNYGHTNGDECLRLIAKSLNKIAIKYKID
FT                   IARYGGEEFILFSVNKSLNEVIKIVSILIEDIRNLEIVHEYSNISNFVTVSIGLAEQIP
FT                   YDSNFTNIIKLADDKLYEAKISGRNQCKY"
FT   gene            complement(431152..435585)
FT                   /locus_tag="BT0420"
FT   CDS_pept        complement(431152..435585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0420"
FT                   /product="sensory transduction protein kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17748"
FT                   /db_xref="GOA:A1QZK6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZK6"
FT                   /protein_id="AAX17748.1"
FT                   /translation="MRGLSLFLFLFFVSHVSLPAKETLKFKLVDQYYPLYYKNQENKMV
FT                   GMIFYLLDKWAQDNDYDISIEAIDYLNKDKIEDDVVYLGLTYNSDLNEYLYFKNEIGKC
FT                   VTAFIYDSEKEQKPSNLFFSNELRVGVVKNTIYEDILRFHGHNDNIFLFPDTEKLLLAL
FT                   RGNKIDLVYGSYKSLSCVWYSSFYPSFMKVFNSEYFYSFGIRAAISKNAISQLRDLNVD
FT                   LLSYMQSLSREEYASFKEFDFLFKLDVGIYNDYPPFSFINSKGQFAGILVDLWNTLARE
FT                   YGFSVKFVGFPKESIKGSLDDKDVSVWGGIIEDDNILTSKKYKATAPICSLNFNLYFTN
FT                   AKNSNKVINSQVIGLSLNDIQLDKNTDIVNNFLDIVNHSYGFVENSITVNYLLKLHGYN
FT                   NILKLQDSSLSKGKFLVLAANNKRLQLFAYMLNALTENILFDTLLQIGKNWLGQDEIED
FT                   YQNNFYGHINSGNFNIEEKIWLQNNKRLTLAVKDWYPIDYFNSGRYKGVNEWLIKKIKR
FT                   LTNLDFNIISVHERDIEELMKLGKIDILSANLDDANSDYIFNIKAVSGIPLHLFSNKTR
FT                   LFTSRSFNSIAVLKFLYTKKLETKIGTRLVQVDSFTDALDLLYRGKVSGIVSDEYTATI
FT                   NFEDLNIRDIKKIFTVPNLTFDLNIAVHNQDYILRRIIQKILFRTNVNNKLYFDDWVFN
FT                   VHESFKDLRLKKSGIAVLTMGMFVFTIFMFCLFNLWKEIGFRKKMYSSAISEKKVIENA
FT                   IAAKTIFLASMSHDIRTPINGIIAATELLENTDLLGVQKEYVQMINYSSISLLSLIDEI
FT                   LYISKIDMNEIYIDNNEIDLEHEIECVLKGFQSQSAKQNIDLIFYSKSDLENYLIGDRA
FT                   RLKRVLINLIGNSFKFTTDGIIVLNYEMIRSTEDNDGNKIITIEFKVTDTGKGIKESNI
FT                   PVIFGLFRQGNDSDSKKYEGSGLGLAISRKLVSLMGGPGIAVESEVGKGTTFSFMLPFV
FT                   LGHKIKDKEVNKLELVTNKKILSLFLSKKTVEVLRDISKIFDYKDIHYFYSYEHAYKAF
FT                   YRYPYYDFVFINVDDFGLQEGLKFAEKIESLNSNVRIVFVFYCLKSDEIIDFKYEYMQK
FT                   PFQRWDFYSDWIKNGAIVDVPIINESNTLKLKNNVGILIAEDNEINQKILKNVLIVIGV
FT                   KEDSIDIVDDGVKAIEFLKTNKYDMAFIDIRMPNCDGLTVSKEIRKFESQNNLNPCVLI
FT                   AVTAHALREYKDRCLENGMNDYLAKPIHISSIKYILKKYLHIEVEDNKIIADKTFDGFS
FT                   NLPNLDINNALKDLNISYDMYVDLCRGFVNMSDNLIRDLDEAFNLNNIKLVKELAHSIA
FT                   GALGNMRSNLFGNFKQIEINTGSIHELKILYSEARKGLIVLIKNIREQILDVIETYDQE
FT                   KLKFKSNDEFLSLMQKLLNGIEDRNPKEYKEVLEVLKRYSLDDNNIILFDSLIKYLRVY
FT                   NFKESANIVKRMINLR"
FT   gene            complement(435772..438711)
FT                   /locus_tag="BTR0001"
FT   rRNA            complement(435772..438711)
FT                   /locus_tag="BTR0001"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            complement(439012..439851)
FT                   /locus_tag="BT0421"
FT   CDS_pept        complement(439012..439851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0421"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17749"
FT                   /db_xref="GOA:A1QZK7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZK7"
FT                   /protein_id="AAX17749.1"
FT                   /translation="MNANYEKYKMLVFDLDGTLLNNNHEIAPLTLKVLLRLKNDFHIIV
FT                   ATGRRLYEIKDVLMQLKDLQIDESYIVTANGAEIFLKNNLILRYKINYDIVRELLKVKR
FT                   GDIDINLYTLNNWYSDREIRSPIMNYFIETLGIQPIITDLSELEIDSCSKIVYYSHDFS
FT                   KLEDFANKIRDKNFKDISIFYSANDLLEITNIDASKYNAIKSIALFECISIDAILAFGD
FT                   NGNDYEMLKNAGKGILMKNANKFVKNNLSNNEVTKFNNDEDGVAKFLIEFFNLDIQF"
FT   gene            439985..440509
FT                   /locus_tag="BT0421A"
FT   CDS_pept        439985..440509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0421A"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BT0421A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17750"
FT                   /db_xref="GOA:A1QZK8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZK8"
FT                   /protein_id="AAX17750.1"
FT                   /translation="MSDKISTLFTEEKIKSKIKDLAQKIRNYYEDKNNVVFISLLKGSF
FT                   IFFADITREIGLNVKIDFLQASSYKNKTLSSLNVLIKKDIDINIQNSYVIIFDDIIDTG
FT                   LTYKKIVEHLKTKNPKEIKICTLFNKPSRRLIELKIDYSGFEIENDFIVGYGIDFNEQH
FT                   RTLKNVAKISK"
FT   gene            440519..441802
FT                   /locus_tag="BT0421B"
FT   CDS_pept        440519..441802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0421B"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:BT0421B"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17751"
FT                   /db_xref="GOA:A1QZK9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZK9"
FT                   /protein_id="AAX17751.1"
FT                   /translation="MSIYAVIGTQWGDEGKGKIIDFLSSKIDYVVRFNGGNNAGHTIVV
FT                   NNKKFIFNLLPSGVLQGAKCILGPGVVIDPLILIKELEALKHNNIKTEIFISDKAHIIM
FT                   PYHIKLDELNEQKKGVYKIGTTKRGIGPCYADKINRTGIRAVDLLDIKIFERKLKINLD
FT                   EKNEIIEKIYNHKPFNYDDILSKYKKCIAILQYAITNTEEILNQAINSGKIILIEGAQG
FT                   TMLDIEHGTFPFVTSSNTLITATTGCGIPISKIKEKIGIVKAFSSRVGSGPFVTEILGP
FT                   IGDKIREKGQEYGSTTNRPRRIGWLDLLTIKKSISLNELNHLALTKLDILNNIEDLKIC
FT                   TAYEFKGKIYDYIPTSCEILENVKPVYKVFKGFKQNIRNISHYEDLPIEAKEYIEFIER
FT                   EVGVQISILSLGAEREKTIFRNQKWINI"
FT   gene            441787..443190
FT                   /locus_tag="BT0421C"
FT   CDS_pept        441787..443190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0421C"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BT0421C"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17752"
FT                   /db_xref="GOA:A1QZL0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL0"
FT                   /protein_id="AAX17752.1"
FT                   /translation="MDKYINPLKSRYASKEMLYIFSPKFKYTTWRKLWYNLALVQKELG
FT                   INISNKQLNKLSKHIENIDFELVKKYESKFQHEVMAHLYAYADLAGDDARKILHLGVTS
FT                   AYLMDNTDLVQIKEALLLIENKLLKLINTLKKFSIKHKNLVTLAYTHLQEAQLTTLGKR
FT                   SSLWLQSLIFDFEELKFIMSNMRFRGVKGTVGNQSSFKELFASNFEKVKDLDINLAKKM
FT                   GFDKVYQITSQTYDRKFDSSILNFLSNLAQSAHKITNDIRFMQHLKEIEEHFEPHQIGS
FT                   SAMPYKRNPIYSERIASLAKFIMSLQSSGGFIAATQWLERTLDDSACKRLNIPQAFLAA
FT                   DATLILLSKVFNNIRVNKKMIEKHVKTEMPFILTEDILMKATKNGGDRQILHEKIRIYS
FT                   MKVKENIYSGTTENDLIKLILNDQSFKLTSKDIDEILNPNENIGFASYQVENFITEIID
FT                   PILEKNKEN"
FT   gene            complement(443187..443765)
FT                   /locus_tag="BT0422"
FT   CDS_pept        complement(443187..443765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0422"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:BT0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17753"
FT                   /db_xref="GOA:A1QZL1"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL1"
FT                   /protein_id="AAX17753.1"
FT                   /translation="MFWFRIVLMDREFFMQDAVTVAKSLLGHLLVRKIGAKEIISRIVE
FT                   TEAYMGVMDKACHAYGGRRTSRTSAMYNIGGYAYVYMIYGMYYMLNVVASNEHNPHAVL
FT                   IRGVELISPKIDGIFTNGPGKLAKFLNIDLKFNKVDLINNGELFLKRGLSFNFEVSCSK
FT                   RINVDYAGEEYANKLWRFYIRGNKYVSKY"
FT   gene            443906..443979
FT                   /locus_tag="BTT0008"
FT   tRNA            443906..443979
FT                   /locus_tag="BTT0008"
FT                   /product="tRNA-Ile"
FT   gene            complement(444516..444590)
FT                   /locus_tag="BTT0009"
FT   tRNA            complement(444516..444590)
FT                   /locus_tag="BTT0009"
FT                   /product="tRNA-Ala"
FT   gene            complement(444665..445894)
FT                   /locus_tag="BTR0002"
FT   rRNA            complement(444665..445894)
FT                   /locus_tag="BTR0002"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            complement(446363..447751)
FT                   /locus_tag="BT0422A"
FT   CDS_pept        complement(446363..447751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0422A"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0422A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17754"
FT                   /db_xref="GOA:A1QZL2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL2"
FT                   /protein_id="AAX17754.1"
FT                   /translation="MIKNRDKEIYKCLNCGYKSLKWLGKCPECFSWESLELYSEFKSGY
FT                   EGDLSKSKNEIFSLRDFKQVDNVRHLTGIEEFDRVLGAGIVIGSAILISGEPGIGKSTF
FT                   LLQISSILSLSDKNVLYLAGEESIPQIKLRANRLRISSDILITNEINVDSLIKMLANIE
FT                   LDFIVVDSIQTLHSKEVQGGLGGVAQLKHCVYKLIEWARGKNITLCLVGHITKDGILAG
FT                   PKVIEHMVDSVFYFEEAEKSLRMLRATKNRFGAINEVGIFEMTGLGLVEIKDPSSIFLE
FT                   KKEEISSGIAIGIINEGSRVLFVEIQALVTRTGMNIPRIFSEKIDSKKISRILAVLSKY
FT                   LNLSFNNDDVYVNVSGGLRMDDIEIELAVLVALFSAKTNVIINQDLIFTGEISLSGKIK
FT                   ASSNIESKVIAAKKAGFQHVLGANLRENYYNGYEGIESVLGVVRRLVRDSKREGHGDSR
FT                   LKNR"
FT   gene            complement(448139..448813)
FT                   /locus_tag="BT0427"
FT   CDS_pept        complement(448139..448813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0427"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17755"
FT                   /db_xref="GOA:A1QZL3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL3"
FT                   /protein_id="AAX17755.1"
FT                   /translation="MLYIVGTPIGNLGDITYRAIDILRLVDVVFAEDTRVAKRLLSHYG
FT                   IVKKLISCNAIIEHKRIGLLLEYLSNGKSVAFVSDAGTPCLSDPGGLLVDAAFKNGHKV
FT                   SPIPGVSSLNTVISVNPFKDKVVVFEGFLPNKGIKRIKRIEELYHRGDAFVLLESSHRI
FT                   LKLLFEISLVNLDANVLVGREMTKLYEEYKIGKPLELKEYFEENNKNKGEFTVLVSRKS
FT                   KS"
FT   gene            449083..449403
FT                   /locus_tag="BT0428"
FT   CDS_pept        449083..449403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17756"
FT                   /db_xref="GOA:A1QZL4"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL4"
FT                   /protein_id="AAX17756.1"
FT                   /translation="MFKLIKKIFIIYFLCITLTGLTMVFIDSKFSERQTIQDGKSKIIK
FT                   HVIDPNLIMLTSAIGGFLGIYSGIWFFDHGKDNFYLSWGSLIILIYNIGLIISVYSKSK
FT                   NK"
FT   gene            complement(449413..449811)
FT                   /locus_tag="BT0429"
FT   CDS_pept        complement(449413..449811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17757"
FT                   /db_xref="GOA:A1QZL5"
FT                   /db_xref="InterPro:IPR015067"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR037081"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL5"
FT                   /protein_id="AAX17757.1"
FT                   /translation="MLEMISGLNPTLKLFKEHRILYSNMERGLKPLLEVDNFINKYIQN
FT                   KEGLEIYDKVVGKAAAVIIYNIGLQNVQAGVISQPAKDFLESRGIRVTFKRLVEKINDK
FT                   TENLIESLENPEEVYKYLIKRGIIVSNS"
FT   gene            449917..450495
FT                   /locus_tag="BT0430"
FT   CDS_pept        449917..450495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0430"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17758"
FT                   /db_xref="GOA:A1QZL6"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL6"
FT                   /protein_id="AAX17758.1"
FT                   /translation="MMLIPKENIYSKIEVKKSIFLSYIFHVEKKEEINKILKEYKLKFK
FT                   NATHVIYGFRIGNSNSFINGMNDDKEPRLTAGKPTLEAILNKNLTDTLIITVRYFGGTL
FT                   LGKQGLIKAYSKAAQEVINKSNLTEKKEMETLCLNLNYNQYNLLIRTKNKMEIKITDAK
FT                   FLDKINTTIKFNIKDKKNIITFLQANSLL"
FT   gene            450687..451439
FT                   /locus_tag="BT0431"
FT   CDS_pept        450687..451439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0431"
FT                   /product="Soj protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17759"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL7"
FT                   /protein_id="AAX17759.1"
FT                   /translation="MKIISIINQKGGVGKTTSAINIAYSITLLNKKALLIDIDSQGNTS
FT                   SGFNILKKEDTNSSYELIYKKQKITPIKNFNLDIIPSSLKLALLEKELIHEIARENFLK
FT                   NALEQYKQDDYDFIILDCPPTLSILTINALVASKYLLIPIETEFFAFEGINQLLDTITA
FT                   VKQINQELEITGIFINKYDIRNKSKEKYIDYLKKVFKEKFLNTKIRKNISISKSQEENI
FT                   PVYMYNKESNAAKDFLELTKEIIEKIKG"
FT   gene            451442..452146
FT                   /locus_tag="BT0432"
FT   CDS_pept        451442..452146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17760"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL8"
FT                   /protein_id="AAX17760.1"
FT                   /translation="MSDNLDTLMALMGQKLKNNVKNEKTLAKQELIIIQNKSFKYEKLD
FT                   KEIADFLKMKQYEIFNIFNNTYTEIGRILKEAQEKLRGNNQYDGLFYKWFTSMGFKKDK
FT                   VYSLISRYELLVENSDKQLIINNLPLSLSYEISKKSCPTHLKMEVLNGKIKSLKEFKSR
FT                   YQKDEHNKKNLEINFNKTQLNREDIIKLIELLLQELENIKNIKLDKIENKKEFLIILKD
FT                   IRQKINLIKKIT"
FT   gene            complement(452139..452951)
FT                   /locus_tag="BT0434"
FT   CDS_pept        complement(452139..452951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0434"
FT                   /product="probable chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:BT0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17761"
FT                   /db_xref="GOA:A1QZL9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZL9"
FT                   /protein_id="AAX17761.1"
FT                   /translation="MYYYKEVFDKMSETFKMVDINLVDVDKSQPRKSINLAELEELSIS
FT                   IRENGILQPIVVFHDNGRYHLVIGERRFRAAKLAGMRQISIIEIETTRKNKDFMSLIEN
FT                   IQRENLTPVEEAYAYKNLMDKHSLTQRALSEKIGKNRSHVANLVRILDLEQEILNSLHK
FT                   KEISLGHAKVLLSLKDSQDRYGLYLLIIKKKLSVRETENYVKNFYKPINDKSEISRDPF
FT                   LNSVKEFLISRIQTKISIKGSKEKGKIEISYFTSSDLKRIISIFESIK"
FT   gene            complement(453056..455503)
FT                   /locus_tag="BT0435"
FT   CDS_pept        complement(453056..455503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0435"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17762"
FT                   /db_xref="GOA:A1QZM0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZM0"
FT                   /protein_id="AAX17762.1"
FT                   /translation="MIGALMAIEEDKEQILNIKIEDEVKTSYLNYAMSVIVSRALPDVR
FT                   DGLKPVHRRILYSMHEMGLRADKAFKKAGRIVGDVLGKYHPHGDQSIYEALVRLAQDFS
FT                   LRYPIVSGQGNFGSIDGDPPAAMRYTEARMAKIAEELVKDIDRQTVDFRANYDDSLLEP
FT                   EVLPAAFPFLLVNGSSGIAVGMATNMAPHNLREICDAIVYMLNHDSVSVYDLIAIVKGP
FT                   DFPTYAEIIYNESLVKAYTTGKGSVVIRSRYHIEEKREDHIAIIITQIPYAVNKSSLLM
FT                   KIAFLIKEEKLEGISDIRDESDREGIRIVLEIKKGFDPHVVMNLLYEYTELRKNFSINN
FT                   LALVNGIPKQLNLKELISEFIDHRKEIVRRRVEFDLKKARDKAHILEGLNISLRHIDRV
FT                   IEIIRFSRLVKDAKECIIKEFNLSEIQANSILDMKLQKLTSLEIEKLEEEFKIVLDLIK
FT                   DYEDILVSPERVVNIVREEIINLSLKFGDERRTKIIYDEEVLKTSMSDLMQRENVIVIL
FT                   TKQGFIKRILQDEYKLQGIGGKGLGSFDLQDKDQVNIALCVNTHDFLLMISNEGKLYVI
FT                   NAYGIKDSSRTSKGQNIRELINLGETEEILAIKNCNELSLDNYLLITTANGKIARIETE
FT                   GFKTVKSRGVIVIKLDDKDFVTSAEIVSKNDKIICISKKGNAFAFNSNDIRLTHRGTQG
FT                   VSGMKVREGDMLIKALSAKQGSHLLIVSENGYGKRLEISRVTELKRGATGYTCYKKSDE
FT                   KAGAVVDAITVAQDDEILLVSKTSKVLRTLVDKISEQGKDARGMQVLSLDEDKLMSVSK
FT                   FIK"
FT   gene            complement(455500..457419)
FT                   /locus_tag="BT0436"
FT   CDS_pept        complement(455500..457419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0436"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17763"
FT                   /db_xref="GOA:A1QZM1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZM1"
FT                   /protein_id="AAX17763.1"
FT                   /translation="MCGRFMSYVASNIQVLKGLEAVRKRPGMYIGSVSINGLHHLVYEV
FT                   VDNSIDEALAGFCDKIEVVINSDNSVTVNDNGRGIPTDIHEEEGISALELVLTKLHSGG
FT                   KFNKGTYKVSGGLHGVGISVVNALSSFLEVVVSRDGNFFKQTYSRGIPTSEVEIVGVSS
FT                   NRGTKVTFLADSEIFETLEYDFETLSKRLRELAFLNDKIRISIEDKRLGKERFLEFYFE
FT                   GGIKAFVDFITNNSKNIQSEPYFIEGTYDDVIVSVGLKWTEGYSDNILSFVNNINTREG
FT                   GTHVAGFKSGFLKAMSEAFKDSKISKKDVPNLTLDDFKEGLTAVISIKVPEPQFEGQTK
FT                   GKLGNSYIKKIVETIVHNELLKVIGNNLLEVDIILNKAIRAARAREAARKARESERKKS
FT                   AFESLALPGKLADCASKNPVEREIYIVEGDSAGGSAKMGRDRFYQAILPLWGKMLNVEK
FT                   TREDKVITNDKLIPIIASLGAGVGKNFYIEKLRYHKIIIMADADVDGSHIRTLLLTFFF
FT                   RYMRELIDNGHVYIAMPPLYKIKYENSVHYFYDDSEKEVFLSSIETGKRDKISLQRYKG
FT                   LGEMNPTQLWETTMNPATRKMKLIEIDDAIQAENIFVTLMGDDVEPRREFIEQNALDVV
FT                   NLDV"
FT   gene            457651..459105
FT                   /locus_tag="BT0437"
FT   CDS_pept        457651..459105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0437"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17764"
FT                   /db_xref="GOA:A1QZM2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZM2"
FT                   /protein_id="AAX17764.1"
FT                   /translation="MQEGKNIWSLILAAIRKELSEEEFYIWFENLYFIDATDESIKISA
FT                   PNSFHKNQVEKRFSKRIKEILTEKGHNTINVEFINPPKEPKTHSMELKNTSLKDISIQQ
FT                   DSPEKRTILNTHTKNIIEHTKHYVIKEDIHTKYRNPFLKKKYTFENFIIGPNNKLAYNA
FT                   SLSIAKNPGKKYNPCLIYGGVGLGKTHLLQSIGNKTEELHKEFKILYVTAENFLNEFVE
FT                   SIKTNETKRFKKKYRHLDMLLIDDIHDLQKKEGIQEELFHTFNALYEDNKQMVFTCDRQ
FT                   PSELINFTDRLKSRFTRGLNVDISKPNFELRVAIIEKKAEEDGIKVPKNILNLVAKKVT
FT                   TNIRDLEAAVTKLKAHIDLEDIEIDTSIVDKIIKEIIAYENDKTNTNNTINIESIKKVI
FT                   LRELKLTNKDIEGNSKKPEITKARHIYAYLLRNFTELSTIEIGKIIGGKTHSTVLYSIN
FT                   KIDKERNNDLEINNLIIELMNKINKN"
FT   gene            459346..460506
FT                   /locus_tag="BT0438"
FT   CDS_pept        459346..460506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0438"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BT0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17765"
FT                   /db_xref="GOA:A1QZM3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZM3"
FT                   /protein_id="AAX17765.1"
FT                   /translation="MNEKFILCDTEQISNEIDKAKSIILNRNINDIWSAILLEVKNSNL
FT                   KIKATDRNIFFESTIPIVSAENFKVLINASNFSDAVKALNLYNELKIKFIEDESKLSII
FT                   GESENKNDNFINDHLSEPTFSSEEIEIYNYDINEEIYNLTVELTQREFKKIINKVSFSA
FT                   SHDESKNVLNGIYFTKDKNSALTFVSTNSHRLSVYKTDLIFEEDINFIVPVKMVNLLRQ
FT                   MMVGEGIIKLKISDKKFYVEFNNYKIVCSLINGNYPDYESIIPNEQQNKALIDVSILKD
FT                   RLSRVSSYTDKRSKKVILNFAGNQLRLMAEDPITGRKGEFFVQSPNYDYEGSEEVVAIN
FT                   SAYFTEAMGVFDTSKLEIKFSGGGILKLSDPANFGFIHLIMPMVLN"
FT   gene            460519..461595
FT                   /locus_tag="BT0438A"
FT   CDS_pept        460519..461595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0438A"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BT0438A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17766"
FT                   /db_xref="GOA:A1QZM4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZM4"
FT                   /protein_id="AAX17766.1"
FT                   /translation="MAKMIKKVEFFNFKNIENRVINFDFNNIYFCGENGSGKTNILDAI
FT                   YCLAFASSFLVRTDRELITYGKTEFYLKCFYNTEGKAGEIGLSLRNGKKEIKVNNSIVK
FT                   DRKNLILNIPSVIFSNYDTDFIIGAPAKKRWFFDQAISLVSLSYLDSLRKYRKILQQRN
FT                   LILRQGNKDLLKVYNETFVDFAFEITKMRENFIKHFYEFFKYYYSFIFDVSYSLEIKYL
FT                   PSVKCSKRDEFLQTLLLKEQDELYSESTLIGPHRDLYEILSGERVFTHHSSTGQIRALA
FT                   LIYRLIQVIMFNKQFGIAPILLFDDVFLELDSMRRKRIFDILPKDSQCFFTFLDDCYDI
FT                   KQDSKFIVYRIKNGRFQL"
FT   gene            461576..461875
FT                   /locus_tag="BT0439"
FT   CDS_pept        461576..461875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17767"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZM5"
FT                   /protein_id="AAX17767.1"
FT                   /translation="MEDFSFKKAADVLKEYLNTDICANEKLNASFILSKNWQIIFKDLA
FT                   DRVKLLNLKDNKILFVAVKNSSVLYTVSLNRSKIIKLIKESTGLEILDIKVLIR"
FT   gene            461966..462121
FT                   /locus_tag="BT0440"
FT   CDS_pept        461966..462121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0440"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17768"
FT                   /db_xref="GOA:A1QZM6"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZM6"
FT                   /protein_id="AAX17768.1"
FT                   /translation="MKRTYQPSRVKRNRKFGFRARMKTKGGRLILARRRAKGRSKLTVS
FT                   DEKKKY"
FT   gene            462102..462446
FT                   /locus_tag="BT0441"
FT   CDS_pept        462102..462446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0441"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:BT0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17769"
FT                   /db_xref="GOA:A1QZM7"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZM7"
FT                   /protein_id="AAX17769.1"
FT                   /translation="MKKRNISIKSKVEIQELFKKGRFIRIEGINIFYEFTSLSISRMIV
FT                   TFPKVFKGAVKRNRVRRIFKECFRKQLALLKNRYVDFIFVVYPQRVDVNYCEVDTMLKN
FT                   IIVHVMKRKV"
FT   gene            462443..464080
FT                   /locus_tag="BT0442"
FT   CDS_pept        462443..464080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0442"
FT                   /product="60 kDa inner membrane protein YidC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17770"
FT                   /db_xref="GOA:A1QZM8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZM8"
FT                   /protein_id="AAX17770.1"
FT                   /translation="MSQSKRILRAIYLSLFFIGIFMLVDDVFFSRKSPSVMEREIGFNL
FT                   DRDFDVEHHSIDENDTLSLSANSKEIGVETGIYYATFSTFGGNLVSLKLKDHLNLERNP
FT                   TEMVKVNMDREGLFYITFDNLTKSLFSYDKINDYTHEFKTKFEYNDKYYEYIKRYTFSS
FT                   KDEYLIKLEIFLNNVDANDNFDIDFYKFVLSSDIENLSERGKLQYNNYLSQSIYYDTKL
FT                   RYGKDGLSVIKPKWVGSSTKYFEVLVSKENMNVEFKQENKVLKTFVLNKIGDTSFSDTF
FT                   YIYAGPRDNGYLDIFNENNLNSFGLSNVEFGMSVEKSLLYFIQVPMQLIMQIFYDVIPN
FT                   WGLSIIFLTIVVRILIFPLTFKSFRATAELSKLQPKMKEIQVKFKNDPKRLNEEMGKLY
FT                   REEGVNPLGGCLPILLQLPVFFALYGLVNNFFLLRGASFIPGWIDDLSIGDSIYYFGYK
FT                   VFVWTDIRILPFIMMITQLLSTIISSNVSFKNLGSQQKFLYFGMPIMFFFILYDMPSGL
FT                   LIYWITTNIFTILQQYYIKMNVSERRNR"
FT   gene            464077..464799
FT                   /locus_tag="BT0443"
FT   CDS_pept        464077..464799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0443"
FT                   /product="Jag protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17771"
FT                   /db_xref="GOA:A1QZM9"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZM9"
FT                   /protein_id="AAX17771.1"
FT                   /translation="MSYEFYGKTEQEAIKKAMRDLDLREGEFDVEILDKEKVGFLFKKE
FT                   MIKIKVSPHVKEDTLKSEAQINEGICDKVLDFIKEMINKMGYCVDLKIESREGEYIKIS
FT                   IDTDSPNILIGREGRNLDALQLLANVYMSRLIGDNGIFNRIVLDIEDYRERFKSRFINL
FT                   AINSLHKVKRSRRSILLPTMNPFERRIIHTTLNRYSDIKTESEGDGNLKRVRISYVRSS
FT                   KYNNNFRSYQKRDSNVRK"
FT   gene            464950..466008
FT                   /locus_tag="BT0444"
FT   CDS_pept        464950..466008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0444"
FT                   /product="UDP-glucuronate 4-epimerase"
FT                   /EC_number="5.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:BT0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17772"
FT                   /db_xref="GOA:A1QZN0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZN0"
FT                   /protein_id="AAX17772.1"
FT                   /translation="MRVFLTGIAGFIGFHVAKRLADNGHEVLGVDVLNDYYEPNLKYER
FT                   LEVLGFDRKNIGSKKVIQSNKYNNLSFIYLDILDKDKVLSLFSDYKFTHVCHLAAQAGI
FT                   RDSIENPDSYISVNIVGFFNVLDACRIHKSHIEHFVYASTSAVYGINKKMPSDEDSITD
FT                   HPLNLYAASKKSNEVIAHAYSSSFNIPTTGLRFFTVYGPYGRPDMALYLFADGIIKQTP
FT                   INVFNNGDMARDFTYVDDVADGVYSVLKKPAESDVNFDVQNPNSSSSLAPYKIYNIGTG
FT                   HATELLEFINELETNLGNKACKNFLPMQKADVVKSCCNISKLKTDFAYESLISIKEGIK
FT                   KFANWYKSKIVE"
FT   gene            466129..467208
FT                   /locus_tag="BT0445"
FT   CDS_pept        466129..467208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0445"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:BT0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17773"
FT                   /db_xref="GOA:A1QZN1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZN1"
FT                   /protein_id="AAX17773.1"
FT                   /translation="MGVLDKIKPGVVYGKELHTLYEICKSEGFAIPAINCVGTNSINAV
FT                   LEAAKEINSPIMIQFSNSGSAFVCGKGLKVEKPQGTSILGAISGAMHVHLLAEHYGVPV
FT                   VLHTDHCAKKLIPWVEGLLEYGEKYYQEHKRPLFSSHMLDLSEEPIKENIEISKKFLER
FT                   MSKIEMFLEIELGITGGEEDGVDNSDREQHELFSTPEDIYYGYSELMKVSPNFQIAAAF
FT                   GNVHGVYKPGNVQLTPKVLRDGQNYVISKTNSSDPKPVSYVFHGGSGSTIEEIHEALSY
FT                   GVVKMNIDTDTQWAAWEGILNYYKNNENRLQGQLGDGSNADVPNKKFYDPRVWLRESEI
FT                   SIKERVKLACKSLNNINRN"
FT   gene            467477..467887
FT                   /locus_tag="BT0445A"
FT   CDS_pept        467477..467887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0445A"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0445A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17774"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZN2"
FT                   /protein_id="AAX17774.1"
FT                   /translation="MLLTNYKKNFLDFLNDDFDFMSPKGVHDIPVNIKDEGKSFILEAY
FT                   LPGIKKDDISISIKNDYLTISYESKDESEEKHDKYLRVERRDISFARSFRLSGNIDQDK
FT                   IKSELKNGVLHIKLPKKAEVIEKIQEKKIAIE"
FT   gene            complement(467915..469672)
FT                   /locus_tag="BT0446"
FT   CDS_pept        complement(467915..469672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0446"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BT0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17775"
FT                   /db_xref="GOA:A1QZN3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZN3"
FT                   /protein_id="AAX17775.1"
FT                   /translation="MFKTIKCNQINDKLINQKIEINAWVKKIRHHGKVTFINLRDRYDE
FT                   AQVLVNDEKLLKITSQIKMEYCIKVQGKLELRPSNLVNKEMRTGAFEILAENINIISRC
FT                   NELPFMIEDNNNANENAKLEYRYLDLRREEQKQKIILRSKVTHTIRNYLTKKDFLELET
FT                   PTFVKSTPEGARDFLVPSRIHKGHFYALPQSPQIYKQLTMIAGLDKYFQIARCYRDEDS
FT                   RGDRQPEFTQLDIEMSFIKKENIFKLMENLIFTIFKNTLNISLPKKFKRMTYKHAMNTY
FT                   GSDKPDTRYELLIQDMGKYFKQSSFNVFKDILQNKGTIKALIIKNQAHNFSRSKINNLE
FT                   EHAKIYKTSGLYFAKIENNEFVGGIAKFLNKIKQTLFQTYSLKNNDIIFFIADSWETAC
FT                   KAMGQIRIKIANELNLTNKNTFEFLWIYDFPLFEYDEDTKNYKAAHHMFSLPQQKYIDT
FT                   LESNPSKVLGEVYDLVLNGMELGSGSIRVHTRELQQRIFNIVGFKDTIAEERFGFFLKA
FT                   LEYGAPIHGGIAIGIDRLLMIMTHSSSIKDVILFPKNSFAASPLDKAPSKVPNEQLREL
FT                   NLTIEDYKN"
FT   gene            complement(469676..471796)
FT                   /locus_tag="BT0447"
FT   CDS_pept        complement(469676..471796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0447"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BT0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17776"
FT                   /db_xref="GOA:A1QZN4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR010884"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZN4"
FT                   /protein_id="AAX17776.1"
FT                   /translation="MNKKILYKILFIINPILSFGMADYMKDTSHNIDAKISSFIMSLAI
FT                   IVISASLLGNLVSKFGIPKVIGQITAGILLSPTFLGKIKIPLLFPLGIISVSDHYLINE
FT                   EIFAISTIASIILLFMAGLETDLKLFLKFLPRGGLIGITEVIGTFTSFALISTILFDVQ
FT                   LISPTALFIGIIATPSSAGIAASILSAKKKMSTSEGVTIISTSIIDDVLSMIMLTSVIT
FT                   ISRSLSDLDIAISITATIKNILIWFCLTFILILLSEPISKLLKSFNSVTLATVITITFT
FT                   FIVASFFQNLGMSFVIGAYIFGLAMSKTDIVCVIQDKLTIFERFFIPIFFTSIGLMADI
FT                   NVILSKEVLILGTLLSLIAIATKLIYCFIPSCFLGFNKLGALRIAFGMVPRGEISLIIA
FT                   NLALSSEFISQKIFGITIIIVFLPTIIVTPIINILFQINKNGLKKEIKTEQNTQITVSF
FT                   KYDNLTKILVWELKNELRKEGFFTQQIKNDFSQYINARYNDISLSIKREGSKITFECPN
FT                   KHLIIIQDLFRETILNLERITEEVKTVSVKAQKLNYSINYDKIRSNIALNKRIKKENII
FT                   LELKATNKTEVLRELLGVIKIEIDKEIILQDLMEREKLITTALKEGFAIPHLKTNLITK
FT                   MHIAIGISHDGIDFNATDKNLSHIFILILYPAKEYVNYPRILASIVGKVDSNKKEMLKA
FT                   KTDKEIYNIIVG"
FT   gene            complement(471793..472074)
FT                   /locus_tag="BT0448"
FT   CDS_pept        complement(471793..472074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0448"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BT0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17777"
FT                   /db_xref="GOA:A1QZN5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZN5"
FT                   /protein_id="AAX17777.1"
FT                   /translation="MQAITIEINNKEGLHSRPSSMIAELASKYPYCNVKLVTEDGREAD
FT                   AKSTVEIMILGVIYKEKIKIIANGKKETEIIDILSELLKSNFKKEIQK"
FT   gene            complement(472089..472385)
FT                   /locus_tag="BT0449"
FT   CDS_pept        complement(472089..472385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0449"
FT                   /product="ribosome-associated factor Y"
FT                   /db_xref="EnsemblGenomes-Gn:BT0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17778"
FT                   /db_xref="GOA:A1QZN6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZN6"
FT                   /protein_id="AAX17778.1"
FT                   /translation="MEPKIQAINYHLSDHTKDFIIKKLEKLGTHIKQNSESLKITIKKE
FT                   NDIFDIDAHLHFNWGKIIHITEHGKELYALIERLVERLQNTANKEKNKKDTVK"
