(data stored in ACNUC7421 zone)

EMBL: CP000053

ID   CP000053; SV 1; circular; genomic DNA; STD; PRO; 1485148 BP.
XX
AC   CP000053;
XX
PR   Project:PRJNA13884;
XX
DT   10-JUN-2005 (Rel. 84, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Rickettsia felis URRWXCal2, complete genome.
XX
KW   .
XX
OS   Rickettsia felis URRWXCal2
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
XX
RN   [1]
RP   1-1485148
RX   DOI; 10.1371/journal.pbio.0030248.
RX   PUBMED; 15984913.
RA   Ogata H., Renesto P., Audic S., Robert C., Blanc G., Fournier P.E.,
RA   Parinello H., Claverie J.M., Raoult D.;
RT   "The genome sequence of Rickettsia felis identifies the first putative
RT   conjugative plasmid in an obligate intracellular parasite";
RL   PLoS Biol. 3(8):E248-E248(2005).
XX
RN   [2]
RP   1-1485148
RA   Ogata H., Renesto P., Audic S., Robert C., Blanc G., Fournier P.-E.,
RA   Parinello H., Claverie J.-M., Raoult D.;
RT   ;
RL   Submitted (23-FEB-2005) to the INSDC.
RL   Information Genomique et Structurale, Unite des Rickettsies, CNRS,
RL   Marseille, France
XX
DR   MD5; 3169405c0a5bbdbbf94be80fbc8d73ee.
DR   BioSample; SAMN02603143.
DR   EnsemblGenomes-Gn; EBG00001232763.
DR   EnsemblGenomes-Gn; EBG00001232764.
DR   EnsemblGenomes-Gn; EBG00001232765.
DR   EnsemblGenomes-Gn; EBG00001232766.
DR   EnsemblGenomes-Gn; EBG00001232767.
DR   EnsemblGenomes-Gn; EBG00001232768.
DR   EnsemblGenomes-Gn; EBG00001232769.
DR   EnsemblGenomes-Gn; EBG00001232770.
DR   EnsemblGenomes-Gn; EBG00001232771.
DR   EnsemblGenomes-Gn; EBG00001232772.
DR   EnsemblGenomes-Gn; EBG00001232773.
DR   EnsemblGenomes-Gn; EBG00001232774.
DR   EnsemblGenomes-Gn; EBG00001232775.
DR   EnsemblGenomes-Gn; EBG00001232776.
DR   EnsemblGenomes-Gn; EBG00001232777.
DR   EnsemblGenomes-Gn; EBG00001232778.
DR   EnsemblGenomes-Gn; EBG00001232779.
DR   EnsemblGenomes-Gn; EBG00001232780.
DR   EnsemblGenomes-Gn; EBG00001232781.
DR   EnsemblGenomes-Gn; EBG00001232782.
DR   EnsemblGenomes-Gn; EBG00001232783.
DR   EnsemblGenomes-Gn; EBG00001232784.
DR   EnsemblGenomes-Gn; EBG00001232785.
DR   EnsemblGenomes-Gn; EBG00001232786.
DR   EnsemblGenomes-Gn; EBG00001232787.
DR   EnsemblGenomes-Gn; EBG00001232788.
DR   EnsemblGenomes-Gn; EBG00001232789.
DR   EnsemblGenomes-Gn; EBG00001232790.
DR   EnsemblGenomes-Gn; EBG00001232791.
DR   EnsemblGenomes-Gn; EBG00001232792.
DR   EnsemblGenomes-Gn; EBG00001232793.
DR   EnsemblGenomes-Gn; EBG00001232794.
DR   EnsemblGenomes-Gn; EBG00001232795.
DR   EnsemblGenomes-Gn; EBG00001232796.
DR   EnsemblGenomes-Gn; EBG00001232797.
DR   EnsemblGenomes-Gn; EBG00001232798.
DR   EnsemblGenomes-Gn; EBG00001232799.
DR   EnsemblGenomes-Gn; EBG00001232800.
DR   EnsemblGenomes-Gn; EBG00001232801.
DR   EnsemblGenomes-Gn; EBG00001232802.
DR   EnsemblGenomes-Gn; EBG00001232803.
DR   EnsemblGenomes-Gn; EBG00001232804.
DR   EnsemblGenomes-Gn; EBG00001232805.
DR   EnsemblGenomes-Gn; EBG00001232806.
DR   EnsemblGenomes-Gn; RF_RNA01.
DR   EnsemblGenomes-Gn; RF_RNA02.
DR   EnsemblGenomes-Gn; RF_RNA03.
DR   EnsemblGenomes-Gn; RF_RNA04.
DR   EnsemblGenomes-Gn; RF_RNA05.
DR   EnsemblGenomes-Gn; RF_RNA07.
DR   EnsemblGenomes-Gn; RF_RNA08.
DR   EnsemblGenomes-Gn; RF_RNA09.
DR   EnsemblGenomes-Gn; RF_RNA10.
DR   EnsemblGenomes-Gn; RF_RNA11.
DR   EnsemblGenomes-Gn; RF_RNA12.
DR   EnsemblGenomes-Gn; RF_RNA13.
DR   EnsemblGenomes-Gn; RF_RNA14.
DR   EnsemblGenomes-Gn; RF_RNA15.
DR   EnsemblGenomes-Gn; RF_RNA16.
DR   EnsemblGenomes-Gn; RF_RNA17.
DR   EnsemblGenomes-Gn; RF_RNA18.
DR   EnsemblGenomes-Gn; RF_RNA20.
DR   EnsemblGenomes-Gn; RF_RNA21.
DR   EnsemblGenomes-Gn; RF_RNA22.
DR   EnsemblGenomes-Gn; RF_RNA23.
DR   EnsemblGenomes-Gn; RF_RNA24.
DR   EnsemblGenomes-Gn; RF_RNA25.
DR   EnsemblGenomes-Gn; RF_RNA26.
DR   EnsemblGenomes-Gn; RF_RNA27.
DR   EnsemblGenomes-Gn; RF_RNA28.
DR   EnsemblGenomes-Gn; RF_RNA29.
DR   EnsemblGenomes-Gn; RF_RNA30.
DR   EnsemblGenomes-Gn; RF_RNA31.
DR   EnsemblGenomes-Gn; RF_RNA32.
DR   EnsemblGenomes-Gn; RF_RNA33.
DR   EnsemblGenomes-Gn; RF_RNA34.
DR   EnsemblGenomes-Gn; RF_RNA35.
DR   EnsemblGenomes-Gn; RF_RNA36.
DR   EnsemblGenomes-Gn; RF_RNA38.
DR   EnsemblGenomes-Gn; RF_RNA39.
DR   EnsemblGenomes-Tr; EBT00001578371.
DR   EnsemblGenomes-Tr; EBT00001578372.
DR   EnsemblGenomes-Tr; EBT00001578373.
DR   EnsemblGenomes-Tr; EBT00001578374.
DR   EnsemblGenomes-Tr; EBT00001578375.
DR   EnsemblGenomes-Tr; EBT00001578376.
DR   EnsemblGenomes-Tr; EBT00001578377.
DR   EnsemblGenomes-Tr; EBT00001578378.
DR   EnsemblGenomes-Tr; EBT00001578379.
DR   EnsemblGenomes-Tr; EBT00001578380.
DR   EnsemblGenomes-Tr; EBT00001578381.
DR   EnsemblGenomes-Tr; EBT00001578382.
DR   EnsemblGenomes-Tr; EBT00001578383.
DR   EnsemblGenomes-Tr; EBT00001578384.
DR   EnsemblGenomes-Tr; EBT00001578385.
DR   EnsemblGenomes-Tr; EBT00001578386.
DR   EnsemblGenomes-Tr; EBT00001578387.
DR   EnsemblGenomes-Tr; EBT00001578388.
DR   EnsemblGenomes-Tr; EBT00001578389.
DR   EnsemblGenomes-Tr; EBT00001578390.
DR   EnsemblGenomes-Tr; EBT00001578391.
DR   EnsemblGenomes-Tr; EBT00001578392.
DR   EnsemblGenomes-Tr; EBT00001578393.
DR   EnsemblGenomes-Tr; EBT00001578394.
DR   EnsemblGenomes-Tr; EBT00001578395.
DR   EnsemblGenomes-Tr; EBT00001578396.
DR   EnsemblGenomes-Tr; EBT00001578397.
DR   EnsemblGenomes-Tr; EBT00001578398.
DR   EnsemblGenomes-Tr; EBT00001578399.
DR   EnsemblGenomes-Tr; EBT00001578400.
DR   EnsemblGenomes-Tr; EBT00001578401.
DR   EnsemblGenomes-Tr; EBT00001578402.
DR   EnsemblGenomes-Tr; EBT00001578403.
DR   EnsemblGenomes-Tr; EBT00001578404.
DR   EnsemblGenomes-Tr; EBT00001578405.
DR   EnsemblGenomes-Tr; EBT00001578406.
DR   EnsemblGenomes-Tr; EBT00001578407.
DR   EnsemblGenomes-Tr; EBT00001578408.
DR   EnsemblGenomes-Tr; EBT00001578409.
DR   EnsemblGenomes-Tr; EBT00001578410.
DR   EnsemblGenomes-Tr; EBT00001578411.
DR   EnsemblGenomes-Tr; EBT00001578412.
DR   EnsemblGenomes-Tr; EBT00001578413.
DR   EnsemblGenomes-Tr; EBT00001578414.
DR   EnsemblGenomes-Tr; RF_RNA01-1.
DR   EnsemblGenomes-Tr; RF_RNA02-1.
DR   EnsemblGenomes-Tr; RF_RNA03-1.
DR   EnsemblGenomes-Tr; RF_RNA04-1.
DR   EnsemblGenomes-Tr; RF_RNA05-1.
DR   EnsemblGenomes-Tr; RF_RNA07-1.
DR   EnsemblGenomes-Tr; RF_RNA08-1.
DR   EnsemblGenomes-Tr; RF_RNA09-1.
DR   EnsemblGenomes-Tr; RF_RNA10-1.