FT   gene            complement(473576..474163)
FT                   /locus_tag="BT0451"
FT   CDS_pept        complement(473576..474163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0451"
FT                   /product="chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17779"
FT                   /db_xref="GOA:A1QZN7"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZN7"
FT                   /protein_id="AAX17779.1"
FT                   /translation="MFSNIYNTKNILSKKGINLILINLFITFFKIGILNFGGGNGIATI
FT                   INKEIIDNKGWITKEEFINIITISRITPGPVATNIATYVGTKVAGITGAIIATIALITA
FT                   PILIITFITLTLHKINFLNYYLKSLRPVIIALWIMTIIILFESIFLKISYNGTEFLKSF
FT                   AIAGLNLIILLFYKNITPAILIISSGILYIFM"
FT   gene            complement(474112..474690)
FT                   /locus_tag="BT0452"
FT   CDS_pept        complement(474112..474690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0452"
FT                   /product="chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17780"
FT                   /db_xref="GOA:A1QZN8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZN8"
FT                   /protein_id="AAX17780.1"
FT                   /translation="MDKTKKTPYELLTLFYLVLKITTITIGGGLLIISELRKIIVNKKK
FT                   LISDKEFNEILATSNVVPGVTAINFAFLIGKKLKGFKGAIMLTIAGILPSILVITMIAL
FT                   YVNLNSNNIYAQKFLEGAKISSTIIMSIIILEFSKKMLKQSITKWITCLLITYTLYKFN
FT                   IDISYILITVLFICSLTYTIQKIFFQKKV"
FT   gene            474864..475730
FT                   /locus_tag="BT0453"
FT   CDS_pept        474864..475730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0453"
FT                   /product="mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:BT0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17781"
FT                   /db_xref="GOA:A1QZN9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZN9"
FT                   /protein_id="AAX17781.1"
FT                   /translation="MDKQSKTFSVFREIFVFQDYVNEIFEMVIVYGLKVLVALVVWCVS
FT                   RFFVKRVGRLFFSAFEKSKLETKLDSTILNFFKSFFKVMIDMVLILMILPYLGVSTTSI
FT                   FAIFGSLGLAVGLAAQGILSDFVSGFVVLNSSFFKIGDYISCDDVEGEVNDIHIFFTTL
FT                   QTVDGKIIKIPNSKFTDTSVTNFSTNPERRIAFDFQVPYDTDIGSLKSRIENLAFSFNK
FT                   EQYGINKPSVVVKEYTPYYIVMQVRSFVKTEFFWDFQYFIAENIKGILDDMGIKFPIHN
FT                   VDFSKLR"
FT   gene            complement(475727..476878)
FT                   /locus_tag="BT0454"
FT   CDS_pept        complement(475727..476878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0454"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase"
FT                   /EC_number="2.4.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:BT0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17782"
FT                   /db_xref="GOA:A1QZP0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZP0"
FT                   /protein_id="AAX17782.1"
FT                   /translation="MKIAIFTDTYLPDKNGVATSIKQIKEGFERKGHSVYIFCPQSQKT
FT                   DLQEDHIYRCFSIKLNQTVDAKIAFPNKTRIKKIIQEYQPEIIHTHSEFTMGKIGKKLA
FT                   LQHNIPIVHTNHTMWNYYLHYLGIFKYLTNPDKMMKKFYDQIHHFIYPSIKSHNKYFHL
FT                   ATNADYKIIPNGVDRKIFIKDLSQEKRQEILTKHGISKNDKIIIFVGRINEEKNICLLM
FT                   KHLKKLLIENKNCKLILIGKGKEETKIRRFRKQYELEKQIILIGTIPWEEMYYYYKISD
FT                   VFTSLSRSEVYPMTTIEALTAGIPAVLINDIIYKDVIQQGKNGFLIDDYENLYKYIKEI
FT                   IENEEKLQTLKKNTEETSMMFSSSFFVEKIEQYYSEIIKNKKY"
FT   gene            476938..477927
FT                   /locus_tag="BT0455"
FT   CDS_pept        476938..477927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0455"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17783"
FT                   /db_xref="GOA:A1QZP1"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZP1"
FT                   /protein_id="AAX17783.1"
FT                   /translation="MKEIYLLLGKEQGLKEAYLNNIFSKLNADNICVTKLFMSELSSIE
FT                   LSERLLTNSFFSKEEVFIIYESENLKNKKDLELVYSTILKSLNKIIIFVSNENSISFDP
FT                   KGSLNLVKKTFYELSDTDKFLFVKKSFFKLGIKITDKAIHLMLFMLDADTKILQFYVNS
FT                   FALMIKNKTIDEHDVNSWLSFMRPENPFSLFESILKKDMEYALVKIKSILEQGEDLVNI
FT                   VMSLGWQFKKFLKVKIDCESLHDIPSVFKKHKIFVSLEKVYKIGLKNYSIFDIKFILKL
FT                   LHKFDLYARIYGKNMHLNLSYFMILVLLSQDDTILDNFSSKFKFTNVL"
FT   gene            complement(478027..479835)
FT                   /locus_tag="BT0457"
FT   CDS_pept        complement(478027..479835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0457"
FT                   /product="excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:BT0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17784"
FT                   /db_xref="GOA:A1QZP2"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZP2"
FT                   /protein_id="AAX17784.1"
FT                   /translation="MREHLNCLHKKVQEFPTTSGCYKMYSQDNKILYIGKAKNLRSRLK
FT                   NYFLEKISLKTKILMRNVVNIEVITTNSEYEALLLECNLIKEHKPDYNIKLKDDKGYPM
FT                   IRITCEKYPKVFKTRKIINDGSEYFGPYVNAKHLDLVLNLINKTFKTRKCKKKSKNPCL
FT                   YFHMGQCLGVCYRNDLEEQYKEEVNKIRHILNGNISKLLDEIEIKMKEVIKREDFESAI
FT                   KLKETKRSLIEISQTQIITKINKLSTDYIYIHKTDNLNVIVIFKYKDGKLVEKDINFDE
FT                   SIYEEEELIAEFITQYYTSLNMIVPDKICIFKKIETEDITKLINELKSTNTEIVYEETK
FT                   DAIKIMEMAISNAEIALKAYNNEKNKALENLKIILEMTKLPKTIEGFDIAHLNGYKTVA
FT                   SLVTFKMGKPFKDGYRVYKINSLNDGEINDFKAIKEIISRRYTKLINEQLELPTLILID
FT                   GGKGQLNAAYSILKGLKIEDKVTICALAKQEETIFLPNKTQGIKLPKGNPALKILQNVR
FT                   DESHRKANSFNRKLRKNIKLNYSKIEGIGEKKAKNILKTLGTYKDIFLLNEDEIAQKMK
FT                   INIKMAKKIKKFSEDQNLKNTHSIES"
FT   gene            479953..481470
FT                   /locus_tag="BT0458"
FT   CDS_pept        479953..481470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17785"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZP3"
FT                   /protein_id="AAX17785.1"
FT                   /translation="MRLIFIFALFCLCLYSVFSQELKLILDAKDGFKFIQEAHNISFTR
FT                   GDRGVLGIYLDRHKGVLDFNNVDFRLEIEKDSIVKDAALNYSVDSNNAKISNSFHNIAG
FT                   NSLIFYSSRNTIKLKPLTKKAFFCSGNVISDFTIQFWAYRSTSVTGEVIVSWNGYKNIK
FT                   GVWLDQAIRLESEGGTFVWNFNNVFLNDNGEPIKIKLRSDDDFIPKEWHLHTVRYRQKD
FT                   GLLEYLIDSKPQAIEYVTADKREGFGYLLNIGNFIDFTLGQYFTGAIENFEIHKSFEEV
FT                   HNAFFSRDKGYIITEPIKLSKDYSQILSVEFDTVKPKDTDIFYYYRLDNKMFYGTDKNG
FT                   KIKKNLTGDWIHFDPKNGFPKFDVSKYIQIKVELYPSGDPVDSPSLYSMILTYIPEAAP
FT                   FPPLITKAVPGAGEILIEWFPVISSNVGGYYIYIGVSPGNYHDKAGNILTSPIDVGNQT
FT                   SFRITGLENGRLYYISVASYNLDKSVNEASFSKEISVRPMEFFKQYE"
FT   gene            481463..482770
FT                   /locus_tag="BT0459"
FT   CDS_pept        481463..482770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0459"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17786"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZP4"
FT                   /protein_id="AAX17786.1"
FT                   /translation="MNSIDFEKALELYKNGDLKNALLNLDVFDDSFDSLALKSLIYFRL
FT                   KDYKALLYVLDTYPVLSEYRFLIKLLHYGKFEDQKSELSYFQNYNLGVFYFGLKDYEKS
FT                   LSYFLKSSQQHPSLIQAINNAAILLEILGRKDEATQMLIKAVDVDKNNALVKLNVWFLK
FT                   NNCIFNSAKPFEIDESFKEANLSLVVNYLMYYFYSIGEISSAIKLSERFLTDSNYSKYI
FT                   WHNRATILHKIGNMTQATKSYVKAILNFPNIYTIYNMHIATIELLNFSPKRSIDRMLLD
FT                   YPNMDSVCFYAFLFFLRNRELEDAYFYIKKLCEIKPDTYSKFLNLLESREDILIEELLD
FT                   EFAMVLKGRWTLEYLFFIDNSLNLKDPVFVFDYNTRLCPYIWKIKDEHIELRANNNEVE
FT                   ITKKIFSDELMQVKLDVAIKEIRDLIEAYRDFKINC"
FT   gene            482839..482928
FT                   /locus_tag="BTT0010"
FT   tRNA            482839..482928
FT                   /locus_tag="BTT0010"
FT                   /product="tRNA-Ser"
FT   gene            482995..483080
FT                   /locus_tag="BTT0011"
FT   tRNA            482995..483080
FT                   /locus_tag="BTT0011"
FT                   /product="tRNA-Ser"
FT   gene            complement(483112..483810)
FT                   /locus_tag="BT0460"
FT   CDS_pept        complement(483112..483810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17787"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZP5"
FT                   /protein_id="AAX17787.1"
FT                   /translation="MTIKLPTIIATFLLIISCTKHAQKIENTEINIEKKIIKETITDED
FT                   NNIFHIDAQTPITEGLELGFEKLIKEWKTNKIESLKTKKSKNYNYESFYYSDFEIFKSP
FT                   DLKITSILYSQYTIDKYDANGITTYHPINLRGKEKIKLSDIISKDQLDSLMQVLRTQVE
FT                   TDFKKFGIYSDMYSNNKSKFEEEFEKAFKQYKYYFKNNNVVIFYDALTIRPRVDGKIEF
FT                   IFPIDNNTEN"
FT   gene            483938..484011
FT                   /locus_tag="BTT0012"
FT   tRNA            483938..484011
FT                   /locus_tag="BTT0012"
FT                   /product="tRNA-Arg"
FT   gene            484028..484114
FT                   /locus_tag="BTT0013"
FT   tRNA            484028..484114
FT                   /locus_tag="BTT0013"
FT                   /product="tRNA-Ser"
FT   gene            484378..486024
FT                   /locus_tag="BT0461"
FT   CDS_pept        484378..486024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0461"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BT0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17788"
FT                   /db_xref="GOA:A1QZP6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZP6"
FT                   /protein_id="AAX17788.1"
FT                   /translation="MISARGTAIKRRPRDLNSLEGQDFVVETLKHSIENNKIANAYIFS
FT                   GPRGVGKTSSARAFARCLNCKIGPTIMPCDMCFSCKSIDNDNKLDIIEIDGASNTSVQD
FT                   VKQIKEEIMFPPASSRYRVYIIDEVHMLSNSAFNALLKTIEEPPSYIVFIFATTEVHKL
FT                   PDTIKSRCQHFNFRLLPLDKVYEMLKHVCLEDNIKYEDEALRWIAYKSGGSVRDAYTLF
FT                   DQIVSLSNSDIQFERIRSKMGFTSSEFLEKLALSILNDDLKELLCILDAVFLTGISCEQ
FT                   LLLDTIEFFREILFLKLGIKNLMFIGIKPESLKEKLLSFDLKHVERSISVLLETYRDLQ
FT                   FSVNPKYELEINFIKILRLKDYVPSHVLIKQIQDIEAKVLDEVSLNLNDTDFDTDVEPK
FT                   LENISSVEPVELGLDKTETALKTEVKASTHLDLNGDDIDEIFIETKDNFDKVDDNDKIK
FT                   ESFVYLVSKYVQTLVYSGEVLIDNDVLYYKIFSGFEYNQLQAYQNEIRAEFCKEFPRLN
FT                   VVFQKQFKDDDDEFDSKVLKIKNIFGASEVK"
FT   gene            486031..486330
FT                   /locus_tag="BT0462"
FT   CDS_pept        486031..486330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17789"
FT                   /db_xref="GOA:A1QZP7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZP7"
FT                   /protein_id="AAX17789.1"
FT                   /translation="MAVNPLDFLKNMSGFKDNIDNFKKEISQIVVCGRAGSDVVVVEMN
FT                   GEFVVKKVVIKEEFFSDLDNEALEHMIKSAFNDAISKVKEEIKSKTMGSIPFGI"
FT   gene            486334..486918
FT                   /locus_tag="BT0462A"
FT   CDS_pept        486334..486918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0462A"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BT0462A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17790"
FT                   /db_xref="GOA:A1QZP8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZP8"
FT                   /protein_id="AAX17790.1"
FT                   /translation="MIIQDLIVLLSKLPGIGRKTAVRMVYDILYNGEEYSRALGQILIG
FT                   FHSSIRKCKNCHNLAEGEFCNICMDLSRCKDMICIVEMPQDLEVIESTREYDGLYFVLH
FT                   GHLDPLRDIGPNRLNLDKLENYVREVGAQEVIIATEFSIEGDVTANYISGILKNLGINV
FT                   TRIASGLPAGGSISNADKITTLRALRLRLKM"
FT   gene            487242..487751
FT                   /locus_tag="BT0463"
FT   CDS_pept        487242..487751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0463"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:BT0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17791"
FT                   /db_xref="GOA:A1QZP9"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZP9"
FT                   /protein_id="AAX17791.1"
FT                   /translation="MSTLIQRTLCIIKPDGVRRGLIGNVISRFERTGLKIVAAKMILVN
FT                   REMAETHYLYDDIAVRHGEFVWQSLINFIISSPVFVFVVEGVEAVEVVRKFCGSTEPKM
FT                   ASPGTIRGDFAYHSFNYANEKEFSVYNVIHASANVDDALREVSLWFKENEILTYKRDDE
FT                   FEHYYG"
FT   gene            487726..488577
FT                   /locus_tag="BT0463A"
FT   CDS_pept        487726..488577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0463A"
FT                   /product="adenine-specific methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:BT0463A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17792"
FT                   /db_xref="GOA:A1QZQ0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZQ0"
FT                   /protein_id="AAX17792.1"
FT                   /translation="MSLNIIMVNVDMNIAIRPILKWAGGKKNLLSSILDNIPLAFNNYI
FT                   EPFVGGGALFFALNVKNSIINDINSNLINFYREIAYNLDDFLLEIEKYNNAPLTKEYYV
FT                   HIRNSFNNENLTNLEKACIFLYLNKTCYNGLYRENGNGKFNTPFGKHKKISLYEIKNLQ
FT                   LASKLLREVKVLNLDFFCLLDFIKKDDFVYLDPPYIPYSKTSNFTSYSKYGFDFRMHEK
FT                   LLQFCDKIDKKGAKFLLSNSNTASSLELYKNYNVTFVDAKRFINSNPIRRGSIREILVK
FT                   NF"
FT   gene            488815..489351
FT                   /locus_tag="BT0464"
FT   CDS_pept        488815..489351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17793"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZQ1"
FT                   /protein_id="AAX17793.1"
FT                   /translation="MMRFALFYFLSILLFLNCTFDYDEHSGRAGAAKETPSIQILGISY
FT                   HNVVGGKKQTILEALSFNYFNYYKIYKIDNGRFLYHALENRISGRFNSLEGSHVTKDLD
FT                   IKDSVELKIEDVNNYYLINTNRLLWKDNEKKLLSPPNELVFIRFDESNITGKGFSYFLK
FT                   NNNFYFYSGIEGLVK"
FT   gene            489348..490046
FT                   /locus_tag="BT0465"
FT   CDS_pept        489348..490046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17794"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZQ2"
FT                   /protein_id="AAX17794.1"
FT                   /translation="MRSLVICLVCIYFLSSYAQDEKSFNKSSKLKTEGDAQKKNEFTFR
FT                   ADFSHGIFSSVYRRVILKGNPEVISSDFKLRADEIEIYGEGSAYIEARGNVYYEDYVNK
FT                   MNVKSQFLFVNRKLDNFYLQKGVELEDLENELIVKAERIEGSRKTSVYIMQYSVKIYKG
FT                   DIFARAENGIYNKEDKEIVLEGIPVIYQDDNYYSASRIIFNTETKKYNLEGDVEGKFTQ
FT                   VEGDVPQQKK"
FT   gene            489982..490815
FT                   /locus_tag="BT0466"
FT   CDS_pept        489982..490815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0466"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17795"
FT                   /db_xref="GOA:A1QZQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZQ3"
FT                   /protein_id="AAX17795.1"
FT                   /translation="MRVMLKVNLLKWREMFLNKKNSIKSIKEKLSLDTVTNIVLKADNV
FT                   VKRYGKKLAVNGVTIDVHRGEVVGLLGPNGAGKTTTFYTIVGFIKANSGRVLINSHDIS
FT                   GLNMYERARLGIVYLPQEPSIFRELTVEDNILIALERREDLSQTERKMELVNLLKDFEI
FT                   KRIQHQKAYTLSGGERRRTEIARALAVSPYFLLLDEPFAGIDPIAIGDIKDIIRILKSK
FT                   NIGVLITDHNVRDAFDIIDRAYIIYQGQVLDEGNVDYIINSEKAKKLYLGEEFRL"
FT   gene            490812..491501
FT                   /locus_tag="BT0467"
FT   CDS_pept        490812..491501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0467"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17796"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZQ4"
FT                   /protein_id="AAX17796.1"
FT                   /translation="MRVVENEFYYEFELDPSIKLIYTKKPFDLNIRDISIDNLSFIPKD
FT                   KKVKYLKQLHTNVVYEVSDDFVNFQEGDGLVSSSCNVALLAYYADCLPIYIFDKSKKYI
FT                   GLAHSGYKGSFKLIILKMLFMFESMGSNFEDLKIVFGPYNRLCCYEVSSEFLSEINLKF
FT                   SKKLLDMSFCKKDDKIYFDNANFNLGLISNFNLDVEDSGLCTYCNCNLYSHRKFKGKRS
FT                   YAAIWRT"
FT   gene            491401..492249
FT                   /locus_tag="BT0468"
FT   CDS_pept        491401..492249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0468"
FT                   /product="NIF3-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17797"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZQ5"
FT                   /protein_id="AAX17797.1"
FT                   /translation="MLRIQVCVLIVIAIFILIENLRAREVTLQFGELNLTVKELSLNLD
FT                   EIFKVKDYRSIDKSLNGLQVGNLELEVKRVAFAVDASMATLREAKDYDFLITHHGIFWS
FT                   KSEKIVSGIYEKVKWLIDNDLSLYCVHLPMDAHPVYSHSRVLSDFFGFHNPIPFANYKG
FT                   INLGIISIAGFNFSEILKKIEIHNKHILYYKKFKEYVEKVAIVSGSGYSFFEESLEHGV
FT                   DLFITGDTSHQIYSLAEEYGVNLIFAGHYFTETFGLIKLMEYFRNQEKLEVNFILKNTN
FT                   L"
FT   gene            492259..492771
FT                   /locus_tag="BT0469"
FT   CDS_pept        492259..492771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0469"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:BT0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17798"
FT                   /db_xref="GOA:A1QZQ6"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZQ6"
FT                   /protein_id="AAX17798.1"
FT                   /translation="MNINRSRLINNFIFISILVFFDQWSKYLVVKYIRIGTEYLSFFGD
FT                   FFKIIHVRNTGVLFSIGSNIDPSLKNLFFLIIPIIILIFVFSFALKETNRIARIALVLI
FT                   LSGGIGNIIDRFFRPLGVVDFLDVKFFGIFGLQRWPTFNFADSYVVIGITLFIIYDLFA
FT                   KNQSTNL"
FT   gene            492768..492995
FT                   /locus_tag="BT0469A"
FT   CDS_pept        492768..492995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0469A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0469A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17799"
FT                   /db_xref="GOA:A1QZQ7"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZQ7"
FT                   /protein_id="AAX17799.1"
FT                   /translation="MKILYFILCSLINLSLMFLVFFLEFLCIAKLNIIVSSVFQLVLVF
FT                   FMIIIAIVISYVLSSIILKNIISKFFNLDK"
FT   gene            493010..493828
FT                   /locus_tag="BT0471"
FT   CDS_pept        493010..493828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17800"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZQ8"
FT                   /protein_id="AAX17800.1"
FT                   /translation="MSLRILIAGEVVGKPGIVVIKNFLSSFKQKKGIDFVISGNNFTTG
FT                   FRGLCKRHAFLLKKYGVDVLTLGENAFVRAGLSDELDKYNFILKPLNCPTKLKGYSYFI
FT                   YSVSGSKVAVIRLVGQTGITKYNFNNPFFAFDYFYEKIKLHTNNIIVLFDSNTTAEVNA
FT                   MFFYLKSRVSACLGIGKRILTADLRIFDSTAVITDLGRVGSLNSVIGYEPKFEIDKFLR
FT                   GFLNNRFTESWDGLGFNGVIVDIDNGKAVKVEIVREYIDFDGYLENSNDV"
FT   gene            493874..495175
FT                   /locus_tag="BT0472"
FT   CDS_pept        493874..495175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0472"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BT0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17801"
FT                   /db_xref="GOA:A1QZQ9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZQ9"
FT                   /protein_id="AAX17801.1"
FT                   /translation="MFSVEVIMYSYLVEGGFKIGGKITASGNKNAALPCITATLLTDEE
FT                   VILENIPDIKDVEVILSILKDIGAEVLREGDTLKIKALNVVKTEIDSSLTDLIRASILF
FT                   LGPMIARCGRIDIAPPGGDVIGKRRLDTHFYGLGKLGARLIEGERIVLEIDKLVGAYMF
FT                   LDEASVTATENIIMAAVLAFGETVIINAACEPHVQDLCNMLNSMGADISGIGSNVLRIK
FT                   GVKKLSGTRFRIGADFMQVGSLISLSALTGGELEINKADPKNFVLISHVYSRLGINFEY
FT                   DNENIYVKEKQDLKVKLDFGGHVPKIDDGPWPAFPTDLMSIMIVTATQVHGTVLIFEKM
FT                   FESRMFFVDKLIKMGAQIVLCDPHRVVVTGKTILKGSNVSSPDVRAGMSLLIAALCAEG
FT                   ESRIQNVYQIERGYEDVVVKLGALGAKITRVEER"
FT   gene            495395..496783
FT                   /locus_tag="BT0473"
FT   CDS_pept        495395..496783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0473"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BT0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17802"
FT                   /db_xref="GOA:A1QZR0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZR0"
FT                   /protein_id="AAX17802.1"
FT                   /translation="MTIYQYNKIQGVFFMLLSRTKTRELILEGNLYRVLLVISFPIVIT
FT                   NVLQAFYELVDMFYVGKLGVMPLAALSLTGPINFFIMVFAMGMAIGSVSLMSRCIGEET
FT                   FSKFSKYAGQLIFLNFVLSLFVAVLVLVFIDSILDIMNVSGELRELTKSYFYVVIYAIP
FT                   VMFLSVSVVYILNAQGETVIAMMLILVANVINFILDPILMFTFGLGIAGAAWSTLFSKL
FT                   MTVFSYFFLTYRLNCGLKVRLRDIAPDIIIIKNIINLGFPAIFGQMMASLSFLIFNYIV
FT                   IQISSKFLAAYGMANNIISFLLLPGMSIGTGIIAIVGQNLGAKNISRVEDILKKGFFVT
FT                   LIIMITVASFLISFKEIIIETFTNDLEVVGYANSYFLLASIGAVGFGLQQVFFGGLIGA
FT                   GFTKLVMIVICIRLWIIRLPAVFILQYFGFMEDSLGYAFIISNYVALIILLCLTFTKYW
FT                   AKAQ"
FT   gene            complement(496918..497307)
FT                   /locus_tag="BT0475"
FT   CDS_pept        complement(496918..497307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17803"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZR1"
FT                   /protein_id="AAX17803.1"
FT                   /translation="MSQHNLEKRLLNIFTIFIVSITTSCIKNNSVKSKEISREITHIIS
FT                   IKKDTEKIEIVKFHTNNKNELIITLKNNKKIAIKQNSLAIFKKGNKTGHIIKEGLKAGE
FT                   EKTFKLKINTNKRQKNIFYIFLKQD"
FT   gene            497704..498888
FT                   /locus_tag="BT0476"
FT   CDS_pept        497704..498888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0476"
FT                   /product="protein translation elongation factor Tu (EF-TU)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17804"
FT                   /db_xref="GOA:A1QZR2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZR2"
FT                   /protein_id="AAX17804.1"
FT                   /translation="MAKEVFQRTKPHMNVGTIGHVDHGKTTLTAAISIYCSKVNKDAKA
FT                   LKYEDIDNAPEEKARGITINARHIEYETAGMHYAHVDCPGHADYIKNMITGAAQMDAAV
FT                   LLVAADSGAEPQTKEHLLLAQRMGINKIIVFLNKLDLADPELVELVEVEVLELVEKYGF
FT                   PGDTPIVKGSAFGAMSNPDDPEATKCIKELLETMDNYFDLPQRDIDKPFLLAVEDVFSI
FT                   SGRGTVATGRIERGVIKVGQEVEIVGIRETRKTTVTGVEMFQKILEQGQAGDNVGLLLR
FT                   GVDKKDIERGQVIAAIGTITPHKKFKASIYCLTKEEGGRHKPFFSGYRPQFFFRTTDVT
FT                   GMVSLEGKEMVMPGDNVDIVVELISSIAMDKNVEFAVREGGRTVASGRILEILE"
FT   gene            498935..499246
FT                   /locus_tag="BT0477"
FT   CDS_pept        498935..499246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0477"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17805"
FT                   /db_xref="GOA:A1QZR3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZR3"
FT                   /protein_id="AAX17805.1"
FT                   /translation="MITKDKIRVRLFSFDVKILDQSAESIVRAVQKSKAQIKGPIPLPT
FT                   KIKKYTVLRSPHVNKKSREQFEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIKQ"
FT   gene            499282..499911
FT                   /locus_tag="BT0478"
FT   CDS_pept        499282..499911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0478"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17806"
FT                   /db_xref="GOA:A1QZR4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZR4"
FT                   /protein_id="AAX17806.1"
FT                   /translation="MLGLIGKKVGMTQVFQGNGVVVPVTVIEFEPNYVIGKKTVERDGY
FT                   DALIMGSVDLRSSKISKPIRGQYKNLENVEPKRYVIEFKGLKGYDAGDEIGLDAFREIK
FT                   YVDITGTTKGKGFQGAMKRHNFSGGPSSHGSKFHRHLGGTGQATTPARTFKGTKMAGRM
FT                   GGEQQTIQNLEVVFIDEEKRAILVKGAVPGVKGSFVIVKKAKKVGV"
FT   gene            499874..500542
FT                   /locus_tag="BT0479"
FT   CDS_pept        499874..500542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0479"
FT                   /product="LSU ribosomal protein L1E"
FT                   /note="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17807"
FT                   /db_xref="GOA:A1QZR5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZR5"
FT                   /protein_id="AAX17807.1"
FT                   /translation="MLLLKRRKKWVFSMERKVFSKDGQELRTINLEEGVFNIDISYGSI
FT                   YNAINNELANLRVGTASTKTRSEVRGSSKKPWKQKGTGRARVGTKRNPVWVGGGVALGP
FT                   KPRDYSYKLPKKVKRLAFRSVLSLCVSVEDRLKIVENFTIESGKTKDLALIMKNFIKIN
FT                   GKTVILLGNDDQMVKRAGKNIRDLKILSFNRLRVVDLFYAKNLIALESAINGLNELYVK
FT                   "
FT   gene            500564..500860
FT                   /locus_tag="BT0480"
FT   CDS_pept        500564..500860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0480"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17808"
FT                   /db_xref="GOA:A1QZR6"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZR6"
FT                   /protein_id="AAX17808.1"
FT                   /translation="MKAYDIIISPMLTEKTNIQRENMNVYAFKVRKQANKKEIGAAIKE
FT                   LFNVTPISCNLLNVKSKVKMVVSRKGYPIGKGKTSSWKKAYVYLKKEDKIDIF"
FT   gene            500860..501711
FT                   /locus_tag="BT0481"
FT   CDS_pept        500860..501711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0481"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17809"
FT                   /db_xref="GOA:A1QZR7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZR7"
FT                   /protein_id="AAX17809.1"
FT                   /translation="MVLEKNMGIKTYKPKTSSLRYKTTLSFDELSKGNSPLKSLTRGKV
FT                   SRAGRDSSGRISVRRRGGGHKRRYREIDFGRRDKFGIPARVVSIEYDPNRSSNIALLVY
FT                   RDGDKRYIIAPKGIKVGDILESGPNAPIRIGNALPLEDIPVGKAVHNIELNVGKGGQLV
FT                   RGAGGYAMVLASKGDYVTVKLPSGEMRMIFKKCIATLGEVGNEDYINVSIGKAGKSRWL
FT                   GKRPKVRGVAMNPIDHPHGGGEGKTSGGRHPVSPWGQPTKGYKTRKKNKYSDKFIIKRR
FT                   NN"
FT   gene            501721..501999
FT                   /locus_tag="BT0482"
FT   CDS_pept        501721..501999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0482"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17810"
FT                   /db_xref="GOA:A1QZR8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZR8"
FT                   /protein_id="AAX17810.1"
FT                   /translation="MARSIKKGPFIEKSLYQKVLASSGREKRVVIKTYSRASTIIPEMV
FT                   SLTISVYNGKSFIPVYITEDLVGHKLGEFSPTRIFRGHAKSDKKGRK"
FT   gene            502005..502367
FT                   /locus_tag="BT0483"
FT   CDS_pept        502005..502367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0483"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17811"
FT                   /db_xref="GOA:A1QZR9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZR9"
FT                   /protein_id="AAX17811.1"
FT                   /translation="MFVNRRYTARGKNLPSSPKKVRPIADNIRGKPYSEAVAILCSMPN
FT                   KCAKLLGKVVKSAASNAMYHNRNLSEDMIFIKTVMVDDGRRRRSVWPRARGRADRLVNR
FT                   SCHIFVEVYEKMYGGE"
FT   gene            502371..503201
FT                   /locus_tag="BT0484"
FT   CDS_pept        502371..503201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0484"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17812"
FT                   /db_xref="GOA:A1QZS0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS0"
FT                   /protein_id="AAX17812.1"
FT                   /translation="MGQKVHPYSLRIKINRDWKSKWYFDKKLYSEILHEDFLIRRETMK
FT                   FLKGIRFDISDIEIIRNNLQRVTVIISTPRPGSVIGVKGANLEKIGQLLTRKISKKINI
FT                   KIKEIKKPEFDAQIVANGIAKQLENRASYRKLLKSSLLSSISKGVQGVKIKVSGRLGGA
FT                   EIARSFEVKEGRIPLHTLRANIDYGFAEAQTTYGVIGVKVWLFKGEVLGKQTNSDAGQV
FT                   INKKTSREKSEYFDKNRVDDKSKKVVNDDKFSRKKLEFGSKSNSSFKKKNGSDV"
FT   gene            503221..503637
FT                   /locus_tag="BT0485"
FT   CDS_pept        503221..503637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0485"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17813"
FT                   /db_xref="GOA:A1QZS1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS1"
FT                   /protein_id="AAX17813.1"
FT                   /translation="MLSPRKVKYRKKQRGRLSGEAQKGNEISFGEYGLVSLETYFITAR
FT                   QIEAARVAMTRRVKRGGKVWIRIFPDVPYTKKPAETRMGKGKGGVDHWNAPVKLGTVMF
FT                   EMAGVPRELAEAAMMLASSKLPVKTTFVVRRDLR"
FT   gene            503641..503841
FT                   /locus_tag="BT0486"
FT   CDS_pept        503641..503841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0486"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17814"
FT                   /db_xref="GOA:A1QZS2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS2"
FT                   /protein_id="AAX17814.1"
FT                   /translation="MLKKFRDLTLEDIKAKRLSLKKEYMDLRFKAVVGHVENPLKKREL
FT                   RRDIARLNTIVHEYEIGIRKV"
FT   gene            503847..504101
FT                   /locus_tag="BT0487"
FT   CDS_pept        503847..504101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0487"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17815"
FT                   /db_xref="GOA:A1QZS3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS3"
FT                   /protein_id="AAX17815.1"
FT                   /translation="MARENKKELIGKVVSDKMSKTIVVEIVQRKMHPIYHKYLKVSRRV
FT                   KAHDEREESKLGDKVKIIESRPISKEKRWMLVEVLEKSK"
FT   gene            504132..504500
FT                   /locus_tag="BT0488"
FT   CDS_pept        504132..504500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0488"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17816"
FT                   /db_xref="GOA:A1QZS4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS4"
FT                   /protein_id="AAX17816.1"
FT                   /translation="MVQMQTYLTVADNTGGKIAECIKVLGGSKKRSARVGDIIVIAVKQ
FT                   AIPNSPIKKGEVHKAVVVRTSKEIRRKNGTYVRFDDNACVILDANLNPRGKRVFGPVAR
FT                   ELRDANFMKVVSLASEVI"
FT   gene            504511..504816
FT                   /locus_tag="BT0489"
FT   CDS_pept        504511..504816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0489"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17817"
FT                   /db_xref="GOA:A1QZS5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS5"
FT                   /protein_id="AAX17817.1"
FT                   /translation="MKTKLKVGDNVKILCGKDRGKTGEVVSIDRKNLKVIVKSCNMVKK
FT                   VVKARTPQEKSKIIDKEAPIDISNVMLFSSGIASRIGFKFENNEKKRYLKKNGENV"
FT   gene            504820..505368
FT                   /locus_tag="BT0490"
FT   CDS_pept        504820..505368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0490"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17818"
FT                   /db_xref="GOA:A1QZS6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS6"
FT                   /protein_id="AAX17818.1"
FT                   /translation="MSYVPALKKHYKDNIIKELVSEFQYKSIMQAPKIEKIIVSMGVGD
FT                   AVKNKKLLDSAVYELSQITGQRAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNIMYEFLY
FT                   KLINLALPRVKDFRGVNGNAFDGNGNYSFGIAEQIIFSEIDYDKIERISGLNVTIVTTA
FT                   LNDREGKALLSKFGMPFSN"
FT   gene            505383..505568
FT                   /locus_tag="BT0491"
FT   CDS_pept        505383..505568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0491"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17819"
FT                   /db_xref="GOA:A1QZS7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS7"
FT                   /protein_id="AAX17819.1"
FT                   /translation="MAKKSMIVKALRKPKYKTRQKNRCKLCGRPKGYMRDFGMCRICFR
FT                   NHASAGLIPGVSKSSW"
FT   gene            505578..505976
FT                   /locus_tag="BT0492"
FT   CDS_pept        505578..505976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0492"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17820"
FT                   /db_xref="GOA:A1QZS8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS8"
FT                   /protein_id="AAX17820.1"
FT                   /translation="MAVTHSVGDMLTKIRNASRVKHESVDLKMSKINKSILDILKEEGY
FT                   IKNYNIFDKKGISFIKAILNYDNKRNPAINRIDAISTPGRKVYSSYKNMPRIKNGYGIL
FT                   IVSSSKGVITGKQAKDNKVGGELICSVW"
FT   gene            505996..506538
FT                   /locus_tag="BT0493"
FT   CDS_pept        505996..506538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0493"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17821"
FT                   /db_xref="GOA:A1QZS9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZS9"
FT                   /protein_id="AAX17821.1"
FT                   /translation="MSRIGKLPIKIVDSVKVDIKDNIVTVEGKRGKLSQELKSSIKVRV
FT                   EDSNIIVERSFDDKQTRAFHGLYRSLISNMVKGVSDGFSKSLTISGIGYRVEQQGTSLF
FT                   FNLGYSTQFEYVIPEGINIRLDGNTKIAVEGIDKCRVGQVAAEIRGLRVPEPYKGKGIK
FT                   YDNEVIRRKVGKSGVKK"
FT   gene            506556..506915
FT                   /locus_tag="BT0494"
FT   CDS_pept        506556..506915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0494"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17822"
FT                   /db_xref="GOA:A1QZT0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZT0"
FT                   /protein_id="AAX17822.1"
FT                   /translation="MKKVKEAEKRNIKRKKRIRDRIGFGVADRPRVTVFKSNKYFYVQV
FT                   IDDVAGHTLASVSTIEKDLKLNKNIDDIRKLGEVLAKKLKDKNINKLIFDRNGYKYHGL
FT                   IASFATSLREAGIDV"
FT   gene            506927..507421
FT                   /locus_tag="BT0495"
FT   CDS_pept        506927..507421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0495"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17823"
FT                   /db_xref="GOA:A1QZT1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZT1"
FT                   /protein_id="AAX17823.1"
FT                   /translation="MESQVHKKQIEKLISLSRVTKVVKGGRRFSFSAFMVVGDGEGQVG
FT                   WGFGKANDASDAIKKSLASARKNLRVIPIRKGTLPHMVIGDFKKAKVLIKPATQGTGII
FT                   AGGPVRAVMEALGVHDILSKSLGSNNSMNVVKATFKAFDLVLDARKVAEIRGKTLRTLW
FT                   G"
FT   gene            507425..507736
FT                   /locus_tag="BT0496"
FT   CDS_pept        507425..507736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0496"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17824"
FT                   /db_xref="GOA:A1QZT2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZT2"
FT                   /protein_id="AAX17824.1"
FT                   /translation="MIKRKLRLQLKKIRFKASRSRLKNKAFIKKMKNNREILIKSDIKI
FT                   EVELKRSLIGKLDSKVKTLKALGLKRIGDKKVHILNKSLQGMLNSVISMVLLSEVKND"
FT   gene            507729..508166
FT                   /locus_tag="BT0497"
FT   CDS_pept        507729..508166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0497"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17825"
FT                   /db_xref="GOA:A1QZT3"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZT3"
FT                   /protein_id="AAX17825.1"
FT                   /translation="MIKLRRPLGANKSRKIVGRGPGSGLGKTSGRGQKGQKARNNSPRI
FT                   GFEGGQTPLYRRLPIRGFSNHDYKVKYEIVGLGDIDRKFEDGDLVNYNTLLQKGLISKN
FT                   KKNIKILANGELTKKVNFEVSRISKSAEKLATKIGCSIKLV"
FT   gene            508179..509483
FT                   /locus_tag="BT0498"
FT   CDS_pept        508179..509483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0498"
FT                   /product="protein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BT0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17826"
FT                   /db_xref="GOA:A1QZT4"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZT4"
FT                   /protein_id="AAX17826.1"
FT                   /translation="MKGLFFNLFTIKDLRSKFLFTLFILFIFRVGSYLPIPGIDPVALR
FT                   SYFKSQSDFSITNYFDFFSGGAFSNFSIFMLSIGPYISASIIIQLLVYSFPSLKKMQEG
FT                   DNGRKKIKKYTKYLTIVAAVAQGYATSLYAKSIPGALNMPFYRYIFIAILTVTTGTFVL
FT                   LWLGEQINQRGIGNGVSLIIFSGIVVRLQAALFNLFQSMRDPSQNINPVFVILVLSVFI
FT                   LVVILIIYEYKAQRRITIHYARANSRNTVSSYLPIKLNPSGVLPVIFASVLITLPLQIL
FT                   SGFAGTSVLSRQILSYLRPNGLYYTLLNVVLIIGFTYFYSKIQLSPKDISNNIRKNGGT
FT                   IPGIKADEMEGYLDRIMNRTLFSGSIFLSIIAIIPFLVQNIFRFPYDVSRIMGSSSLLI
FT                   MVGVALDTLIQIDAYLKTQGLSRGPGKKYAFLQKI"
FT   gene            509493..509606
FT                   /locus_tag="BT0499"
FT   CDS_pept        509493..509606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0499"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17827"
FT                   /db_xref="GOA:A1QZT5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZT5"
FT                   /protein_id="AAX17827.1"
FT                   /translation="MKVRVSVKPICEKCKVIKRKGVLRIICDNLKHKQRQK"
FT   gene            509616..509993
FT                   /locus_tag="BT0500"
FT   CDS_pept        509616..509993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0500"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17828"
FT                   /db_xref="GOA:A1QZT6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZT6"
FT                   /protein_id="AAX17828.1"
FT                   /translation="MARIAGIDLPNNKQLQIALTSIYGIGRARALEICRKTDILPEKRA
FT                   KDLDNDEVNKLRKIIESDYVVEGKLRSELAMSIKRLMDIACYRGLRHRKGLPLRGQRTK
FT                   TNARTRKGKRKTVANKKMAAK"
FT   gene            510024..510413
FT                   /locus_tag="BT0501"
FT   CDS_pept        510024..510413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0501"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17829"
FT                   /db_xref="GOA:A1QZT7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZT7"
FT                   /protein_id="AAX17829.1"
FT                   /translation="MSAKVSTNKKKVKKNIGEGNVYIQATFNNTIVTVSDIRGNTLAWA
FT                   SAGGMGFKGAKKSTPYAAQMTAESALGKVKDFGINYVHVFVKGPGIGRESAIRTVGSTG
FT                   IIVKSISDVTPIPHNGCRPKKTRRV"
FT   gene            510426..511460
FT                   /locus_tag="BT0502"
FT   CDS_pept        510426..511460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0502"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BT0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17830"
FT                   /db_xref="GOA:A1QZT8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZT8"
FT                   /protein_id="AAX17830.1"
FT                   /translation="MMSLGKLLKDFTIPDRIEFVRGEDDSSYGKFIMYPFEKGFGVTIG
FT                   NTLRRVLLSSIEGYAISAMRIQSNQGGSLKIVSSEFDLIPGVVEDTLEVIANIKNIHLK
FT                   LDEGVNSTTISLSVNGKDTNVLKAVHLEREGVEVFNKDLVIATLSSEANLDFEFQINYG
FT                   RGYVSSEQNAKYLEEVNTIALDSIFSPIEKVTYSVEDTRVGQRSDYDKLVMEIWTTGVI
FT                   SAKDAIKKAASIVRDFLLPLVNFEDKVVHSVENSELRDSDILSINIEKLNLSVRSLNCL
FT                   TKENVKTLGELISKSAEDLSKARNFGKKSLEEIIEKLNTYGLFLGMSKAEALKILNKND
FT                   KISH"
FT   gene            511479..511853
FT                   /locus_tag="BT0503"
FT   CDS_pept        511479..511853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0503"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17831"
FT                   /db_xref="GOA:A1QZT9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZT9"
FT                   /protein_id="AAX17831.1"
FT                   /translation="MKTKVGFNRLDRKSSHRKALLRNMVISLFRHEKITSTKAKLSEVK
FT                   RFAEKLITRAKVDSVHNRREVSKFIHDKYILNKLFTRISPIFKERKGGYTRVIKLGQRY
FT                   GDAAEMAILELVDKTLEEKQ"
FT   gene            511925..513466
FT                   /locus_tag="BT0504"
FT   CDS_pept        511925..513466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0504"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17832"
FT                   /db_xref="GOA:A1QZU0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZU0"
FT                   /protein_id="AAX17832.1"
FT                   /translation="MSYITFSSILAGVLGIVLGFLIRIILGRFSLLNLDKKLKKVQEEA
FT                   IVEIENEKKRVISHAKAQMLKEKNQQDREIRERKNEVFNLERRLLQREETLDKRISALD
FT                   KQQSRIDFKLKEFEQKEKIIRDKELSLVKKLENIAGLTKEEAKKIVIEKVENESKRDAQ
FT                   IIINKSEQEAQLLADKVAKDILVSTMQRIVTEVSSEFTVTSVELPNDEMKGRIIGKEGR
FT                   NIRVLETLIGADIIIDDTPEAVVISCFDPVRKEIAKRTLERLVADGRIHPARIEEIVYS
FT                   VTNEINNIILEEGEKAVFDLNIHGFDKRLIRGLGRLYFRSSYGQNVLSHSKETAIIGEI
FT                   LAKEMKLDPIVVKRACLLHDIGKGMESISENSEGHAITGAELAQSCGESDIVVNAIAAH
FT                   HNEIKPESFEAIVVQIADAISASRPGARRESLNNYINRLKRLEEIAYGFEGVQKCYAIQ
FT                   AGREVRIIVDNLLINDEKATMLARDIAKKIEVEMRYPGKIKVTIIRETRVIEYAR"
FT   gene            513435..514247
FT                   /locus_tag="BT0505"
FT   CDS_pept        513435..514247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17833"
FT                   /db_xref="GOA:A1QZU1"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZU1"
FT                   /protein_id="AAX17833.1"
FT                   /translation="MKLELLSMQDNDVIRALIIGDVIGNGGLKKVFFNLKNLKEKYNID
FT                   LTIVNGENSSGGFGITPEIAENLFKAGVNVITTGNHVYADHSIREYLDKQEYILRPNNF
FT                   SDLLEGHGYCILNVKNEKVAVINIQGFVGMTFIVKNPFENIKKVVNMIRNKVKTIFVDF
FT                   HAESNYEKESFGYFLNGLVTGVVGTHTHIMTQDERILDKGTAYISDLGMTGSLNSVIGF
FT                   NPEISLKGLLEYVALRTETVEENVIIQGVVITSHLKTGRALKIERIQK"
FT   gene            514228..515019
FT                   /locus_tag="BT0506"
FT   CDS_pept        514228..515019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0506"
FT                   /product="putative cell adhesion protein"
FT                   /note="contact hemolysin TlyA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17834"
FT                   /db_xref="GOA:A1QZU2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZU2"
FT                   /protein_id="AAX17834.1"
FT                   /translation="MKEYRNSLLNVLCKNYPGLTREELRILILTGRVYVNSHKERNPKV
FT                   LLLRNSKINLIESESRQFVSRGGHKLFESLETFKITVKDKICIDVGASTGGFTDCLLQE
FT                   GAKLVYAVDVGFNQLSYKLRVDPRVKVFEKTNIFAIKQFDIQPNLAVIDVSFRSVISIC
FT                   ANLIDKLSDKLIVVLVKPQFELKGLNLDIKDFNGVVGKRYLSKILNKVIKKFYDNNLQI
FT                   KNILKLATKGRKGNQEFMFLVVKDNSMNLMQSLALLDDINF"
FT   gene            complement(515016..515774)
FT                   /locus_tag="BT0507"
FT   CDS_pept        complement(515016..515774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0507"
FT                   /product="germination protein GerM"
FT                   /db_xref="EnsemblGenomes-Gn:BT0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17835"
FT                   /db_xref="GOA:A1QZU3"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZU3"
FT                   /protein_id="AAX17835.1"
FT                   /translation="MIRKKRNSKRKTSSFNQIDIFLVLFAIFLTGLCLLLIIKNSLIKN
FT                   IFNEQINNNDNFEFSQSKPNKIEAKLENTKNETIKILNNEKFLIKPPEIQKIEEEFKYQ
FT                   EQKYLKNKKEVKLYFIKVTAEGHFLKQWIKRTIQYDKNILKETLKALINGPNEYELKNN
FT                   FLSLIPINTKVLNLSINDGIAHINLSKEFYENSFGVEGTINQVKQIILTCLEIQGINGI
FT                   TLKVENNPIILEDLNLDFSGILDNKKLAKY"
FT   gene            515861..517177
FT                   /locus_tag="BT0508"
FT   CDS_pept        515861..517177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0508"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17836"
FT                   /db_xref="GOA:A1QZU4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZU4"
FT                   /protein_id="AAX17836.1"
FT                   /translation="MIGSKVQDYKSVLIVGRPNVGKSTLFNKLLSSNRSITDEIYGVTR
FT                   DLIKEICTVDSYKFYLIDAGGFTLLRDELSRVVVNKVISLLDSIDLILFVLDVNEILSE
FT                   DYELIERLRKYSDKIVLVLNKIDSHHKQALTYEFQNLGFQKSFLVSATHGKGVNSLRIF
FT                   LKNSVGKLAIDDNVDVKIGLIGKPNSGKSTLINFLAGREVSIVSRVAGTTRDFVKARFQ
FT                   RNGKTFELIDTAGIRRRARVNELIEHYSVSRALRVIDMVDIVFLLVDVKEDLTAQDKKI
FT                   AHYATKRGKGIIIVFTKWDLVKSKSGYFEALKNRVKFFFPILNFSPILRISAHRREGVD
FT                   NLFKEAIKLKKQLELKISTADLNKMLSLWIKDYHLNASHKVKYITQISVNPVKFILFAN
FT                   KITNFPNSYYNYLVNNIRKIGYYNIPILIELREKTRDLK"
FT   gene            517174..518433
FT                   /locus_tag="BT0509"
FT   CDS_pept        517174..518433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17837"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZU5"
FT                   /protein_id="AAX17837.1"
FT                   /translation="MRYIFLFLIVANLNPFAFENFFYDFSVRANYAKYFNSRNTAFKIK
FT                   PQKYYISDDYYVEVSNSILGDYAYYSFFNRKNGASYIFPGSYVIKVGRYGIEQIKIFFL
FT                   NRADTFIRIKAGDVHSSADFYLINTFIYKDIKLPFKISDIATGSFLEIVKYISNFIDFE
FT                   LFRPRSLEAYDNISNIVDSLRAFLKVSPLIFEVHDGAMNELGEMVYIRTGEPQREPIGF
FT                   NCSGFGKWVADSIYKAMTGKLLKIKDLKVKHIGIRGNSFTKYYEFSRDPFFGLDWTRNI
FT                   AYKLKNVDADLDLSRVKELDVNNIGFLKYIENRGYEIDNLEFILYYLAVKEPGHMYFGS
FT                   LNTTINGFPGKVFHKHVVVLFPFIDRESIFRVSLMEINDETSIKSLRGRYPNSYIHLVR
FT                   AKVPKNISIVPIPKRINKDK"
FT   gene            518443..519129
FT                   /locus_tag="BT0511"
FT   CDS_pept        518443..519129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0511"
FT                   /product="phosphocarrier protein HPr-phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17838"
FT                   /db_xref="GOA:A1QZU6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZU6"
FT                   /protein_id="AAX17838.1"
FT                   /translation="MIKAVVFDLDGTLYPEININLIMFPEFLKNIKFFLAFKKVRKEIR
FT                   CLQKGRSIPSSRDELMSIQIKMLAKHLGFDENRCEFLLNKIYYGKSFRNKFRNLKPYFG
FT                   VHDLIYSLKSKGIKLGVMSDFPIATRVSNLLGIEDSFWDVLYSSEETGYLKPNKIAFLR
FT                   IMDELGIDSNHILYVGNSYEYDILGASGVCMRTAYLSKKKLLKDMKCDFIFSNYKDLQR
FT                   YILLNI"
FT   gene            519131..526036
FT                   /locus_tag="BT0512"
FT   CDS_pept        519131..526036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0512"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17839"
FT                   /db_xref="GOA:A1QZU7"
FT                   /db_xref="InterPro:IPR000074"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZU7"
FT                   /protein_id="AAX17839.1"
FT                   /translation="MWVKYFMIDFVTVLVNLLLVFVILFIYRQYDRRSRALDKIKKFID
FT                   IAKDNLEDFIDEKTKEINNLAVDMEAYQRSSIEIIKKIDEVQRKIKDKSNDFAEVEKKI
FT                   AYHDSMLKELDDMALKVQDNIQRLQVDGKIVDKLSKTLKNFNTQIDSIDSRLSTVFEKF
FT                   DKTNKENLETIKIESWDKFDNTIKDFSVRMDNLDRELISYQESLVMIEEKKREILDKGN
FT                   EKLENEFKEFVFKIESSIDNYNKSMEDSFGIYETKYKSIENSLDLIVEQAKTKINDKED
FT                   FILTRLNEELQIKFDEVFMYVDERSHQMRDKLEGKLVLIDNEISSLSSVFKDNTYSRLN
FT                   SLEETIRQEMRQYEEQLADILEQFRVQIESSVGDIYKEYDSKINQFDKDIRDRIESSLK
FT                   DANSRIESVQGGVRTLLDDLEKDSNKIYVEFKDKVKGDIDSFSENVFSRMNDVGSELEL
FT                   KLSNISTDIQDRIAKLDSSLYSELKEMNEKFVNDYSCLDGSINLKYETLLEALNLKSGE
FT                   LETQLKDKYKNIADKFERDIDDLTIKCDENFSKISEKSDYDYQNFEITSTKLKESISSL
FT                   NDLLVQDFETLKGDFKSKLSKMSVDINDEVFNLKSHYGEDISEFIKQMEADKLQYEHWQ
FT                   REVGLNLEDIKSHLNKTNEEFLNLIENQRTKGKELSENIFNELSEHIQKKAMDMHTNWK
FT                   DELIILNKSLLDIKISSEELLLSASSKIDSFEKDVNERLEYVTSKTEDFESSVLDKYKE
FT                   LRDMSYNNSEETLSGIKEFIDNQAEIIHDKIIMMLNGLNEDFSNKEELIKGNIEELDYR
FT                   LKDFKVGCEDVLNNLRSELDGFIESRMQKVSEIKIDNQKQIDNFLNRISEDILSKRDML
FT                   NSEIDNKLNDWQGKLSEISVNIENVLSSGKIDINSIDSEMTLKIKDLKSTFEGLESYYL
FT                   EKIDEFRNQGNVYADELLKNIMSHFDTDTKDLEESLSKKFATVLERSEEFVKEVDSLLK
FT                   DKRTDIASFQASIDITIDSLNSRFNDVNREINEKYSKVISDSRGYSETLANKLENEIGY
FT                   EIENVNRRLTDKIDILSKNMDENLENFKSSFDVSKYQVENFEIKIKDIIEKEELRLGEL
FT                   LREIERQYRVRWDEAIDYKKAIDSDILQLREQFIGVINELKNNIEDKSEFLNDLYKERF
FT                   KIIENNFEERYSTFFIESEGAISKIRDEIYKILTDNDEHLRAKISEMDLNFEIIDGRSK
FT                   EILELEEDLRKRIQEDSNNIHHQFDVIKSGLEKEIKDHFDMYMMKATAAIDEEIEKYEH
FT                   GINEKISALKSIENNFEMIEKNLKDKISEYHNKLDETLDVRYAELEGKYDEKHLLVEKK
FT                   INEKTNSVEELIANKYAELEGKYDEKHLLVEKKINDKVNSVEELIASKYAELEGKYDEK
FT                   HLLVEKKINDKANSVEELIASKYAELEGKYDEKHLLVEKKINDKANSVEELIASKYAEL
FT                   EGKYDEKHLLVEKKINEKTNSVEELIANKYAEIDSKYSNMHLDMESRFNACISDLGIEL
FT                   ARSSEKMDKEIEEQLKNLGELKLSLSNIEGDVLKLKEDSYHNVSSHLKLLEEDFFKDLK
FT                   ERSDNLKNSLENFVASSDQRIENLERHIIKNLEDKEILMKNFRVEIEQELMLNKESFYS
FT                   EFNKEFDVRKRDTESKIVVMETNVTNRIDEFIKLVDNRQNNVDSWFLKVKDDMINWQEN
FT                   AYKELEERAGITKRNLDEIKSDVSAIESGLEVVKDGVNQRAKEIFDRLQSDIKDFENRS
FT                   YLNLKNISDEVQSKVLNIEDFMDFKIKSINDKIDSHIEELATQVEIKFLSQQKDIEDKI
FT                   IEANDKLEYEFNSMASRLDEEKQNIVSKFLNDTGGFESQVQLMQDDVLKLTEKVNAYRI
FT                   DIEKTIRENYDSFSSSIREEYTVFENEVKNSLNYSEEEIQALRDSLKVQVNSIESEFKD
FT                   KYDLMIKGIDDHVSQLKLKVLNYDGELNHFIDEVKDNLIVYKADLREELDSRYAVMSAK
FT                   LENFKRLEVELERNNELMKEVYYFKNNLEELRETLASEINLIQGYKGDFEGITREIGDI
FT                   KSKSSDIIEVFNDLKVHQMDIEGIKKDLTQFLEFYTSFKERYKKFTESYDEMQIYKTKL
FT                   KEIKEAQSNILDNYDRISNKDSILKSTLESVDKNFDLINEIESKMHVLFKESSGFQQSL
FT                   GELKGIMSELLVNKDLSQEVLNNVQTLKEMLGEIESKLEHTRNIREKVAKSETRLENLN
FT                   IAAEERIKTLGILVKTESKYKDNVGLNNETVRDSVIKLMRQGWSALEISRATKLSIGEV
FT                   ELILELGIISKSDD"
FT   gene            526049..527596
FT                   /locus_tag="BT0513"
FT   CDS_pept        526049..527596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0513"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BT0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17840"
FT                   /db_xref="GOA:A1QZU8"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZU8"
FT                   /protein_id="AAX17840.1"
FT                   /translation="MKNRFEVVRTLHPLEIKVILNYKEGDEIFALRLVADLLYNEGQSN
FT                   KTIEWLVSKGILRETFRKLNVFYRLTERGVDALANGLVEERIINLVSRKTVLVANLPSE
FT                   LEIDARDAGKAFGNLSKEGVLSLGLGKEILVKDLNRSSYNIVKELLSKAQNSDLLEDDL
FT                   SQDELLVISNYSKKKGAGDVLFKVIESLDLKFEFSKFGLEVKSELGRSNLTGDEIVKLT
FT                   PEMLKNKTYENKNFRAYNIHVSSNKTFIGRANPYSEYIAKVKDKLVSLGFEEFDGPLVE
FT                   SEFFNNDALFMPQFHPARDIRDVYYIKEPSSLKSLPEPYFSNVKAVHEDGYTTGSRGWR
FT                   YDFSESISKRLVLRSQGTVLSAKQLIDAKNPGKYFGIVRCFRYDQVDATHGADFYQTEG
FT                   IVIGDVNIKTLLGLLEIFAKELAGATEVKYVPAYFPFTEPSIEVHVKHPVLGWFELGGS
FT                   GIFRPEVTKPFGIDVPVIAWGIGIDRMALMHLGLSDLRELFTHNIGDVVLRRGKVNA"
FT   gene            527589..529283
FT                   /locus_tag="BT0514"
FT   CDS_pept        527589..529283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0514"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BT0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17841"
FT                   /db_xref="GOA:A1QZU9"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZU9"
FT                   /protein_id="AAX17841.1"
FT                   /translation="MPKVEIYKSILLEKIGKILTKSELVSVLEMAKAEICEFDTVNDKI
FT                   KIEFNDTNRPDLWSCAGLARQIKTYLFGHLPLFKFFSMADNLQEFYGEILVSPEVFSIR
FT                   PFIFGFLAKGVICNERMLETLIQLQEKLCHNYGQKRKRVAMGMYSSDLIEFPLSYTACN
FT                   SDYRFIPLGMDREMSIEEINRVHSKGIEYSTILASFNKYPLLLDDKDKVLSYPPVINSH
FT                   DIGALKVGDTDLFIEVTGTNLEATLLSLSVTACDLHDMGFEILPVKTIFPNETLFGKEI
FT                   ICPYYFQNMLEVNVDNVNKMLGSNFTANNMCLDLKKLGISAYFKELDKFYVIPPVYRND
FT                   FLHEVDVIEEIMIGMGLDSFKPELPKDFTLGRLSQIEEFSRKIKNLMIGMGFQEMIYNY
FT                   LGSRTDFIEKMNIEGDDFLSVANPMTEGYEYIRGSIVSDLLKSESISSNFPYPHKIFEI
FT                   GKVALKDLNSVDGTITYDNLAFLMADKEFSFNEINSLVSSLFYYLNIEFKLRESSKSLY
FT                   IDGRGVDILINDTVLGGFGEVSPYILRNFGIMVPCCVLEINLNKLLN"
FT   gene            529382..530359
FT                   /locus_tag="BT0515"
FT   CDS_pept        529382..530359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0515"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17842"
FT                   /db_xref="GOA:A1QZV0"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV0"
FT                   /protein_id="AAX17842.1"
FT                   /translation="MLKFEVLDIKKSNKKVLRTEMNSIEDVIIVGSGPAGLTAGIYTVM
FT                   SGYKTVILEGPEPGGQLTTTTEVYNYPGFKNGVNGRELMLNMKDQVINLGAITYLETVT
FT                   SIEKRDNIFYLFTDNYIYKSKAVIIAAGSVPKKLNTLKNSDLFWNRGISVCAICDGHLF
FT                   KGKTVAVIGGGNTAISEAIYLSKLSEKVYVIVRKDYLKAIAMLRQNVEKLPNVEILYNC
FT                   EAIEVNGDNIVSMVQIIDNKNNSTFELSVNGIFVAIGYKPNTEFVKGFLELDEDGYIST
FT                   QDLVKTSVEGVFSCGDVSNKLYAQAITAAAEGFLASVELRNFLG"
FT   gene            complement(530388..531122)
FT                   /locus_tag="BT0516"
FT   CDS_pept        complement(530388..531122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0516"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17843"
FT                   /db_xref="GOA:A1QZV1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV1"
FT                   /protein_id="AAX17843.1"
FT                   /translation="MYITHANSIIESIKNNKGLELYISKISPKSINIEKIAREYNTQII
FT                   KVNDLAKIIGNNNHRGFALKLKISKSNNTNKQDKNLEEFLEKFQYKNNVFILILDGIED
FT                   PQNFGAILRTSEQFNIDLVITSQRRSAKDNATTLRTSSGASQYVNKLIVPNINNVIKDL
FT                   KKNGFWIYASDIKGKAINTIKINDTKIALIMGNEGKGIHKLIKENSDFLVKIPTTGKID
FT                   SLNVSVSTGILIFEIKRQLNLL"
FT   gene            complement(531124..532221)
FT                   /locus_tag="BT0517"
FT   CDS_pept        complement(531124..532221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0517"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:BT0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17844"
FT                   /db_xref="GOA:A1QZV2"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV2"
FT                   /protein_id="AAX17844.1"
FT                   /translation="MKRDYYEILGLSKGASKDEIKKAYRKIAIKYHPDKNKDNKEAESI
FT                   FKEATEAYEVLGDDNKRAQYDRFGHTAFEGGGGFSGFSNGFSGFSDIFEDFGDIFDSFF
FT                   TGRRGQDKNRQNEKGQDITYQIEISLEDAYLGYKNNINIARNMLCESCLGKKSEKGTSP
FT                   SICNMCNGSGRVMQGGGFFRVTTTCPKCHGNGKIISNPCKSCKGAGSLKYKETIELKIP
FT                   AGIDDSQQIKMRGKGSVNPDNQQYGDLYIRVSIKPHRIFKRNGKDLYATLPISFTQAAL
FT                   GKEIKIQTIAEKKIEIKIPKGTENDEQIIIKNEGMPILHTEKFGNLILIIKIKTPKNLS
FT                   YNAIRLLEDLSKEINDIDKVTLNKI"
FT   gene            complement(532221..534173)
FT                   /locus_tag="BT0518"
FT   CDS_pept        complement(532221..534173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0518"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:BT0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17845"
FT                   /db_xref="GOA:A1QZV3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV3"
FT                   /protein_id="AAX17845.1"
FT                   /translation="MHKAKINIRNQKYKRRFYMGKIIGIDLGTTNSCVAIMEHGKPVVI
FT                   QNSEGGRTTPSIVAYTNKGERLVGQVAKNQMVTNPENTIYSIKRFMGRRFEEVASEIKM
FT                   VPYKVEKGQNGDARVNISNIKKQMSPPEISAATLTKMKETAEAYLGETVTEAVITVPAY
FT                   FNDAQRQATKDAGKIAGLDVKRIVNEPTAAALAYGIEKKNEEIVAVYDLGGGTFDISIL
FT                   ELGDGVFEVKSTNGDTHLGGDNFDDEIIKHLITEFKKDSAIDLSNDKMALQRLKEAAEK
FT                   AKIELSGAQEASINLPFITADANGPKHLQYTLTRAKFEQMVDHLVQKTKEPCLKAIKDA
FT                   GLKASDINEVILVGGSTRIPAIQKIVKEIFGQEPNKGVNPDEAVAIGAAIQGGILTGET
FT                   KDMVLLDVTPLSLGIETLGGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGER
FT                   EMASQNRVLGNFILDGIPAAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESS
FT                   SGLSEDEIERMVKDAEAHAEEDKKLKESIEAKNIANSLIYQTEKSLKEYGEKITSEDKE
FT                   AIENKIKELKDALEGSDIALIKSKTEELQQASYKIAEMMYKDAQSSSSNQDNAQNNASS
FT                   ESKEADYEVVDEDKK"
FT   gene            complement(534154..534702)
FT                   /locus_tag="BT0519"
FT   CDS_pept        complement(534154..534702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0519"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17846"
FT                   /db_xref="GOA:A1QZV4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV4"
FT                   /protein_id="AAX17846.1"
FT                   /translation="MKEKEQCEEPEKIKEQKNDILPNEDSPNMESKVTELENEISNLKD
FT                   LYLRKQAEFENFRKRLEKDKENFIKFANENIMKDIINFLDNLERAIDSSKQSRDFDTLL
FT                   SGISMIESEVLSSFDKKYNLKKFGKPGETFDPSQHEAISIEEKEGVKIPEIVEVYQKGY
FT                   CYNNRVLRTAKVKVAQSKN"
FT   gene            535253..536821
FT                   /locus_tag="BT0522"
FT   CDS_pept        535253..536821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0522"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17847"
FT                   /db_xref="GOA:A1QZV5"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV5"
FT                   /protein_id="AAX17847.1"
FT                   /translation="MLIIYFVKICIAQTKCRVFKFKHILGVFKKNYEYALQNKVDILVF
FT                   PFIFVGGIEYENLFHRAEYLKKILDGLDFIKDQVDDRLCVVFGHYSFYEGKLLDCVSVV
FT                   NDHQFVLTTREVNKPFLFNYKGQSIAVLNLDDDLLFQGLEDKFNGSFSKADYLLVPSKS
FT                   YFTGEKNNLRLKFFKEVAMKNNLEVVYANLCGVYGSTVFDGLSFFINEYGKIKQAKKFE
FT                   DDILFNEGFHDLELDCESKIFDKLIEALISSLREYVDLSGFDKVHLGVSGGIDSAVVAY
FT                   IACAALGAHRVVGISMPSRFSSKGSVFDAKELARGLGFKLIDMPIEGMFQFVLEFFNGY
FT                   FNTKGVTEENLQARLRGLFLMSYSNANKSLLLNTGNKSEIAVGYCTLYGDSCGGIALIG
FT                   DLFKRDVYNLAKYINLREGRSVISVNILSKEPSAELRPDQKDSDSLPKYEILDEILSRY
FT                   LLENEPLELLYESFGKEVVAKVLDLYSSSEYKRRQGSMIVKVSRKAFGDDILLPISKVA
FT                   LTEDE"
FT   gene            536814..538397
FT                   /locus_tag="BT0522A"
FT   CDS_pept        536814..538397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0522A"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BT0522A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17848"
FT                   /db_xref="GOA:A1QZV6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV6"
FT                   /protein_id="AAX17848.1"
FT                   /translation="MNSNNVISILNEFSLKLEDIFLLINTYSYELYKETPRYFYDDITN
FT                   CLELTLEIVNKFQGEFEGSQDLSLGKFLIRSMKCDLVSYLYLSLELIDNSMHYSGIRDA
FT                   GIAFFKAIAYKISSIISYIEIELENVFLSSSLASRQALNKDGHKILIFSCDSIYSKRLT
FT                   DYLILGDYIVVSADAVDLFNQLLCNDFYDLIILDLSSDEDIQLILNLLKNIKNNGLYEM
FT                   IPVIVISQISEKDIIQIFIEERVDDYFLKSLDFLVLGIRISSFIEKKKIIEQGQKYLDF
FT                   VLRGRKYFESELIEAGNYIENLLPKKMQNEFFNSNWIFVPSKRIGGDFFNYYFVNDDNL
FT                   IIYLIDISGHGIGSALLSLSVSSVINSYIMNNNDISPSEVLRYVNRYFVKFKSDMFITL
FT                   WYGVLNVKTRHLRFASAGAPPAVVLNAKDNVYLQTRGAILGIKEMYSCEENECILSKFS
FT                   HLLLFSDGVYEVENEQDVIMAIDDFYKILKDNTYDLDDFILVRLYKKMLNLSRYNAFRD
FT                   DFSILEFILN"
FT   gene            complement(538523..538957)
FT                   /locus_tag="BT0525"
FT   CDS_pept        complement(538523..538957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17849"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV7"
FT                   /protein_id="AAX17849.1"
FT                   /translation="MKIPKNYIPGTNPYKSLPKKPIIESKKLSKKQEQINAEIMNSQER
FT                   ILKLYMRRLQKKDQIILQNFIMEGHKVGSKIFNNLSRILKEIITIMNIESLKVLLRNTK
FT                   NPIKKLYIKFSTWTLNKLLKSINSSNITQDKQTSKKNVKK"
FT   gene            539075..540883
FT                   /locus_tag="BT0526"
FT   CDS_pept        539075..540883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17850"
FT                   /db_xref="GOA:A1QZV8"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV8"
FT                   /protein_id="AAX17850.1"
FT                   /translation="MNKYCGLSFFYLLIGILFLFLIVFIQFRDLSLNVFLLKDLKLLVN
FT                   NKVEDSQYVLDSLILSIRGIKINLSKTKPIIIPANGLHLYPISYKVQDNAIHVYFENNI
FT                   FLLFSFDSNDNFNVSSNLSKKLLISYEIESDYKVLFDENIIIKGTDGHFEVALGKHSQM
FT                   NEREISVSPQEVFQIGNLVEESQTSDELISREPSRDIPLDINSPVVYSLIKKVDKSFFD
FT                   SALLEFRNKAYDAWSHKSNFSVEKGGWRRGNVYSFDEDIFIYLLAESLRRPNYEATFLN
FT                   LKSLIDLNEDHLTYLSASYYVNAERLGKFFRYLSVNKTFINSLESDKLLRYLKEDAYLL
FT                   EKIFLSENISILNGALDILRKPEVILASGFSLTQAYNVLSNYIIFLQFDNDSFVLGRLR
FT                   EELTKFVSTLFSVTSHGEAYVSDNKDDLSWDFEYTLKIAGLLKRLAFQLGDDLILEFAF
FT                   NAIYYSLLKPDIEKIPYENYYADIVDNDYIPKFSLFPNLGIGHWIYGASKIVNFNFSNA
FT                   FYSIDFNRNLNSPGYFFFKGISNPTLVKFRNISWFTDPRFYIYSDGWRYYSDNKILVLK
FT                   ITPKKPDDMKILLRFDDIKVLKDIDE"
FT   gene            540873..541661