DR   EnsemblGenomes-Tr; RF_RNA11-1.
DR   EnsemblGenomes-Tr; RF_RNA12-1.
DR   EnsemblGenomes-Tr; RF_RNA13-1.
DR   EnsemblGenomes-Tr; RF_RNA14-1.
DR   EnsemblGenomes-Tr; RF_RNA15-1.
DR   EnsemblGenomes-Tr; RF_RNA16-1.
DR   EnsemblGenomes-Tr; RF_RNA17-1.
DR   EnsemblGenomes-Tr; RF_RNA18-1.
DR   EnsemblGenomes-Tr; RF_RNA20-1.
DR   EnsemblGenomes-Tr; RF_RNA21-1.
DR   EnsemblGenomes-Tr; RF_RNA22-1.
DR   EnsemblGenomes-Tr; RF_RNA23-1.
DR   EnsemblGenomes-Tr; RF_RNA24-1.
DR   EnsemblGenomes-Tr; RF_RNA25-1.
DR   EnsemblGenomes-Tr; RF_RNA26-1.
DR   EnsemblGenomes-Tr; RF_RNA27-1.
DR   EnsemblGenomes-Tr; RF_RNA28-1.
DR   EnsemblGenomes-Tr; RF_RNA29-1.
DR   EnsemblGenomes-Tr; RF_RNA30-1.
DR   EnsemblGenomes-Tr; RF_RNA31-1.
DR   EnsemblGenomes-Tr; RF_RNA32-1.
DR   EnsemblGenomes-Tr; RF_RNA33-1.
DR   EnsemblGenomes-Tr; RF_RNA34-1.
DR   EnsemblGenomes-Tr; RF_RNA35-1.
DR   EnsemblGenomes-Tr; RF_RNA36-1.
DR   EnsemblGenomes-Tr; RF_RNA38-1.
DR   EnsemblGenomes-Tr; RF_RNA39-1.
DR   EuropePMC; PMC1166351; 15984913.
DR   EuropePMC; PMC1392945; 16461734.
DR   EuropePMC; PMC1538700; 16885313.
DR   EuropePMC; PMC1951237; 17553977.
DR   EuropePMC; PMC2223442; 18025092.
DR   EuropePMC; PMC2394910; 18359823.
DR   EuropePMC; PMC2440523; 18612416.
DR   EuropePMC; PMC2474969; 18665265.
DR   EuropePMC; PMC2568045; 19086373.
DR   EuropePMC; PMC2600387; 18680660.
DR   EuropePMC; PMC2609893; 18826827.
DR   EuropePMC; PMC2669486; 19292914.
DR   EuropePMC; PMC2679400; 19426447.
DR   EuropePMC; PMC2866381; 19861070.
DR   EuropePMC; PMC2978049; 18399779.
DR   EuropePMC; PMC2990048; 21118938.
DR   EuropePMC; PMC2990049; 21118939.
DR   EuropePMC; PMC3026830; 21283549.
DR   EuropePMC; PMC3129644; 21214386.
DR   EuropePMC; PMC3129645; 21413886.
DR   EuropePMC; PMC3205644; 22049052.
DR   EuropePMC; PMC3214141; 21989454.
DR   EuropePMC; PMC3321914; 20587190.
DR   EuropePMC; PMC3366522; 22665618.
DR   EuropePMC; PMC3375787; 18217575.
DR   EuropePMC; PMC3471621; 23017437.
DR   EuropePMC; PMC3484133; 23118963.
DR   EuropePMC; PMC3532327; 23075233.
DR   EuropePMC; PMC3566102; 23405087.
DR   EuropePMC; PMC3740205; 21967477.
DR   EuropePMC; PMC3741420; 23675818.
DR   EuropePMC; PMC3767692; 24039725.
DR   EuropePMC; PMC3768654; 24031560.
DR   EuropePMC; PMC3911462; 24226919.
DR   EuropePMC; PMC3957756; 24371248.
DR   EuropePMC; PMC4054137; 24727277.
DR   EuropePMC; PMC4080579; 24778194.
DR   EuropePMC; PMC4165615; 25324688.
DR   EuropePMC; PMC4186946; 25266919.
DR   EuropePMC; PMC4193185; 25272251.
DR   EuropePMC; PMC4232316; 23790098.
DR   EuropePMC; PMC4297373; 25510419.
DR   EuropePMC; PMC4316617; 25477419.
DR   EuropePMC; PMC4344283; 25695615.
DR   EuropePMC; PMC4369868; 25884425.
DR   EuropePMC; PMC4435010; 25923891.
DR   EuropePMC; PMC4517713; 26196587.
DR   EuropePMC; PMC4652196; 26565771.
DR   EuropePMC; PMC4847369; 27117813.
DR   EuropePMC; PMC4862146; 27161452.
DR   EuropePMC; PMC4990410; 27537367.
DR   EuropePMC; PMC5035074; 27662479.
DR   EuropePMC; PMC5062770; 27402519.
DR   EuropePMC; PMC5457682; 28400593.
DR   EuropePMC; PMC5552056; 28831298.
DR   EuropePMC; PMC5822307; 29047217.
DR   EuropePMC; PMC5859732; 29554953.
DR   EuropePMC; PMC5875266; 29553921.
DR   EuropePMC; PMC5931684; 29677221.
DR   EuropePMC; PMC6025725; 29954410.
DR   EuropePMC; PMC6341658; 30665414.
DR   EuropePMC; PMC6460736; 30975188.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01774; rpsL_ricks.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000053.
DR   SILVA-SSU; CP000053.
DR   StrainInfo; 681609; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1485148
FT                   /organism="Rickettsia felis URRWXCal2"
FT                   /strain="URRWXCal2; California 2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:315456"
FT   gene            1..822
FT                   /locus_tag="RF_0001"
FT                   /note="RF0001"
FT   CDS_pept        1..822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0001"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60852"
FT                   /db_xref="GOA:Q4UNK5"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNK5"
FT                   /protein_id="AAY60852.1"
FT                   /translation="MTKLIIHLVSDSSVQTAKYAANSAFAQFTSIKPKLYHWPMIRNLE
FT                   LLNEVLSKIESKHGLVLYTIADQELRKALTKFCYELKIPCISVIGKIIKEISVFSGIEI
FT                   EKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQMLNELSEADIILIGPSRTSKTPTSVFLA
FT                   YNGLKAANIPYVYNCPFPDFIEKDIDLLVVGLVINPNRLIEIREARLNLLQINENKSYT
FT                   DFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRIYYNRKNKYNK"
FT   gene            914..1375
FT                   /gene="trxA"
FT                   /locus_tag="RF_0002"
FT                   /note="RF0002"
FT   CDS_pept        914..1375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="RF_0002"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60853"
FT                   /db_xref="GOA:Q4UNK3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNK3"
FT                   /protein_id="AAY60853.1"
FT                   /translation="MSFPRRRESRVKRDKSSFSKNFKVLDSRFRGNDIKAICTILQKHK
FT                   GKIMANNVTDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELKGKVKVLKM
FT                   NIDENPNIPSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSLLDWINKSI"
FT   repeat_region   complement(914..1014)
FT                   /note="RPE-6 Full"
FT   gene            1381..2124
FT                   /gene="rfbE"
FT                   /locus_tag="RF_0003"
FT                   /note="RF0003"
FT   CDS_pept        1381..2124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbE"
FT                   /locus_tag="RF_0003"
FT                   /product="O-antigen export system ATP-binding protein RfbE"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60854"
FT                   /db_xref="GOA:Q4UNK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNK1"
FT                   /protein_id="AAY60854.1"
FT                   /translation="MSLSHSKVFIEITNGYVEGIDTHKRAQGLKHFFLKKGVSLSPNIP
FT                   ILNDINFSCQEGEKIAFIGSNGSGKSSLLKLIAGIYPLKSGTVKVHGDIAAIIDMGVGF
FT                   EPEQTGRENIKMLMLYNNMLDKYSRKIEKEIIDFSELGNKIDLPIKNYSSGMLSRLAFS
FT                   VSIFQNPQILLLDEVFAAGDSRFIEKSLNLMKSKFKNTPISIIVSHQEEIIKDNCDRCI
FT                   LLKDGNIIGDGTPSEMFKIYNRLLG"
FT   repeat_region   complement(2110..2246)
FT                   /note="RPE-1 Full"
FT   gene            2264..3040
FT                   /gene="rfbA"
FT                   /locus_tag="RF_0004"
FT                   /note="RF0004"
FT   CDS_pept        2264..3040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="RF_0004"
FT                   /product="O-antigen export system permease protein RfbA"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60855"
FT                   /db_xref="GOA:Q4UNK2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNK2"
FT                   /protein_id="AAY60855.1"
FT                   /translation="MIKYFFSKKYWRAIALLVKASIIRQNKDSFLGSLWGLIQPFIHIM
FT                   VISYFFGFLLRQPREFMVMNLVGGIPLWSFIVSSLTICSSSLVTRDQIIKKVRISKTFF
FT                   PVADSLGQLYTLICSFSAMYFAFILLFPEKFSWQIIFMPILILPLIICVISGSIAVAFL
FT                   TPYIRDIPQMLSVILGVIYWSIPIVYPYSLIPESKKIYFEFNPFFLVIRPVQALVIDGT
FT                   LPDMMLIVKSIIVAFITVCISYLIYRQFSKRVIYYL"
FT   gene            3037..6264
FT                   /gene="gltD"
FT                   /locus_tag="RF_0005"
FT                   /note="RF0005"
FT   CDS_pept        3037..6264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="RF_0005"
FT                   /product="NADPH-dependent glutamate synthase beta chain and
FT                   related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60856"
FT                   /db_xref="GOA:Q4UNK4"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNK4"
FT                   /protein_id="AAY60856.1"
FT                   /translation="MKLGFNLDFNELDLTGLKKLDQIFLDYLFKADKSLHKDLMLFRST
FT                   PLSIIPQDYSEFLLKISPHLDDFLAELFCISKEVTISRLKHKDFDIIYECKRKFVQRVA
FT                   VKKYPPEKIKDIDFEDVYLKLTDLIGTNFTSREFAKQIIIWQQDEKNFAEELDIAARYA
FT                   ACRVSFRGLTATNRHCERLQEAWQSHKNVLRLPRRGFASPRNDGKVDPVARPRDDTLFS
FT                   QDDILFNLPQKLDKENLIDDKKILKYQKNERVDFDYTDSFLNLDEALNASHYCIYCHKQ
FT                   SKDSCSKGLLQPQNRHCEERSDVAISSNLLRLPRSFQSRSSDGLKQGCPLKQKISEMNY
FT                   VKAQGFNLSALAIIVIDNPMVAATGHRICNDCSRACIYQKQDPVNIPLIESNILEETLK
FT                   LPYGLEIYLLLTRWNPLNIYAPLPKKPTNYNILVTGLGPAGFSLSYYLLRSGHNVTAID
FT                   GLKITPLPFNVHKPIKFWHEYKNLLSERMPRGFGGVAEYGITVRWDKNNLDILRLILER