FT                   /locus_tag="BT0527"
FT   CDS_pept        540873..541661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0527"
FT                   /product="Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:BT0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17851"
FT                   /db_xref="GOA:A1QZV9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZV9"
FT                   /protein_id="AAX17851.1"
FT                   /translation="MMSKLVASVQLIIDIGNTSISFALYGLDKMQIFCKLSTKRDLSFK
FT                   ELYEFLKFKFDCKVDQVFVSSVVPVIDKVLINVIVALYKVNPLFIRFDLNYDLSFDLYN
FT                   TNRFVLGSDVFANLVGAIEYYNINDALVVDLGTACTIFAISRKEGILGGLINGGPFTSL
FT                   NALIENAYLLTDFDLAVPKKLLGLSTVDSVNSGVIYQYKYLIEGVYHDLMRNYDRKFKL
FT                   IITGGNSYLVLPLISLDFVSNLYLTLEGIRILGNAFKVVY"
FT   gene            complement(541950..542756)
FT                   /locus_tag="BT0530"
FT   CDS_pept        complement(541950..542756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17852"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW0"
FT                   /protein_id="AAX17852.1"
FT                   /translation="MQKNKDTILDILEWIYNKYNKREFVHPDPLEFLYKYTEKEDIELA
FT                   GLISSSLALGRVERILTAIESVLKPLGNKPSKTLKTLKKEELDIIYKDFTYRFFKTEDI
FT                   VRLLMSFKKVKEKYLTIENLLHNIYKKNKNFISSLDDLITQMENINGHQFGIILPKPSR
FT                   GSACKRLFLFLRWMIRKDDVDLGIWNKFSPSNLIVPMDTHMTNISSKLFNLKNKKNVSI
FT                   QRAIEVTKHFAKENKDDPVKYDFSLTRFGINREFNKEELFTNIFKL"
FT   gene            complement(542743..543354)
FT                   /locus_tag="BT0531"
FT   CDS_pept        complement(542743..543354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0531"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BT0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17853"
FT                   /db_xref="GOA:A1QZW1"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW1"
FT                   /protein_id="AAX17853.1"
FT                   /translation="MQKKFILLTICLTLLTVKSYCIEEIIEINTEIQKEKYIPFLLSKG
FT                   ISQVEDLVKYTLKMNPYLEAEYVKTIAQTYIDEAIIEGINYDIAYAQMLLETGILKFNG
FT                   IVSKEQHNFSGIGATDNFTKGSSFSNIKEGIRAHIQHLKAYASRQNIKSNMVDPRFYLV
FT                   QRGSAPTIYDLTGKWAKDKFYDKKLKKILLGLLESDNAKK"
FT   gene            complement(543357..544643)
FT                   /locus_tag="BT0532"
FT   CDS_pept        complement(543357..544643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17854"
FT                   /db_xref="GOA:A1QZW2"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW2"
FT                   /protein_id="AAX17854.1"
FT                   /translation="MHEQSYETIFLISFSIFLIINFFNFKREFSYEDYFIIFPGIFFII
FT                   TLYLIEVRPLMFYTGSIFLFFLITTTMKTIKTIILRRQTKKKDNKLRRIIFTIPFKIMI
FT                   VLPSIMVVLIATIFSYLGFFTDYQKDVNSTYKIGFTKVKDHKNNLNLSVWYPISLTLGF
FT                   KSQNPFFYYDFNPFFINEMNYLPKYENVYKDAPISDNQKLYDSILVILPFYSHDSMFKS
FT                   FVNRLVKKGNIVYLYAPQYRHINTHNFIKNKNAGLLAHISNTTIKYLIEPIKIFSDRKD
FT                   KISEVTEIQNILELIKSTQKLKFLNLRTDLNQLTLITMGNQANIANEIISKNKQIKKYI
FT                   NIGGKPQSSKIKALQLLIKQDENEWQKTDIDPSSIKVINMNHIGEISDFIFSRSYLESF
FT                   NFFKDKKLMLPRFDFITNEINQFIEDRGS"
FT   gene            545035..545793
FT                   /locus_tag="BT0533"
FT   CDS_pept        545035..545793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0533"
FT                   /product="metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17855"
FT                   /db_xref="GOA:A1QZW3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW3"
FT                   /protein_id="AAX17855.1"
FT                   /translation="MLGIFLGTGSSSGVPMLSCDCRVCSLNFGKNKRLRSSFLINLYGM
FT                   NLLIDTGPDIREQLLRENIVKLDLVLYTHEHYDHIMGLDDIKFYTRGAPLSIYARESTM
FT                   QHIRNAFPHNFSSKVSISGKANIIPNLAVDLQQIFFRGIKIMPIPLLHGDIISLGYRIN
FT                   NLAYLTDVKFIPEISYNYLKGLDVLVIDALRLKPHPGHLNFDDAIVEVKKIDPKIAYFT
FT                   HISHDVMHEEFDYLKRDNIYLAYDGLQIHM"
FT   gene            545813..546571
FT                   /locus_tag="BT0534"
FT   CDS_pept        545813..546571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0534"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:BT0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17856"
FT                   /db_xref="GOA:A1QZW4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW4"
FT                   /protein_id="AAX17856.1"
FT                   /translation="MNLISWNVNGIRAIFGKGFLEFIEKYNPDVLCLQETKAFKEQLPK
FT                   ELINIEGYYSYFSKSIIKGYSGVGLYSKVKPIKLENMNMEIFDREGRCLIAHYRDFILI
FT                   NAYFPNSQSLRKRLPYKLEFLMSLESIANMFVTSGKNIVICGDFNIAHTEIDLANPKTS
FT                   RESAGFYIEETTWMDNFLNGGYVDTFRMFNMDPGNYTWWDYKTRARERNIGWRIDYFIV
FT                   NEFFKSKVKDALILREVMGSDHCPVFLELK"
FT   gene            546598..547344
FT                   /locus_tag="BT0535"
FT   CDS_pept        546598..547344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17857"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW5"
FT                   /protein_id="AAX17857.1"
FT                   /translation="MGRYFITILIFFVHGFSFGINLESIDFYRSLEKKDLLFVIHLLDR
FT                   ERYLTQKNELFTYIDLAKQVLSEMGFEVLSGGNELDGIQHINTLQPPENYNSSKFVLKA
FT                   SKALDIFVYFDDNDGFLKTLDGRNVGIQDGKFMILEPVSFKSYDSLSNEHTTIEIYEMS
FT                   IVNPDFSKFVLDKLKPFVYVGELNKRVYLDDISKLSKGELLFLFYELFPLARLKGVNDW
FT                   YDFGFSSILKEIKKIYNVKINSRKIK"
FT   gene            547341..550163
FT                   /locus_tag="BT0536"
FT   CDS_pept        547341..550163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0536"
FT                   /product="zinc protease"
FT                   /db_xref="EnsemblGenomes-Gn:BT0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17858"
FT                   /db_xref="GOA:A1QZW6"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW6"
FT                   /protein_id="AAX17858.1"
FT                   /translation="MKYEHIDNISILKFIFLILVFLFLSCSSSKLKVDKNLVSGQLKNG
FT                   LKYYIYGNQLPSKAVHMGILFNVGSLNEEENERGLAHYLEHMAFKGTTDYPGSEGMLEV
FT                   LKKFGMKFGADINAYTSFDKTYYHLDLPDGGNESEIDEALNVLRNWAFQVKFDEVEIDK
FT                   ERNVILEEKKRRENYAGRVAEKIFGVIFNNSKYAVRFPIGLEERILSFKSEDFKKFYKK
FT                   WYRPDLTSIIIVGDIAPEKIEKKVRERFASLEKPVSEPERVKISLDTIIDKTFVSIEDI
FT                   ETPFPSMNFVVKKKIENNFNTIDDVKRLVEKTLLDELFVNRFYELKIAGTNYFMSFDKF
FT                   DSQFKSDNNYILINEISFKINPEHFKEAIEGFFYEIERIKRFGFTKGEIDKIKSKLISS
FT                   AKLNKDNINKRYSSSIAHTLVDVASQGYLMFDMDEYFDIFIDHLSKISLKTISDFARNE
FT                   ASIDDMAIIYSYSNKSHPNLTFEEMKELRNFALEREIKPYDDVSIQGEFFKKSLERKDI
FT                   IDEQELLDGISSFILENGVEVYFKHNENKQNVVNFSASSWGGLLSENAELIPVLSLAPR
FT                   VVSSSGYGDYSQLQIEKYLSDKIVSLSPTVGDQMTSINGSADIKDLETLFRLIYFTFNE
FT                   PKIDDVVLQSIIDDIQARIKSRENSSKHLFYSAVERFYNNDDYRLRDIKESDLKNVSKD
FT                   VLLDFYKKRFTYANNFKFVFVGDVDLETIKNLSSKYLGNLNSKKLNEFRDLDYSYKKST
FT                   DRIVIKKGEDSSSLVYILYPFKFNYTPENILNYEALASLLTENLIKTVRREMSSVYSIG
FT                   VSFEYLLRKHSNSDGFMTVYFTVEPKVLDSVLQVVNEYILEKQKSDFVDKDFDYIKKNI
FT                   IKNNSIRSESNGYWLSKILGSILWYGALKDTFSDKFIENNLSKDIINMLFKKIDFKQGA
FT                   EIILLPEKDN"
FT   gene            complement(550186..551631)
FT                   /locus_tag="BT0536A"
FT   CDS_pept        complement(550186..551631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0536A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0536A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17859"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW7"
FT                   /protein_id="AAX17859.1"
FT                   /translation="MYIIMKNILAVLILLTSFYIIYANKKEIKFSISHNNQKKIYYDED
FT                   KINHIVLNLQINENASIEINTQDKNYSYNIPKIINQDKILTIEIKMNNIKSINLNNIII
FT                   KNSKNKTARSNPQKFKILINQNEYFIKFNLNNNMFPIIGFKAKEIILSPMITNLCSEKE
FT                   SQKIVLSNFVKYTSLNNKNDEIKSTKNNNMIQISEIGYIDMNAYYDINKPINSDLKFIF
FT                   NYKKENYRRDSFELFKLIAEPDIYVLKFKNLNDQSLMLKRIAFFIEKKGFRGMLLSNNE
FT                   LKNKVGWKGHNYRLKDIITFFNVAQKSNIKLNKEEIILKNLIIINKLAHIENNTIKIKD
FT                   KSRNIAFATYAEDETMSKTAQMTIFMHEILHMYFFTDNNFNKAIFNFWNKNVSSKDKKA
FT                   WIKFLDNKGYDVKSQYLIINEFFTYTTQISKKDIAKYLTNSKYFSKFGLKRYEKWAITL
FT                   EELLWKSKGLIAGELLILFEGKI"
FT   gene            complement(551699..551771)
FT                   /locus_tag="BTT0014"
FT   tRNA            complement(551699..551771)
FT                   /locus_tag="BTT0014"
FT                   /product="tRNA-Glu"
FT   gene            complement(551779..551851)
FT                   /locus_tag="BTT0015"
FT   tRNA            complement(551779..551851)
FT                   /locus_tag="BTT0015"
FT                   /product="tRNA-Lys"
FT   gene            complement(551948..552021)
FT                   /locus_tag="BTT0016"
FT   tRNA            complement(551948..552021)
FT                   /locus_tag="BTT0016"
FT                   /product="tRNA-Lys"
FT   gene            complement(552072..552725)
FT                   /locus_tag="BT0537"
FT   CDS_pept        complement(552072..552725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0537"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17860"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW8"
FT                   /protein_id="AAX17860.1"
FT                   /translation="MKWRKKMVNKNFCSKIILILLSCLSLLNAQGKEDSLLLYRQGKFQ
FT                   EAILNTQNEIKYNPNNLDARVILIWSLIATGEYKRAELESIKGLEINKHDVRIIQALGE
FT                   AYFFQGQYKNALKHFQKYIGLEPNGARIAKVYILTADSFYKLERYNEADFAYENALRFL
FT                   PNNQNILLKLAKARFNAKNTILAKGILTKLLTLNPNHLEAKNLLKKIEKNNHNP"
FT   gene            complement(552697..553056)
FT                   /locus_tag="BT0538"
FT   CDS_pept        complement(552697..553056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0538"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17861"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZW9"
FT                   /protein_id="AAX17861.1"
FT                   /translation="MSIDTLEFEENNTQNVIKGNFEFEGYIESNKPIIIEGVLKGIINS
FT                   TSSIYLREKANVEAEIKCNNFLNHGTMKGNVKALETIKIYKTGNLIGNIKTKELFIDSG
FT                   ALFNGNCEMEEKNGK"
FT   gene            complement(553135..553830)
FT                   /locus_tag="BT0539"
FT   CDS_pept        complement(553135..553830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0539"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17862"
FT                   /db_xref="GOA:A1QZX0"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX0"
FT                   /protein_id="AAX17862.1"
FT                   /translation="MFELTHEKQEIRIKNKFLAQVFGLMAIGLLISAIFAYTTSENPAM
FT                   RAIIFTNPMSYIAMILVQFGLVYAISGAIEKISSGTATALFLGYSALTGVTLSSVFMIY
FT                   TQSSIFYTFGITSLTFLAMSFYGYTTSTDLTKMGSYFIMGLWGIIIASIFNIFFRSSGL
FT                   NFLISILGVILFTGLTAYDVQNISKMNRMLEDGTEIKSRMAVVASLKLYLDFINLFLYL
FT                   LRFLGERKD"
FT   gene            complement(553843..555918)
FT                   /locus_tag="BT0540"
FT   CDS_pept        complement(553843..555918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0540"
FT                   /product="protein translation elongation factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:BT0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17863"
FT                   /db_xref="GOA:A1QZX1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX1"
FT                   /protein_id="AAX17863.1"
FT                   /translation="MDYKKLRNIGISAHIDSGKTTLTERILFYCNKIHAIHEVKGKDGV
FT                   GATMDSMELERERGITIASAATHVEWKNHPINIIDTPGHVDFTIEVERSLRVLDGAILV
FT                   LDSVAGVQSQSITVDRQLKRYNVPRLAFVNKCDKTGANPNNVKDQLKDKLGLNSVLMQI
FT                   PIGLEDKHMGVVDLVLMKAYYFEGKDGIEIIEKEIPAELINEAEEKRKIMLDALSDFND
FT                   ELMELHMEGEDIAVETIYDAIRTGTLALKFCPVFMGSAYKNKGVQLLLDAVNRFLPSPH
FT                   DIKNVALDLNENEKEIELKTDETLPTVALAFKLEDGQYGQLTYVRIYQGILKKGQELIN
FT                   SRTSKKFKVGRLIRMHANNTEDIEFGSSGDIVALFGIECASGDTFCDPSINYSMTSMYI
FT                   PEPVISLSIKPKDKKSADNMAKALARFTKEDPTFKTYVDAESKETIIQGMGELHLEVYI
FT                   ERMRREFKAEVETGMPQVAYRETITDKAEFNYTHKKQSGGAGQFGRVAGFMEPLESEGQ
FT                   TYEFVNLIKGGVIPTEYIPSCDKGFQKAMEKGTLIGFPIVGIKVTINDGQYHVVDSSDI
FT                   AFQLAAIGAFREAYNKAKPTILEPIMRVTLEGPTEFQGNMFGLLNQRRGIILGSVEEGN
FT                   FSKVEAEVPLSEMFGFSTVLRSSTQGKAEFSMEFLRYGKVPSTTFNELCKKFNEQK"
FT   gene            556316..556558
FT                   /locus_tag="BT0541"
FT   CDS_pept        556316..556558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17864"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX2"
FT                   /protein_id="AAX17864.1"
FT                   /translation="MEDISLNTLTISHELSKICQVDYDSALSELSVFFKDGRAYKYFKI
FT                   EPRHFNIISKLVQEKRSVGKYLTEHIFNKYDQEKL"
FT   gene            556737..557816
FT                   /locus_tag="BT0541A"
FT   CDS_pept        556737..557816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0541A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0541A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17865"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX3"
FT                   /protein_id="AAX17865.1"
FT                   /translation="MKKFLIIIILFLSFSTSYAKFVYFSAGFSTQISLESFSLFNRKTG
FT                   TVLDKLISFELFTILTNFQNNFLNRLSEFENSAAVLYSSFQNNLNLLIRLFKNRKNSDS
FT                   QLDNVDDSDLSDLDSLVNSTHDLKKFLRELSKLNNKVTLQKLGETGSSIRKLLVDLEET
FT                   AKRAIELKEVIFSQLNEFGISNQDDFLRLCEEISTPGTVLNDALRQKLSPLFSTGFQGY
FT                   FQIGLPIATSNFYYGFELGFGVNLGRMMFPNLNLLKASYPVKLGSGIVPRLFIKYDIYY
FT                   LAATLFSGFGDRSLVVDPVYTGNLIGNGRVTNPFNVIETGFRLRLAFLSVESSLLFSIN
FT                   DFKYRDLRAGLGFEIPVVI"
FT   gene            557868..558416
FT                   /locus_tag="BT0542"
FT   CDS_pept        557868..558416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0542"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17866"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX4"
FT                   /protein_id="AAX17866.1"
FT                   /translation="MGFALMYKGLFFFLFYFVLSCKTLAKDYQTISDEYYKLAKLNEEL
FT                   GNNQASVELYEQAIKFNSNVNDASTYNFILAYINLKKYDEAGLKLESLLENDQDNILLI
FT                   NLKAYLYFRKENLEEALKLYLKTLEIAPANQEALFNVFYIYHLKKDMETAKKYILKYKE
FT                   LKYSVPSNASEIVSSVLED"
FT   gene            558450..559142
FT                   /locus_tag="BT0543"
FT   CDS_pept        558450..559142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17867"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX5"
FT                   /protein_id="AAX17867.1"
FT                   /translation="MFFNDLNVQIHLNILGDLSVMQIKILFLSLLIFITSNAFSDVDFE
FT                   LNLGVGLDFPVSTISNFYNTALYIGEELESNMSDLAREKIVTDFADMVNIAKTGLTYGG
FT                   YAQMGAKFDDFFSLGFELGFSFNVLRYVNRKGRLSDIFSFIAAIESRVYTRLDFFIGSV
FT                   ALFTGPRVNMATAFRDSIMDEYDIFGWDLGARSTFAFLVLEGYYCWNIQNNKFSDFKLG
FT                   IGFEFGVI"
FT   gene            559320..560540
FT                   /locus_tag="BT0544"
FT   CDS_pept        559320..560540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0544"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17868"
FT                   /db_xref="GOA:A1QZX6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX6"
FT                   /protein_id="AAX17868.1"
FT                   /translation="MGLLIKKSIGIIACPGGRVFADKIMEELKKIFLDSESEVIEKISQ
FT                   TSSCFKEDVLKLEEILSPFLEGLEFSNLRFDESVEIPVNFVKFANGEFKAEILKTIRNK
FT                   DIFIVQDVSNTYPVNVNNNEKVVMTINDHLMNLMTTIDACMQAKANSVSVIIPSYPYSR
FT                   QDKKHSREGLTASLFGRFLEELRVKHILTLDIHSKAIENVFRKTYFENLNASYEIFDAL
FT                   AELIDIRDSSLVVVSPDTGAVNRNKFFASNLKRPLALLYKERDYSKVTHNVNDSNISVT
FT                   KLLGDVEGKNVFMSDDILATGGTLIKAVKLLKSMGAKKIICAISLPFFNGDAIRYFDKA
FT                   YEEGYFYKIIGTNAVYHDDRLISKPWYYEANVAHLFAGAIFAIHNRVSLQKILDRSHDI
FT                   QNLISKS"
FT   gene            560545..561909
FT                   /locus_tag="BT0545"
FT   CDS_pept        560545..561909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0545"
FT                   /product="xylulose kinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BT0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17869"
FT                   /db_xref="GOA:A1QZX7"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX7"
FT                   /protein_id="AAX17869.1"
FT                   /translation="MDVLSIDIGTSTLKSALINSHHGVLESFDVNYFDHFNVDFENFDY
FT                   KIWLFAFKRIISNFKYKKIDCISVSGISPCLIALDSNLVPLEVLHWNSSKVVSNFRGKS
FT                   SFLPFVLSTVERGVYDKVRYFVSCFEYFIYLLTDNLITSYPSLSYIPFIWNDIEIRKHN
FT                   LDTNKFPPFLRMGEVAGRVTNSASIEFGIDSGIEVINAGMDYLSVLIGSGAFFSGIVSN
FT                   RTGTSEGFNFISDAYLSDFSLVYPYFLDNLFVIGRIVPSGYLLQLFKDRLFKKKKSFEE
FT                   FFEEIPRVYDSGNVYFYLSKRELFSDHILIDSQIRDNLNKGIFGKVDNPLQIGIAILEA
FT                   AYFSFYNKILQLKSFKRDVLDIFVSGSNSDNLFLNELKSNIIGKDLKIFEFKHAEIIGN
FT                   AILAFCCLGEFDSLDKAFKKLAKFKQVISFSASMHDVYLEKYHKYVSNFDLFVNS"
FT   gene            complement(561892..562596)
FT                   /locus_tag="BT0546"
FT   CDS_pept        complement(561892..562596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17870"
FT                   /db_xref="GOA:A1QZX8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX8"
FT                   /protein_id="AAX17870.1"
FT                   /translation="MRDFNENNNKGFLVALTSIVTVCTIIFLGIIIFFPNKNLASEIAG
FT                   KNIILQETKDENVIESENNEDTLAITDKPNEIIIDLTQDIKQDKSFNSSINQNNKKIIN
FT                   KKEPQIINQHQTTNTHTKEEKLQKTQTIAKTKQENKKKQKHNNFENKYDPRKEYYIQFA
FT                   SLADPISADNNIQELMKYKINAKIYSATINDKDTYRVRSGPYKTISEAKLDLNKISGSS
FT                   EFKDAYILTINK"
FT   gene            complement(562597..563193)
FT                   /locus_tag="BT0547"
FT   CDS_pept        complement(562597..563193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0547"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:BT0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17871"
FT                   /db_xref="GOA:A1QZX9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZX9"
FT                   /protein_id="AAX17871.1"
FT                   /translation="MGRNSSIIGITGRISTGKDTVSKIISSEYGFHEINVDKIGHTALQ
FT                   AKQDTVVKIFGKQILNNKNEIERIKLRNIVFNDRKKLEKLETITHPLIYKEVEQVILKK
FT                   KFDKIIINAALLFKLNLAKFCGHIFITKANDEIIKNRLKSSRNIDENLIINILKCQKDI
FT                   FLNKNILNSKIINIINNKSYEYLKNEIRKKMKEVT"
FT   gene            complement(563172..565931)
FT                   /locus_tag="BT0548"
FT   CDS_pept        complement(563172..565931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0548"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BT0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17872"
FT                   /db_xref="GOA:A1QZY0"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZY0"
FT                   /protein_id="AAX17872.1"
FT                   /translation="MKEIYLIDALNIIFRNYHVMKNNPLTNKKGENVNAFIGFFKTLFF
FT                   IIKEKNPENLIVTFDSETQTFRQQKYPSYKATRDAPPDNLIPQIYWIKESLIKANIPMF
FT                   EIQGYEADDLIASFAKKAEINNYLTYIISPDKDLLQLMSAKTKILKIENSSFVEMDNDY
FT                   VMKKFGVNKSQIKDYLSIVGDRSDNIPGIKGIGEKGAAKLLNEFQTLNGIYDNLDSINN
FT                   KYREILLKERENAFLSYELISLVEDLELPALEKFKLENLKEDILLLFEEYSATTLIKSY
FT                   KTILKKRYATNQTQKSLFETNINQTDTEILQTTTSHSNALKTIQEENIKYETILKKEQL
FT                   DLLIEKLKQANYVAIDTETTSLNVHEAQIIGISVSFKEFESYYIPIETKEKKTIEKAYI
FT                   IQKFNEFFKAQPKLIGQNYKFDYKILKKHEFNVIPPYFDTMIAAYVIDPNTKVSLDFLA
FT                   EKYLMHKNIRYEEIVAQNGTLKDIPLEMVSNYAAEDADITFRLFKIFTKKLKEDNLENL
FT                   MTDIEMPFSNVITEMEENGIYLDKDYLRQYGYELDKELKLIENEIIKSIGIEFNLNSTK
FT                   QLHTVLFERLNLVLPQNVKQDSTDIKVLETIKEQHESIPKLIQYRQIAKLKNTYTDNLI
FT                   EFVNEKTNKIHTNFIQTKTATGRISSTSPNLQNIPIKDEKGRKIREAFKPEKGNIFISA
FT                   DYSQIELVILAHLSEDESLIEAFKNKKDIHIKTASQLFKVDEEKVTSSMRRIAKSINFG
FT                   IIYRMSAFRLSKELSIKREEAQKFIDSYFNLYSKIKTFIQNQIDFVRKNGYSETLLKRR
FT                   RYIKEINSQNYSERSGAERIAINSTIQGSASDIMKIAMIKVYNELKSKNLKSKILLQVH
FT                   DEMLIESPEQECEEVNKIIKTMMENAYPLKIPLKVNIETGKSWGEIHR"
FT   gene            complement(565928..566326)
FT                   /locus_tag="BT0549"
FT   CDS_pept        complement(565928..566326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17873"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZY1"
FT                   /protein_id="AAX17873.1"
FT                   /translation="MSTNRILKIYLKDLILELKKLKAILEFENEEINKGMLNILNITNP
FT                   AKDLILNSINNYYITINSWLKEQEQMQEEIKKLIEDTCLLKEKICIQYHNTHKTLKRLF
FT                   AQKTTIPKTQLSKTLFKDNNPLLVDVKI"
FT   gene            complement(566316..566735)
FT                   /locus_tag="BT0550"
FT   CDS_pept        complement(566316..566735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0550"
FT                   /product="flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:BT0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17874"
FT                   /db_xref="GOA:A1QZY2"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZY2"
FT                   /protein_id="AAX17874.1"
FT                   /translation="MIAKEEIYKKTQINTSSPISILVMLYEKAIQDLELAKEFYKSKDP
FT                   TSTAKADEKVYHAQDIIIELMSTLNFEDGGDISNNLFSIYSFLNKTLENVILEKNRDNI
FT                   QEVLKHLKNLHTAWKALLKKDNNIINKKLGINIVN"
FT   gene            complement(566746..567153)
FT                   /locus_tag="BT0551"
FT   CDS_pept        complement(566746..567153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0551"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:BT0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17875"
FT                   /db_xref="GOA:A1QZY3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZY3"
FT                   /protein_id="AAX17875.1"
FT                   /translation="MLKLSKEWGLEENKKALIVDDSIFMRKNLIKILKKLGFNEFLEAE
FT                   DGIQAIKEFEKQEEIHLITLDITMMSMDGITALEKINEVNEKLARKMNVLMVTALGKQE
FT                   LIAKALELGAKGYITKPFKEEQIAEQIKRLN"
FT   gene            567318..569348
FT                   /locus_tag="BT0552"
FT   CDS_pept        567318..569348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0552"
FT                   /product="NAD-dependent DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BT0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17876"
FT                   /db_xref="GOA:A1QZY4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QZY4"
FT                   /protein_id="AAX17876.1"
FT                   /translation="MGRFNVKFMIKDIEDEILCLRDNIRKWNKEYYVDSSPSVSDLTYD
FT                   KALLRLQDLESKYPEYKTLDSPTLKFGSDLLNNFEEVTHSFPILSLDKAYDIKELLLWI
FT                   EKMVLEGSSLGSYTGISVEPKIDGCSIVLYYKDGILQKALTRGDGRVGNDVTENVRTIK
FT                   NVPLSIDEKVELVLRGEIYITKENFLKINHTLKNPYLNARNLASGILRRINSREVASFP
FT                   LDIFVYDILYSSFGLSTNHDAFDKLKKFGFKINPFCKFFGGKNLEEITNHVKKIEMQRN
FT                   SLEYEIDGVVLKVDSFILRDILGYTSHHPKWSVAYKFESCTGVSKIVDIVVQVGRSGKI
FT                   TPVAHVEKVFVAGAFITNASLHNQDYIDSIGLNVGDVVAISRRGDVIPAVELVVEKLSI
FT                   GSFKISSNCPSCKMALIKEGSHLFCVNKHCPYRIIEQIKYFCSKKCMNIVGLSGKTIEF
FT                   LFEMKFISSEIELYTFNFDRLINLRGFDLKRIDNLKRSISDSKGRPFRKLLLGMGIKEL
FT                   GANTILVLINNNLNSFDIISTLCKNKEAALAKLLKIKGIGEKIALNIIEAFNDKIILDK
FT                   FNFFKELGFKLEEYNTNYVVDDSFLFGKKFCITGSFEGHSRDVLIEKITKKGAIFNRAV
FT                   TKRLDFLLVGEKPGLKLQKANNLGIKTFGLFDIKDFVDLDN"
FT   gene            complement(569351..571483)
FT                   /locus_tag="BT0553"
FT   CDS_pept        complement(569351..571483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0553"
FT                   /product="myosin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17877"
FT                   /db_xref="GOA:A1QZY5"
FT                   /db_xref="InterPro:IPR027132"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZY5"
FT                   /protein_id="AAX17877.1"
FT                   /translation="MFMSKKILSMLSKTFMLLSCTLLFGESKKNITHYIMNHSKVYIPK
FT                   EDLSEDFDNEEEIIYHKKNEISKDNNSNAPSKKSNKFKVSDNRKTRNNILTNEELQYPQ
FT                   SLNTKNFYSEQENIDDWFIKDIDNLKLRIENYEKKIENIENLLSHTNIKSIKNKNEEYE
FT                   ILTKSLKEIIEKIKNLINTKENLFNHAPQSKNNHYNNDQEYEENQNEYISNEEYNYPPE
FT                   KNTYDMHAQEQEYFNSETQILSELDNKINNNKDTLNNNTHKLSELDNKINNNKDTLNNN
FT                   THKLSELDNKINNNKDTLNNNTHKLSELDNKINNNKDTINNNTHKLSELDNKINNNKDT
FT                   INNNTHKLSELGDKINNNKDTLNNNTHKLNELGDKINNNKDTLNNNTHKLSELDDKINN
FT                   NKDTLNNNTHKLSELDDKINNNKDTLNNNTHKLSELDDKINNNKDTLNNNTHKLSELDD
FT                   KINNNKDTLNNNTHKLSELDDKINNNKDTLLAFQKELIDLKNNHDTSLKNIENNLSSIE
FT                   KVINALKDKIDKNAELYEENKDTIQQKQDKINILNEKLMNNENAILTLKEEFTKYKNKD
FT                   LFTHDNGESQYTKKEFYPNNEKKIHKSSVIKTAEFTIYPDTHSNNYNFKDQSSEFDFKK
FT                   SNGYYIEIEPTKNLYRAQEIYKLIPKYNVKTHFINPSLKHKEKFFRNLIKIEHANEIGT
FT                   LYKNLASEFKKIRIIK"
FT   gene            571758..573623
FT                   /locus_tag="BT0554"
FT   CDS_pept        571758..573623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17878"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZY6"
FT                   /protein_id="AAX17878.1"
FT                   /translation="MKLKNMEEVWALPVCCNIKNSIIEDFKILDKYKDQVFNISYKDDI
FT                   TLKVIDAVDSNEFDLKLFDNKINFEGQIPLVLYSDSLDSLVEAEASVVFELKVIEQNGV
FT                   YFDSGLKELGEFKIYNSYYEFSDCLNYCSDVILVKVCFKDDSLVIDADLDNIALVKQII
FT                   SDNFCIAKDKIIINPINNNCVNVLFSVSFNAVLQGIIIAKKLGLKVNVLYYKRHFLMAQ
FT                   SLNLKFSAVNYLSSENKLDKIMLDLEINRPLHFLYKFYFDYLRHIFDNLFFDVCIHFNF
FT                   ISTTSNAVFFYDNYFLFGIAVYNFIYSNFYNLAVSLSIEPLSYLLSYVKSEYNVFFKLF
FT                   KEMDLKNSIMRKSSAISLKNEYNIFDVRRKGIGFAFLNLDPYRDSALLGGNQTVSMSLH
FT                   KDKLDVFIPYKIMDINLMNYLRNTLARTFSLSYSNVNFIVSDVFIDDVGLYSTLIKESY
FT                   IIEREVLAIKDVLVMMIGENFRGEYPVVAGQDFVMDIDKKFNVACSLEIDIEIYSFNIV
FT                   FSNVNFFVENGKFDKLRINNKRIFSIFSLAVDYVFGNITYDIVDSVDLEFIEDGEFVFS
FT                   FRILFIASVCAIKTALIQAFDFNICKTPIDLKDILDNWSIRIDTN"
FT   gene            573610..574071
FT                   /locus_tag="BT0555"
FT   CDS_pept        573610..574071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17879"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZY7"
FT                   /protein_id="AAX17879.1"
FT                   /translation="MILISFNLNGETLSKSIKLPLSTKELLISIFYSGNQSFIENMNKK
FT                   FSLVLLDLKPVYSSLVSAFMLNGRSIITVEGLQNTTFYETLVKVLLENDFGFCTNCFSS
FT                   NALLFYYLLKRKVIIRADILGYYNTLKCNCLDVNTFLDLYLRLEELERK"
FT   gene            574068..574931
FT                   /locus_tag="BT0556"
FT   CDS_pept        574068..574931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17880"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZY8"
FT                   /protein_id="AAX17880.1"
FT                   /translation="MRGVKVYYPENFNTLVNLFKEDSNNYIVYNEIDFHKNAEIFMKNE
FT                   ISDNFFIINNFERFNKVSLKSNFLEMGPCVTYDTILQFGERNIPRLFYEFISRLNDRIY
FT                   LNSINIANGFYYKNTVFDLYPLLLSLDAQLEFKNILTKKTYTYNAYSINRDDYIQSRHT
FT                   LFLSKLKFPITNLWNKSFCSRIFVDTFSFDILEEANIIFICVLLNIKRDIISDFLMKIF
FT                   YNDKVITLRDFQVLLLNKSLPLSLIEIEDSLKMLDKNIRDVKNFSLGERSLRLIKNFYF
FT                   DILSSF"
FT   gene            575092..575352
FT                   /locus_tag="BT0557"
FT   CDS_pept        575092..575352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0557"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BT0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17881"
FT                   /db_xref="GOA:A1QZY9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZY9"
FT                   /protein_id="AAX17881.1"
FT                   /translation="MVKKEATINAVNGLHVRPASTFVKKAKEYASDITIEADGKSVSGK
FT                   SLFRLQTLELSSGKKLVVCADGDDEEKAVTELVELIESFKE"
FT   gene            575368..577089
FT                   /locus_tag="BT0558"
FT   CDS_pept        575368..577089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0558"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17882"
FT                   /db_xref="GOA:A1QZZ0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ0"
FT                   /protein_id="AAX17882.1"
FT                   /translation="MTLSGKRISKGIGVGEALFIKKDFDKFIDKSKIASLQIDDEIKKF
FT                   NDAKSKAISALKELTKKAVAQLGADKEGIFEGQILVIEDDELSDSVTSFIKNENYCAAY
FT                   AVYMSFKELIASVEEYTDAYLKERASDFKDIRNRLISNILDQVTDLSEVKRDVVLITEE
FT                   LTPSDTMQVDLSYVKGFVTTVGGETSHAAILARTMGLPALVMTPLDIAKIKEGEQLIID
FT                   GLSSIIIGNPSSSELDKYAHKILEYNEYERELFALKNQDAKTKDGIKISLKANIGTPTD
FT                   VFYVNKYGLDGIGLFRTEFLYMESVKPPTEDEQFEAYKRVVDTIEKKGVVTIRTLDIGG
FT                   DKEIPYFKFPKEDNPFLGYRALRMYMDYEDLIQSQFNAIFRASHYGKIRIMVPMLTRYE
FT                   ELDIVNYFINKAKTNLKSRNLPFDENLEVGCMIEVPSAALMASDFADKLDFFSIGTNDL
FT                   TQYTLAVDRGNQKISNLYDKYNPAVLRLIKNVLDAGNNFDIDVSVCGELGGDEAGALIL
FT                   IGLGFRSLSMVPSASLRIKYLLSKYTMSDLSELASKVLNSKSELETLKFLDKYIGD"
FT   gene            577093..577662
FT                   /locus_tag="BT0559"
FT   CDS_pept        577093..577662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0559"
FT                   /product="PTS system, glucose-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BT0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17883"
FT                   /db_xref="GOA:A1QZZ1"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ1"
FT                   /protein_id="AAX17883.1"
FT                   /translation="MGFLGFFKKSATLDLIAPVSGKVVSIDKVPDEAFAEKIVGDGIAI
FT                   MPTGSELVAPCDGNIGKIFKTNHAFSLETKEGVEIFVHFGINTLNLNGKGFTRVAEEGM
FT                   SVKQGDVIIRLDLEYLKAHAESVVTPVVIANSDEVSSIEYVFGKLDDGSEYIVPSSTTL
FT                   TEDIKTKISQTNPVEAGKDLVLRVKK"
FT   gene            complement(577696..579543)
FT                   /locus_tag="BT0560"
FT   CDS_pept        complement(577696..579543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0560"
FT                   /product="chaperone protein HtpG"
FT                   /db_xref="EnsemblGenomes-Gn:BT0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17884"
FT                   /db_xref="GOA:A1QZZ2"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ2"
FT                   /protein_id="AAX17884.1"
FT                   /translation="MKKQFDTEVNDLLYLIIHSLYSHKEIFLRELISNASDAIDKLKFL
FT                   NLTNEKFKDIKLDPKIEISFDEKLIKIKDNGIGMNREDLINHLGTIAKSGTKEFIKNLK
FT                   KDEKNTASLIGQFGVGFYSAFIVANKVELVTKKALEDTAYLWSSDGKTGYEINKAEKDE
FT                   YGTEITLYLNEEGIEYTNKWKIQEIIKKYSNHISYPIFIKYKEPLMKDGKQEGFEEKED
FT                   KLNDTTAIWIKNKNEITDEEYNEFYKNLTFDYENPLIHIHTKAEGSIEYTNLFYVPSKA
FT                   PYDLYYPNTKPGVKLFINRIFITDSADSLLPNYLRFIKGIIDCQDLPLNVSREILQQNK
FT                   ILAKIKASSVKKILSELEKLSESDNSKFNEFSKEFGRCLKEGVYSDFDNRSKLISLIRF
FT                   KSSHVDGLVSLREYKERMPEEQKSIYYITGGKENILKINPIVTAYKEKGYETLIMDDEL
FT                   DEAILNFITEYDGIKLKAINKNETSDELKDENFKQMEEEFKDILLKVKTILKNHVKDVS
FT                   LSATLTQEPSAIIIDSADPTYQMQRIMISMGQEVKEIKPILELNPNNKIIQNLKNLDDI
FT                   NLEKISIILFEEAMITSGLQSKNPRQFINIINEMLEQNI"
FT   gene            579664..581058
FT                   /locus_tag="BT0561"
FT   CDS_pept        579664..581058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0561"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:BT0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17885"
FT                   /db_xref="GOA:A1QZZ3"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ3"
FT                   /protein_id="AAX17885.1"
FT                   /translation="MDIGIYGLGVMGSNLALNIADSGFNVSVYNRDNDKTEVFLVNDAH
FT                   KKINGFKNIEDFIGSLKKPRKIILMISSSAVDEVIEQILPLVEKFDIIIDGGNSHYKDT
FT                   IKREKELSSKDVYFVGLGISGGEKGARFGPSLMYGGSKKAYGLIEPILNKIAAKTNMGD
FT                   ICSAYVGESGAGHYVKMVHNGIEYADMQLICESYFFMKRAFNLDNLKISEVFDKWGEGD
FT                   LSSYLIEITSKILKYKENNEYLLDKILDVANQKGTGKWVSIEALQLNVPANLIFESVFA
FT                   RFLSGLKHERVIASDILKMDVDSVEFDLSDWILDLYYALLVSKILAYAQGFMMLKSASV
FT                   NYSWDLNLGKISLIWREGCIIKSVFLEKIKLAYDKNPHLINLIFDDYFLDIIRNYHKSL
FT                   RRIVSRASEIGIPLPAFYASLSFLDSYSTNYLPANLIQAQRDFFGAHSFERIDSKRGEF
FT                   FHSTWE"
FT   gene            complement(581073..581612)
FT                   /locus_tag="BT0562"
FT   CDS_pept        complement(581073..581612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17886"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ4"
FT                   /protein_id="AAX17886.1"
FT                   /translation="MQKLVLIAILTLNIWGGAFGKSSYSDRKIGFGGSIGNPIFNYIMS
FT                   FPFIDLEIGYGGTNGINLSEDKLKSKKYDFNIFVLSALDLILTIPLIEKLSIGTGIGGN
FT                   IHISSNKSNFINMEIGFGFRIPIAIFYDLTEQIEVGLKIAPSIEFVSNAKSIAYHYLYA
FT                   GLKTNIIGGIFIKYYI"
FT   gene            complement(581742..582257)
FT                   /locus_tag="BT0562A"
FT   CDS_pept        complement(581742..582257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0562A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0562A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17887"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ5"
FT                   /protein_id="AAX17887.1"
FT                   /translation="MKKIILILLLINYFNVSAKESHTNKGYFGIGILGPLSNAFQLVLG
FT                   KNITIEIGIYNGLKNLFNNFNTLFASLEFTALSSDSSEQSKAIDASLGIGIYGLWWIPE
FT                   WQNTRKTYNSTNIGIRISLTLNLPIIKKNFDIFLKTGPGINIWGIGGGNPKQKWEAFAG
FT                   LGMRLWFA"
FT   gene            complement(582650..583165)
FT                   /locus_tag="BT0563"
FT   CDS_pept        complement(582650..583165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17888"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ6"
FT                   /protein_id="AAX17888.1"
FT                   /translation="MKTKNMLALMFMLVSISAFANSTSTARNKFGMGILLPFPIALEFN
FT                   IGNFDIDLGAYSGTNNFFKDWKTLFLAIDYIFYIHTFAGADNMLDFAVGGGGYGTIWFS
FT                   RWSNNKINSGPMSLGARLPLILNLAIARKKFDIFLKVAPGLGLNIWSRGVGFRWEVFAG
FT                   LGMRLWFA"
FT   gene            583650..584186
FT                   /locus_tag="BT0565"
FT   CDS_pept        583650..584186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0565"
FT                   /product="chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:BT0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17889"
FT                   /db_xref="GOA:A1QZZ7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ7"
FT                   /protein_id="AAX17889.1"
FT                   /translation="MELETDLQGTLNQYLLFSLDELYAIEIKYVVEVLEYTKISKIPRT
FT                   PDYMAGIINNRGKIVPVIDIRKQFGMQDRKVSDDGLKKKDVDISNIIILNLIYEGDELN
FT                   LGILVDYVNEVLELNLSDIDEAPKIGTGFNSRFISGIGKRNNKFIIILDVENLFDIKEL
FT                   SSFKNTTIYDPDCDQ"
FT   gene            584201..584512
FT                   /locus_tag="BT0566"
FT   CDS_pept        584201..584512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0566"
FT                   /product="hypothetical protein with NTP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BT0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17890"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ8"
FT                   /protein_id="AAX17890.1"
FT                   /translation="MIYNPEGELVVNSIFKVKEDLLNILKEMKEEETLVMNLSNVEKID
FT                   VTFIQILYASNKYAKDRNLFIKIEYPSDEVLSSLIYGGFLNDIEDIDHLDLGLSLIEF"
FT   gene            584536..586689
FT                   /locus_tag="BT0567"
FT   CDS_pept        584536..586689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0567"
FT                   /product="chemotaxis protein CheA"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17891"
FT                   /db_xref="GOA:A1QZZ9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A1QZZ9"
FT                   /protein_id="AAX17891.1"
FT                   /translation="MNSSDMIDKFKDSFKEESIENISDIEHALLNIEFESGKEVVNSIF
FT                   RNFHTIKGSAGMFGFNLTASLVHEIETVLDPIKEGSDEFNQDTVDATLMAVDFIRELIE
FT                   GDEAIDESAYKNREKILIDTIKKGFGLGVDVGLNTDSVLSSTGGDQISLSNDLDSQGAF
FT                   LDASLEQGKFEDEALNVETKIYKILFSPSRGILFHGHKPINFLKKLLNLGNGQVRARVK
FT                   NIPDLELMSPDNVYVEWEVKLETEESKSSIEDIFMFLDGQSKFVVEEVDSSYDMPEAFE
FT                   LDSLVNNLDKGVDEVCSKEKQNSSKTEEIFNKTALKGGANFNDDTAKSKVNIASIKVDS
FT                   KKLDHLVNLVGELVTIQSKLAKEAESSNNNILNSISAEFSLLINELRDYTTGLRTVPIE
FT                   ILFVKFQRIVKDLSAQLGKSIRYHSQGGDTVLDKSIIERLNEPLVHLIRNAIDHGIEPA
FT                   EERIEAGKDPQGVIKLSAHQSGDSVIIIIEDDGRGLNKRKIIKRAIERYIISDAVSRTL
FT                   SDVDIYNLIFEPGFSTADVVTNVSGRGVGMDVVKKQVESLRGNVILESEFGKYTRIKLI
FT                   FPLTLAIIEGWLVRVRDEHFIVPLSSVESCLEADKLMSKVCGFENNSNVMNYRGSMISF
FT                   IRLREFFEISDEESDSEHVVVVNANSGKIGIVVDEVLGQHQTVIKTLGKIYSKVEGVSG
FT                   ATILGDGSLALVVDIDTITKVIR"
FT   gene            586738..587889
FT                   /locus_tag="BT0568"
FT   CDS_pept        586738..587889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0568"
FT                   /product="protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BT0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17892"
FT                   /db_xref="GOA:A1R000"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A1R000"
FT                   /protein_id="AAX17892.1"
FT                   /translation="MKILIIDIQGLIRQVFVRAFSKDLNVEILNPGSNSLNLINVFLQK
FT                   FPDLVIVDENSAKSHFGNALNNVLNNISLPVIFIAEDEVYPQFGFLESKRDKIKLIINK
FT                   LNFKLTVNLFRSDYLDLIKSEIKKLAGNKFIVSFETKRIKAPDSFVKSESKKSEGSISG
FT                   ITRSYKVADVINVAPKNDPDVILKYQGVINKNKTGKVIFVGSSTGGTEALRVFLKFFKR
FT                   DSPPIVIVQHMPGGFTTSFAKSLNNELEIDVKEAEDGDILRPGLVIIANGHYHLIVKYA
FT                   NGNYFVNLLDGPLVSRHKPSVNVLFRSAAMYAGENAIGVMLTGMGDDGACCMLEMKKSG
FT                   AYNIAQDQVTSVVFGMPMEAIKIGAVDKVLPLNKISEYILRRS"
FT   gene            587889..589661
FT                   /locus_tag="BT0569"
FT   CDS_pept        587889..589661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17893"
FT                   /db_xref="UniProtKB/TrEMBL:A1R001"
FT                   /protein_id="AAX17893.1"
FT                   /translation="MEDDGKFLDINPHINKLFVELEAFDSRSRQVYASLSKSIPKLIEK
FT                   LSKDIKDLSFNIGFISNLDIDNDYSLNNFISKVIRVLNDFVSYFNSSTELLEAQFGVIR
FT                   DKVKDIEILEDVIEKMKKSSIDMEIMSINTLTVAMRAGRAGGAFSYITNEIKTLTQSMI
FT                   KQADQLTSRGRDIKVGLDRAKDQVLENNTAENKILEEFKDNLIKNIDEFSGGIGEVIAF
FT                   YDNILGILSEFKFKFVNAVSYLQFQDRLTQSLYHLNIMYSSIDVFKFRDTSEVQKLKVL
FT                   SVFTNSSKMIVGDVIAKLDENLRAFEEFIDTSISSIQVINDLKSDNSSYIDISRSVESF
FT                   SVILSNLLKRIDDVEKNNSNFLNLYYEQIKLVKSLELMFSNISAISSRFQNINIASKIE
FT                   VVKRVELEDMEGNISEMSKIISDIELNITKGREFLSQIIFFFEKVVKDCDNRFYLERNY
FT                   FNKFKKLFMEIKNNIFEIKKIALDQVLSYEIFPVDFLEIFEEVKLGIHNIKNLRMDLLN
FT                   LEKTLMEMDNDINSTLDLELLKNGLKCVEIEDKEFIRRIANRFTLFIHKKYLLSLIEDE
FT                   KDVHSFDEGSVILF"
FT   gene            589699..590073
FT                   /locus_tag="BT0570"
FT   CDS_pept        589699..590073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0570"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:BT0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17894"
FT                   /db_xref="GOA:A1R002"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1R002"
FT                   /protein_id="AAX17894.1"
FT                   /translation="MQKRILVIDDNRAIRQSVAYILEQNGFGVSEAQDGLEGVSKFKEA
FT                   VGQSDKDFDLIITDINMPNLDGIGVIKQIREFGSFVPILVLTTESEQSKVDEGRKAGAT
FT                   GWLVKPFNPDTLMRTISKIF"
FT   gene            590099..591463
FT                   /locus_tag="BT0570A"
FT   CDS_pept        590099..591463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0570A"
FT                   /product="Xaa-His dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0570A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17895"
FT                   /db_xref="GOA:A1R003"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1R003"
FT                   /protein_id="AAX17895.1"
FT                   /translation="MCSRFSFMDFKLEKQFYFHLGELIKFNSVNASALKNRPFGEQIDL
FT                   CLDKVLEIAKNIGFKVYRDRDGYYGFADIGQGDELIGILAHIDIVDAGNVSNWNSNPFK
FT                   LDFRDGKIYARGILDDKGPLMAVLYAFKLLVLEGIFFNKRFRIIFGTDEEVAWRCIEQY
FT                   KIKEEIPDFAFTPDGDFPVVNAEKGLLQFDIISDEKFFMDFEIGTGYNVIPDECSFELG
FT                   DFNKDDFRILLDSFGGKIRYKFFENSVLIHGISAHASLPELGVNVAPYALKIIKSLGVK
FT                   ANFINFFEDRISFTINGEKLFGKVLEDSKSGQLTLCLTKVKLSKTSNQILSFDMRYPVS
FT                   CRREELVDLIKRTLNVYSLDYHEVSFLDPLYVDSDSKFIESLIEVYKAFTGESNVSPIA
FT                   IGGATYSRALKNCVAFGPLFKGSDNTAHKTNEYIDESELMNLVLIYKDAIKRLNT"
FT   gene            complement(591596..591679)
FT                   /locus_tag="BTT0017"
FT   tRNA            complement(591596..591679)
FT                   /locus_tag="BTT0017"
FT                   /product="tRNA-Leu"
FT   gene            complement(591688..592377)
FT                   /locus_tag="BT0571"
FT   CDS_pept        complement(591688..592377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0571"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17896"
FT                   /db_xref="GOA:A1R004"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A1R004"
FT                   /protein_id="AAX17896.1"
FT                   /translation="MLKIISLGGGIINPDKINIEYIKNLKNLIFKWVQEDNRRKIILIT
FT                   GGGKTAREYQDAYKQINPKFKNHELDEIGIMATKLNAKLISKAMQPLCIDNIVSDPTQD
FT                   FHFKGQIVIASGWKAGFSTDYITVKFAEKFKADEIINLTNVNQIYDKDPKKFDDAKGLS
FT                   NITWNELQNIVGKNWEPGSNLPFDPIATKLALKLGIKAYILNGTDLQNLKKVFDKNDDF
FT                   LGTIVVK"
FT   gene            592586..593662
FT                   /locus_tag="BT0572"
FT   CDS_pept        592586..593662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0572"
FT                   /product="SS-1,4-galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17897"
FT                   /db_xref="GOA:A1R005"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1R005"
FT                   /protein_id="AAX17897.1"
FT                   /translation="MEGFMCKYKVSVIICFFNSDSTLEVMIKSALNQTLRDKEIILVND
FT                   GSYDNSLKIAQKYADQYDCVKIINQKNLGIAASRNNGLEKAEGEYIIYWDSDDSVENTM
FT                   LEVLYNRAKADNSDVVCSQFYVYFIARNIKRRSALPFPNYPITGEEAFKNLLLTVFASF
FT                   SKKNFVVGTLWDKLIRRDLIVKNDIIVNDIILEDIVFMLHVFLKADKVSFVNNYFYTNF
FT                   QWMRSASSSINVISKVSLSFKVVESFLKEEGIFEKYFEYYKRFYLQLYYYISFKQIYII
FT                   GWHIKDRLVYKAHKAKLISVLNEVQNSKEFQIYYASLKGARFSEIQILPKIMLKVWHLS
FT                   ARLYVNFSLFIYKSFLKN"
FT   gene            593724..594542
FT                   /locus_tag="BT0573"
FT   CDS_pept        593724..594542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0573"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17898"
FT                   /db_xref="GOA:A1R006"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R006"
FT                   /protein_id="AAX17898.1"
FT                   /translation="MKIEFIDVSFSYRKIKVYLDLNLAFSKPQTYLILGKNGMGKTTLL
FT                   KLISGLLNPLKGEVLFNSLKVFPRNPLNLVNLFFVPEEFDLPSVSLNDYYRSLCKFYPN
FT                   FSEKDFKEYLLKFEIDINLKFGSSSYGQRKKSIIAFSLATDVPILIFDEPTNGLDIASK
FT                   NVFRDIISNFKNKIVFVTGHNVRDLVDIVDHLTIIGNNNILFSNSVSYINNSYKVKIVD
FT                   KLEGEELYYEKVKGGFKALYFESGFCDDNVDLEFFFLYITSNKLKDLANV"
FT   gene            594535..595392
FT                   /locus_tag="BT0574"
FT   CDS_pept        594535..595392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0574"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17899"
FT                   /db_xref="GOA:A1R007"
FT                   /db_xref="UniProtKB/TrEMBL:A1R007"
FT                   /protein_id="AAX17899.1"
FT                   /translation="MFSLKRFFLLFNFDFVYHRKLYLYFVFSIFLVFPLIYFFLKIYGF
FT                   TNLINFVFINSKLFFFVLFCIVYIVSIYNMFDHYKPIHDLLKDVFYLSLPVSTLERYLF
FT                   VLVKFLFILPLFLIICCYISLNLTVLLDKNFFVGNQINYLSLYFVFSFFKETCVIYFVG
FT                   FPIFLLSRIIFKNYPFFRAIVIGSLFFTLLVVFFYFVIFFVNTYLFKVGNDFGGWGEYY
FT                   FIKFICMLFAGFIYFCAYFILKNLGNLNTKVNLSILAGVISFFAVLFFFLLAFLTIFVY
FT                   VFRF"
FT   gene            595679..597289
FT                   /locus_tag="BT0575"
FT   CDS_pept        595679..597289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0575"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:BT0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17900"
FT                   /db_xref="GOA:A1R008"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:A1R008"
FT                   /protein_id="AAX17900.1"
FT                   /translation="MIDNLKILVVTGGVISGIGKGVTSASIARLFKDNLKITPIKCDGY
FT                   LNTDPGTINPVEHGEVFVLDDGGEVDMDFGHYERFLNLNSKSNWNITMGKIYKNILENE
FT                   RHGKYLGRTVQLIPHVTDEIRETIFKIAKEESSELLVIEIGGTVGDMENILFIETMRQI
FT                   RYEIGSDNIAFVHLTYIPSPVGINEQKSKPTQQSVKTLNKAGIFPDLIIARSSQLLTKQ
FT                   MRQKIAMFCNVDTLSIIDNTDVSTIYEIPISFYKQGLHEILGSKLKINVKPKVDGLERL
FT                   VGIIKRNLVSPQRIVNIAICGKYTELGDSYASIFESLTHVSANLDILVKTTVIDSTNFD
FT                   ERMLKGIDGIVVPGGFGGRGYAGKIRAIKYARENDIPFLGICLGMQLAVIEFARNVCGI
FT                   FDADTEEILSEGNSICSSITPVIHLLPEQKEFTDKGATMRLGGYSVLLKKDTLAFKLYG
FT                   SEMIVERFRHRYEVNNDYLDSFNNHGLIVSGFSEDFRIVKIMEIPKNKFFVGCQFHPEL
FT                   ITRLENPSKLFVGLVKACL"
FT   gene            597391..597978
FT                   /locus_tag="BT0577"
FT   CDS_pept        597391..597978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17901"
FT                   /db_xref="UniProtKB/TrEMBL:A1R009"
FT                   /protein_id="AAX17901.1"
FT                   /translation="MKESDIKKAISMKRLVKYFFDELEYRMKIPCLRPNSRSMSKKYIL
FT                   LNLLRKIANLPFNKQYEIEEQFPLDISGKGILTDAVLIKRLDYERCVITGIIEARAEHV
FT                   DLEYELKRFVIRSGKVNVLFWQPKRTILKQDGDLIILDADDIFKLDNDFYLPVIKEKLE
FT                   NFINIFMKFFSYEDVLFEYNKLHGKYSLVKNK"
FT   gene            598175..599356
FT                   /locus_tag="BT0578"
FT   CDS_pept        598175..599356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0578"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17902"
FT                   /db_xref="GOA:A1R010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A1R010"
FT                   /protein_id="AAX17902.1"
FT                   /translation="MYKFSFFGKKKSDMSNSFKNESLKNIENDNQSLNMCEYKVPVKEM
FT                   IQGFYHARSSISNVLVRIEFLYKNLFFNFENIGKIFESLIEKTNNARSQVSVIFEDIEK
FT                   NNEEKLKRVSAVIVGVQGSLETINSFLGATNMISLNAKLEAARAKEYGKGFSVVADEIK
FT                   RLSDQAKSVMSMISVKEIEQVSKDLISKNIKELQLDIDNFFSNLIGELISLGDLFKHFI
FT                   SQQNEFSTLIGELENVEASVSYLARNCDSLSSSEIFMYSNDEFLKELEFSISEQMSWMS
FT                   IVRAIVENQKRMPIQTDPMKHGFGLFYKGLIPRASKVRAVWEDIYSCYLNIHKLVVEIV
FT                   KVFAQDSSDDIDLRRAKDFLVQAEGLSDEIVSKLESVKKIVVECENQGISIFE"
FT   gene            599501..602953
FT                   /locus_tag="BT0579"
FT   CDS_pept        599501..602953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0579"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BT0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17903"
FT                   /db_xref="GOA:A1R011"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A1R011"
FT                   /protein_id="AAX17903.1"
FT                   /translation="MDLKVKFVHLHVHSDYSLLDGAAKITDIVAKAKKCNMSHIALTDH
FT                   GNLFGAMKFYREAKGAGIKPIIGMEAYMSSTSKHIKKNDELGRPYYHLIFLAKNELGYK
FT                   NLLKLTSVSYLEGFYYRPRIDKEDIEKYSEGLICTSACIGGIIPQLILANKFDDAKNEI
FT                   LWFKSVFGDDFYLELQRHGIKQQDIVNEKLVAYSRELNVSLSVSNDSHYVNKEDATAQD
FT                   IIVCIGTGAKRSDPNRLKMETDEFYLKTQEEMCKLFRDLPEALANTLKIAEKCNEFEIK
FT                   FPGPIFPEYQVPSEFDTLSQYLEYLTLEGLKFRYANVTDSIKDRAFYELSTIIKMGFEA
FT                   YFLIVWDFIKFAHDNGIPVGPGRGSGAGSIVAYALRITDIDPLKYNLLFERFLNPERVS
FT                   MPDFDIDFCFEGRDEVIKYVTRKYGEDKVAQIITFGTLKPKAVFKDVGRVLDIPFTESN
FT                   ELTKLIPDGPKVSLREVFKDKALKAYLNKGVVYNELMEAALVLEGMNRYVSTHAAGIVI
FT                   ARTPLTDYVPLYKDYKQNTVSTQYTMDLLEDCGLVKMDFLGLKTLTLIKNAENLIRITN
FT                   PNFSIANISDSDVKTFKMLSEGRSASVFQFESEGMQQVLREAKPDSIEDLIALNALYRP
FT                   GPMQFIPQFIAAKTGTKRIRYPHPDLKEVLKPTYGVIVYQEQVMEVARIIGGFSLGKAD
FT                   ILRRAMGKKKEDEMNKMKVDFIKGALSKGYDETLANDIFELLKPFAGYGFNKSHAAAYS
FT                   LIAYQTAYLKANYPENFMAANLTNEINNTEKLSYYIEEAKSMGINVLKPDINQSFKEFS
FT                   VVGLNISYGLNGIKNIGGLIVDLIITERQENGEYKSFEDFIRRVDDKVINKKFLEAAIK
FT                   SGLFDSLGQNRKTLFENLDKLIDFVIKDRNDKKLGQNSLFGSIGSQDAIQQSFNYHVFE
FT                   EYSYPELLRFERELLGFYVSGHPLDHYKPELERFTNFNVLEDLAVKKDTTVKFAGSLNV
FT                   VRVIRTKRNNARMAFGVIEDFKGEMDIIVFAASYEKYNHLLIEGDVIGVIGKLRFERDK
FT                   FSIIVEKVLSIEEISVNNENKINNLHIKFSNERLGDSHLLYSLKDKIFNLEDHTGFSHV
FT                   YLYLKNDDKSLKLKMDLTLNFKPDEFKLNELRCHEIVEDIWFD"
FT   gene            602965..603537
FT                   /locus_tag="BT0580"
FT   CDS_pept        602965..603537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0580"
FT                   /product="integral membrane protein, YggT family"
FT                   /db_xref="EnsemblGenomes-Gn:BT0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17904"
FT                   /db_xref="GOA:A1R012"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A1R012"
FT                   /protein_id="AAX17904.1"
FT                   /translation="MIIETLILFLNIYRILILIRIFLSWLVSSGINTSAFFRFIYNSTE
FT                   PFLSIFRRIRFFRFGIYDFSPIAALITLSIVERMLSYGDYKLSTFVILFIIEVWGILRS
FT                   VFFALIFFFVLRFIFLFLHLFDGTDFMRSVDSFLMPLSVKISNMVTDKNMSYTINLIVA
FT                   GALLLAFIIICEQAIWAISILGFYLPF"
FT   gene            603541..605610
FT                   /locus_tag="BT0581"
FT   CDS_pept        603541..605610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0581"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17905"
FT                   /db_xref="GOA:A1R013"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A1R013"
FT                   /protein_id="AAX17905.1"
FT                   /translation="MFMFLHEFQYDLQGISGLGNKGIDRLHNLNITNIKELIEYFPKKY
FT                   EDRQNIKTFPDPLEVRSCELMTVFVVLEHRNFGSNSKKNLKIIAQSENDEIFEILLFNR
FT                   GFLEGVFKVGQKFYIYSKFNYSDYTQMWSCSNFDSEVFSYNPERFKKIMPVYSLGEGLT
FT                   SKKISSYVKEALIYFLKFGKSDIPDFLINKYSLLSLHDALNEIHFPTSLEMLDRAKKTL
FT                   IYREIFLLQFFSRGKSSLVFLRKEKHLPMNLLDQVVLKLPFRLTKDQEVVISEIIDDLK
FT                   SNKPMNRLLQGDVGSGKTLVAFLSSIPLIEAGYQVALMVPTDLLARQHYNNLSNMLKDF
FT                   NISIALLTGSLKTKNRNDVLEKIQSGTYSLVIGTHAIFSQRTKFKKLAYVIIDEQHKFG
FT                   VEQREKLKNKGEEVDMLLMSATPIPRSLALTLFGDLEVSLIKRGPAGRRPVTTYLAKHG
FT                   NEDKVYEFLNNELGKGHQVYFVYPLISSSEKFNLKDVTSMCLNLKNIFVEYSVAMIHSK
FT                   LESHVKEEIMRDFYLKKIDILVSTSVIEVGIDCLNATCIVVEHAERFGLSALHQIRGRV
FT                   GRGSLKSFLFLLYKEPLTEAGKFRLKTIKENIDGFKIAEEDLKLRGPGNLFGLEQTGYL
FT                   KLKIADFVEDKEVISLIREELTMFFLNKAFYDKADIELLDSLLVSYLRFVGKEN"
FT   gene            complement(605613..606407)
FT                   /locus_tag="BT0582"
FT   CDS_pept        complement(605613..606407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0582"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BT0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17906"
FT                   /db_xref="GOA:A1R014"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A1R014"
FT                   /protein_id="AAX17906.1"
FT                   /translation="MRSLNIFSLILLVNNLTLQANTISRKDFKSLFKIIKILDKSYQKQ
FT                   IKEKPIQFIKELKPLLEAEKNDLLILVNKKIPIPKGYNPTDLVYLKDFKELKNIGKKNL
FT                   KLRKILIDDLTNLVKAGRENGLQIKIVSAYRTREYQKFLFEHNVKTYGLKLAKIQSAIP
FT                   DHSQHQLGTTIDFIQIDDNLLNTKAGKWLYENSFKHGFSLSYPKDHEIETGYKSEPWHY
FT                   MYIGKQACILQKKYFNNLQYKLFKFWHEHKKELSTLIQKYTN"
FT   gene            606494..607843
FT                   /locus_tag="BT0583"
FT   CDS_pept        606494..607843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0583"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BT0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17907"
FT                   /db_xref="GOA:A1R015"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A1R015"
FT                   /protein_id="AAX17907.1"
FT                   /translation="MLTKFNKYRSILRELLVLAIPTVFESFLFQLVTFFDNYMIAYLGS
FT                   AQVTGTSLANRITFLCFIVIFALGTTLSAYASQAFSKGKFTHVKQAFAYALIIGITIGI
FT                   IFFCMSFVFSKELIKLFIEENESLNFGMDYLKIVSISYIFMSYSFLSAMGFKSIKDIKV
FT                   PLVVTIFVVLMNIILNYIFIFGFNMGIRGAAYATLLARISEFVFYFFYNFLNVKSYYHL
FT                   KISDFFVSNSVKVAYLKILIPVFLHEICWVLSITILHAFYARLGSSEYASFAVASNILD
FT                   LYFVVMHGMGVATGVIIGHLMVNDKEQVRALGIFLSVIGFILGFFVAFILCLTSKIVPI
FT                   IFSNLDSPELVSTFISIFASIVVFKGFTAQTLVGVFRASGIPNICFYIEAGVIVFYTLP
FT                   VAYFLVFFTNFRLPLIVFIVNLEEIFKNIFILIEFFKNNWIKDIHYEELT"
FT   gene            608027..609370
FT                   /locus_tag="BT0584"
FT   CDS_pept        608027..609370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0584"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BT0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17908"
FT                   /db_xref="GOA:A1R016"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A1R016"
FT                   /protein_id="AAX17908.1"
FT                   /translation="MYSLSKSKKNSVYQDILNIAVPTAIEFFLFNVVAFTDNIMVSYLG
FT                   DYPVVGVSLANKLFELFSTIAFTVMGAYNILATRQYAQGDIDNFKNTFFISILILLFFS
FT                   FLFIVISLFYSYFFLGLLSDDPVAIFYGVSYLNIAVYSFIFAVVKGIIANSLKVVKITK
FT                   IQIATSVISVVLNVVFNYLFIFVLNMGVVGAAIATTLVRLIELVFYLLYTVFNINSHFY
FT                   LKIKNLKINPVIFSELIKVFVPIFLNDFIWYLGYFGLIAIFSRIDTAKYAAYSITFSTY
FT                   FIGLNITYAFCFAVNIVMGHEMNNDKREIMSVAVYLGKIGFVLAFLTSLIIFALSFIVP
FT                   HIFYKLEHADLMGVMLRYYAISAFFTSLAFQYLFGFFRAGAAPNFGAIMECSVTFIYTI
FT                   PVAYFLANYTQTPFELIVFIPTLEDVIKFGISLPYFYSTKWIKSIKTG"
FT   gene            609395..610750
FT                   /locus_tag="BT0585"
FT   CDS_pept        609395..610750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0585"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17909"
FT                   /db_xref="GOA:A1R017"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1R017"
FT                   /protein_id="AAX17909.1"
FT                   /translation="MYLDEIRGKNFLIMGLGLHGGGLAVAKFLLKHGGNLVITDLKNEL
FT                   ELIPSIEALKQFRDKIRYVLGYHDEDDFKRADIVIKNPGVSFDNKYLKLAKRVETDISL
FT                   FLMFNQNPIIAITGTKGKSTLASLLHKVLVIKYPNSKLGGNIGVSPLSFLDELDGVSPI
FT                   ILELSSWQLHDLRNLCPIISIITNIYSDHQNYYSNFDSYIEDKSRIFINQNSGILISQD
FT                   QAYYNYFSRFKSKLKSILFSEAVPLNFENDVFYFKKGKIYLNNKVVGTLSESRIVLLIS
FT                   KMITIFIASYLGLDLSVVSKIVTDFDGIEHRLEFVREFEGVKYYNDTASTIPDSTILSV
FT                   KSLRAYGGLINLITGGTDKELDFAIFGEILSIVKTWILLKGSATLKIIKFLEDNNINYF
FT                   IFSSLEECVCYAKKISVQNDIVLFSPASASFELFKNEFDRGLQFKNLVSIMA"
FT   gene            complement(610747..611796)
FT                   /locus_tag="BT0586"
FT   CDS_pept        complement(610747..611796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0586"
FT                   /product="N-acetylmuramoylpentapeptide-ornithine
FT                   N(5)-glycyltransferase"
FT                   /EC_number="2.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17910"
FT                   /db_xref="GOA:A1R018"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1R018"
FT                   /protein_id="AAX17910.1"
FT                   /translation="MNIKKIEIENLNENYLQSKLWTTVKKVSSNKSPWKAIAFSNNHFN
FT                   KILVMQRKIFGKFYLSYIAHPEFSNKKIEEINVDEINIQIKKFSENIRQYLHKNTIFVR
FT                   YDLMFYTSRGLKEDYIPLKLKFKNLQKSFDDIQPANTTILNLNDSLDAIKAKMKKKTRY
FT                   NINLSSKKNIKVIIDDDFKYFDEFYALHKETAQRDKFAIHSKDYIRNLIKAFREDKNSK
FT                   IKLIIALYNEQLISGIIVGIYKDKATYLYGASSRENRNLMPNYAVQFKTIQMLQSLSIK
FT                   EYDLLGIPPNADTKHPLFGLFQFKTGFGGKLIHRIGCYDFVYKKFSYKVYSILEILRYI
FT                   YYKIIKKRF"
FT   gene            complement(611818..613998)
FT                   /locus_tag="BT0587"
FT   CDS_pept        complement(611818..613998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0587"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BT0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17911"
FT                   /db_xref="GOA:A1R019"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R019"
FT                   /protein_id="AAX17911.1"
FT                   /translation="MKKKNLITAALPYVNNIPHLGNLVQVLSADAFARYSRMMDIDTLY
FT                   VCGTDEYGTATETKALIEKTTPEELCNRYYAIHKSIYEWFNIKFDIFGRTTNKSHKQTV
FT                   QDLFLKLEKNGYITDKESEQFFCQQDQMFLADRYVTGECPNCGNNAKGDQCENCSKLLA
FT                   PIDLINPKCIICKNIPIIKTTKHLYINLPKIKNELIHWMQTTEHNTNWNTNAIKTTNAF
FT                   LRDGLKERAITRDLKWGIPVPKKEYENKVFYVWFDAPIGYISITKEISKDWESWWKNNK
FT                   ETNLVQFIGKDNILFHTVIFPAIKLGSKENWTMLGKLASSEYLNYEHLKFSKSAGIGIF
FT                   GNDVITTGISADIWRFYIYYNRPEKSDFQFMWDDFMERINSELIGNFSNLVNRVLTFYK
FT                   KFFGDKIDTIEIKEDFWKEINLKYDKTLNFFKQIELKSALKEILDISRIGNKIFQDKEP
FT                   WKTKDSTPKKTKELLLNLIYLIRDLSILISPFIPHTSDKIRRFFGESYEISNKFLGTNL
FT                   GLNTIQFTEVLFTKLEKELIDSLKLKYSGGKNMQDEQTENPINLFSEKVCLKVVQIKTI
FT                   ERNPDAEKLFILKLDDGTPDGKQIVSSLADYYKEEKLIGKHIIIVDNLKPAKFRGIKSE
FT                   GMLIATEDENKNFKVIIVEDFKDNPIPGERIILESDSDKKLKLPSKISIDKFLKTQIVA
FT                   ENGELKVNGINLILEHSKEKILSREIPNGKVY"
FT   gene            614125..615171
FT                   /locus_tag="BT0589"
FT   CDS_pept        614125..615171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0589"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BT0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17912"
FT                   /db_xref="GOA:A1R020"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A1R020"
FT                   /protein_id="AAX17912.1"
FT                   /translation="MGSFNFKNYVCDRAKKIVREKGDKASIVFPESTDVRILEATIDLL
FT                   KKKLAGLVVLIGRRDEVFRRLKEQSGSRDDILEMVKVVDPSSFKDFNRYLDEYFSLQHN
FT                   RKLTLKQAREELLDEIAFSMMMVRLGEVKTCVCGALVSSAKVLRSVFKILPKLKETNFI
FT                   SSFMIMDTGNDLGRAETCFGYEGILMFADCAVIINPNALQLAEIAIQSANSFKNIFNAE
FT                   PKIALLSFSTKGSANSIEVDKVKGALELVKSKCSDLLIDGELQIDAALVKGVAEKKCGD
FT                   SLVAGAANVLIFPSLESGNIGYKLVERLAFANAYGPFLQGLKNPVSDLSRGCSLDDIVL
FT                   TSALMIGS"
FT   gene            complement(615142..615978)
FT                   /locus_tag="BT0590"
FT   CDS_pept        complement(615142..615978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0590"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17913"
FT                   /db_xref="GOA:A1R021"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1R021"
FT                   /protein_id="AAX17913.1"
FT                   /translation="MNINYNSINSIKSALASKNIAPRKIWGQNYLINEHIREKIVDTLE
FT                   IKENENIWEIGPGLGAMTIILLKKTNFLTVFEIDPKYSEILNEQFGQFKNFKLIKGDFL
FT                   KTYKQERQNINKIFSNLPYNIASKVISMLIEDGILTHMVFTVQKELADRMLAKEGNKNY
FT                   SSFTVLVQSHFNVIKIMDIDKKNFYPIPKVKSTTLKLIPCKRVIKDFKAFNKLVRTVFI
FT                   SRRKKLKNTIINFTKDGSILEEDFLKRFLDKRPEEISVKEFITISNKLTTNHQGTR"
FT   gene            complement(616006..617283)
FT                   /locus_tag="BT0591"
FT   CDS_pept        complement(616006..617283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0591"
FT                   /product="COME operon protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17914"
FT                   /db_xref="GOA:A1R022"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:A1R022"