FT                   NNNFKYYDGVALDFNITKEQAFDLGFDHIAFCIGAGQPKVLDIENFEAKGVKTASDFLM
FT                   TLQSGGAFLKNSNTNMVIRMPIAVIGGGLTSLDAATESLYYYKKQVEEFAKNYIEKDLT
FT                   DEDKKIAEEFIAHARLFKEAKSNEELRKVFNKLGGATVYYRGRLQDSSAYKLNHEELIY
FT                   TLALGVDFKENMQPLRINVDKYGHVEGVEFKTRHCEQSKTAWQSQEFSLTRLPRQCYAF
FT                   PRNDVKAKTVIMAIGIENNTQFDENKYSYFGDCNPKYLGSVVKALASSKEGYEAINKIL
FT                   INNAPSFKNSYKDFCTQLDYLLISRIHKINILDDKTFELIIHSPLAAKNFKFGQFFRLQ
FT                   NYSEDIARLIEPVALSATDIDVEKGLIKFVIYEVGKSTSLCKTLSENEKVALMGPTGSP
FT                   LEVPQNKKIVIVDSEVGNIGLLKVLKENNNEVIFVTYPDIKIRKLVSVDIVIINTSPDI
FT                   IEELQSLKNEIFGENTELIVSVNSSMQCMMKGICGQCIQKVKGEQKYIFACSRQNQNAE
FT                   IVDFKSLKTRLRQNSLQEKMLRHCERL"
FT   repeat_region   3590..3654
FT                   /note="RPE-7 Full"
FT   repeat_region   complement(3923..3980)
FT                   /note="RPE-7 Full"
FT   repeat_region   5240..5307
FT                   /note="RPE-7 Full"
FT   repeat_region   6282..6398
FT                   /note="RPE-6 Full"
FT   gene            complement(6426..7220)
FT                   /gene="lpxA"
FT                   /locus_tag="RF_0006"
FT                   /note="RF0006"
FT   CDS_pept        complement(6426..7220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="RF_0006"
FT                   /product="Acyl-[acyl carrier
FT                   protein]--UDP-N-acetylglucosamine O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60857"
FT                   /db_xref="GOA:Q4UNJ9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNJ9"
FT                   /protein_id="AAY60857.1"
FT                   /translation="MSNSNIHPTSLIAEKAKLGKNVKIGPYCIIGPEVVLHDNVELKSH
FT                   VVIEGITEIGENTVIYPFASIGQPPQILKYANERSNTIIGSNNTIREYVTVQAGSQGGG
FT                   MVTRVGNNNLFMVGVHIGHDCKIGNNVVFANYVSLAGHIEVGDYAIIGGLSAVHQYARI
FT                   GEYSMIGGLSPVGADVIPFGLVSSKRAVLEGLNLIGMNRKGFDKADSLSALKAIEEIFS
FT                   GEGNFAERIKQVAEKYKNNSIVMQIIDFLNQDSSRAFCRFEK"
FT   gene            complement(7229..7666)
FT                   /gene="fabZ"
FT                   /locus_tag="RF_0007"
FT                   /note="RF0007"
FT   CDS_pept        complement(7229..7666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="RF_0007"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60858"
FT                   /db_xref="GOA:Q4UNK0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNK0"
FT                   /protein_id="AAY60858.1"
FT                   /translation="MIIDITEIMDLIPHRYPFLLVDRVLEIDLNKSIKGIKNVTVNEPQ
FT                   FTGHFPARPVMPGVLMVEAMAQLAAILVAKSLGSTKNKEVFLMAIENAKFRRIVQPGDT
FT                   MYIHATIDQQRANVWKFSSTVTVEGEMAAESKFTAMIKDKS"
FT   repeat_region   complement(7714..7829)
FT                   /note="RPE-6 Full"
FT   gene            complement(7897..8937)
FT                   /gene="lpxD"
FT                   /locus_tag="RF_0008"
FT                   /note="RF0008"
FT   CDS_pept        complement(7897..8937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="RF_0008"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60859"
FT                   /db_xref="GOA:Q4UNJ8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNJ8"
FT                   /protein_id="AAY60859.1"
FT                   /translation="MVSSNFYKNLGPRKLTAIIDFLHDIIEPPKIHEDIAIHDIKILQE
FT                   ASPNDISFLSNPKYSEFLKTTKAAACIVPKNFTGEANPNTVLIHAENSYFAYGKLIDFF
FT                   YTPIKSYPAKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDNSIIEAGSFIGRGVTI
FT                   GRNARIEQHVSINYTIIGDEVVILAGAKIGQDGFGFSTEKGVHHKIFHIGIVKIGNNVE
FT                   IGSNITIDRGSLQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQAGIAGSSTIGKYCAL
FT                   GGQVGIAGHLNIGDGTQVAAQGGVAQNIEAGKIVGGSPAVPIMDWHRQSIIMKQLVKTS
FT                   NSKLKK"
FT   repeat_region   complement(9094..9196)
FT                   /note="RPE-4 Full"
FT   repeat_region   9197..9221
FT                   /note="RR-2 Full"
FT   gene            9700..10440
FT                   /locus_tag="RF_0009"
FT                   /note="RF0009"
FT   CDS_pept        9700..10440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0009"
FT                   /product="Predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60860"
FT                   /db_xref="GOA:Q4UNJ6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNJ6"
FT                   /protein_id="AAY60860.1"
FT                   /translation="MYNLVFYGGLNSEKYLEGFLGQLLKDKGFDPEITFKQLHDSQKTN
FT                   IDLYVVCTNLSTQFPEILSYENAPDEKVVKFVHASGAFPIYFQPVQKTVQGVVSTYVDG
FT                   GVTNNYPVEVFDDKTAARSLPQTDNKNYKTLGFKPINKEILEAYQNGTEPKPFVDTTTV
FT                   VDQLYALAEVLTSSDLISCFQNHDRTVFIDDHNISALSFDITAEQKEALINSGYSATCD
FT                   YVTRMENIMLAGLAVNDSSDSLVL"
FT   repeat_region   complement(10499..10594)
FT                   /note="RPE-7 Full"
FT   gene            10946..11248
FT                   /locus_tag="RF_0010"
FT                   /note="RF0010"
FT   CDS_pept        10946..11248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0010"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60861"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNJ7"
FT                   /protein_id="AAY60861.1"
FT                   /translation="MNTKTAAERIAIIEPYLDFIIKDKDLLREIYPNGINGELKIELIL
FT                   AKKPYNTYAYYKLIRNLFKLPHRKIILIIDKQLLKASLGLFRSIILGTLIISKLS"
FT   repeat_region   11382..11403
FT                   /note="RPE-6 Partial"
FT   repeat_region   11450..11544
FT                   /note="RPE-7 Full"
FT   gene            complement(11601..12578)
FT                   /locus_tag="RF_0011"
FT                   /note="RF0011"
FT   CDS_pept        complement(11601..12578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0011"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60862"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNJ5"
FT                   /protein_id="AAY60862.1"
FT                   /translation="MFTSVKKFFGIHEESDEILYNQLISLLEKLTRVITAKDSDKKEVE
FT                   KLIDKIKNTNLFNQSDENGNTTLILAADAGLEEACLKLIPKMSDEAINMIENIRGQPAL
FT                   VKAMWRDLDSVCIELIPKMSKENINAIDNCGRTLLMLAAKKGMTTVSKMFINLMPPEMI
FT                   IHADNEGNTTASYADTDHAFADTTKTIKLLQEKLLKSLASFINKSFLKKDHVKKGVDNF
FT                   FKIVWATKFYKKIKVNKELLASYLQEQNNDPESTNTPESMIKTMNNFIKLHLFAIAGVC
FT                   KIIQPAFETSSLHLSCLPKEAICCIISHLENEKWGVDAVLLGEN"
FT   gene            complement(12718..12793)
FT                   /locus_tag="RF_RNA01"
FT                   /note="RFRNA01"
FT   tRNA            complement(12718..12793)
FT                   /locus_tag="RF_RNA01"
FT                   /product="tRNA-Phe"
FT   repeat_region   complement(12798..12836)
FT                   /note="RPE-5 Partial"
FT   repeat_region   complement(12850..12946)
FT                   /note="RPE-7 Full"
FT   gene            13117..14094
FT                   /gene="nifR3"
FT                   /locus_tag="RF_0012"
FT                   /note="RF0012"
FT   CDS_pept        13117..14094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifR3"
FT                   /locus_tag="RF_0012"
FT                   /product="Putative TIM-barrel protein, nifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60863"
FT                   /db_xref="GOA:Q4UNJ4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNJ4"
FT                   /protein_id="AAY60863.1"
FT                   /translation="MIKIGDIELSSNVILAPMSDITDLEFRKLVKRFGAGLVVSEMIAS
FT                   RAMVVKSRQSMQKCAIVHDDPTSACVQLAGCEPNVIAEAAKMNEDMGAKIIDLNFGCPA
FT                   KKVVGGYAGSALMRDEQLAAKIFEATVKAVKIPITVKMRMGWDDNTKNAPDLAKIAESS
FT                   GVQMVTVHGRTRCQFYSGNADWDFIRSVKEAVKIPVIANGDITNFAKAKEALQKSGADG
FT                   IMVGRGAYGKPWLVSQIAHYLKTGEEKPAPSIAEQLDIVTEHYNAILDYYGESVGVPIA
FT                   RKHIGWYSSGLPSSAEFRGAVNLMNDPAEVKEKIAEFYTSVMKE"
FT   repeat_region   14141..14236
FT                   /note="RPE-7 Full"
FT   gene            14243..14626
FT                   /locus_tag="RF_0013"
FT                   /note="RF0013"
FT   CDS_pept        14243..14626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0013"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60864"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNJ3"
FT                   /protein_id="AAY60864.1"
FT                   /translation="MTDKQVHVTMLEWVVKRNILSYIFIILFFNLSYADEKAAIITDYK
FT                   PVFLPVIAENKKIKIAIRSYLNNEKSYFVLVDPNSFKTELVLQELVILPTNKTEKENLL
FT                   KKLNKTLHLIYCKITVLRVACIK"