FT                   /protein_id="AAX17914.1"
FT                   /translation="MILLFIVSALNLLTRYYLRLNPIYLNLILMSIFLIKRNAHLSLTF
FT                   MISTSLLVIFEISLNFKRLEDNFYQITNITYFAKYSNTKIESIDGFGKKYKFIFKNIEN
FT                   KYKIGDIVKIQNNKMQLIKKPLLVNIREKYNKLINRFLNSISTKYSHFSKAILTNNKSD
FT                   ITKYESNLFQKAGISHILVVSGLHFYLIYIIFYYLLLIIKNEKLKYLILSTILLNYLIL
FT                   TGFSPSTLRAFIMIKTLIIYKSTYGKINLLSTLAISFIINAIILPHTLNSIGFKLSYLA
FT                   VLGISISLALNQRYNLNKLIYPIFTTLMIQVSTAPIFYVNDLNLQPISILSNLIVTPLM
FT                   LVFLIITILSLGSYIINAHLFLLLDLMNTYIFKAIKETAIIFSKFPVIQNYNVKIFLVL
FT                   SILTILYIIYKLEQEKRYLNKNIKHQ"
FT   gene            617398..618102
FT                   /locus_tag="BT0592"
FT   CDS_pept        617398..618102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0592"
FT                   /product="CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:BT0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17915"
FT                   /db_xref="GOA:A1R023"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A1R023"
FT                   /protein_id="AAX17915.1"
FT                   /translation="MTLLNKYPLRYVFLEVLLSYFIVTRISPFDSIDVDLWNFDKNHYY
FT                   YWLYSTFLILFVVYFSKLTSSYNFRDEFFIPEFNPIFIWQAFLIFVKLLICIFLLLIIF
FT                   CFILYCLPESVRVWVEVGNSGFMWNIGSKQSLYLMVITSLFTGGVEELFYRAFIITKLK
FT                   QIGITSLIAALLSSFIFAYGHFYYGFVGFLFALIFGGILSYIYLIHKNIYYSIFVHSFY
FT                   NIFVSVLLFLLN"
FT   gene            618116..620047
FT                   /locus_tag="BT0593"
FT   CDS_pept        618116..620047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0593"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BT0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17916"
FT                   /db_xref="GOA:A1R024"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1R024"
FT                   /protein_id="AAX17916.1"
FT                   /translation="MLDTIPKRFNEVVRLYGDLDIFIYKENESKDFKRQIYSDFWNEVK
FT                   SIGSGLLHYRIKKGDRVALISDSRKEWIIIDIAVMSLGCIDVPKGNDSSEDELVYIINH
FT                   SESSFVFVENAKQLQKIISKKHELKFVKHVVVIDDDKLYEDKLGNITIISYKKLLSLGY
FT                   DYLKDNPKMFDSELEKVSGKDIATIIYTSGTTGLPKGVVLRHESFIFQVDRIGDYLPTI
FT                   KPGKIMISILPLWHSFERTCEYIVALNGMAIAYSKPIGPVLLKDFAALNPHAIISVPRI
FT                   WEGIRIGIMKRVSESFFKRFLFNFFLKIGILYIKLKEKFLGLVPVYKRSNFLVSIFIKV
FT                   ACLTGLIFILPFKFLGHVLVFRKIKKALGKRFEFGVSGGGALVNYVDYFFKAVGIMVLE
FT                   GYGLTETGPVLSVRRFKSPVANTVGPLFPDIEYRVVGNDGNFLSPGEKGELWVRSPQVM
FT                   SGYFKDDTTTREVLTRDGWFKTGDLVCATINNEISIVGRSKDTIVLRGGENIEPESIER
FT                   ALSKSLFIENVVVVGQDQKFLGAIIVPNFEVLEKWAGSNEIIFDSHDDLLSNESVNKLY
FT                   SKCISDIVNLKSGFKSFERIVGFVLLKDSFVVGEELTNTLKLKRYYIFEKYHKKIMSIF
FT                   NKDDCELL"
FT   gene            complement(620078..621832)
FT                   /locus_tag="BT0594"
FT   CDS_pept        complement(620078..621832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0594"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BT0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17917"
FT                   /db_xref="GOA:A1R025"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R025"
FT                   /protein_id="AAX17917.1"
FT                   /translation="MISKIKKDLENKISKTIKELALKQNITLDKINIIMKKPPKSELGD
FT                   LSILIFEFSKILKLSTSVIIEEIIKQIGKKYTTKSMGAYLNIKFNRKEYIKDIIKKVNE
FT                   QKEKYGINNVLKNKRIIIEFSSPNTNKPLHVGHLRNDIIGESLSRILKASGGQVTKINL
FT                   INDRGTHICKTMLAYKKFGNNTTPELSLKKGDHLIGDFYVKYNEYAKNNKMAEDEIQQL
FT                   LCKWEEGDEETVKLWKKLNKWAIEGIKETYKLTNITFDKIYLESEIFKIGREIILQGLE
FT                   KGLCYKREDGAICINIPIETNEMTDQKFKQKVLLRANGTSIYLTQDLGNILTRKNEFDF
FT                   DEMIYVVGSEQIHHFKTLFYVADKLGITKENNLVHLSYGMVNLPTGKMKSREGHVIDAD
FT                   NLIHDLSESTMIEIKKRHSNEQDSKKIALNISLGAIHYYLLKTAIHKDILFNKEESLSF
FT                   TGNSGPYIQYVGARINSILDKYDELNLPSKNINFDLLINENEWAIIKIISEFEEYIIKA
FT                   AKDRNPSIIVNYSYLLAKSFSAYYQDTKIIDKDNPELTHARTDLSKAVLQTIKNCMHLL
FT                   NIPYMKKM"
FT   gene            complement(621822..622415)
FT                   /locus_tag="BT0595"
FT   CDS_pept        complement(621822..622415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17918"
FT                   /db_xref="GOA:A1R026"
FT                   /db_xref="UniProtKB/TrEMBL:A1R026"
FT                   /protein_id="AAX17918.1"
FT                   /translation="MNNKTFYITDRYLKTSLMLFPIFAYTKNFLEGTIISIWISLCILL
FT                   PAIIIKQIELRNQILGIYLLIIGIVVSLTYLFMYYITPILYENLRFSIPILTVIIISFH
FT                   KNEPFKSVKDSLSILQYSKLPIITFISLSATISLFREILNTGGLQLFNIKLSIIKDGNI
FT                   IKTPVYSSNIFLAASLIFLLINILINIKGKKNDQ"
FT   gene            complement(622431..624659)
FT                   /locus_tag="BT0596"
FT   CDS_pept        complement(622431..624659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0596"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17919"
FT                   /db_xref="GOA:A1R027"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A1R027"
FT                   /protein_id="AAX17919.1"
FT                   /translation="MRIQVKRNHSSSTLFYKFNIVIVIYTMIIATTIFLLLDHGYRKII
FT                   TKELQSFTKFVNNIMIKSFSRDTRNMLIAIDDFVKNYNQNLNTQKSDHLNNVISIDQLS
FT                   LFPSYIKIIEYTNKNGKILYSSDERRLNTYINLQEMKTDSNIDNYHTVILNQDLTIINN
FT                   KSYIPMLYKIPQQDQNDLYNTSNANIKSEKNMSINHDGYVVLYADILEQIKQLRKNIFM
FT                   LLERSLLEKGNQHKSSHYFKIYAINSQGDIFGEQDEETLKPIKLSLNSLFENNPKITTP
FT                   LLNAIAQRKSNYNTSYNNNIISITRLTSSSWYLAIQMNYNNIFSNELNNIKLMSISTII
FT                   LLVIIFILIMIITIKKLIISKIEKLNKIIPKVKEGDLTIKIESKGKDSISATINYFGYF
FT                   IENLKNVINSLQGRVKLLKENGDLLFNEINKAYDTITNSNKYIEKTQGEIEKQVEFISN
FT                   TTNTIENLSKNIASLDNSIETQAASVEESSSAIEEMIGSIQSVTEITQKAAKSTEELKL
FT                   FSDDGRKKQEEIIMQIKDIYKNSTRLQEANALISSIASQTNLLSMNAAIEASHAGEAGK
FT                   GFAIVAEEIKDLAEQVTSQSESVAASINEIMDSINQTVKTSELTNKAFNQIFNSINLVV
FT                   QVIEEINHTMQEQSIGSQEILKALNTMREITYEVKIGSNEMFRGNKEIINTVSVLEEIN
FT                   VTVSNSMKGLKEEIKKLIEAVESIKTFGTTNSNHITEINTDTNQFKTK"
FT   gene            624857..627055
FT                   /locus_tag="BT0597"
FT   CDS_pept        624857..627055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0597"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17920"
FT                   /db_xref="GOA:A1R028"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A1R028"
FT                   /protein_id="AAX17920.1"
FT                   /translation="MNEDLVNVKLKNMSFLLYFILFIFICFGLLFLGQAYLNYKSGYLE
FT                   RVESDFKLFSNNVAFQIKNKYDGAVGVLKNLVENDRVLNVLHNVSNSFIASVDLRFIDL
FT                   DTSIALFLSSKGFNEVSKIFQHIPLEENSLEGIFYIPVGQNVLISNKNFSFLGINNIIE
FT                   DPIYFVPAKKHVTYYSSYKRIKNRLYSVVSIPVMNDSSAILGVICFLVCFDNLFIDIAN
FT                   QFDSYLKFSNKNYEFFMIDREFNPLLMSLNDLSTDNFAENYASSVLSRVISHVKDNPNI
FT                   SRDILKHKTSSYVLSTAQIDGSVVQGIILNMDYLPFKFQSNAIFFLGFIFFAYLIIFYL
FT                   YNRFILPFIGDFRMLLKYKKEREDILSLDPILEVQYKSFIFSYISAEFDNFFSKTTNIV
FT                   DSIKVYVRNLRKCLTEINIPEENIEKVHNSLTTYDKIGDAFSKFEKSIVNILKDFESIS
FT                   NPISDHNKNILDIATQFEENANAFYGIDKNLEIFSKVVALNSTSIDDVKNKVFELNSIF
FT                   ENVNKNFSELLSQTNSLQSANKLLVLISAQTNMLAMNAAIEAAKAGDAGKSFAVVAEEI
FT                   RKLAINSGKYSTTIKDELKMVNNIISVVSSEIDAIYKDFIDIQENIHNNAVQHERINIT
FT                   LAKHVKEIEEFKDKYLSYDIKIKDTKNMCKEIFNSYFVISGKFNNLNNDLSEFEVSKMS
FT                   LDALEPLREHVSLVNECREKVAKMKDVVENINNEFWDK"
FT   gene            complement(627057..627974)
FT                   /locus_tag="BT0598"
FT   CDS_pept        complement(627057..627974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0598"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:BT0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17921"
FT                   /db_xref="GOA:A1R029"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A1R029"
FT                   /protein_id="AAX17921.1"
FT                   /translation="MLKNINNFLEKINIKPKTENLANHTTYKIGGISKLFLTPKTIKDA
FT                   EHIFKVAIKEKVKIFILGGGSNLLINDEVEIDFPIIYTGHLNKIELQNNQITAECGTNF
FT                   DDLCHFALQNELSGLEFIYGLPGTLGGAIWMNARCFGSEISEILDRVIFVDENGQTICK
FT                   KLEKSEFSYKISPFQNKNTVILKATLNLTKGNKKHIEEIMKQNKQKRIDKGHYLSPSSG
FT                   STFKNNKKFLKPTGQIIEECNLKGLNIGGATVSHYHGNFIINKNNASSKEIKTLIEKVK
FT                   TEVQIKTGFLLEEEVIYIGFNDKN"
FT   gene            628182..629627
FT                   /locus_tag="BT0599"
FT   CDS_pept        628182..629627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0599"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BT0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17922"
FT                   /db_xref="GOA:A1R030"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R030"
FT                   /protein_id="AAX17922.1"
FT                   /translation="MLLRLYNTKTKSLSEVKNFSDIKVYACGPTVYNYAHIGNFRTYIF
FT                   EDLLIKSLRLLKYNVNYAMNITDIGHLTGEFDEGEDKVVKAARERGLTVYEISRFFTEA
FT                   FFCDCEKLNIVRPDKVLIASEYIASMIEVIKVLEQNGFTYFVNGNVYFDTSLFKSYGQM
FT                   AGINLNDFEFSSVSRVEVDPSKKNKSDFVLWFTNSKFKDQEMKWDSPWGFGYPSWHLEC
FT                   AAMNLDCFRSTLDIHLGGVDHIGVHHINEIAIAECYLNRMWCDIFVHGEFLIMEDEKMS
FT                   KSNNNFITIQDLETNGFSPLDFRYFCLTAHYRTQLKFTFNNLRACKVARKNMLNKLTAV
FT                   FSSLNQFDLLLLSKNYENIESVLEKRYYDSFLEKIAFDLSIPQALALLWDIIKDDNLSA
FT                   LSKLRLTFKFDEVLSLGLKEGVFREIEKDRINIDDAMNSLLEERRLAKIRKDFKRADEI
FT                   REYFYSKGFVLIDTEEGTKVKRG"
FT   gene            629631..631181
FT                   /locus_tag="BT0600"
FT   CDS_pept        629631..631181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17923"
FT                   /db_xref="GOA:A1R031"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A1R031"
FT                   /protein_id="AAX17923.1"
FT                   /translation="MAVFFKSQYFVLSLVFLIFLSLFIFSGFLFYLKPVIYEISPMPAS
FT                   HENVIVIKGRNLGDKIGEININDHYLMKSSIVSWSNEKIVFKITDEINSGLVFIKSEKG
FT                   ISNELFLVISRQVPIKLEKKNKPFLFVTDELVLMTNVPVILRGKNLVSNFAGVEIFIQT
FT                   KHELYKVLPRDILKLSEEEIKFIPPKTLHIDGEIFLQVDGVESNKIPFNFNINFFKWNL
FT                   KRTRNFKISHEIYFVQAYSKDLSLTSDDINFNVFYLNPIENERQKIKFSDNNGAILDLD
FT                   NLFFKSLKSNTYHLKFEVETCKLDLDIFDRKALESIKVNTDSNMYEFKTYVLNKRDRYL
FT                   SYDSLDLSSINLNVNNKDSAYELAKSIIDALILHFTVIDNDLTLDESIKVREISADNLI
FT                   LLTNLLFLRNNIPLRNAVGLYFDTRSSSLKEHTWCEFFLEHIGFIYFDIVNAVLFRDSS
FT                   NYFLSMSENYIQYGYKEDYDDLLFDDYFDLLLLKYKSLTNSNYSLNYRITLEENINDR"
FT   gene            631171..632424
FT                   /locus_tag="BT0601"
FT   CDS_pept        631171..632424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0601"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17924"
FT                   /db_xref="GOA:A1R032"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R032"
FT                   /protein_id="AAX17924.1"
FT                   /translation="MIDSILFDLIEREAKRERENIELIASENFVSLGVRQAVGSILTNK
FT                   YAEGYPSKRYYGGCFVVDDIENLAISRAKELFGASYANVQPHSGSQANMAAIMALIKPG
FT                   DKILGMELSHGGHLTHGSKVSFSGMLFDAYSYGVSRDSEIIDYDDVRRIARECRPNLII
FT                   AGASSYSREIDFKKFREIADEVSAYLLCDIAHTAGLVVTGFHNSPIDVAHLTTSTTHKT
FT                   LRGPRGGLILAGKESSMIVNFNNKERTLENAVNSCVFPGTQGGPLMHVIAGKAVAFGEA
FT                   LMDEFKDYISSVIENTKAMAEYFVSEGFRIVSGGTDNHLFLVDLGILGITGADAEKVLE
FT                   SVNIILNKNIIPFDSKNPSVASGIRIGGAAITSRGLNRDDSIEVARFIIRALKTKSDYE
FT                   LKKIKCEVVEFISSFNMP"
FT   gene            632451..633200
FT                   /locus_tag="BT0602"
FT   CDS_pept        632451..633200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0602"
FT                   /product="DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17925"
FT                   /db_xref="GOA:A1R033"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1R033"
FT                   /protein_id="AAX17925.1"
FT                   /translation="MSNLFQIFFLLLSFILIFSPFILSMFFIFFVFFIITSILGGFRTY
FT                   TTRDYFYSKSRELEFYKLSCLLMAKLISILGSMTGEQLNYINFIINSLNLSEKHKTELY
FT                   NVFHFSVTQNRNADKILYTLKLGYFQHRDLFVWLVSVLKEINNLARYGNLEGDKFIRYV
FT                   SAFLEIDFENHDAYKNINIEIVNPYEVLGLRYNASDDDIKKAYKKLVIQYHPDRFASEP
FT                   IKQREANEKFIKIQDAYEKICKERNLK"
FT   gene            complement(633305..635098)
FT                   /locus_tag="BT0603"
FT   CDS_pept        complement(633305..635098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0603"
FT                   /product="p66 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BT0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17926"
FT                   /db_xref="InterPro:IPR020967"
FT                   /db_xref="UniProtKB/TrEMBL:A1R034"
FT                   /protein_id="AAX17926.1"
FT                   /translation="MNKTILLCIFIFILTTVTVFADDTDKDISKSNPWSPKLTFENSSE
FT                   FRFDMDESIPGLENKSQLGIKFVPYETHNEIGKHDPFSAYIKVEDLVLKAKGKKDAILK
FT                   LDVGSITTQINIYDFYLKIESMTDFDFNQESLFSFAPMTSIQSEYYGFPSDDCATRRTI
FT                   LARSTAKTIGTLQFGYTFPQLELVLAIGATGTGNRNYKKNANDSEEDKKKKDETPYNNT
FT                   YQGILYGTKVKWTPMKNELAQYSSDVIAEIPFELHFGLSGAIGNSTFNHSSITYGLKDK
FT                   SVVGSDLVSPTLSNASIMASIGFTYKLGLTKINDKNTYLLIQTGSDVGIDPFASDFSIL
FT                   GHISRKANTDDKDQFNPTENKLKFDNKRSTNFAFSVGTGIGLAWNTDDGEQESWSISGD
FT                   NSYNTRIFGTQNKKSGIGLGITYGKNLYKPTSSNKIIQDIAAKSFQTFNAEISTYEDNT
FT                   KGIIPGLGWIASLGIYDLLKEQPQSNDIITILTPKTNTQTQTQTVAFTEATKIGGALYI
FT                   DYAIPVESISPTTHIIPYVGTHILGSFKGSDKSIYLKAGVELDNLIKLTKISLGWDSNN
FT                   LFATKDQMGSVFLQFAVAFNE"
FT   gene            complement(635298..636833)
FT                   /locus_tag="BT0604"
FT   CDS_pept        complement(635298..636833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0604"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BT0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17927"
FT                   /db_xref="GOA:A1R035"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A1R035"
FT                   /protein_id="AAX17927.1"
FT                   /translation="MVNLKRSTHLIMNFYDFIKALVPITLIIIGLGIIKKPAYYVIPIC
FT                   LIVTIAITLFDKNLGIINTSLAIFEGTIMGIWPIVIVIIAAIFTYKMAESQNDMKIIKA
FT                   MLSNVSSDKRIIVLLVVWGFGNFLEGVAGYGTAVAIPVSILMAMGFEPFFACLICLIMD
FT                   TSSTAYGSVGIPIISLSQATGLDVNMLSYDVSLQLILPTLIIPFVLVMLVGGGIKGLKG
FT                   GMFILTLLSGASIAISQVYVSKTLGPELPAILGSIPAMAITIIYAKLFANKDTINNNIK
FT                   VSAMQGFLACLPYILIVSLIIIVSPLFYGINKYLSNFKTTLSIYPGANPLQFKWLTSPG
FT                   PLIILATVVSYSIRGVPIIEQLKTFVLTIKKMALSSFVIICIVSISRLMTHSGMIKDLA
FT                   DGISTLTGTLYPLFSPLIGALGTFLTGSDTVSNVLFGPLQTQIAANIDVNPYWLSAANT
FT                   TGATGGKMISPQNITIATTTAGLIGQEGKLLSKTIVYALGYIFISGILVYFLL"
FT   gene            636885..637823
FT                   /locus_tag="BT0605"
FT   CDS_pept        636885..637823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0605"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BT0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17928"
FT                   /db_xref="GOA:A1R036"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A1R036"
FT                   /protein_id="AAX17928.1"
FT                   /translation="MKIIPVILNILILSSVFGELFSIDLLEIKKVTEDAKSVVLIDYDT
FT                   KCILYSKNPGLVFPPASLTKLVTIYTALVEARKKNIDLKTTVPISSAASYYNLPLDSSL
FT                   MFLEEGHKVNFEELLKGLIISSGNDAAIAIAEFIVGKNLSDFVDLMNINVLNLGLINMS
FT                   FVDTSGYSSDNKITALEMALFARTYIEEFEFILDIHSLKDFIYPRSENLGNTSSLKMLN
FT                   FKQKNKNVLIFNYPYADGLKTGYIKTSGLNLVATAKKDDIRLIAVVLGVNKGVDNVGER
FT                   KRALIAQKLFEYGFGNYAQFSFIGKIKRKDL"
FT   gene            638079..638570
FT                   /locus_tag="BT0606"
FT   CDS_pept        638079..638570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0606"
FT                   /product="chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:BT0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17929"
FT                   /db_xref="GOA:A1R037"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R037"
FT                   /protein_id="AAX17929.1"
FT                   /translation="MLNHFNFKLKRDVTIIVPGEAFVSNDRVISTILGSCVSVVLYDGV
FT                   RRLIGVNHYVLVKSDSVVDVLQKGRYGVYAIPMLIDAMIENGASKSNLKAKLFGGANFM
FT                   AKGTIRVGVENSEFAVNSLTKYGIPVVAQDFDQSKSRKIFVFPENFKVVVEYPDGAKIF
FT                   "
FT   gene            638846..640267
FT                   /locus_tag="BT0608"
FT   CDS_pept        638846..640267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0608"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17930"
FT                   /db_xref="GOA:A1R038"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A1R038"
FT                   /protein_id="AAX17930.1"
FT                   /translation="MENVVIRYFRAISQIPRCSQNLKGISNFIKEEARKFGYSFKEDSI
FT                   GNIVVEIKANGCSNMFPIILQAHTDMVCEKNESVVHDFEKDPINIIEDNGYFVASGTTL
FT                   GADDGIGVAMMLAIMSESSTFKHPALELLFTVDEEIGLIGAIGLDPNLCSGKMLINLDG
FT                   EEEGYFLVGCAGSRLVHINFEPQYRQNRKKTGIEILFTGLKGGHSGADIHIDLANSLKL
FT                   MFFALSTLRANMEFEIGYISGGDKSNAIPREAKALILIEAEHYVLLEKELKSFKRHMQE
FT                   MYTFDSDFEIILRRVNFSGDVLDDMDQDKLLNMGMAFLHGVQKVENYGEKLIRTSLNFA
FT                   SLLKVGNEYQFVFTIRSLLDIEKEYVFNHLKAISSLSGANFKIVYDYSSWKPAENSKLL
FT                   NHLKNVYKNMYLEEAKTVVIHAGLETGIISAKFGGIDSVTIGPWINAPHTPREQVDIAS
FT                   TIRVYNFLKKSLETL"
FT   gene            640368..640441
FT                   /locus_tag="BTT0018"
FT   tRNA            640368..640441
FT                   /locus_tag="BTT0018"
FT                   /product="tRNA-His"
FT   gene            640460..640533
FT                   /locus_tag="BTT0019"
FT   tRNA            640460..640533
FT                   /locus_tag="BTT0019"
FT                   /product="tRNA-Arg"
FT   gene            640591..640671
FT                   /locus_tag="BTT0020"
FT   tRNA            640591..640671
FT                   /locus_tag="BTT0020"
FT                   /product="tRNA-Leu"
FT   gene            640678..640749
FT                   /locus_tag="BTT0021"
FT   tRNA            640678..640749
FT                   /locus_tag="BTT0021"
FT                   /product="tRNA-Gly"
FT   gene            640798..642144
FT                   /locus_tag="BT0610"
FT   CDS_pept        640798..642144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0610"
FT                   /product="trigger factor, ppiase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BT0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17931"
FT                   /db_xref="GOA:A1R039"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R039"
FT                   /protein_id="AAX17931.1"
FT                   /translation="MILNNDVKLIPGSKVEAVIRISKKFVKSKYNEILQDYSSRLKVKG
FT                   FRIGKVPFSIIEGKYSDNIRALTIEKLIHKSLEEFFKSATYKPLGYAVPKILDEKLEID
FT                   FSKDFEFTVVYEAYPEFELPDISNVEVEIPEVFVSDSDVEEELKLLQLENAIVVEDSGD
FT                   VKSGSIVRVDFVELDDSLSEILTTKRQDFVFTVGESNNYYGFDNDIIGMKKDEEKIVEK
FT                   NYGMDYKFSELANSFKRLKISLKDIKRRDIPKLDDDFAKDIKDSFNTLEDLKEHIRENM
FT                   LRLVKERSESLKLSKLLSDIAEKLNIEIPSSMFEAEFKNVLNEFSHQNKINLEQLSNSS
FT                   TGLEGINDVFKENVLKKLKSKLIFQKIVDNDLTEVTDSDLEDELVKQAEDAKMKLADIK
FT                   KFYQEKNLLEILKDEIKRQKVKDKILKNVKEINPKKVAFRDFINYKTGE"
FT   gene            642144..642743
FT                   /locus_tag="BT0611"
FT   CDS_pept        642144..642743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0611"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:BT0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17932"
FT                   /db_xref="GOA:A1R040"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1R040"
FT                   /protein_id="AAX17932.1"
FT                   /translation="MIREYMHNLVPTVVEHTGNYERVFDIYSRLLRDRIIFLSGEINDV
FT                   RADTVIAQLLFLESEDSKKDIYVYINSPGGSITAGLAIYDTMQYIKPDVRTICIGQAAS
FT                   MAAFLLAGGAIGKRESLSYSRIMIHQPWGGIGGQASDISIQANEIIRLKRLIIDIMSDK
FT                   IGVSKEKLSLDIERDYFMTPKDALDYGIIDGILVRN"
FT   gene            642749..644056
FT                   /locus_tag="BT0612"
FT   CDS_pept        642749..644056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0612"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:BT0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17933"
FT                   /db_xref="GOA:A1R041"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:A1R041"
FT                   /protein_id="AAX17933.1"
FT                   /translation="MWVRFDMARSKSQKIEGCSFCGRTKAEAEGRIISAKSVAICFECS
FT                   KICHNLFKEETEKPVRPKSSRGLPTPKQLKSHLDKYIIGQEDAKKVLSVAVYNHYKRIF
FT                   KGNKRDNGVELEKSNILLVGPTGSGKTLLAKKLAAEMNVPFAMADATTLTEAGYVGEDV
FT                   ENILLKLIHAADGDVSFAERGIIYIDEIDKIAKKGENVSITRDVSGEGVQQSLLKIIEG
FT                   TIANVPPKGGRKHPYECTIEINTQNILFICGGAFVGLENIIKKRINKSSIGFSSAGRKD
FT                   SGEINSLKYLEMEDLVKFGLIPEFVGRLPVHSYLEKLEKEDLIKILIEPENSIVKQYCH
FT                   MFKMDNVDLLFERDALDAIAEEAMLKNTGARGLRSILEELLKDVMFEIPSTKQIKKVIV
FT                   TKESVLSSNIEPLILTGRHANKPWAKELYEINSQSN"
FT   gene            644001..646436
FT                   /locus_tag="BT0613"
FT   CDS_pept        644001..646436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0613"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:BT0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17934"
FT                   /db_xref="GOA:A1R042"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R042"
FT                   /protein_id="AAX17934.1"
FT                   /translation="MLISLGQKNFMKSILNLISSKKDDLPVIVLRQNVFFPNVTLWVNC
FT                   DDSISINAIYQSMLEGRLILFFCVNDLNSDNSSKISLENLYSIGIYAKIIQVVKVTEIL
FT                   IKILVTFQDRVIIKSIVKKNNYFRAKVDFISDKCEFNNELFTYSKFLREAYDTYRSYLP
FT                   VKKLDNDESNDFFDSPAKLVDVIASNVNLEYKVKVELLQELDVKLRIEKLIINLNIETE
FT                   LLILKKDIKAKVKTKLDKGQKEYFLNEQIKEIQKRLGRDETDYLERLNSKNIPENIKSR
FT                   IEKEISRLTRVNTNSPDANIVRNYVELLLDLPWDENTVMKNSLREIELILRNSHYGMYE
FT                   TKEKIMNFLSVYHINSKVQAPILCLVGPPGTGKTSVALSIAKSLSREFTKISLGGLRDE
FT                   TEIRGHRRSYVGALPGVFINAIKVAGKSNPVILLDEIDKINSTYKGNPEAALLEVLDSE
FT                   QNSRFVDHYLEIPYDLSNVLFVATANSLHEVSRPLLDRMEIIKIEGYSCVEKLEIAKNF
FT                   LIPNIIKDSCLNNVYIKIEDDVVLHIIRNCTMESGVRNLKRVLTNLFRMVVRELLYVYS
FT                   REDIIKGNFYFPSSLMHGNNLLFTHDPDIPGIYKIINMNNFHFYVNCEYKFNLIRIDSS
FT                   GFVYGLAWTSYGGAVLPVEAIKFDKKGDIILTGSLGSVMKESAQLAYSVVKTYSSELNF
FT                   DINEIPEIHLHFPEGATPKDGPSAGITIATAIASVLSDKRVPLDLAMTGEVTLKGSILP
FT                   VGGIKEKVLAAYRNGINKIIIPKDNEKDYVKLPEDIRDNIDVKYVSNLGEVFNYLNII"
FT   gene            complement(646652..647278)
FT                   /locus_tag="BT0615"
FT   CDS_pept        complement(646652..647278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0615"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:BT0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17935"
FT                   /db_xref="GOA:A1R043"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R043"
FT                   /protein_id="AAX17935.1"
FT                   /translation="MNRKNIAKGKLVRRFGVNIFEQPKYDKLLKKKPNAPGMHGRSRRA
FT                   KITEYGKQLIEKQKVKFTYGVSERQLTNIFKESRRQHGVTGDNLLALLERRIDNVVYRA
FT                   GFAISRAHARQIVSHGIIMLNGRRVTIPSITLRANDMIQVKEKDRLKKLVRSNIEKTST
FT                   LRKLPTWIEVNADDLNVKITRPPSRDEIPTLANEQMIVEYYSKRA"
FT   gene            complement(647299..647372)
FT                   /locus_tag="BTT0022"
FT   tRNA            complement(647299..647372)
FT                   /locus_tag="BTT0022"
FT                   /product="tRNA-Met"
FT   gene            complement(647428..648726)
FT                   /locus_tag="BT0616"
FT   CDS_pept        complement(647428..648726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0616"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17936"
FT                   /db_xref="GOA:A1R044"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A1R044"
FT                   /protein_id="AAX17936.1"
FT                   /translation="MIKIINNKNINKCTNLKLASLKKDEIYIIYTENNVEMVSYLKAKI
FT                   QNKEIKINNFYIDPNFKAEGIERVLIHNLIYYGKKNKLQKILCKINDIKEELKNLGFEN
FT                   NNNIYEKDLTYETKKNTLIIRIGLISVLAEVASITSKLTVGILFNSFALIADALHVTSD
FT                   FILSTITYFSLKITNRPETIYYPYGYKKMENLIAFIIGLIIIISGFTMFLGTTGLNKLM
FT                   NFRNESGLHIHNHGYDHQEYDHYHEDKKNILEIFSNNSLKKSIWIPLIPFIFFLVKIIE
FT                   YLVKFQIGKRYNNYLLLALSSSDKNCIFSHGGTTLSLLLANYVWTGFDKIISICISFIM
FT                   IKEGLHVIINNANKLLSKQDIDLKRKIKNTLKNINVNFKELNLFHQGNDLSLHVKLDLS
FT                   YENDLKSLIQKKEKIKYTIKKYHKEICEIYILI"
FT   gene            648827..649210
FT                   /locus_tag="BT0617"
FT   CDS_pept        648827..649210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17937"
FT                   /db_xref="UniProtKB/TrEMBL:A1R045"
FT                   /protein_id="AAX17937.1"
FT                   /translation="MGGMFMLQSQFFVKRCKRAISKEEVLINNVKNVEHVFYNFFKIFD
FT                   EKALKSVFDYYYENFDFDEGIYAFIDKFIPIINFLSLEVLDYEFSIDEKKLILEVFDSS
FT                   ACTLKDDTLSEFARAIVSLGILD"
FT   gene            complement(649244..649699)
FT                   /locus_tag="BT0618"
FT   CDS_pept        complement(649244..649699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0618"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:BT0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17938"
FT                   /db_xref="GOA:A1R046"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A1R046"
FT                   /protein_id="AAX17938.1"
FT                   /translation="MKDNEQNAIVKAFQLAETARNNAYSPYSKFKVGACIKTKDNLFFQ
FT                   GSNVENASFGATRCAEQAAIMNMISSVGIQKIDFMLITTTPASVPCAICRQVMSEFFEE
FT                   NTKILMTDPNQFNATKTISQTYTLKDLLKIPFNKEELSRIFKANQET"
FT   gene            649830..650789
FT                   /locus_tag="BT0619"
FT   CDS_pept        649830..650789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0619"
FT                   /product="phosphoesterase, DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17939"
FT                   /db_xref="GOA:A1R047"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A1R047"
FT                   /protein_id="AAX17939.1"
FT                   /translation="MIDVIEFIKKYNNFIIIGHKDPDFDCIGSSLALASFLSRIGKRVI
FT                   MLNEGPFVRKEIIPFKDKFLSKWPDIDSSDYAVIILDCSIFDRIGDEFGFYVKDMPILV
FT                   IDHHASGDKLDVPGYIDSFAPSTTFLIEKLIRKFGYEVTKEEAWYILVGFCTDTGFFRF
FT                   ISRSDPEPFEMVARLVSKGLSLKDVYNYIESVKSLTSIDMLSVMLNNLKAYFDGKVLLT
FT                   ILPFNSKKDNNVSGVNELFYALLSNVENNEILIILKETEDGSILVGLRSREYFDVGELA
FT                   KYFGGGGHKHASGFKIKNSSLNLLESQIISYIKDAIKA"
FT   gene            complement(650779..652434)
FT                   /locus_tag="BT0620"
FT   CDS_pept        complement(650779..652434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0620"
FT                   /product="beta-hexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:BT0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17940"
FT                   /db_xref="GOA:A1R048"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A1R048"
FT                   /protein_id="AAX17940.1"
FT                   /translation="MKKIVCIAIFFIHNNCFAYNFWTTEDKEKLIDNIVSQMDDKELLG
FT                   QMFMISYPKEQITKFVLNFIKEKNLGGIKIFGWNAKNLHTLIESINKAQSMSQNNRFKI
FT                   PLFIATDQEGGWTQHIKLKTSKTIGNLGITATLSPNDSYLTGYHIANELRQLGINLNFA
FT                   PITDIYSNEENFTIGPRTYSNNPQIVSLFALAFYKGQKQAGIISTAKHFPGHGNTIVDS
FT                   HIKMPIINSNLKEMQSNELLPYKILIQENIPMIMSGHLAYPMLTNGKEIPASSSIKIIK
FT                   ELLRKKLKYDNLIITDDLLMNAVRYNNESIYDTIERIIRTETDILLISLNENIQNNAYN
FT                   KLLSLMQKDSEIRENIIKSNKRILRIKLEYLKERKNETEIYSNHKKVQAIPTKEAKNFF
FT                   EQSTLRGITKIKLSKQVSKHKKTLLISPYNTMIKEGKKIFQNSSGYYYDYYPLNNMNPT
FT                   KLKEIKKLIEKHEQVIFNLSTPASQQYIENLKEYKDKISIIVSLTPQYIKNLDWIQNIV
FT                   IVYGTTILSFKSGFLTLTEDFNPKGKSPLINFKP"
FT   gene            652770..652843
FT                   /locus_tag="BTT0023"
FT   tRNA            652770..652843
FT                   /locus_tag="BTT0023"
FT                   /product="tRNA-Met"
FT   gene            652860..653405
FT                   /locus_tag="BT0621"
FT   CDS_pept        652860..653405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0621"
FT                   /product="4-methyl-5(B-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BT0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17941"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1R049"
FT                   /protein_id="AAX17941.1"
FT                   /translation="MRVAIVLANGFEEIEAIIPMDILKRGGVDLKVISLSDDKVVSSSR
FT                   GFTFYADEKISDYSEDHFDLIILPGGMPGAVNLFESKDLDKILRNMNLQGKLIAAICAS
FT                   PAIVLSAKGLLGANKFTCYPGFENDITDGEFVDEDVVISNNFITSKGVGTALEFAFTLL
FT                   KIVKGERVLEDVKKQVLL"
FT   gene            complement(653552..654766)
FT                   /locus_tag="BT0622"
FT   CDS_pept        complement(653552..654766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0622"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17942"
FT                   /db_xref="GOA:A1R050"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R050"
FT                   /protein_id="AAX17942.1"
FT                   /translation="MKILTINTGSSSLKFTLYKHKNTQILVSGTIEKIKTKKSIIKIKT
FT                   KNGLLEKTDKHIKSHKEALKQLIRILTNKKLKIIENPDEIQGIGHRIVHGGPSFKNSTI
FT                   LNTNTLSELKKISKLAPLHNPIAIKVIEITLKIFPNAKQVLCFDTSWHKTMNENAFLYA
FT                   TPYSWYKDYNIRKYGFHGLSYSYITKRVATILNKPKEDLNLIILHLGNGSSINAVKKGL
FT                   SYDTSMGLTPLEGLVMGTRSGDIDPAIIPLMSKLLNKTPKKIEEILNKQSGMLGISLKS
FT                   NDLRDIWEGVKNNEYNSKLAVEIMAYRIKKYIGSYLAVLDFNIDAIIFTAGIGVTDYGI
FT                   RELSLKGFEKIGIEIDPQKNNLARDKHTESDISSEKSKTKILVIPTNEELTILEDTYNL
FT                   ITKPS"
FT   gene            complement(654783..658151)
FT                   /locus_tag="BT0623"
FT   CDS_pept        complement(654783..658151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0623"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BT0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17943"
FT                   /db_xref="GOA:A1R051"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A1R051"
FT                   /protein_id="AAX17943.1"
FT                   /translation="MNIEKELTARLNDNQNLKKIQQLIEKNLPFTIVGHEGFFKAFLIN
FT                   KIKEYSSSNKIILIVKNESISDELKDDLMQITDNIYELNYFSPLIYKDIGSKSKVFIKR
FT                   VKFLINFYENNPGIYIVSLKSLLSKIPTKENLFKNIYKIQTDTIINIENLESKLIKLGY
FT                   EKTMRVTLPGEFTIKSEIIDIHSFNKTEPIRISVKVDKIKEIKYFNPLTQLKKGTPISE
FT                   FAIIPKKEIIWNNENINKLKHHLKENEYKKLFEQIETKYNARAEEIFYPLIGDTYLSQE
FT                   INEDIPIINLEIPNLQEEIKKIYKEYEKLYSQAIESGKKTIAPKEIFINLSDLKLKTNI
FT                   FIVQTPANIKTKELIEFNIESERKFFSNITLAKEEIQNWLNNGFKVIIAAESNSQKEKL
FT                   KYIFKDLTKIKIEILKISSSLIINKEKIAIILESDIFNRRQKTNKAFESSKTKTIDSFI
FT                   EVEKNSHVVHINHGIGIFRQIKRIKTSLLEKDYIEIEYADNEKLFIPIEQTHLIQRYIG
FT                   NETQNIKLDKISSKTWEKKKAYAKKRIDAIADKLVELYVQRESSKGFQYPQDNEWQLLF
FT                   ESEFPYDETPDQLTAISEIKQDMMSLKVMDRLLCGDVGFGKTEVAMRAAFKAVMGKKQV
FT                   AILSPTTILTEQHFNTFKQRFKNFPINIAMMSRFIKKSKERDIIKKLETGEIDIIIGTH
FT                   KILSKKIIYKNLGLIIIDEEQRFGVKEKEKLKEIKISVDCLALSATPIPRSLHMSLIKL
FT                   RDISVLKTPPQNRIKIETYVEEFSELLIKHAIENELSRDGQVFFVHHNIQELDLIKAML
FT                   EKMVPYARIATIHARLQGDQIENIMHDFINKSYQVLLATTIIENGIDIENANTIIINNA
FT                   NRFGLAQLYQLRGRVGRSSQKAFAYFLYKENSSLNESAIERLRAISEFSELGTGFQIAM
FT                   KDMEIRGVGNLLGREQHGEIESIGLDYYLTMLNKAIEKRMGKNSKEDEITIEINYNGFI
FT                   PDSYINNEQDKISIYKKISKVQNKEENNKIRTEIYDQFGPIPKELNNLLILSELKLLAK
FT                   KLNITSLKEKNELLEIEYLNTKSIPAEKIMQIIKDNPTILKINPEYKNSVFLNLKHIKK
FT                   SEKINCIYKNLNLLL"
FT   gene            658249..659211
FT                   /locus_tag="BT0624"
FT   CDS_pept        658249..659211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17944"
FT                   /db_xref="UniProtKB/TrEMBL:A1R052"
FT                   /protein_id="AAX17944.1"
FT                   /translation="MKFRNLLFVISLMVVPFMLFPRDYKGLDFKIKFFNQSIYRVNSNV
FT                   SIEVSLSNSSDDLLVLEIGDVNTFGFDFDVTDTTNIKVKRSLEYVKDRAKNVAIPVRTL
FT                   SLRPNERFSVVMSLNQFVQFDKDGVYFVKGMFFPDISDPQKRVESNVITLFLKPKMDDV
FT                   AGKFDFSNLSSNREIQSILKRENLSPDKVVEYLFSALRLGEREKFFLYIDIESLILSDQ
FT                   NKSYLYKQELKSGSNNMLEEYKDYLWNDSNSAISKVPSKFSIIETTYTDSTGKVVSDVY
FT                   FEDGHFYVAKRYTFFLKKYDYYWIIYDYTVQNTGIKEKY"
FT   gene            659147..661216
FT                   /locus_tag="BT0625"
FT   CDS_pept        659147..661216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0625"
FT                   /product="autolysin"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BT0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17945"
FT                   /db_xref="GOA:A1R053"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1R053"
FT                   /protein_id="AAX17945.1"
FT                   /translation="MIIIGSFMIILFKILGLRRNTRPFIFKIKGLSIVLWIVSYFSLYA
FT                   DFKHEVVKGDTLYSISLKYKIPIKELKSANNLKSEHIRVGRILVIPNSSKVNKIITKKN
FT                   NRKPKLSKLDAKIHVVKVGDTIEDISKQYGIKEKELLAWNNLSSKLLKVGSKLNLDEPS
FT                   FLKPYIVKKGDSLSKLSVDFDISIEDIIRFNSLENKSLIIGQKLYLKRTSGNVNFHYVK
FT                   RGETLGKIAYIYGVTARHLVRLNGSKAINLKADSILDVSKVIEEDLPSSKSLQLKSENR
FT                   SSETFISHKVSVGETLYSIARKYGVLLEDLKSWNNLNGNSIFHNQELKIYDKSKGPVVA
FT                   NKELKEFVDKTSKTTVKAIANIVSAKSKKLNLNFSNVLDNRDVFDISALVVLEPKIPIF
FT                   EANGVFYYWYKPKKGSQPSEFYSEDWYSPLNAYKKASQLFKSFESLVQSRPVKNNSLKN
FT                   KLIIIDPGHGGLDPGAIVKARDGLKNEIFVVEDEYVYDIALRLYVYLKEYGANVELTIL
FT                   SPDHLIRDSVSANNTFVNVKNEVYNDYDLNKTDTVDSWINGTQEGLRKRLAVVKKFINK
FT                   YKNVKEQDVLYISLHSDNSVGAPRCMGFYYQSEDGKGFDAHSKSMIEKMTKGFKRTPYI
FT                   KGQNLYVLKNNVVKTKLLVEVRNLAFDEEAWAIRSSKLRDRDSKILADAILKVL"
FT   gene            661293..661364
FT                   /locus_tag="BTT0024"
FT   tRNA            661293..661364
FT                   /locus_tag="BTT0024"
FT                   /product="tRNA-Asn"
FT   gene            complement(661908..663176)
FT                   /locus_tag="BT0627"
FT   CDS_pept        complement(661908..663176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0627"
FT                   /product="probable M18-family aminopeptidase 2"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17946"
FT                   /db_xref="GOA:A1R054"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:A1R054"
FT                   /protein_id="AAX17946.1"
FT                   /translation="MHDQTLDISHFQKLLDKSLTPYHLINYIEQKLVYYLNAKELKLDD
FT                   KWTLETGYYYVKKEGTSLIAFNINTNTIHEPFLIAAAHSDSPGLKLKIESRKYKDNVFS
FT                   HHIETYGSPIISTWTDRDLSLSGVVYFNKDEIINSELITIENIGIIPNVAIHLNRNVNE
FT                   GFAYDTHENIVIITSFKKSIKEKILEKLQISEKDFLSCDLIFTASEPAKIIGSEGEFLA
FT                   SKNLDNKSGCHAIMNAFVHTNNNKNKVAVFFDNEEIGSLTSRGADSTLLTEVLERIDHV
FT                   LNLGKEEHLIKLNKSFNISMDGAHGVHPGYICKHDPNYQISLGKGVTIKNNANFKYSTT
FT                   AHGCAKLKALAMKNNIKIQEIIMKANTNAGTTIGPISNSQTGIETIDIGTPMWGMHSLR
FT                   ETIAISDHIEAIKLLRTFFENWN"
FT   gene            663276..664001
FT                   /locus_tag="BT0628"
FT   CDS_pept        663276..664001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17947"
FT                   /db_xref="UniProtKB/TrEMBL:A1R055"
FT                   /protein_id="AAX17947.1"
FT                   /translation="MDRFYSLMLVLLIFIACTTISEVNLQDDASGTVLLIFNVDKEFEK
FT                   IRKELVATLVGEEIAKMPLFPIDKIKQYFGDEGKKLGLNLLNIKSNGDSLNLIVQFDNL
FT                   VKVLKDYLAKETMPIFKIANKNGKNILDIDFNLKTVTKIINESKDQVNDALAALLPSEE
FT                   IPMSEKEYKDVLVYFLSDFTSRANELIDNSNVTLKIKTSRKIQEQFGFKQLNSNNLELK
FT                   LDMIRTLSLETPIKLRLVY"
FT   gene            complement(664035..665882)
FT                   /locus_tag="BT0629"
FT   CDS_pept        complement(664035..665882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0629"
FT                   /product="PTS system, fructose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BT0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17948"
FT                   /db_xref="GOA:A1R056"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A1R056"
FT                   /protein_id="AAX17948.1"
FT                   /translation="MQDLFSKKLILLNYEAKSKDDVIEKMADMLNENEYLNNKEDFIKE
FT                   IKKREEISGTGLEEYIAMPHAKGNFVKKHGIAILRIKGEGFDFNASDLRPSKLFFMIAV
FT                   PEKTTGNTHIKTISYLNNIFNNEILRQEIMSTNDINRFLEILLNSNTDVIMNDTGSKNF
FT                   ILAVTACPTGIAHTYMAAESLKRAAAELNVEIKVETNGSSGVDNLIEEEEIERAKGIII
FT                   AAGKTVDKDRFNGKPLIEVGVKDGIHKAKELIQNILDNKAKIYKRKTVQGESNTTRKPG
FT                   GAYKHLMNGVSFMLPFVVSGGIIIAISFMFGIKAFDPNDPSYNKIADILMQIGGGNAFF
FT                   LMLPILAGYISFSIAERPGLAPGMITGLMMSKGNAGFLGGILAGFIAGYVTLAIKSISK
FT                   KIIPPKISGINPVLTYPLFSVLISGSLTYFLLAPIAYINTSITNMLNSLSGTNMALLGA
FT                   LLGGMMAIDMGGPVNKAAYAFGIAMITAGNYIPHASVMVGGMTPPLGIALATSIFNNRF
FT                   SQEEREAGKVCYFLGACFITEGVIPFAASDPLKVIPACIIGSSIGGFLSALSKVELMAP
FT                   HGGIFILPIITNPLMWIISILIGALITGLLIGFMKRDKK"
FT   gene            666013..666921
FT                   /locus_tag="BT0630"
FT   CDS_pept        666013..666921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0630"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:BT0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17949"
FT                   /db_xref="GOA:A1R057"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R057"
FT                   /protein_id="AAX17949.1"
FT                   /translation="MVYTLTLNPAIDYKIVVEGFQTGCLNHVVRNNFFAGGKGINVSNV
FT                   LKNFETESIALGFLGGFTGDYIRGYLDLMGIKHDFISISDNTRINIKMMSDGKETEING
FT                   RSPVILESDFQSLILKLKNLDKDMLIMSGSVPSSLGYQAYNEIAKSIASNVKLIIDTSG
FT                   PALQEIIGLRPFLIKPNINELKELLGMNLTSSKDLINAGCELMERGVQNIIVSMGSEGA
FT                   VFINNKDACLASVPQINSLSTIGAGDSVVAGFVYAHQNGNSLLDSFRFGVASGTATALR
FT                   GQLCSLDDVKDIFDKVKLEHL"
FT   gene            complement(667084..667157)
FT                   /locus_tag="BTT0025"
FT   tRNA            complement(667084..667157)
FT                   /locus_tag="BTT0025"
FT                   /product="tRNA-Asp"
FT   gene            complement(667205..669031)
FT                   /locus_tag="BT0632"
FT   CDS_pept        complement(667205..669031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0632"
FT                   /product="exodeoxyribonuclease V alpha chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BT0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17950"
FT                   /db_xref="GOA:A1R058"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A1R058"
FT                   /protein_id="AAX17950.1"
FT                   /translation="MRNFLVLREFLKDHKRNYLNPELKIYEIIETLNINIENYYKAHLL
FT                   TKKIKDKKYEEITIFLIFLFNYLSKGHLRANINLLIKDIQNTIDCAFLEIKDEDQSYQK
FT                   SINILEELAKITQATKIHEIILHLKENNIMKDLNQNERIITPLILENNIHIYTQKNFRE
FT                   EEELIKKIDQRLKDNKSEITTQRIQNIMNNLNTKDLSEEQINSIKKSLKSNFFILSGGP
FT                   GTGKTTTINYILKAIDMHLNVKQKVALVAPTGKASQKLKSSLKESFTNLETEYSTVQKL
FT                   LKMSFINKGNKYDEANPLEFEIIIIDEASMIDLSTFLKLLKAVKRNTKLIITGDKNQLP
FT                   SIAGGNVYSSLTQIKEISDENVEILKKNFRSNDEINLLAKAIYQEDTNLIDIQLNANKN
FT                   IILKDINKVNIENELLNHTKDLYKKISNFDLNSLNNKEIESIINALLSNVILCSRNFGK
FT                   FGTKRINEIIKLYLKKTYGNLIGQIILITQNDYKNDLFNGERGILFRENSKIYALFKRE
FT                   DEKYKRINFNLINKYELSFATTIHKSQGSEYQHVQIIIEDHPFLTKELLYTAITRAKES
FT                   IKIISSKDIIKNVSLKTIKRDSKISDHIDALK"
FT   gene            complement(669041..672484)
FT                   /locus_tag="BT0633"
FT   CDS_pept        complement(669041..672484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0633"
FT                   /product="exodeoxyribonuclease V beta chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BT0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17951"
FT                   /db_xref="GOA:A1R059"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A1R059"
FT                   /protein_id="AAX17951.1"
FT                   /translation="MKEIIDKIKYNEKILIEASAGTGKTYILENTITNLLINKTYSPSE
FT                   ILVLTFTKKATEEMHIRILKSIENAYQNSQTDKSLKKIYEQSNKIFISTINKFALHSLN
FT                   NFQIETEHFVRYSVKENFTSEIDEIVYEFLRKADSLKKELTIKDDEFEIFKSKFKTTKD
FT                   MIQYIRQGYKRDKTQELGDWIKTQTIFKKMLTNQDRLIHEYNSIVEALNKMTMEEKRTF
FT                   LNKHNQGIKISEIKYSNEKDIVKITDILANNKFFSKIIESNLKKNVTLLPKELKIQTAL
FT                   RELSHKTNTNKEDKNTLKRFINLKIEYKILKYIEKELANIINATNTIDQKHIMLNFKKH
FT                   LESRDNKLLNSIKNRYKIILIDEAQDLNLIQIEIFKLLNSCGIKLIFIADPKQIIYTFR
FT                   NADISYYNQGIKDQIKDNAKITLLTNYRSNKKLVEPLNIMFDNIYNKTHTAKIEQIEFT
FT                   KSKTESKNDENKIFINDQEIEAINIIETESEDENILQKTAITIKYLLTNGKIYDNNKLR
FT                   QIKESDIKVLCRTSKEIDLIDKELKNQNIKTNKIEESFFKTKEFSEIFYLIKCFDRKQN
FT                   FQTLNYILTSKIINLPWELYLSLLEKNEIKHIEAAISDIIYLLENQEITLIKAIDEIIS
FT                   KKDLWLNLAKFFNNTTFTEFAQSKKSYRETLINEKKFEELKNYEISLDFISKIYYEDKT
FT                   IESLICTLEDLILNKDTEQDEEQITTQGDQSIEILTIHKSKGLSINIVFLIGDIQHNDN
FT                   LMKKSDTFYKFCLENRIKYDFLKLKENQQSAKHKILNEEKNIFYVGTTRSRFALFIINK
FT                   GTIINKMLDLAKIKTIDKINLDFNVYNLIKTHKFNKLEKNDNKEIKLIPPTPINKHLFR
FT                   REYTHSYTSLASSYKSTYHANQETRDDETYDNDANCTEETLPKGKDIGNILHVIMKDIN
FT                   FSDAKDDFNNFQKINIALIQKRIEHFNSKLNTPKIQEMLIKMIYNILNTKIRFIDARLC
FT                   DIQELQKEMEFLIKIDTKIYEQKSLFKNYNKLDLTFNEGYIKGIIDLIFKINNKVYILD
FT                   YKTNYLGANLKDYNLTNLKKKMKQEKYDLQYKIYALGTKKILFKNPEEYNKYFGGVIYL
FT                   FTRAFQKNIKEQSKTQNGIYFTIPNFKELDLEQIYLQLKY"
FT   gene            complement(672495..675719)
FT                   /locus_tag="BT0634"
FT   CDS_pept        complement(672495..675719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0634"
FT                   /product="exodeoxyribonuclease V gamma chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BT0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17952"
FT                   /db_xref="GOA:A1R060"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R060"
FT                   /protein_id="AAX17952.1"
FT                   /translation="MYNMYKIYKTNKVSKIYNKIKELIKNDDIFKKETIIILKSNILSE
FT                   EIKKYIATLNEVSYNLNVKQNIIKMIYNLSMENHNIKKFLENNTLLLYSETEKFILYHM
FT                   LKDNKIKNIKQFKSTNNRYIFASKIITLFHKYYSKFPNLIDHWRQNKFLFEDQNKIHYE
FT                   SMQKEMFEKLFENQINLFNLHEKIEQEITEPKQSIETKRIIIIGETREIDRKILHCLQK
FT                   IFDITVYELILEDTTQIKSAFIDELVPVKIKKCNSSTQIEEETDIQLFEEKNFLASFKN
FT                   NIIKGTPLLNLDNSFKIIEAKTKKREVEILVNNILHSTQNNHLKINDIVITYLPKDMDI
FT                   YLPYIEEFLNKYELEFTILDSKDVSKSKSVIALKQLMQLFISNRGTISNFNRKEIIEFL
FT                   SNTKVMNKFNISISELEYLIKFNDAVNINFGMNDTHKESLSYDKNFLNSWENGFDRFLT
FT                   STMFNEKYECNNCQESISFQDPDSIVRLISIIKSLYEDIMYFREQEYTIYEWAEIMDIF
FT                   IDKYIKLEDNNKIDEYINTRIQYLKNFSRDFNENLYKDYMTKVKDRKVDFALFKIMFEE
FT                   SIEQKAYQSNNQNIGILVASSDKIEYLQKSEIHFLGIHQLNSNIHFDNMNLLNEYYDYV
FT                   NLEQENISNLIKIIFAASNKFYFYYSLSESLNPDINKPKVINKIINYIKDMGQELKIEI
FT                   HPSENYDFEYFKYEKANYLINYDTEAFNIAKSLQQGKHPNFKQKRLKLKKQITLRIEDI
FT                   NKAITNPYKYFYEEILNVYIKDISQIGDIKKKQEEQIIDIDNFNYKLMNNLIPIHEYIK
FT                   NETNEYILEKIDNIIENQIQKGIIPMNIKKTTIKEEFIEKFNEIKNNIVINFQEFFKMQ
FT                   ETDITLNKSIFINFEGETIEFKLNGKLKNIYKIDNRYFYVNLEKKDYGQDKIIRKINLY
FT                   IIGLMLKSSIANIESIQEIRITYKTSKLSLENQYTNETINYLDLTNLLKQIAYISSYPT
FT                   PIYKDLIQKSLIKIKDINEFPTVLKTQIKYPQKSININKDMEFILQQKDITWCPYYNRF
FT                   KDTHDLNINDNLEKLLQDFYTKFIKV"
FT   gene            complement(675735..677180)
FT                   /locus_tag="BT0635"
FT   CDS_pept        complement(675735..677180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0635"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:BT0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17953"
FT                   /db_xref="GOA:A1R061"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:A1R061"
FT                   /protein_id="AAX17953.1"
FT                   /translation="MKNLSLFTDFYELSMMNAYFIKNINPKVKFEMFFRKTPFKNGYII
FT                   LAGIHTLINALKELHFRDEEIEYLDSLQYFDKKFLKYLKTFRLNIKISSIEEGRIVFPH
FT                   EPILIIEGNLIELLLIEGLVLNTINFESLIATKTARIKEAGAKNLAEFGLRRAQGINGA
FT                   LSASKAAYIGGADFTSNVLAGYKYNIPVIGTMAHSWIMSFKNEEEAFWEYAKIYPNNVS
FT                   LLIDTYDTLNSGLKNAIKVFKALKSKGSKNFSVRIDSGDLEYLSKQVRKTLNENGLSEV
FT                   KIIISNELDEEIIMYLNSIHAPIDFWGVGTNLVTAKGESNLSGVYKMTSIQQNGKFIPK
FT                   MKMSNNINKATLPSQKGVVRIYSNEQMIFDLIFLKEEEEEIKKMLSLKKEFTIFHPIQD
FT                   NTFKEIKTYESFEFLINTVFENNKICQTCELSLEHIRARVQSDLKNIDHTHKRLINPHI
FT                   YKVSITEKLKNLRNKLIKENKKL"
FT   gene            677376..678809
FT                   /locus_tag="BT0636"
FT   CDS_pept        677376..678809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0636"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:BT0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17954"
FT                   /db_xref="GOA:A1R062"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R062"
FT                   /protein_id="AAX17954.1"
FT                   /translation="MSEKNVSNFDVIIFGVTGNLSRRKLIPSLFNLYKDGHINNFRIIG
FT                   FARRNFTDYELKVYIKDSLWQEESTALIDDFLKFFVYLSGDFREKDAYVKLSSLLDNRD
FT                   RIYYLSTSPEFYEAIIENLKPYSFSNTSYLSKIILEKPFGSSLDTARCLNTLLYSVFSE
FT                   EQVYRIDHYLGKETVQNIFTFRFGNSIFENIWNNRYVDFIQITVAEEAGIDGRAEYYDS
FT                   VGALRDMVQNHILQLLSLIAMEPPIGFSADFIHDEKVKVLKSLRKLSRDTMQNHIVKGQ
FT                   YICSQVQGILKKGYREEANFLSISDTETYLAMKLFIDNWRWSGVPFYIRTGKALVRKFS
FT                   EIYIQFKKSDFTIFNTGLINLSNALIFRIQPRDGIEIKFNTKRPGYNYDIQEANMEFSY
FT                   HASFNKFFSESYERLLFDAFLGDKTLYARNDEIDSSWEFVSDILDKWEDIKNWDYCYGS
FT                   EGPVEANMILEKDHFWRKM"
FT   gene            679989..681329
FT                   /locus_tag="BT0638"
FT   CDS_pept        679989..681329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0638"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17955"
FT                   /db_xref="GOA:A1R063"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A1R063"
FT                   /protein_id="AAX17955.1"
FT                   /translation="MNKVSHVQPNFLGLVPFLVFIVVYVGTGVVLEIQGVEMAFYQMPP
FT                   IIAMLLAVVTAFLLFKGSFIDKMNDFIEGCSQTDIIFISFIFMISGAFSAVCKEIGSIE
FT                   TVATIGLRYIPANLLIAGIFLICLFLSTATGSFLGTVVAITPIGFEIADKSGIPLPMVA
FT                   GAVLGGGAFGDSMSLISDTTIIASRTQGVKIIDVFRNGAFFTFPASILSTVAFAVLGSY
FT                   IGGIGVNVELGEISYLKVIPYLFVIIFAFLGVDVFLVLFFGILIAGGIGIVNGDLTLLL
FT                   MFKNINAGLLDLSEMLILVIFTGGVSYMTIRHGGFEWILTKLKYFAKCRRSAEFTITFL
FT                   IIMVTGFLSNSGLAILVNGTVTKGISEANSVCPKRCAALLSISSCALIGALPYGMHMIS
FT                   LINIAKGTISPLDIMPFLFYQVFLGVIIIVSIAFFGLKNQFLNSAKV"
FT   gene            complement(681373..682422)
FT                   /locus_tag="BT0639"
FT   CDS_pept        complement(681373..682422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0639"
FT                   /product="spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17956"
FT                   /db_xref="GOA:A1R064"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1R064"
FT                   /protein_id="AAX17956.1"
FT                   /translation="MKKFLILAIILIVTSCSSQKTQSTLNVLNWAEYIDEKLLAQFERE
FT                   NNIKINYECFNNNEEMMAKFNNTKGYYDIIVPSEYLIGELISESKIEKLDYSKLQNVKN
FT                   NILDKLYNLEHDFGNFYSVPLFWGVMGILYNKTKVDINDMNEFDILFNEKYKQEIAMLD
FT                   SPKENIGVALKKLGYSFNEHNISIIKRAEELLKKQSPLVIGYFSDIAAKSLILNGESSI
FT                   QLTWSGEALDAMLKDPNLDFYVPNSTNIWVDVMVIPSDAPHKELAYKFINFLYENEASY
FT                   ANFKETKYNSPNKNVLNRLQEEAKENPEINIYLEEKFLPTNFSNHEVFKTVPKEVKEEQ
FT                   MRIYVELSS"
FT   gene            complement(682440..683231)
FT                   /locus_tag="BT0640"
FT   CDS_pept        complement(682440..683231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0640"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein PotC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17957"
FT                   /db_xref="GOA:A1R065"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R065"
FT                   /protein_id="AAX17957.1"
FT                   /translation="MLKILKNTFLFLTLGFVYAPILILIIYSFNAGNNGFFFQGFSLKW
FT                   YKEVFASQQIKIVIYNTLLIAIVSSLISIVIGVLGAYSIYKTKNKKIKTILLSINKIPI
FT                   INPDIVTGISLMTFFSLIKIQLGFSTMLMSHIIFSTPYIIIIILPKLYSLSENVIDAAR
FT                   DLGASEIQIFKNIIYPEIIGSVVTGGLIAFTLSIDDFLISFFTTGQGFNNLSILINSLT
FT                   KRGIKPIINAISSILFFVILSLLFIINKCVGIKKLTVDTEI"
FT   gene            complement(683247..684062)
FT                   /locus_tag="BT0641"
FT   CDS_pept        complement(683247..684062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0641"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein PotB"
FT                   /db_xref="EnsemblGenomes-Gn:BT0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17958"
FT                   /db_xref="GOA:A1R066"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R066"
FT                   /protein_id="AAX17958.1"
FT                   /translation="MQGIINMNRIILILYTLFLSIFIIFPLVIIIGLGFFNEQNELTFA
FT                   NFIKLLEPSYLRIFSRSINFALITTIFCMLIGYPTAWFISMSKKSVQNMLIIMIILPMW
FT                   INTLLRTYAWIRILGKNGIINNLLKAMGLETIELLYNEKAVIIGMVYNFLPFMVLPIYI
FT                   GLSKIKYEYIEAARDLGARMWQVLLYIKLPLTLSYLATGIIMVFIPSITVLIISDLLGG
FT                   AKQILIGNLIEKQFLFVEDWHTGAAISFIVMIVILIFNLIILKLMQKTT"
FT   gene            complement(684050..685093)
FT                   /locus_tag="BT0642"
FT   CDS_pept        complement(684050..685093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0642"
FT                   /product="spermidine/putrescine transport ATP-binding
FT                   protein PotA"
FT                   /db_xref="EnsemblGenomes-Gn:BT0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17959"
FT                   /db_xref="GOA:A1R067"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R067"
FT                   /protein_id="AAX17959.1"
FT                   /translation="MNNYILEIKDLSHYYTDSNNKTLDTINLKIKKNEFITLLGPSGCG
FT                   KTTLIKIIGGFLNQNKGEIHFLSKEISKITPNKREINTVFQNYALFPHMNVFDNISFGL
FT                   RMKKVNKNLIQEKVKAALSLIGMQKYAYRNINELSGGQKQRVAIARAIIMEPKLLLLDE
FT                   PLSALDLKMRQEMQKELKKIQRKLGITFIYVTHDQEEALTMSDRIVVMNEGIILQIGTP
FT                   EEIYNEPKTRFVASFIGESNIFEGTYEKEFIVKMFGKDFKCLDKGFKNKEPVDLVIRPE
FT                   DVKILPKGQGHLSGIITSAVFQGVHYEMTLEIQKSHWLVQSTKLTKVGEEVDISLGPDD
FT                   IHVMCKE"
FT   gene            complement(685165..686082)
FT                   /locus_tag="BT0643"
FT   CDS_pept        complement(685165..686082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0643"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17960"
FT                   /db_xref="GOA:A1R068"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A1R068"
FT                   /protein_id="AAX17960.1"
FT                   /translation="MHKTQISYLIKLSYNLTMSNKINWFPGHMKRALDLIQENLQRTNI
FT                   VLEILDARAPLSSQNPLTEKIIKNSNRNKIILLNKSDLAQEEEILKWREYFETLGNNVL
FT                   ITNIYKKGMKKQIIDNIIKIANVKKIKTYEEKIKVLVIGVPNVGKSSIINLLVGKKSTS
FT                   VANKPGHTKNIQILKINERINIFDMPGILWHNLEDQEIAKKLAILDMIKNEIIDNTELA
FT                   LYLLKKMHINNKTKLLNKYNIISTNSLEILEEFAKTRGFINKKHKIDIERASKILIKEY
FT                   REGKFGKIILDVKRHNNNKYKSFT"
FT   gene            686252..686881
FT                   /locus_tag="BT0644"
FT   CDS_pept        686252..686881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0644"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BT0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17961"
FT                   /db_xref="GOA:A1R069"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1R069"
FT                   /protein_id="AAX17961.1"
FT                   /translation="MSKMALAAKMGGAVGIRANSVLDIHQIKSEIDLPIIGIVKRVYND
FT                   SPVFITPTIKEVDELCSEGVDVIALDATLRKRPDGLLLSEFFNKIKEKYPSQLLMADIA
FT                   SLEEAVNADRLGFDFIGTTLHGYTKDTEGCNIADNDFAFLKNLLKCNFKSKLIVEGKID
FT                   TPLKAKRSFELGVSLVVVGGAITRPMEITKKFVDKINEVKEIWEYL"
FT   gene            686922..688466
FT                   /locus_tag="BT0645"
FT   CDS_pept        686922..688466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0645"
FT                   /product="PTS system, glucose-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BT0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17962"
FT                   /db_xref="GOA:A1R070"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A1R070"
FT                   /protein_id="AAX17962.1"
FT                   /translation="MGKFFENAQKFGRSFMLPIAILPAAGLFLGIGGALSNPATVNTYS
FT                   FLNVFFLQSVFNIMRTAGAIIFVNLPPIFAIGVAVGLAKSDKGTAGLAAFIGYLVLNST
FT                   IGILVDMFSNSEELSKGAVGLILGIRTLETGVFGGIIVGILTYYLHNKFNKIEFPKVLG
FT                   FFSGSRFIPIIVSFSNIFLAVCMFIFWPYMQAGISKMGVLVDATGYVGTLIYGIFLRML
FT                   GPFGLHHIFYLPFWTTGLGGSEIINGKLVEGTQNIFFAELASHSTDKFFIGTSRFMSGR
FT                   FITMMFGLPGAALALYRLAKPNQKTKVFGLLFSSALTSFLTGITEPLEFSFLFVAPVLY
FT                   VLHAVFDGFAFMFAHILQITIGQTFSGGFIDFILFGILQGNARTNWVLVPLVGVCWFFL
FT                   YYFSFAFLISKFNYKTPGREDTINSNDTFLSDATVKGDNVASQVIMGLGGSDNIIELDC
FT                   CATRLRVTVKDSLKVLKNTLENTGAKGILIKNSGVQVIYGPGVSVLKNEIEEILGN"
FT   gene            complement(688508..689524)
FT                   /locus_tag="BT0646"
FT   CDS_pept        complement(688508..689524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0646"
FT                   /product="carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BT0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17963"
FT                   /db_xref="GOA:A1R071"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R071"
FT                   /protein_id="AAX17963.1"
FT                   /translation="MIMKIIKGKQYMNIKNTIFILIFLLLLIVVGPRMKFRNEFEETKI
FT                   PNKLGEIDQYLLTEESKFNLEANTKKEIIWNGDQKRTEYAVIYIHGFGASKNEIYPIPN
FT                   NIAKALNANIFFTRLKGHGINDKNAFKDVKTKDWLRDIDEAIQIGQSIGEKLILIGTSN
FT                   GGACAIWALKNYPDKIYSAVLISPNIYPKDKRTSLIYYPWGRQIAYLITGGYNELEIRQ
FT                   NKRIEHEEITPFHSPIRQVDSIIAMMGLVKLINNNGFNEIKTPLTIAYSPNDPTVDSQT
FT                   INKFISEYGGYKKTIPIILVESFHSHVPAGNHSYRSAQNTSYLTKHAVDFIKNIKSK"
FT   gene            complement(689505..690023)
FT                   /locus_tag="BT0647"
FT   CDS_pept        complement(689505..690023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0647"
FT                   /product="oxidative stress response regulator BosR"
FT                   /db_xref="EnsemblGenomes-Gn:BT0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17964"
FT                   /db_xref="GOA:A1R072"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R072"
FT                   /protein_id="AAX17964.1"
FT                   /translation="MNNNTIEVHSTLEKVGITNDPILLKSLTTELGMKASHSRNRIILH
FT                   IASNPKEYFTAKEIYNKLIKEIPSLSKATVYNTLNILKERNILKDIKTTDQKETRFYLS
FT                   LTSTIAHFKCNKCNQVYPIQLDDIKDILKDKLGEEWKTKSIEIIYSGSCNNCYQQSKKE
FT                   KSNIDYENN"
FT   gene            complement(690115..691806)
FT                   /locus_tag="BT0648"
FT   CDS_pept        complement(690115..691806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0648"
FT                   /product="serine/threonine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BT0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17965"
FT                   /db_xref="GOA:A1R073"
FT                   /db_xref="UniProtKB/TrEMBL:A1R073"
FT                   /protein_id="AAX17965.1"
FT                   /translation="MMFRKFRNSRTYIVIISITAFAESKLYSILSNTKYLIENKNLSYK
FT                   IHWIFPTYFFEILKLNPELNEWFFNRLKNNEDIYIPSTYSGSPHEYMLHDEIHVDLYWS
FT                   LKNPFKSGYKDLFKDNPHTFYVYNMEKLRKRVLELYRKLNFNYIEGIRIAKNNKKYLVF
FT                   YKNNCQFLSEIQEPETQKQNIDTLIYFHEIKDIYNNQELKNFLLSLKGLDANFYSIKIQ
FT                   NLEGKKITTELLEIPEFNSLKEQAIILQFQNKRLKEYQINEISLKEFLVNKNFEYHSTN
FT                   LEPITSKNIEYNMEGNFTLSHEKYHVKFEEGKLNKIKYKERKAEFLDSCRTYIKILSQK
FT                   DIIIEPTIESSFSFSNEKIVGIRQYLNFNTKEKSIIDFFLDENLASFFISIKIAWPSVI
FT                   TCNNKSLKLSNTNYLLEYSSLEIPIFEVEKGTNLKITAKYNDFDTYEKIIETKKDIKGY
FT                   INGTEFLISKGNDQNSNFFISFLNIEKHIIYTINYKIAKRGFKRWFILNIGGSYNTIKA
FT                   EDLKNYSLSLNLLLLPINNNFDNKIKINSKIKTLLFYPNIKKNENK"
FT   gene            692025..693659
FT                   /locus_tag="BT0649"
FT   CDS_pept        692025..693659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0649"
FT                   /product="60 kDa chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:BT0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17966"
FT                   /db_xref="GOA:A1R074"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R074"
FT                   /protein_id="AAX17966.1"
FT                   /translation="MAKDIYFNEDARKSLLSGIEKLSNAVKVTLGPKGRNVLIDKKFGS
FT                   PTVTKDGVSVAREIELDNALENMGAQLLKEVAIKTNDLAGDGTTTATVLAYAIAREGLK
FT                   NVSSGINPIGIKKGIEHAVTLASEKIRKSAKKITTKEEIAQVASISANNDTSIGEKIAE
FT                   AMDRVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDAYILIC
FT                   EKKISTIKELLPVLEKVLNTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKAPGFG
FT                   DRRKAMLEDIAILTGGVFVSEELGLTLENVELEQLGQAKSVKVDKDNTTIINTGNKEQI
FT                   KERAELIKKQIEETSSEYDKEKLQERLAKLVGGVAVINVGAVTELELKEKKHRVEDALS
FT                   ATRAAVEEGVVPGGGSTLIEVAMYLDTVDTSKLSYEEKQGFEIVKRSLEEPMRQIIANA
FT                   GFESSIYIHQIKTDKKGLGFDAASFKWVNMIESGIIDPAKVTRSALQNAASIAGLLLTT
FT                   ECAITEVKEEKSNAGGGYPMDPGMGMM"
FT   gene            693718..694014
FT                   /locus_tag="BT0650"
FT   CDS_pept        693718..694014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17967"
FT                   /db_xref="UniProtKB/TrEMBL:A1R075"
FT                   /protein_id="AAX17967.1"
FT                   /translation="MSENEFVFCIGYDGSKAIVDKELLSQHKDKSVEELCELGFYRSAF
FT                   SKALYKNDDTLIEYLIDRYNKISKSSYSKREELELLFGVVYPGNIASIKVTYV"
FT   gene            694015..694338
FT                   /locus_tag="BT0651"
FT   CDS_pept        694015..694338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0651"
FT                   /product="protein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:BT0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17968"
FT                   /db_xref="GOA:A1R076"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A1R076"
FT                   /protein_id="AAX17968.1"
FT                   /translation="MLGNFMFLLQDFSHSSSFFRSLLVFIPVIAIFWFLVISPQRKEEK
FT                   KKKDMIKNLKKGDKVLTIGGIFGIVKKVNDSEVILELSPTSEVRFIKNSVERVILDEIK
FT                   DKN"
FT   gene            694420..696192
FT                   /locus_tag="BT0652"
FT   CDS_pept        694420..696192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0652"
FT                   /product="protein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:BT0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17969"
FT                   /db_xref="GOA:A1R077"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A1R077"