FT   gene            complement(15083..15208)
FT                   /locus_tag="RF_0014"
FT                   /note="RF0014"
FT   CDS_pept        complement(15083..15208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0014"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60865"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNJ1"
FT                   /protein_id="AAY60865.1"
FT                   /translation="MSRNKNAFLIGSNFNSGNIGIIKSIPAFSLLLPCTNMKEPS"
FT   gene            15303..15551
FT                   /locus_tag="RF_0015"
FT                   /note="RF0015"
FT   CDS_pept        15303..15551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0015"
FT                   /product="Antitoxin of toxin-antitoxin system StbD"
FT                   /note="COG2161"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60866"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNJ2"
FT                   /protein_id="AAY60866.1"
FT                   /translation="MKSISSKEAQNHFGELMNQAVKSPVVINKYGKPTVVLISHEEYEK
FT                   FNQLEDMYWAMQAKNASKSGFLSENESKDFLNKILKE"
FT   gene            15554..15832
FT                   /locus_tag="RF_0016"
FT                   /note="RF0016"
FT   CDS_pept        15554..15832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0016"
FT                   /product="Probable toxin of toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60867"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNI9"
FT                   /protein_id="AAY60867.1"
FT                   /translation="MTLILSKSSQKFIEKLDIKQARQIAIKIKELYELINHPNDSKLLK
FT                   SSAEQYYRVDVGEFRIIYQKDKIKTCIFLIGKRNDGEVYKLFKRKIK"
FT   gene            complement(15840..16355)
FT                   /locus_tag="RF_0017"
FT                   /note="RF0017"
FT   CDS_pept        complement(15840..16355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0017"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60868"
FT                   /db_xref="GOA:Q4UNJ0"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNJ0"
FT                   /protein_id="AAY60868.1"
FT                   /translation="MLILNNEEETKKLAKLLAQSLKPNDIVLLNGDLGAGKTFFCREII
FT                   KHFCGENTNIISPTFNLLQTYKTSNFTIYHYDLYRLKSPEEIYELGFEEALNGNLILIE
FT                   WSEIIKHLLTPPLIEVNLEVLDENKRLCSIITNSSESSLIDFLQASPLFSTKLDIQRDK
FT                   SPTRKIEL"
FT   gene            complement(16343..17356)
FT                   /gene="znuA"
FT                   /locus_tag="RF_0018"
FT                   /note="RF0018"
FT   CDS_pept        complement(16343..17356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="RF_0018"
FT                   /product="Zinc/manganese ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60869"
FT                   /db_xref="GOA:Q4UNI8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR022436"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNI8"
FT                   /protein_id="AAY60869.1"
FT                   /translation="MRDSVLNHHCEEKLKILTKQSRTKILRLPRSFQSLAMTILLYLTF
FT                   FSLTSYAKPKIVVSITPIASIVSMLVKDKADIESLAISSDCPHHYNIKPSDLVKVKNAD
FT                   IAIYINEQFDGFAEKLIDNHSKNIIKISDIKSLTIIKDIVKSVGFNYKERGAKPITNRR
FT                   ATSDDGSEFKSFDYNWHIWLDLDNVRILLQEFARIFSKNFPELQEDINNNLSAALKELN
FT                   KLQEIKNNEFATIKDVILLSDSSEYFFVNTNIKTSKLYSESQKSLRYIRKLEDLIKESN
FT                   NKCLVLSSEQNSRLYDKLNAKIIILNSENWNVKNINSSTFQNQYLQMINQVKKCLY"
FT   repeat_region   complement(16826..16929)
FT                   /note="RPE-2 Full"
FT   repeat_region   17268..17334
FT                   /note="RPE-7 Full"
FT   gene            complement(17353..18510)
FT                   /gene="pcnB"
FT                   /locus_tag="RF_0019"
FT                   /note="RF0019"
FT   CDS_pept        complement(17353..18510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="RF_0019"
FT                   /product="Poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60870"
FT                   /db_xref="GOA:Q4UNI7"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNI7"
FT                   /protein_id="AAY60870.1"
FT                   /translation="MQVIHKTLKIPSKGYKKILSLLNEKGHARLIGGCVRDALLEKDSY
FT                   DIDIATNLTPDEVINILSKAKIKTIPTGLKFGTITAILNEEKFEITTLRKDIECNGRHA
FT                   KVIFTNDFAEDAARRDFTINALSYCPFKNEIYDYFEGFKDLQQEKVVFIGEALDRIKED
FT                   YLRILRFFRFSSYYANQLNDGSFKACKALKDGLKTLSRERIKSEMDKIIVSKKAAQILE
FT                   AMSHIGILELIFSIQNYEIKFFEQSKELELATNYALLLYNLKNINSKLLLDWKFSRQEA
FT                   MQILSILNFLNDSKDSMKKIWFEKKNYKEYLLAACKIGKLNHSQVKEFIYKYDVLLRPK
FT                   FQVNGNDLLNMNIEKKEIGTKLEYLKNFWIEQDFKPSKLELLEKL"
FT   gene            complement(18494..19708)
FT                   /locus_tag="RF_0020"
FT                   /note="RF0020"
FT   CDS_pept        complement(18494..19708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0020"
FT                   /product="ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60871"
FT                   /db_xref="GOA:Q4UNI6"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNI6"
FT                   /protein_id="AAY60871.1"
FT                   /translation="MLCVSGLHLSLVVMIIFLTTRFLLNLSNYLAYNFNIKLISAYCSL
FT                   IGSFGYLELSGMQIAATRAFITAAIFIYGIIIGRSCFPLRSLAIAAFIILSLNPEYIFH
FT                   PSFQLSFIAVLSLVAGFEFYLKNSWLIGENKGIFGAVKFYMASNIYSSFLASIITVPVV
FT                   INQFFIFSTYSVPANLIVVPITSFFLMPLALLSLPFTMIGFDSYILKLMRFFIDIIIKS
FT                   AAYFNSLPRSVWYFGYITNFSILLFLFGFFWICIWKTSWRLLGLVIMIISFIFMFYSPK
FT                   PELIFDTNHMAVGIKDKDGKLIIYADKIPTFNRTYWANWFGQKDSMVLPLKDNIFITNH
FT                   GQKIVINNNNHCEKAEIHINLNYKAKCHGSLITINHNFLRKSPVILIFCNKKECTVKSN
FT                   NASYT"
FT   gene            complement(19611..20513)
FT                   /locus_tag="RF_0021"
FT                   /note="RF0021"
FT   CDS_pept        complement(19611..20513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0021"
FT                   /product="ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60872"
FT                   /db_xref="GOA:Q4UNI4"
FT                   /db_xref="InterPro:IPR022438"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNI4"
FT                   /protein_id="AAY60872.1"
FT                   /translation="MLDFELSFTTIFFIFCACLILTFARNSNIFLQFTYWMIIAFIFGV
FT                   FISKYRVTNLHGETLHKPIITKISGNIESIKPTIIGGQIVLNNIKIEKINRNLQKVKIS
FT                   IPRKYLYSSEMQSDYMKINLEKSNRSVSRGAERTEVREHPRTYKDDVANFGGSSSIKEI
FT                   RVNDRITLLAKLYKPQNAILPGGYDFGFYAYIGANGYAMSQPQIIERNETNFDSFIYRV
FT                   RIFIYNNLIEKLGKDKGNFAAAILLGETKGLNRQIMQDMRQSGIITRALRFRFAFIFSR
FT                   DDYFPYYKIFIKSLKLFGI"
FT   repeat_region   complement(20035..20159)
FT                   /note="RPE-5 Full"
FT   gene            20794..25905
FT                   /gene="sca1"
FT                   /locus_tag="RF_0022"
FT                   /note="RF0022"
FT   CDS_pept        20794..25905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca1"
FT                   /locus_tag="RF_0022"
FT                   /product="Cell surface antigen Sca1"
FT                   /note="212 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60873"
FT                   /db_xref="GOA:Q4UNI5"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNI5"
FT                   /protein_id="AAY60873.1"
FT                   /translation="MNKLTEQNLLKKSRFLKYSLLASISVGAIIAIPFEGMASSKQKAL
FT                   FQNALEKKLSLRLSQSNGNRDTTNTPQQIGTVIVPEPERNTYTSSEIREMEISKQSKAS
FT                   NPLKDIPIEDHYKKVARSKSDVGKARKVRPPTRSKTFVDTEKVEQNQNNYTHEPTEQTP
FT                   QKPEIIITASSPTVSPASNGFVTAPNTPNTTLTSPEHYTTAPGTPSTPVTPYQPTPDSK
FT                   PNDNLEAKTPPNTNSKAVRRLSFSSEPQQTVVQPSTQAKPPVPPKPLLLSSAGVVAKKV
FT                   VSNILRVNEMLGIKLAEVESTIKNTQGKENKKPLQQLKKQIASSQKTTEKLKSEAAKIG
FT                   IKIKELDEENKSLKTGRVKNKRELDKDNAKLKENNKKIDKLQQKLTNKNNEANRLSEEI
FT                   DISVKKVVLIKPQVKAPVTEMPPAGSFLNQQQQLEVLTQQQKVNAARQAVVDKKRAEAN
FT                   GVKRNSAEYKDLISEREEIQLEQNQRHIAVEKTKKQQQAEDKEQRQEAQKQLSKIKKQE
FT                   KAIKAASDEAQKILNDAKKEASRTKLKKLQEQMDNHVAMVTNDKIEENIKKLEGLALTP
FT                   STTSSAATISKQSLTAKSTMQLSHELQRTLPEDEDGYLEPIKVQQQPYTVMLSNQEVAD
FT                   PKSMDSGLGSLPSGIETDEDTEFNLGWGNGHHKELILSVDSKLIEKAAQLISGLDVKRS
FT                   EILQTTSPSQQKSLNLALQGIENDYQEAIEVYQGLQQALIHKSEDIKAYNAEAEKRLDA
FT                   IKSRADKYFNNIETDADVGFNQDWSNVHTQTAQSDSVLKMQQALLEKRSKEGSNPNFTT
FT                   YLDPQPGEEGLKSIDSGLGSLPIDASVIPQYVEELNNLASFSSLNQIQQKKPLIITNML
FT                   LSETSALSDDEFRAVANEVHPKIRPILTYNRQKEKEAKLVEAEAAHSQVVQNAIKTPNS
FT                   TQAKEAVENAAKLFGQYNNSFKLTQALRDEHRKKYYETPKKVTDSINSLDLAVPAESQQ
FT                   LKEPRSKSLEALDLAGSVSSQLKQAEYKSVLSPSSSVNSLLSNEDEQNHEFEIPKSLSF
FT                   SFGSLNSDAESQQLKEPRSKSLEALDLAGSVSSQLKQAEYKSVLSPSSSVNSLFSNEDE
FT                   QNHEFEILKSLSFSFGSLNSDAESNLSWDNTGDIGVGHRYGAEDSCPTPDQSSSKIANS
FT                   SDKNSSETKLALLRTYQMAVIVKRQELEQLPSTSSGADQNTQKIKELKEVEVTMHDAIN
FT                   ACIADSSKLNDVSFEEINEALKKLGSEIPESAISDFESKAQKDPEAILDGSILQEMLSS
FT                   KDSLPSGDEEQEDTEVTESGIQKAGDKGLLALPVSSNECALALSDGREKECLALGDGSE
FT                   EKEETIEQLSDSVEGNLKIEQEEKKEMQTQISKNAPTLNQAKVVNTIVNNMIRNRLDAS
FT                   MNMSNNMVAVGAGDEEESRIKRGLWMRGMYGTNNHGRVENMTGYRGTNKGATIGFDVEI
FT                   DNNILGIAYSNVHSVFKFKNSKNNDKELIDSHVVSIYGQKELPRNFALQALVSASKNFI
FT                   KDKTTYSYGDTKIRSNVKHSNHSYNAEALLNYNYLLQNKLVITPNIGLRYGKSRDGVYN
FT                   ETGINVQEIALTMKENNILSGIVGTKVKVPLKDVLKFNNLGLTFQGAVEHNFKEKTQRI
FT                   NRVVKIFDTEFKQNYAIPKQPKTSYNLGTGIIGSIKNTTISLDYNYYLNKHYRSHQGSV
FT                   KLKVNL"
FT   repeat_region   complement(25983..26080)
FT                   /note="RPE-4 Full"
FT   gene            26143..26217
FT                   /locus_tag="RF_RNA02"
FT                   /note="RFRNA02"
FT   tRNA            26143..26217
FT                   /locus_tag="RF_RNA02"
FT                   /product="tRNA-Glu"
FT   gene            26398..26718
FT                   /locus_tag="RF_0023"
FT                   /note="RF0023"
FT   CDS_pept        26398..26718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0023"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60874"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJL5"
FT                   /protein_id="AAY60874.1"
FT                   /translation="MKADVFSSKNLVNTSDYQTIIACLEQNVPSFVHLDFSNLHLTLPQ
FT                   LEEVAAKIQNNSFIGNVSWGKMPNASSDFVQKIESKIILNNQNYKHHPNDFVQVYLVCT
FT                   LI"
FT   gene            26886..28085
FT                   /locus_tag="RF_0024"
FT                   /note="RF0024"
FT   CDS_pept        26886..28085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0024"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60875"
FT                   /db_xref="GOA:Q4UNI3"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNI3"
FT                   /protein_id="AAY60875.1"
FT                   /translation="MVLAYRGTTFEKLDLLKANSPLKTHLKSILGGQIVAQQAAAYEAT
FT                   GEITKYANEINYNLSFTGHSLGAWLAELSLYFAHRDFHYPEAKAITFDSPGSAKIMDSF
FT                   KPNILSHETTFDVKNLNITTYLSAPNFVNVCNQHIHKAYRLFPKITAAEYNSKIINTLN
FT                   KAVPIKSYITLLSLNGDLLDSMLDAFDLETGKPIRSEKILDWPCIEYDPKDDTLGKKAI
FT                   DKVLNFIPIGSTIKDLASKLIHRNITATTLGSFIEVIDQLVSGNIASEQFLEIYKHLEN
FT                   NAAQGYPSKEIITPEGKFELSYKGHYRIEKVNLSVDIANTNNKGSSDWYLAQLSKLSID
FT                   KKEIPNLIKQQLKAIKELYEIKPQYGKYYIFTNSPNIKVDDLKEQILRLIEVSSEVKEV
FT                   "
FT   gene            28185..28883
FT                   /locus_tag="RF_0025"
FT                   /note="RF0025"
FT   CDS_pept        28185..28883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0025"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60876"
FT                   /db_xref="GOA:Q4UNI2"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNI2"
FT                   /protein_id="AAY60876.1"
FT                   /translation="MQKIEEVLSEKRFVTVSAFAGTGKSTIAIEYGCKQRDEAKKIVRF
FT                   IYADSAYKVLEAYRQLAKEFAIYTIGEKKEDIIRLVHERIANLNSNTLFVFDNVEAYKD
FT                   IETYINGIINMPNDKTQVIITTRNNNLSEDITNIKLLPFSNEEARLYLEKSLGNRLNEK
FT                   DSYKLVEEFGSKDAVSPYRLSKAVAYLKENKLLKVNDYINYFKNSKDDHIETVLLLQLL
FT                   EKSPLAWLIL"
FT   gene            28998..30647
FT                   /locus_tag="RF_0026"
FT                   /note="RF0026"
FT   CDS_pept        28998..30647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0026"
FT                   /product="TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60877"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNI1"
FT                   /protein_id="AAY60877.1"
FT                   /translation="MNLTYKNEQAGLQLHRLMQSITKQYINKYKEHAIDEQKIYIRLLE
FT                   VLNNLFPRVTDIPNKNWENAKLLYPHIIKILNNDIKIDKLRRANLYQKIGYYNESILCR
FT                   FADSLKYHEEALKIYQELYQGNHHNIAISFNNVGSAYKDLGETSKGLKYLEEALKMLKA
FT                   LYQGNHHNIATSLNSVGLAYQNLGDISKGLQYLEEALKILQELYKGNHPDIASSLNNIG
FT                   LAYRDSGYNSKGLKYLKEALKLFQELYRGNHPKVAESFGSIGLTYHKLGNISEGLKYFE
FT                   LALKMEQELYKGNHPDIAISLSNIGFTYHRLGNIFKGLKYFEDALKMYKALYQSNRPYV
FT                   ATSLNNISITYQDSGDTNKTLELKKQAYLMFMQTLSSNYAITKELKNYLEKNAPEFIKN
FT                   NETREFILQRGDFEEVTLEIKQKIQKNVLNKIYISAAKDKWNSKFSILGNWGVKGYLGD
FT                   RYLAKQLRALANVKNIEIAKMLCFEAICLGAINSPSKNFTCVKEFAASYPELTNKITNE
FT                   HPEYFIDGSILRTCINDEEILRKLLGSGCVAM"
FT   gene            complement(30640..31134)
FT                   /gene="atpF"
FT                   /locus_tag="RF_0027"
FT                   /note="RF0027"
FT   CDS_pept        complement(30640..31134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="RF_0027"
FT                   /product="ATP synthase B chain precursor"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60878"
FT                   /db_xref="GOA:Q4UNI0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNI0"
FT                   /protein_id="AAY60878.1"
FT                   /translation="MNFLDESFWLAVSFIIFVYLIYRPAKKAILNSLDAKILEVQEKVL
FT                   KAEKLKEDAALLFEQTNAQIQKLETLRSQMIEESNEVTKKIIQEKTKEIEEFLEHKKSD
FT                   AIQLIQNQKSTATKELQDEFCDEVIKLVSEYFQSAKFSESNIAKNLMDKSDSSHNNDKS
FT                   T"
FT   repeat_region   31198..31286
FT                   /note="RPE-7 Full"
FT   gene            complement(31240..31749)
FT                   /gene="atpX"
FT                   /locus_tag="RF_0028"
FT                   /note="RF0028"
FT   CDS_pept        complement(31240..31749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpX"
FT                   /locus_tag="RF_0028"
FT                   /product="ATP synthase B chain"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60879"
FT                   /db_xref="GOA:Q4UNH8"
FT                   /db_xref="InterPro:IPR003319"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNH8"
FT                   /protein_id="AAY60879.1"
FT                   /translation="MPQFDIATYYSQIFWLIVTFGLLYIFVYKFITPKAEEIFNNRQTN
FT                   IQDNITQADTLTQEVEKLNKYHNEEIDKTNTEIDRLKKEKIYSLESEFLIKKKNLEQDL
FT                   KNSINHNIEDINLAAKQFRTNKSEAIIKLAVNIIEKIAGAKADMDSLKSLRHCEENYEV
FT                   IDEAIQ"
FT   gene            complement(31768..31992)
FT                   /gene="atpE"
FT                   /locus_tag="RF_0029"
FT                   /note="RF0029"
FT   CDS_pept        complement(31768..31992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="RF_0029"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60880"
FT                   /db_xref="GOA:Q4UNH9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNH9"
FT                   /protein_id="AAY60880.1"
FT                   /translation="MDMVSLKFIGIGLMAIGMYGAALGVSNIFSSLLSSIARNPSAAEN
FT                   LQRMALIGAGLAEAMGLFSFVIAMLLIFS"
FT   repeat_region   complement(32030..32152)
FT                   /note="RPE-5 Full"
FT   gene            complement(32229..32957)
FT                   /gene="atpB"
FT                   /locus_tag="RF_0030"
FT                   /note="RF0030"
FT   CDS_pept        complement(32229..32957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="RF_0030"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60881"
FT                   /db_xref="GOA:Q4UNH7"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNH7"
FT                   /protein_id="AAY60881.1"
FT                   /translation="MTHSPLAQFDIKKLIDIKMFGFDVSFTNSSIYMLLASILALTYFY
FT                   LAFYNRKLVPSRLQVSAEIVYNLVADMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMT
FT                   PYSFTATSHIIVTFTLAILVFLTVTIVGFVKHGLRFLTLFLPHGTPLWLAPLMIVIELF
FT                   TYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLKFLPIPLMVILIGFEIFVAIL
FT                   QAYIFTILSCMYLNDAINLH"
FT   gene            complement(32962..33291)
FT                   /locus_tag="RF_0031"
FT                   /note="RF0031"
FT   CDS_pept        complement(32962..33291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0031"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60882"