FT                   /protein_id="AAX17969.1"
FT                   /translation="MLFMNKVSKFILILCVTSFAYLLIFPTLKWYFFTNDEDKKISLYS
FT                   KEALRDYSKNKALSSLIELKKLYQKNPNAQIPDDLKYLIPIAQNNYKIYGKEFPKSFDN
FT                   VKVLRDGFLTDADIEELSLEIYRYYEEIKRNKNRIIQLGLDLSGGMSVTISLDYSGLEQ
FT                   KLGRTLSFQEKEEAFDRTMQILKDRVDTFGLTEPKITREASGNKIFLDVPGERDEKRVD
FT                   SLLSGRGNLLFYVVDNEATSVLNTKILEAGPLYSISDIKNSMGLGENKKIFPWYVKDSY
FT                   GIDDESTVRYYVVDSSVESSFDGSHISDAGVLNDHKTGRDVVTFNLDNEGSEKFFEITK
FT                   KNIGKALAVVMEGKIKSVANISHAIAGGNVSIQGDSFDKREASELALVFKTAAFPVEIK
FT                   IDDLRVIGPTIGEKTVKLGIKASLLALVLVFLFMLAYYKISGFVAGFSLVIYNLFLILA
FT                   ILSAFNFTLTLTSIAGLVLTMGMAVDINIIIYERIKEEIRNGRKFERAFDDGFKKAFWA
FT                   IMDSNITTFIAVLFLTLLGTGTIQGFAWTLSIGIVASLFSSLIFSRFILEFIMSFSKSK
FT                   CLSISWSSNYAKGV"
FT   gene            696176..697075
FT                   /locus_tag="BT0653"
FT   CDS_pept        696176..697075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0653"
FT                   /product="protein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:BT0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17970"
FT                   /db_xref="GOA:A1R078"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A1R078"
FT                   /protein_id="AAX17970.1"
FT                   /translation="MQKVFNFLKYGNKVIIVSFCMILSGFIYTFMYHGGYNWGIDFSSG
FT                   VNINFVIDKSGIKDYDIQRILSSVYKTFDVNKIISSDESKSQFSIIVKSDITDYALKKE
FT                   IHSTLIDKLNTEFGANVEILDSYFIDSNFSSILRTKSMLLVCLTFTLILFYVALRFRLS
FT                   YAVASIFATIHDILFVVAFLGIFRIEINSSIIVSILTIIGYSLNDTIIIFDRIRENSRN
FT                   MTDTLFLNILNVSIKQTLSRTILTSMTTFVAVLSIYVFTEGAIKDFSLIFMVGVVVGTY
FT                   SSIFIASPILLSCYKKIK"
FT   gene            697099..698250
FT                   /locus_tag="BT0654"
FT   CDS_pept        697099..698250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17971"
FT                   /db_xref="UniProtKB/TrEMBL:A1R079"
FT                   /protein_id="AAX17971.1"
FT                   /translation="MKFLDFGSLGFYRFFDFQKHLNFSIFRYSLINYYSYKEQSSLIND
FT                   ANLLKSKIIFLDKVHKDIARVASTSSKLNDSLNINKKIFCDALVIIKNLIKKYYPSSEF
FT                   LNLEYDVLLSNEDTFNKFLDKLRYLNFRVDLKKKIEEFDRKNKTPYSCIKIATFFIKEE
FT                   FLERLANTIDFFSNEANNSSLDLINKEIDEYCEKVEQVKVSEYIKDTHKKFVIEYAKER
FT                   ISKIMKDHSLDISKLLVKISLLDITIQCFESYYLNLLETLNILLSISNIIEIGLDELPG
FT                   AIFNEWNEFIYLRRKEFQKLVLISDCVFQKRIISIINSGGWKFTFFSLSPRQGDIIQFS
FT                   VDVNKNFNNIEDGIKEYELKINRFNDFKLDWEKSLKNFEHLFV"
FT   gene            complement(698256..699095)
FT                   /locus_tag="BT0655"
FT   CDS_pept        complement(698256..699095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0655"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:BT0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17972"
FT                   /db_xref="GOA:A1R080"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1R080"
FT                   /protein_id="AAX17972.1"
FT                   /translation="MSKDYYNILGIHKNATTEEIKKAYKKLAIKYHPDKNKGNKFAEEK
FT                   FKEINEAYEILSSPQKKANYDNFGSANFNNNFNTEGFSKGFKNTDFHNFESFDLFSDIF
FT                   GGATRGTLKDTEITIKISLYDAYMGGKKSILINNEKIDINIPKGTIETTKLKFNGKGNI
FT                   NPISGKRSNLIIKFEISSYKNFTLKERNLETKINVYPWEIALGSEKVFETIEGKKIKIK
FT                   IPKDTKNEEILSLKGLGMPALGNTNKGDLRVKLIVDVPKIINDEVKKIYERLKEIYN"
FT   gene            699216..700355
FT                   /locus_tag="BT0656"
FT   CDS_pept        699216..700355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0656"
FT                   /product="coproporphyrinogen oxidase, anaerobic"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17973"
FT                   /db_xref="GOA:A1R081"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR030933"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A1R081"
FT                   /protein_id="AAX17973.1"
FT                   /translation="MNFLRLTDLSIYIDLTKCFSYVFFDKILQELSYYLKVLGSPQIKT
FT                   LYIKYETSGLGNDSDLESFLTSLSQNFDFLTLDEFTFELHPLEITLSLLAILNDFSVSR
FT                   ISIDIKSFSSKLLKVMGVYEISVAEINNAVNGIRKFDFDLNIDLNVNIPYQEKMHLRND
FT                   LVKLVACAPEHICLSEILVDGENCIIDFFKDVSSNYNEAKAEDFWFYAFDFLESNGYMN
FT                   YEISNFALKGHESKHNLRYWELKPYLGLGVNSVSLLVISKGDGLKAVIKMDDNFLGVGK
FT                   STAAFEILSDLDFFICHFITNLGTKKGLEVSVLKRRFIYNQEDFCNFINYLLRLSKGVV
FT                   FSNDILYLDGHERFKLDFYLRLIREYLVSNSFKVNFKFL"
FT   gene            complement(700342..701028)
FT                   /locus_tag="BT0657"
FT   CDS_pept        complement(700342..701028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0657"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BT0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17974"
FT                   /db_xref="GOA:A1R082"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1R082"
FT                   /protein_id="AAX17974.1"
FT                   /translation="MEEQKKLVSQYAIDHYVKSNMHLGIGTGTTVFYAIKYLSKKIKSG
FT                   DLKNLKLYPTSSDTKYLLARENITYESKFTKLSKNIDITIDGADEILLETKALIKGGGA
FT                   AHLMEKIVAYNSHQLLIIADETKIVQTLGTRASVPIEIVPDALAFITANLANMNFNPVL
FT                   RTCKSKSGPIITDNNNYILDVKMNVENPKGAEKYFKLLPGILEIGIFNHQNTKIIYYQN
FT                   GQIKET"
FT   gene            701256..702002
FT                   /locus_tag="BT0658"
FT   CDS_pept        701256..702002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0658"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17975"
FT                   /db_xref="GOA:A1R083"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R083"
FT                   /protein_id="AAX17975.1"
FT                   /translation="MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGISEALEGGRVLKQ
FT                   EGYSFDIAFSSVLVRANDTLNIILRELGQSYIDVEKSWRLNERHYGALQGLNKAETAEK
FT                   YGEDKVLMWRRSYDIPPMPLEESDKRHPIHDLRYRGIPKSELPSTECLKDTVARVIPYW
FT                   TDKIARAIIEGKKVIIAAHGNSLRALVKYLDNMSDDDILKLNIPTGIPLVYELDRDLRP
FT                   IKHYYLGDEDKIKAAMESVANQGKKK"
FT   gene            complement(702090..703652)
FT                   /locus_tag="BT0659"
FT   CDS_pept        complement(702090..703652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0659"
FT                   /product="class 1 lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BT0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17976"
FT                   /db_xref="GOA:A1R084"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:A1R084"
FT                   /protein_id="AAX17976.1"
FT                   /translation="MKTAHWADFYAKKIIEEKGEKEQYTVASGITPSGTVHIGNFREVI
FT                   SVDLVARALKDANKNVRFIYSWDNYDVFRKVPKNMPDQELLTTHLRQAITRVPDTKTNQ
FT                   SSYARANEVEFEKYLPIVGIKPEFINQSLKYMSSDYSNQIKFALDHKDEIAKVLNKYRT
FT                   TKLADNWYPISIFCTKCDRDTTTVKNYNHCYSIEYHCECGNKESLDLRKTWAAKLPWRI
FT                   DWPMRWKYENVDFEPAGKDHHSSGGSFDTSIEIVKIFGGTPPITFQYDFISIKGRGGKI
FT                   SSSSGEVVSLKDVLEIYTPEVTRFLFASTKPNTEFSISFDLDVIKIYEDYDKFERVYYG
FT                   IDDIKESKKEAFKRIYELSQPKAPDKEIPYQIGFRHLSVICQIFEGNKDKIFKLLHDVK
FT                   ENQKEKLINKIDCCINWIKKFAPEEFKFSLRTTFDNTESLDSNKQGVTQLLNFLKKDFN
FT                   NITEKEIQDEIYNIARSNNIDPPLFFKQIYNILINKDKGPKLAGFIKAIGIQKFEEIVK
FT                   HYI"
FT   gene            complement(703740..704612)
FT                   /locus_tag="BT0660"
FT   CDS_pept        complement(703740..704612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0660"
FT                   /product="GTP-binding protein era-like"
FT                   /db_xref="EnsemblGenomes-Gn:BT0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17977"
FT                   /db_xref="GOA:A1R085"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R085"
FT                   /protein_id="AAX17977.1"
FT                   /translation="MKSGFVSIIGRPSTGKSTLLNSICEHQISIISSIPQTTRNKIKGI
FT                   FTDKRGQIIFIDTPGFHLSKKQFNIALMHNVHSAIKETELILYVIDIQDKPGIEENEIL
FT                   TIISKSKINFLVVINKIDIQKTKEREIMIFLEEKGIKKDNIIKISAEQKINIEEIKDKI
FT                   YENLQEGPLYYPEEYYTDQEMNLRTSEIIRGVTIKKLKEELPYSLYIEIEILEDRKNKL
FT                   FIKANIIVAVESQKGIIVGKGGKGIKTIGEEARKIISEIFEKKCDLFLQVKLRKNWNKN
FT                   PKLIKNLIN"
FT   gene            704680..705060
FT                   /locus_tag="BT0660A"
FT   CDS_pept        704680..705060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0660A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0660A"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17978"
FT                   /db_xref="GOA:A1R086"
FT                   /db_xref="UniProtKB/TrEMBL:A1R086"
FT                   /protein_id="AAX17978.1"
FT                   /translation="MCLKDYSLKKVNFEVFCEHCGGKVELNKSVCLNCHSKLGDLECPN
FT                   CRYVGIVSAFENGCPKCSYSPLEGQSQERIFRMRRRSRLKESRTSNDFLKSRFCFGFNV
FT                   SVMLYLFASFLIVLLFVYILFF"
FT   gene            705073..705480
FT                   /locus_tag="BT0662"
FT   CDS_pept        705073..705480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17979"
FT                   /db_xref="UniProtKB/TrEMBL:A1R087"
FT                   /protein_id="AAX17979.1"
FT                   /translation="MGITVFYLFSVFLSFKIGENVKFVEDNVRQTSILYSDIEEVEFPY
FT                   AKTQILKFKGKTPIRYAYFSFDNDRLYSYTFVFDKKLISQYSIVLSIREKFGDAIVVTP
FT                   FSYIWDVGDSIIALNSNILRMTLKSYVNKER"
FT   gene            705477..705911
FT                   /locus_tag="BT0663"
FT   CDS_pept        705477..705911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17980"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:A1R088"
FT                   /protein_id="AAX17980.1"
FT                   /translation="MILRALFALIFYISCANHVYDKEIIINDTKFFVKLALDEVTRAKG
FT                   YMGTESINENNGMLFIFKEEKNLSFWMKDTPVPLEIAYINSVGVIKEIYSLVPFSQRVV
FT                   NSRYKVKYALEVPEGSFSKFKIKVGDRVKFNFDVNSLNVE"
FT   gene            complement(705912..706559)
FT                   /locus_tag="BT0664"
FT   CDS_pept        complement(705912..706559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17981"
FT                   /db_xref="UniProtKB/TrEMBL:A1R089"
FT                   /protein_id="AAX17981.1"
FT                   /translation="MISTKMLKISILNIDQLKYSIVIAVLILITLISCKDKNVTYDKRI
FT                   KKILDNNKIEYRIDKENDFIVSKIINDTKTEIIVRSKINSYQNSKTREIFGIVEIFDVN
FT                   SNKIQEISESLMSDSYNNRVLGSWEIIHDPERGNNSLVYIVKAEENAKETFLLDALEEV
FT                   AATISIFKKVIKGNDIEVNTKNTSNEIDNDTLHNEEKMKDHAEEELQKIKAE"
FT   gene            706603..707562
FT                   /locus_tag="BT0665"
FT   CDS_pept        706603..707562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17982"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1R090"
FT                   /protein_id="AAX17982.1"
FT                   /translation="MYFKSNDYSYTVIQSKNNYVQKSTFGISFVILNRGTKIFREDLFG
FT                   SLSNFDFIREIISIEKQSNRNSLQFISESYDKLKFILLSDDLNSGEKVNLAMKESICSF
FT                   VFVLQSDMYLLNPFWIPNIFDEIVKKNVLLVGGEFFDKEEEVVPSVFIPTIDEQQKLKV
FT                   ILINSERDYEKSLITMDYCGLYSKERFVQLGGFDRRIKNEYFQRLDFGLRAIYFGESVH
FT                   IYRKLRIQYTALNVPEDLTKNRSFLIFLLKNYVPIFIGNGIKFSFFRFLKLCLRYGINP
FT                   FKFGREFKEIKHEITKNSLRFKGDLKSAIELWENNIID"
FT   gene            707525..708550
FT                   /locus_tag="BT0666"
FT   CDS_pept        707525..708550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0666"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BT0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17983"
FT                   /db_xref="GOA:A1R091"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A1R091"
FT                   /protein_id="AAX17983.1"
FT                   /translation="MQLNFGKIILLINLIFVYFFLEAQEVDYVNILDSLDSKFFKFNFN
FT                   IANDILTIEHEKGHLKLKVGFEYGLSSVGYYIYVDPILLKDGEILITKRALMQIENHFR
FT                   ALQSYSKPRIMSIVIDPGHGGHDRGAVVTHKINEHDITFLEKDFALTYSMHLYKVLSNY
FT                   FLDRNILLTRVDDVFVPLQDRSELANAIKPDFPHNVIFLSIHVNNAPNPEARGIEFWYL
FT                   PQDSKREVVRNFKGYDIRGNRYLRELNDILDIKYKYESKKLAEILYETFIDVLCETKIR
FT                   SIREEQWFVIKNSSMPAVLIEIGFLSNIADAMLILDYNYMSKINILVLKSLIRFIEFYE
FT                   K"
FT   gene            708531..709052
FT                   /locus_tag="BT0667"
FT   CDS_pept        708531..709052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0667"
FT                   /product="flagellar filament outsheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17984"
FT                   /db_xref="GOA:A1R092"
FT                   /db_xref="UniProtKB/TrEMBL:A1R092"
FT                   /protein_id="AAX17984.1"
FT                   /translation="MNFMKNNSIYCSFFSRNGAKYSFEILIALLLLSFIFSLCMIFLNY
FT                   ENIFFRKVFYFYCENELIADLRYLKEKKTLKENLDFLVKDFLLGNSKGFSLQFGTRNVK
FT                   FLYSFISNDVYFINLSKEFYNSFENGGYNDSDKLRVNLFVKSLKETIDFNYPGNVRKIV
FT                   IFIEGYVLNV"
FT   gene            709130..710179
FT                   /locus_tag="BT0668"
FT   CDS_pept        709130..710179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0668"
FT                   /product="flagellar filament outer layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17985"
FT                   /db_xref="GOA:A1R093"
FT                   /db_xref="InterPro:IPR006714"
FT                   /db_xref="UniProtKB/TrEMBL:A1R093"
FT                   /protein_id="AAX17985.1"
FT                   /translation="MIFMSKVKNIVFILFFLIFLSSLFGQEVPGASSGDNSVKNEPGEL
FT                   VLDFAELARDSSPTKLDLTDYVELVYSGASNIVKAEDMVLDLGISNWTVLLTPSSRMQA
FT                   YVKNSVVAPAVVKGESKRYAGDTILGVRVLFPSHSQSSAMILPPFKIPFYAGEDGNQFL
FT                   GKGLIDNVKTMKEVKVTVYSLGHEVDLEVLFEDMSGMEYVYPLGTLRFKGWADLVWSNP
FT                   NYLPGISAITGKDNIPNYPLPSSKMRFKAFRVSKSHSSKDQNLIFYVKDVRVIYDKLSV
FT                   SLDSDIDNESVFKIYETRGAESLRKLKAQEALKKVLKIKEDVSMPDESFQDFLEKGSND
FT                   ESGARTKEQ"
FT   gene            710251..712815
FT                   /locus_tag="BT0669"
FT   CDS_pept        710251..712815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0669"
FT                   /product="chemotaxis protein CheA"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BT0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17986"
FT                   /db_xref="GOA:A1R094"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1R094"
FT                   /protein_id="AAX17986.1"
FT                   /translation="MLDSENKELLEIFFEEAQNLVDTLEENIMSLEDDPNNAETIDEIF
FT                   RAAHTLKGGSASVDMMELSGFTHVVEDVFDAIRDNKLKICNDLVDLLLNALDVIKGMLD
FT                   ARLNGDVYLQDVSELKNKLRRFLGDEHQTVSEISLENINDDEFLLSSRELSDMCEVVGL
FT                   GQKVLKVSIYFNKDNPMATIAGIQMFQALKDLGPILYTVPNYEQLIADKFLRRVDYYLI
FT                   SLNKNTIEEKIKLSGVALSYAIDEFDIDSELAKTEAIERNTVVYDTLSEGKVRLSNDEL
FT                   ISLRERVGDAKLFEVKLNFNKDNPMSTISGLQMLQALKSLGEVYKSIPEDLLADKFFDF
FT                   IVYYLISDTSVDSISKKVDLSDVVVSFDINEVDLKNIKDVNLNTEVGSYASSKESKKTT
FT                   VNVNLIRIDSKRIDSILNLVSEAVISKSTYNQINSDMTSFLYSFNYFYDYQESFRNSFL
FT                   VDLKIIFKDMGLELESSLENQIANLVEHKLDRTLQDMVGLRDLLFKILQDSRFASGRLS
FT                   RIITDLHESVLKTRMLPVSSIFSRFARVVRDLSKKLGKIVELSTEGEDTEVDKSVIDDL
FT                   VDPLMHCVRNSMDHGLETADERLSKGKDKAGHIILRAKNEGNVISIEIEDDGRGIDPDI
FT                   IRQKSIEKGLIKEDMVLSESEILNLIFEPGFSTASQITDVSGRGVGLDVVKNNIKKLNG
FT                   TIVIDSKVNVGTTFKIKLPLTLVIVQGLLVKSGSEIYVIPLNSVLETHRISEENIKLLE
FT                   NDHEVYNLREEVISVLRLDELFNINNDQNLYEKFLIVISVNDKKAGIVVDSILGEEDFV
FT                   VKPIKDKYASSPGIVGATTLGNGKVVLIIDVFRLFDLKDMKG"
FT   gene            712820..714205
FT                   /locus_tag="BT0670"
FT   CDS_pept        712820..714205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0670"
FT                   /product="chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:BT0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17987"
FT                   /db_xref="GOA:A1R095"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A1R095"
FT                   /protein_id="AAX17987.1"
FT                   /translation="MMEIKEICLGDHNVSNQVKGPTPVNLDFKVVSFNIGNDNYLVDIM
FT                   QVKEIRKSSNFTYVPNAKKYVVGLDNLRGEIISIIDLRIMFNLEVLKRNLEDIMVLRNG
FT                   DLLIGVIVDKVNNVFSIDSSLIQDPHPVLSQEALIRYIKGVVEYGEKLYILLDVDRIFD
FT                   YDREEEILLEDSRNYDEIDASGNENNSLSYSNNFLELSESSVGDLATSSKSDLDDLKVI
FT                   KENLFKYSFNASLVNDEFLKEIGMQLDIANINDLSYDNFLGEFYSKSSGRLWDDRYLKE
FT                   FQDEIVKPYINEMSGVGTVLNVFEVGCGDGKETISFVNVLYESYKDPFKVTAIDNNLVK
FT                   VIGTSNLIFSGSDINLSEIYRKNSFEQSPGVYKFKPEIMNNILFEYSDAILSEFPENLG
FT                   IIFLRDILCFLNDDGQNLILDAIAEKSVSGALLILGDNEELKNNDLFVKDRSVKYFNLY
FT                   KRI"
FT   gene            714217..714702
FT                   /locus_tag="BT0671"
FT   CDS_pept        714217..714702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0671"
FT                   /product="pili chemotaxis protein methyltransferase
FT                   CheR-like PilK"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:BT0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17988"
FT                   /db_xref="GOA:A1R096"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:A1R096"
FT                   /protein_id="AAX17988.1"
FT                   /translation="MRIDYIEPFLDAASSVLRDMLLVEDIQMGSPGLKSINQKIRGVSV
FT                   IVGLAGSVEGSIIIDMDIDTALFVASKLNFEEYVDFDDEETKEMVAATLTEVGNIIAGN
FT                   FVTTLHAKGFVFDITPPAFIYGENMKISNKGSEALIVPFTLPDGKIIEVNIAIRERV"
FT   gene            714751..715191
FT                   /locus_tag="BT0672"
FT   CDS_pept        714751..715191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0672"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BT0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17989"
FT                   /db_xref="GOA:A1R097"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1R097"
FT                   /protein_id="AAX17989.1"
FT                   /translation="MIQKTTIAVDSSNKPKGINYDTGVPFNVLIVDDSVFTVKQLTQIF
FT                   TSEGFNIIDTAADGEEAVIKYKNHYPNIDVVTLDITMPKMDGITCLSNIMEFDKNAKVI
FT                   MISALGKEQLVKDCLIKGAKTFIVKPLDRAKVLQRVMSVFVK"
FT   gene            complement(715212..715724)
FT                   /locus_tag="BT0673"
FT   CDS_pept        complement(715212..715724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17990"
FT                   /db_xref="UniProtKB/TrEMBL:A1R098"
FT                   /protein_id="AAX17990.1"
FT                   /translation="MIKKIFLLLIINTSIHSRLITTSIEKRSSEATKKYSAFNLIIEEE
FT                   YYTKHPKGTHEMQIYELTENFIKSIFRDKINYTAITPTYKEANKYLLQSEIIDKDFSKY
FT                   KIFKIKAIDSIFKSSALIYTKKGFYKLELHIGNNNKNKLEIFNLNMSYFTKHLNEISNA
FT                   MIFYKKY"
FT   gene            complement(715721..716767)
FT                   /locus_tag="BT0674"
FT   CDS_pept        complement(715721..716767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17991"
FT                   /db_xref="GOA:A1R099"
FT                   /db_xref="UniProtKB/TrEMBL:A1R099"
FT                   /protein_id="AAX17991.1"
FT                   /translation="MVKILSNFFKATLIASIIAFLIEELSIILFLPYKIRFALIFIGFL
FT                   FDAILILIFLYKISKAYFSQKLQIYIRNNLFFDLIHCLIPLIFYSSHQIQNIINPHETI
FT                   LSPIVLSLFKLRFLRLLRFNDLMIEIYYNPKEKNLILVAFARTFSISLLIPFIFFIIFS
FT                   SSGFANTIPEKQEFNIIKNISITTEKNYIKEKYPFILIIKDTDKTIYSKSDDIFFYYSP
FT                   SEYKIIEMEQTKFYIDKYLQRKNDSVIGIFLFTLFISFALFLTNFYKFFKASFLNPIIL
FT                   MQKVLQNPIEYRKIQIPFHFSEEKVYEMAKTFNNVLLKDKLNAKRRSKLPLEIEKVKRI
FT                   INSNKEHV"
FT   gene            complement(716761..717624)
FT                   /locus_tag="BT0675"
FT   CDS_pept        complement(716761..717624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17992"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0A0"
FT                   /protein_id="AAX17992.1"
FT                   /translation="MNSKVYFPHLYHYLFNHESIKGLSVFEKEIEIIKYLEENKKTIST
FT                   FIDENFKSDTDLLIQYVKEKTDIIITPLVLSNIESIDLNIVKDLFNKELNKNNLELIFG
FT                   SIKANPYLRKEFLYDFNAISSGHITFYINKLFEDKNSYTTHLIKKENDMLDSSKIVKNY
FT                   IKILLLLRVLIIKFYLEKEIKLMPRNIENTAKLVSREIEFLDDNTVSLITQSLFKYENL
FT                   SNISPIATLISIFSNRTRIPNIKNNRIKGFIGYDESWFSIKQLSSKEHDPRIIKELLEI
FT                   ARKNKW"
FT   gene            complement(717621..718283)
FT                   /locus_tag="BT0676"
FT   CDS_pept        complement(717621..718283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0676"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BT0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17993"
FT                   /db_xref="GOA:A1R0A1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0A1"
FT                   /protein_id="AAX17993.1"
FT                   /translation="MRIKACIFDMDGTLINSIMDIAFSMNLALKKLGYTEIKIDEFNTL
FT                   VGRGYSKLVENTLEHLNVNLNDKHLKDNLYQEFVKAYNQNLSSLTKAYDGIPELLRKLN
FT                   SLNIPVGILSNKNHEELLIISKDIFKDINFFEVRGYSPRFEAKPDPSNALDMIIELNLM
FT                   PKEIAYIGDSDVDMITAQNAGFLPIGVSWGFRTIKELKESGAKYILSSPSELLDIIK"
FT   gene            718474..720075
FT                   /locus_tag="BT0677"
FT   CDS_pept        718474..720075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0677"
FT                   /product="nucleoside transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17994"
FT                   /db_xref="GOA:A1R0A2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0A2"
FT                   /protein_id="AAX17994.1"
FT                   /translation="MNFRLSLMQDILILDKVTKRYGDFIANDNICIRFKKGEIHAILGE
FT                   NGAGKTTLMKTIYGIHKPDSGQIFLRGHELKLKDSSESIRSGIGMVFQHFMLIPKFTAV
FT                   QNIILGYEDSKFGFINYDHAKRRILKLSERYGLKIDTDKPIENLSVGMGQKVEILKVLY
FT                   RNADIIIFDEPTAVLTPNEIDEFMNVLKILAVEGHTVILITHKIKEIKAVAQRCTIMRL
FT                   GKVIGTFDITKTDEGMLTKLMIGKETSLDISKRQIVDHTNILEIRDLSVKDERGVFKVK
FT                   NISLNLREGEIFGIAGVEGSGQEELVEAILGVRDIFSGDIIKKVDGKFESIKGLSVKQI
FT                   IDRKIGHIPSDRQKHGLILDFNILQNIGIKSFDDVNYLKMKSSGIGNDKLKVKFLNTVK
FT                   KQFVNFNLILLKKISEQLAASFDITPRDILSKVKNLSGGNQQKVVVAREINLKPEVLLA
FT                   VQPTRGLDVGAIENIYKKFLAQRDEGMTVLLVSLELDELMSVCDRIAVMYNGGIVGVLE
FT                   HNFDVGVIGKMMMGIV"
FT   gene            720076..721227
FT                   /locus_tag="BT0678"
FT   CDS_pept        720076..721227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0678"
FT                   /product="nucleoside transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17995"
FT                   /db_xref="GOA:A1R0A3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0A3"
FT                   /protein_id="AAX17995.1"
FT                   /translation="MKVDNYKYKEAIAVFLNSSIFINFFAFFLGILILGLIVLILGYSP
FT                   LRMYYIMIEVIFSSPKHFAYIVSYATPLIFTGLSIGIALRVGLFNIGVESQFMLGSISA
FT                   LIAGIFLDFPPVLHVICIFLFASLASGILGVLIGYLKIKFNINEVISGIMFNWILFHLN
FT                   NIIIDLPAIKKDNSDLSKPIRESAFIDFFGSWKLSSEGLAYRAKHPFINDLLKAPLNFG
FT                   IIIGIIIAILMWFLLNKTMLGFKISSVGRNIVASYRVGIDIKKILMFTMFLAGAFAGLA
FT                   GAIQVMGVNKAIFKLTYMEGTGLNGIAVALIGNNSPIGIIFSSTLFSILFYGSSRVQSL
FT                   MGLSSSIVSLMIGIVVIMISASHFLNKMFLRGIKSVKRTNISN"
FT   gene            721199..722125
FT                   /locus_tag="BT0679"
FT   CDS_pept        721199..722125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0679"
FT                   /product="sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17996"
FT                   /db_xref="GOA:A1R0A4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0A4"
FT                   /protein_id="AAX17996.1"
FT                   /translation="MSNALIFLISETLINSQTLILAGLGGLISERCGIINIGLEGTMAL
FT                   GAFVGATVAYCYGSPLFAIFAGGLSGLVLSILHAIFTVFLKSDQIITGMAINFLGPSVA
FT                   MLFGTFIFGSASTPPIDIKLPILFDGVLDKRSLVFQIFGKRYSLYIAIICVVLFHVMFK
FT                   YTKIGLRIKASGEEPEVLESLGVNVFMIRFFCVLLSGLFAGIAGAVLSTVIASSYMQGI
FT                   IGGQGFIAIVMVIFGNWQPFGILMGSFLFSFIRTLVVMMSQVSFLSLIIPLKILIILPY
FT                   VVVILSLMFFSKRNYVPKALGLPYKKD"
FT   gene            722253..724502
FT                   /locus_tag="BT0680"
FT   CDS_pept        722253..724502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0680"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17997"
FT                   /db_xref="GOA:A1R0A5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0A5"
FT                   /protein_id="AAX17997.1"
FT                   /translation="MINLRGSFMLKIKHRFIGFLFLCLLITILFFSLIFKFVLSSYLER
FT                   YYKQLTRAQIRRAAFAVQALLDTFYIIIDGASSNLALETMSEYSFIKNGGHIFSEVELD
FT                   RLRENSKIVLDAVKGNRKYRNRVYEILFNLKLDTFYEEFAFLDFEGKIIVSTRHANNID
FT                   FGQSESNTEYFKNSVKEYKKSELNFVGWYPGLTEGITGEVAIRSHYKDKKASAIVVPVY
FT                   SAEDKVFLGYLVGYLLDDVIRDKLDRSRFGFYNRGNLFYLDPYNNLVNPLIEYNESSKV
FT                   SDKFVSILKNALSKPPMQPLVPGQIPVYQIERAYFPEMKLYNYYAILPISSELGDNSGI
FT                   LVARIPYEDIYGVIYSLAFKFIVCAILGIIILVVILSVRLETVISFRLNLVRNLVKEIV
FT                   QGNLDKDYVINDKYDDELGSLGLQIVKMRDAIADAIASVLKNISYVNKASVEVVNSSQN
FT                   LSSSALQQASTLEEMSANIEQISSGVEMSVNHSRETERIALITNENAQIGGKAVEESVV
FT                   AMQSIVEKVSVIEEIARKTNLLALNAAIEAARAGDEGKGFAVVASEIRKLADLSKESAL
FT                   EIGELVEENSRLATEAGLIFKDMLPEIEKTTNLVKKIFEGSYKQNDQIIQFKEALDQVG
FT                   EVVQASASSSEELSSMADRMLEKAKELKQVISFFKVKDFEVDAFDKLNSGDDVLMTGDL
FT                   TSLNMESNSSLGDSQDDIHGDSKVSYESINKRVDPKKAIDVVDKDLDFDEDFSDF"
FT   gene            724532..726439
FT                   /locus_tag="BT0681"
FT   CDS_pept        724532..726439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0681"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BT0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17998"
FT                   /db_xref="GOA:A1R0A6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0A6"
FT                   /protein_id="AAX17998.1"
FT                   /translation="MKLKLKVRILLIVSILIAIFISILFFVFGMSINSSLVAQQLDLMQ
FT                   NLIGNVKNSLTLYLSSMEERVKINSMYLDSSSVFESIARSKPKRIEAILDQIEILVKTG
FT                   RGNNLMITNKKGEIIFTTAVKDNSDYGISVADKEYFLKLRGTSSIYNSSVLLADSGSVE
FT                   EVLMRDVSKIRNKSGQIPYLLIGIPLRDHNTSDVFGYFMIFYAIDYLYNSFKGISFGAL
FT                   GSGRTMVFDQTGSFLIHHTWLPGDNLVNVNPYYSSVVKSTSEDLIQKNQEISLRRYVDL
FT                   HGQEFVGFAQKVKCHLSNFSFIVYLRVNTNDFYYMTRLTTFILGISFVVTLVILGLVTI
FT                   YLVGKLSAVLNGILSYSGRLASGDFTVSSYSLEWKTLELHGLYEDLELLRSNFSSVARG
FT                   VIENLDYLYENAIQIANASQNLSSGAVEQASTLEEMTANIEQISQGVTENTDNASTTES
FT                   IAVNTNEKTKEGHESVTKAIEAMEVITDKIGVIDEITRQTNLLALNASIEAARVGDKGK
FT                   GFEVVAAEVRKLADQSKESAREIIDIAHKSLTVASKAGNNFEQIVPGMEKTAGLVKNIT
FT                   RESYNQSNQIGQFKNAIEQVSQLVQTTASSSEELSAMSERMLDSVKHLKESVDYFKIDK
FT                   "
FT   gene            complement(726495..727559)
FT                   /locus_tag="BT0682"
FT   CDS_pept        complement(726495..727559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0682"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BT0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAX17999"
FT                   /db_xref="GOA:A1R0A7"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R0A7"
FT                   /protein_id="AAX17999.1"
FT                   /translation="MQIAVLLSGGVDSSVALYIMIQKGYKNIKCYYLKIWLEDELSYIG
FT                   ECPWKEDINYVEAVCKKFNVPYEIISLQDEYYKRVVTYAIEELKIGNTPSPDIFCNQRI
FT                   KFGAFFDKINEHYDLIVTGHYAKIENKNDHYILKQAKDKIKDQSYFLSHLSRKQISKLH
FT                   FPLGDLLKTEIRQIAQKIDLPNKNRKDSQGICFLGKIKYDEFIKYHLGELKGNIIEQET
FT                   GKILGTHNGYWFFTIGQRKGIKLSHGPWFVTEKDIQNNIIYISNSINYLKQGKQQFLVH
FT                   KTNWINKPLNNGDLSAKIRHGEKKIKCKIEMLKNDIIKVDLEEKDYGISPGQFCIFYQE
FT                   DECLGGAKILKTLT"
FT   gene            727588..728880
FT                   /locus_tag="BT0683"
FT   CDS_pept        727588..728880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0683"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /EC_number="2.3.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:BT0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAX18000"
FT                   /db_xref="GOA:A1R0A8"
FT                   /db_xref="InterPro:IPR011554"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0A8"
FT                   /protein_id="AAX18000.1"
FT                   /translation="MNFDVFMIYSILLGNYFFNRGKLMKVGISDIRVFLPLNCLNLHVL
FT                   LDNSLYNSDEKFFKKFNRAIDATLQKAFRFTSPNEDSVTMASSAVKLIFDNNNLELDKM
FT                   RVFLGGTETGVDYSKSISSYVYGALKLAGINLSNNFLTFQVQHACAGSALSLHSAASIL
FT                   SHSEKFEYGIVFSSDIAHYSNLTTAEITQGAGATAVLIEQNPKVVSINLSEFGVYTDDV
FT                   DDFFRPFGSLEAKVKGRYSIDCYNKANEEALANFAYKKNMSIKDLFSKYRFILHVPFAQ
FT                   MPIDSMHYVLKKYYSEDESERNAYLESIDFYDSVEASKEVGNLYTGSIFLSLMSYLKRV
FT                   FAKKDISGEKILFCSYGSGNIMVIYELTVEENAHCVVKTWDIDKMLSVRHDANFDEYRD
FT                   FFENRIVPGESQGFYLKEIREDGYRVYGYRA"
FT   gene            728849..729928
FT                   /locus_tag="BT0684"
FT   CDS_pept        728849..729928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BT0684"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:BT0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAX18001"
FT                   /db_xref="GOA:A1R0A9"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0A9"
FT                   /protein_id="AAX18001.1"
FT                   /translation="MDTGFMGIEPNILNNKKRQIEICLDKEDVSKSDNLLNFVNLKHDA
FT                   LSELDFCEIDTRESIFGYDIAMPIFISSMTGGVKEGNKLNKSLVKIANDLRIPMSLGSF
FT                   KLIFKYPEYIKDFYLRKYAHNIPLFSNIGATQLREFGIFEIIEMNKRLEVDAIIVHLNS
FT                   GQELMNLRGERSFRGIKDSIARICSVSNIPVIVKETGFGISPDSVISLLDLGVSYVDLA
FT                   GSGGTNWVLVEGIKEENLDIASCFANWGISSVLTLLSIKDFFKDKVFASGGYETGMDIA
FT                   KGIALGAKLVGIAAAILRAFYAGGENALYNLLKGYEYVLKMSMLLSNSKDLAQFRLNKY
FT