FT                   /db_xref="GOA:Q4UNH6"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNH6"
FT                   /protein_id="AAY60882.1"
FT                   /translation="MVKLRDDRGEIDPRLLADGDKLMNTEKLKDIKARIKDLKTSKISN
FT                   SKIQQEISPFTIAVDLVSGTMIGVVIGIFTDKFFNSKPLFLIIFTIIGMIAGFNIIRQK
FT                   VNNKK"
FT   repeat_region   33270..33356
FT                   /note="RPE-4 Full"
FT   gene            complement(33416..34252)
FT                   /gene="dsbG"
FT                   /locus_tag="RF_0032"
FT                   /note="RF0032"
FT   CDS_pept        complement(33416..34252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="RF_0032"
FT                   /product="Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60883"
FT                   /db_xref="GOA:Q4UNH3"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNH3"
FT                   /protein_id="AAY60883.1"
FT                   /translation="MRSIFIVPIFLLFLSSCSEEKTQNKNQEEKQIIVQETLQNNNTSQ
FT                   EINQEAVNSENAAESIVPANDNNQTDEVSTPPSQEQKNPEIKPVKVTFKVDDNDMVLGN
FT                   KKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAILA
FT                   RCKGDINSFVQFHNIILQQQDKWAYSNKYRELLTDIGQLGGVPPEEYKQCLNSDKITET
FT                   LIANTNFVANAPKFIGTPSFFVNGVQTGNYSIDSISTAVDKALEEQKEKAKNEMSL"
FT   gene            34413..34946
FT                   /locus_tag="RF_0033"
FT                   /note="RF0033"
FT   CDS_pept        34413..34946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0033"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60884"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNH5"
FT                   /protein_id="AAY60884.1"
FT                   /translation="MANTTQSENKTEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGTE
FT                   IKVYVISFSQDKMTLKVPVSRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQ
FT                   EYEGKINSGNIVAIAEVLRDLHKNVDNDRSYSERTLYESALNRLAGELAILENIHPTEA
FT                   INKLVEVLREKLVA"
FT   repeat_region   complement(34957..35025)
FT                   /note="RPE-7 Full"
FT   gene            complement(35094..36698)
FT                   /locus_tag="RF_0034"
FT                   /note="RF0034"
FT   CDS_pept        complement(35094..36698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0034"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60885"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNG9"
FT                   /protein_id="AAY60885.1"
FT                   /translation="MTKQANKISYDEVPYSPFTFSYTSPPYLRTIGKLFGLNPSPLETA
FT                   KVLDIGCGVGVNLLNFAETYPKSQSLGVDLSKTQIELGKKIISDLKIKNAELKALSILD
FT                   LDESYGKFDYIVCHGVYSWVPKEVQDKILEVCNKLLNPNGIAFVSYNTLPGWNMQRTIR
FT                   EMMMFHSELFNTSHDKLQQARLLLKFINDSLESSTTPYSNFLRDETKLLSAYTDSYVLH
FT                   EYLGEINTGTYFHQFIEKAQNNNLNYLGDTSITAMFIGNLPTKAAEQLQAVNDIVRTEQ
FT                   YMDFITNRKFRSTLLCHQNIPINRKIEFNNLKGFYTSLNIRPVTPEKDVDLTNEQENIS
FT                   FYYENLPDPFISTTSPIIKAILYVYAENISNPISLEQVAKEAFKKLGKYQLQDFLATLE
FT                   QHFITFIFQGYLKIFETKPHAIATITEKPKTSEFARYQTKQAHFNNVTSVFSVTNRLND
FT                   MVGIPIHEKYILEMLDGTHNIDDIKKGVLEKINSKLLTARDDKGQEVTDPKLLKEFVDY
FT                   VVTASLEKFRMSYMLVG"
FT   repeat_region   complement(36774..36847)
FT                   /note="RPE-7 Full"
FT   gene            complement(36903..38165)
FT                   /gene="recF"
FT                   /locus_tag="RF_0035"
FT                   /note="RF0035"
FT   CDS_pept        complement(36903..38165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RF_0035"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60886"
FT                   /db_xref="GOA:Q4UNG8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNG8"
FT                   /protein_id="AAY60886.1"
FT                   /translation="MATSFYKICGTHVLSIRSVPRLVNSLLFLKLTFVYQLFIYSKYKY
FT                   NASLTIILFHKMKNIFLHSLTLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISL
FT                   FYPGRGLRSAKLADICKASEDQCLVKALLQSKLGLAEFTTQFKRSSNRRITEYNESKIA
FT                   NNELSKFTSMVWLTPQMEGIFTSGSSDRRKFLDRIVYNFDSKHAELVSKYEYYMYERNK
FT                   ILAEDIRDDNWLKIIEEKMADMSSHIANNRLKTLEFMQQAIDELENEFPKADLSIDGIV
FT                   EQKILDGKENIVNFITAELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGE
FT                   QKAILIAIILAEMNYAIKLTKIAPILLLDEVFVHLDDKRRGYLIEFFTGLNMQLWVTAT
FT                   DLEGIENFANKAQLIKLPIIL"
FT   gene            complement(38035..38823)
FT                   /locus_tag="RF_0036"
FT                   /note="RF0036"
FT   CDS_pept        complement(38035..38823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0036"
FT                   /product="Pyrroloquinoline quinone (Coenzyme PQQ)
FT                   biosynthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60887"
FT                   /db_xref="GOA:Q4UNG7"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027572"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNG7"
FT                   /protein_id="AAY60887.1"
FT                   /translation="MKFLEQLNIDLEQYNLLNHPFYQLWNMGKLTHSTLQIYAKEYYHH
FT                   VTAFPRYISAIHSKCSDIKARQILLGNLIEEEQGEENHPELWKRFAEGLGCLRSRLTSE
FT                   PKLNSTQKLVQGYFNLTEKSFSIGLGALYAYERQTPEVSDSKIQGLQKFYGISDYRTLQ
FT                   FFIVHSKVDQWHTQECANLINNLSSKEQKLVYQGAIKGAKLLWQFLDGIYTRSISKIGY
FT                   VVLQDLRYSRIKYTLRSSPCELLALFEIDLRIPTLHLLEV"
FT   repeat_region   38062..38186
FT                   /note="RPE-5 Full"
FT   gene            complement(38833..39018)
FT                   /locus_tag="RF_0037"
FT                   /note="RF0037"
FT   CDS_pept        complement(38833..39018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0037"
FT                   /product="Dihydrofolate reductase FolA"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60888"
FT                   /db_xref="GOA:Q4UNG6"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNG6"
FT                   /protein_id="AAY60888.1"
FT                   /translation="MVGGAEIATLFLEQNLIDEFLLTKINKNYDGDAFFPIDFLAGWHS
FT                   VIIDKTNNYQIYKFIK"
FT   repeat_region   complement(39091..39224)
FT                   /note="RPE-1 Full"
FT   gene            complement(39114..39458)
FT                   /locus_tag="RF_0038"
FT                   /note="RF0038"
FT   CDS_pept        complement(39114..39458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0038"
FT                   /product="Dihydrofolate reductase FolA"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60889"
FT                   /db_xref="GOA:Q4UNG5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNG5"
FT                   /protein_id="AAY60889.1"
FT                   /translation="MKNRKIIGIMACDPQGVIGNKGQMPWSYTKEFEYFYQTVKNNIIV
FT                   MGRKTFDSIPAKILKNCICIVFSRNTPLQSYNNRTLRKLAYREEFEGDTERRTAAYVRI
FT                   RVPDRRTNYP"
FT   gene            complement(39448..40836)
FT                   /gene="folKP"
FT                   /locus_tag="RF_0039"
FT                   /note="RF0039"
FT   CDS_pept        complement(39448..40836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folKP"
FT                   /locus_tag="RF_0039"
FT                   /product="Folate synthesis bifunctional protein"
FT                   /EC_number="2.7.6.3"
FT                   /EC_number="2.5.1.15"
FT                   /note="bifunctional PppK and DhpS"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60890"
FT                   /db_xref="GOA:Q4UNG4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNG4"
FT                   /protein_id="AAY60890.1"
FT                   /translation="MRTEGLTKRRSQFFKFSEYTMIYISISSNLGNRLLNIKKALNLLK
FT                   SCDFRLLKQSIIFETQVILPPNADKAWNKSYLNMVVQGKSTLTPSKLLIELKKIEKQLG
FT                   RADSYDKWSPRVIDLDILLWSNCHIDLPDLKIPHPELLNRPFLIHLIAGLSLECRYTCP
FT                   TNNFYNNKTFAEIAHLIENQGVIRSLVLNPQFVGILNITPDSFSDGGLNFHKEDAVRNF
FT                   VRLINEGATIIELGSQSTRPSALIINEDEEYARLENVLEELREVIKEKEVIVSINSFTP
FT                   EVIKNVLKKYPISCINLVKNNLDNYTLRLIADYNCKIITMHSLAVPPQKQKCLDFDNSP
FT                   LANLNIWAEQETTKLEKYGFDRKNIILDPGIGFGKSVYQNLYILQHMKKFKNLGCEILV
FT                   GHSRKSYISAFYNSKASERDLETIAISKYLTEHGADYLRVHNVIEHQRFFVTDHMIKLS
FT                   SHEK"
FT   repeat_region   complement(40780..40903)
FT                   /note="RPE-5 Full"
FT   gene            complement(41384..42043)
FT                   /locus_tag="RF_0040"
FT                   /note="RF0040"
FT   CDS_pept        complement(41384..42043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0040"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60891"
FT                   /db_xref="InterPro:IPR020171"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNG3"
FT                   /protein_id="AAY60891.1"
FT                   /translation="MTNNQFSEDTKKIADQIKDALMGISNDLVLESKEVEEIFEELSQN
FT                   EEFEYEIERILAILNEQTMDLTQLQSRIILLIRKYLGKTKNLKLKMDEKLVNKNVAEVS
FT                   NYLMHQRSKIVRDANKNLANPKDKLQGITKQARMDLKRLIKSFAVYQVYMFMNPKRIAG
FT                   ETKLMNFAYNMIRGGMKLAKKYEGGKEKDIKSYSPRLIKKLEKAHAGFKKSGGISI"
FT   gene            complement(42136..44391)
FT                   /locus_tag="RF_0041"
FT                   /note="RF0041"
FT   CDS_pept        complement(42136..44391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0041"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60892"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNG2"
FT                   /protein_id="AAY60892.1"
FT                   /translation="MGLLKKNLTESSNILDSFYIKNEKYLTYKSSYLDAANSSSESTID
FT                   KFFLQKILSTTPTKFILAIKNIETKNSNSSLVKANLEKLVGIFEQFTKLLRYIDINESN
FT                   LSIVVTDSPANNNNTRISKIIDDTIKLGNFSDEQKIIINKIKDSIYLLPQASEQAKDYK
FT                   DLLNITDDNYIIPDEYNKITIDGENLTYILNSINVIDKEILISINEFKTYIEKKWKQNI
FT                   ESNLSFEDISAKTDKLKQLIDIVNCYKQLENNAKTIGSFLETVKKLNQLLETPKLENKL
FT                   ENLLNYLKYLSDIKFSEKENLVTINSAKWFNDLFSNLGAYNIKEKLLESFKHTICKDKD
FT                   SFYNKLNETIEKFYEDIKNNDVLDLKAINNIYNLKNFLQHINNSSPDIENLDNIKLFLT
FT                   KSFKNFNNVLGITINNSISNLEKLIGSVSKQEAKSLWKYITASKSITEISRNLDEVIYD
FT                   KLLHKPVLPDQELPIYNLLEKLLKETHKSINDCYKNENLYKHQLAEIYCGQAQIYTANG
FT                   STKLSKESIELYENAANLGSEEANIKLGKIEFKSGNYVKALEYFKTTTHISYAKEAFNK
FT                   LLHLKESELKKKIQQKNPQDIAKLTSEIIELYSSQGDFYNQYNLDISEKSLQDSLKVFF
FT                   LNTIALIEEQGRPKPYGILYDLSKELASMISSPCIQLKFIQQAEKYKNLAEKFKEEKLE
FT                   TDYTNITTSRSHDSYFKEPLLKFNDIIPNTSFKTYYDNNEDSSNMLGACYNSSEYPQ"
FT   gene            complement(44367..44831)
FT                   /locus_tag="RF_0042"
FT                   /note="RF0042"
FT   CDS_pept        complement(44367..44831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0042"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60893"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNG1"
FT                   /protein_id="AAY60893.1"
FT                   /translation="MYNYTAYVKRSNDKPKKQENTEIVDNTTPEDHPPQTLNDNTNETQ
FT                   PIQTPLNQNSFEITNNIENNKAENMRDTMMLKQEEIENFISDMLKDKNFIDLINKDSEK
FT                   YESIIDGNNKAIIILGQEKEDLNLIANFLKDGKLILESNEYGDWDFSKKI"
FT   gene            45059..45655
FT                   /locus_tag="RF_0043"
FT                   /note="RF0043"
FT   CDS_pept        45059..45655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0043"
FT                   /product="Sco2 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60894"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNH4"
FT                   /protein_id="AAY60894.1"
FT                   /translation="MRNNKNQMYIIKIFIALAMITGIIFLCLFYSSLTPSKLKIGAKTS
FT                   NMDDSPKIKFTLIDQEGKKFDSTHLQGHLSLIYFGTTYSLYDNQALKRVEDIIKILKKE
FT                   NIVVQVVFITLDPQHDTSEVLKKYLEKIDDNFIGLTGRVQDIEQLADQFKVFYTSKIFD
FT                   VKTNEYELQHSNFVYLISSQGKFLKHYCLGLPKNG"
FT   gene            complement(45666..46235)
FT                   /locus_tag="RF_0044"
FT                   /note="RF0044"
FT   CDS_pept        complement(45666..46235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0044"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60895"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNH2"
FT                   /protein_id="AAY60895.1"
FT                   /translation="MGDKIFHNLSGKTLVATPHAITKGIYHKSLIYMLSHTEEGAIGLI
FT                   FNRLVNHIDLKSFFKIKNDEITTPVMVPIYLGGPVEHEKGFFLHSSDYNKNLLLDFQND
FT                   LAVSSNLEISEDIAFGKGPKNSLFIVGYTAWKPGQLEEELEKNLWLVMDCNKEFIFADN
FT                   PESKWHNALKHLGIDEIHFSSQIGNA"
FT   repeat_region   complement(46258..46392)
FT                   /note="RPE-8 Full"
FT   gene            46470..47138
FT                   /gene="cvpA"
FT                   /locus_tag="RF_0045"
FT                   /note="RF0045"
FT   CDS_pept        46470..47138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="RF_0045"
FT                   /product="Uncharacterized protein"
FT                   /note="Similar to colicin V production proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60896"
FT                   /db_xref="GOA:Q4UNH1"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNH1"
FT                   /protein_id="AAY60896.1"
FT                   /translation="MITFFDITIFAIITLFSFFGLYQGIIGISTRILGFITSIMLGYFL
FT                   YPYISELIGKYMDNEVIRIIIAGVISYVVSLILCVFIVYKFLAIISFMRNGFIDRFLGL
FT                   LAGFAVGTTISLVLFFITMIFTSENYFKSKSLKDFVVSSKQSKYGGVLKVSVTTDYLDE
FT                   LSKNIIVIIPNETLKSIEIFENKDLNNFKNSLKKSNDSNDDEDIFSQELQDELSNIDDE
FT                   "
FT   repeat_region   complement(47153..47227)
FT                   /note="RPE-7 Full"
FT   gene            47449..48687
FT                   /locus_tag="RF_0046"
FT                   /note="RF0046"
FT   CDS_pept        47449..48687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0046"
FT                   /product="Cell surface antigen-like protein Sca10"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60897"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNH0"
FT                   /protein_id="AAY60897.1"
FT                   /translation="MTNMKKTFFNKLLLATSSMGLLASMESSAAVVVAVPHENNTSYVM
FT                   DPMRGGDRPQDWRSNNGAQYQPQNGDDIILRRAHLINFNQNININDINIYGYSASTFID
FT                   NWHNGINDRREMGGIAITPGFGANRIVTINNIINSDANNYRIAGSNALGEALIYGNKNA
FT                   KVRVDLLESLNDLKLIITGNDISAVDSIVMSGGTNEIIFRNPIKVKSKIYARNILQGKV
FT                   KIESNNIVFESPIGNDGRDNHSISIFKVDDNISVTLENNIAAEDINLGKNSTVIIDTTK
FT                   RNIDVRSGIVVNNTVDNQGIVQVRGHAKNTVTFHENIGVQDFKAAEIQIENGKKTEFKQ
FT                   KVYAKKITVASNDVVFEEKLDMAQYNQNNRGNRTNLIHTGNLEFTNRGKVKFNKDYVGT
FT                   ITTSKANIGEVIL"
FT   gene            49122..50600
FT                   /locus_tag="RF_0047"
FT                   /note="RF0047"
FT   CDS_pept        49122..50600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0047"
FT                   /product="Cell surface antigen-like protein Sca10"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60898"
FT                   /db_xref="GOA:Q4UNG0"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNG0"
FT                   /protein_id="AAY60898.1"
FT                   /translation="MNFRNGLQVQQAGQAAAQEVAQQQVRVNSQTQAMQAQAQQGQAQQ
FT                   NQQQVQQNQQQVQQQNQQQQQAQAQREANERARQQRLQAEREENARREQQQQQQEEERR
FT                   NENERLAQQEANERAIAEENNRRIEEQRLQAEYQQRQANEIRVAEEYVKKPESQKLAEA
FT                   INNTIVAHTENTFVAEVQKEVIREKSALVMKNPEKHAVELAKELINNKAELKEVAKVAN
FT                   DDTVVVSKTKQEQSLLFVANLAQVAPDNAKKVVEHLTEQGTRSVSVANVTAEAVTANIN
FT                   NHLSGGTMIAVAAGDEETPIITKKGLWVAGTFGSSTQDAYKGNPSYKGTVSGGTIGGDL
FT                   YIGENSLVGLAYSRMNSDFKFKGSSTGDKLSAESDIISLYGQQQFSNGLILQEIFSASN
FT                   SKINKKDLRPVGPNSYKTASGKYTSKAYGFEGNVGYQFSPVDGINLMPNIGIRYNTYKD
FT                   NAYTETGTGVNNMYVAGKSGNFNYRDCRHKINRS"
FT   gene            50536..50859
FT                   /locus_tag="RF_0048"
FT                   /note="RF0048"
FT   CDS_pept        50536..50859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0048"
FT                   /product="Cell surface antigen-like protein Sca10"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60899"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNF9"
FT                   /protein_id="AAY60899.1"
FT                   /translation="MLQVNPVTLTTGIAGIKLTAPKRLSNDTQIVPGLHASVENSFSNK
FT                   QPKVKARFIWADNYFENTTSSSTPKVGYNVGASLLTAHKNIELLATYNCNLRSKYTSHQ
FT                   EVH"
FT   repeat_region   50959..51054
FT                   /note="RPE-7 Full"
FT   gene            51062..51643
FT                   /locus_tag="RF_0049"
FT                   /note="RF0049"
FT   CDS_pept        51062..51643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0049"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60900"
FT                   /db_xref="GOA:Q4UNF8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNF8"
FT                   /protein_id="AAY60900.1"
FT                   /translation="MCKFLKGCIKENITKREITMTQKQNAAMEQAIDLLINNDTDVSIL
FT                   FREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSDAQNSRNGYNTKNLITKNGAVEIE
FT                   VPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYVSYKDRKKLA
FT                   GDLKPIYTVNTGRKMIQIFNKHRLKNDTVS"
FT   gene            complement(51661..52461)
FT                   /locus_tag="RF_0050"
FT                   /note="RF0050"
FT   CDS_pept        complement(51661..52461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0050"
FT                   /product="Transposition helper protein, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60901"
FT                   /db_xref="GOA:Q4UMQ1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ1"
FT                   /protein_id="AAY60901.1"
FT                   /translation="MNLQHQRIEELCHSLNLMQIAENYLDIAQSSSKEDSSYTDFLESI
FT                   LKTELLARQHRSKSILTKMAGFPAIKTLDDFDYDFATGIKHKVLEGLRSLSFVERQENI
FT                   ILLGPSGVGKTHIAIALGYAATQCGIKTKFTTAADLMLILNAGLNQGNLDSIFKRVILP
FT                   YKLLIIDEFGYLPLKPEQANLLFQVIAKRYEKGSIILTSNLPFGQWHNSLAQDSALTAA
FT                   ILDRLLHHSTILNIKGDSFRLKDKKKTGLVPIEIINKQEDNFMT"
FT   gene            complement(52458..52901)
FT                   /locus_tag="RF_0051"
FT                   /note="RF0051"
FT   CDS_pept        complement(52458..52901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0051"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60902"
FT                   /db_xref="GOA:Q4UMQ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ0"
FT                   /protein_id="AAY60902.1"
FT                   /translation="MVLGIHRFNKGMLDFAKHYSFRLKVCRPYRAQTKGKVERFNRYIR
FT                   ESFYNPLVTKLKTSELVLDVDTANSEVLKWLRDTANLRVHRTTGAIPAERLKLERNHLQ
FT                   PLPLDYSGSHPTVLEIMRDKGERFSTVSLQHSLCIYQSILEAL"
FT   gene            complement(52876..53487)
FT                   /locus_tag="RF_0052"
FT                   /note="RF0052"
FT   CDS_pept        complement(52876..53487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0052"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60903"
FT                   /db_xref="GOA:Q4UMP9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP9"
FT                   /protein_id="AAY60903.1"
FT                   /translation="MIILEQIMEIKILNKHGKSLRSIAREVGVSVNTVRKYLKYDGSPK
FT                   YKDRSELVTKLAPYKDYLSERIKSAHPVSLPGTVLFQEIKELGYTGGITQLRDYLRSIK
FT                   PVAKQEDIIRFETASGKQMQVDWIEFRKGKDPLSAFVATLGFSRASYIEFVNNEKLITL
FT                   IECHKRAFDYFGGVPEEVLYDNMKTVILDRDTYGPWDTPF"
FT   repeat_region   complement(53892..54002)
FT                   /note="RPE-3 Full"
FT   repeat_region   54211..54352
FT                   /note="RPE-6 Full"
FT   repeat_region   54372..54468
FT                   /note="RPE-6 Full"
FT   gene            complement(54547..55866)
FT                   /locus_tag="RF_0053"
FT                   /note="RF0053"
FT   CDS_pept        complement(54547..55866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0053"
FT                   /product="Putative surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60904"
FT                   /db_xref="GOA:Q4UNF4"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNF4"
FT                   /protein_id="AAY60904.1"
FT                   /translation="MKKLLLTASIICLASAGLAEENPTPVISNSDTEIKLEGFYLFESG
FT                   YIKQDHLILFDKNVTDNRKKLGFYTEAAFAATISKTINDVIAGAKIVLQPTTRVKTSAS
FT                   YNGSHIFIETSYGKVELGSPVDASAKLRVTGSQVTAGTGGWYRYALLDGQYMRYNGLKP
FT                   DFDTSASFYLESYSNSFDQINEKTEKARRLNFFTPKMKGFQAGISYTPDTANTGGNKDI
FT                   NNLTLESSGRNGVSVSRTGIKTVSLGNGETMTINQNIRDAFSAGLTYEHEISEDADLKL
FT                   SVTGEYGKPARRLVHAKMEGTKVIEVLNTYKLSNLKAYNLGAVFTYGNFSCGASYGSLG
FT                   KSLTAKEYYKVGRDTYYYNGAVAYGQGPIKTSLEYLKTSRYKNTVDAVSLATEYKIMPG
FT                   LLPYAEISHFQAKGKPVYYPEAPSKTTRGTVGLIGTKLKF"
FT   gene            56155..56721
FT                   /gene="dcd"
FT                   /locus_tag="RF_0054"
FT                   /note="RF0054"
FT   CDS_pept        56155..56721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="RF_0054"
FT                   /product="Deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60905"
FT                   /db_xref="GOA:Q4UNF3"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNF3"
FT                   /protein_id="AAY60905.1"
FT                   /translation="MAIMSDKWIKEAVINQSMIRPFAEKQVRVHNKEKIISYGLSSYGY
FT                   DARVSNEFKIFTNINSTTVDPKNFSEYNLVDREVDVCIIPPNSFALGRTIEYFKIPRDV
FT                   LVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKIYANEGACQFLFLKSD
FT                   QICDTSYADRQGKYMKQVGVTLPLT"
FT   repeat_region   56764..56897
FT                   /note="RPE-8 Full"
FT   gene            56930..57388
FT                   /gene="secB"
FT                   /locus_tag="RF_0055"
FT                   /note="RF0055"
FT   CDS_pept        56930..57388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="RF_0055"
FT                   /product="Protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60906"
FT                   /db_xref="GOA:Q4UNF2"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNF2"
FT                   /protein_id="AAY60906.1"
FT                   /translation="MSTINTDTNEAMPHISVNAQYIKDLSLENPSAPSSLAALEQRPQI
FT                   DLSLDINITNLSEENFYEVELNIEATARNEKYKLFQIELKYAGVFNLINIDSEQHPILL
FT                   SVHCPAMIFPFARKIIASCTQDAGFQPLMIDPIDFGALYHKKMSEHQN"
FT   gene            57613..58326
FT                   /gene="czcR"
FT                   /locus_tag="RF_0056"
FT                   /note="RF0056"
FT   CDS_pept        57613..58326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcR"
FT                   /locus_tag="RF_0056"
FT                   /product="Transcriptional activator protein CzcR"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60907"
FT                   /db_xref="GOA:Q4UNF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNF1"
FT                   /protein_id="AAY60907.1"
FT                   /translation="MRVLLIEEEPEMANLIELTLASEGIVCDKASVGVEGLRLGKVGGY
FT                   DLVILDLMLPDINGFEILLRLRAAKIKTPILILSSLTDTDQKITGFSSGTDDYLTKPFV
FT                   REELIARIKAIVRRSKGHVASVFRFDKVSVNLDTRTVEVDGKKVHLTNKEYAILELLIL
FT                   RRGTILTKEMFLNHLYSSVDEPEMKIIDVFICKLRKKLSDAAGGRDYIDTIWGRGYMLK
FT                   EYDELQQKEILAQGA"
FT   gene            58330..59151
FT                   /locus_tag="RF_0057"
FT                   /note="RF0057"
FT   CDS_pept        58330..59151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0057"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60908"
FT                   /db_xref="GOA:Q4UNF0"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNF0"
FT                   /protein_id="AAY60908.1"
FT                   /translation="MPLSTSLLGKKSTYKDSYDATLLFKIPRINNRNELGINSNNLPFY
FT                   GVDIWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESVEEL
FT                   ERIILQDLSNVTHAKVTGRIFPINTKIEFSIPSGKNIDDLDIVCNNYGPPDNSLIEYED
FT                   VLVEEEINSNLLKSNCLVTGQPDWGTIVIKYKGKKLKHDSFLKYLISFRNCNEFAEQCA
FT                   ERIFTDIKNAINPDFLSIYIVYTRRGGIDICPYRFTNKSYTLPSDKRFIRQ"
FT   repeat_region   complement(59216..59312)
FT                   /note="RPE-7 Full"
FT   gene            complement(59457..60017)
FT                   /locus_tag="RF_0058"
FT                   /note="RF0058"
FT   CDS_pept        complement(59457..60017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0058"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60909"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNE9"
FT                   /protein_id="AAY60909.1"
FT                   /translation="MNSQKTLPLLPKATAMWLIENTSLTFKQIADFCGIHEFEIKGMAD
FT                   GEVAQSIKGLNPIANGQLTLEEIERCSKDPNANLQISYRPADELMKNQKKQRAKYTPIA
FT                   RRQDKPDAIYWLLSNYPNIQDHQIIKLIGTTKTTIDAIRTRSHWNMNSIRPRDPVLLGI
FT                   CSQIDLNKIVESLKPTQNPIKES"
FT   gene            complement(60072..61469)
FT                   /gene="pntB"
FT                   /locus_tag="RF_0059"
FT                   /note="RF0059"
FT   CDS_pept        complement(60072..61469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="RF_0059"
FT                   /product="NAD(p) transhydrogenase subunit beta"
FT                   /EC_number="1.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60910"
FT                   /db_xref="GOA:Q4UNE8"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNE8"
FT                   /protein_id="AAY60910.1"
FT                   /translation="MSLQIIQLLYLVAAVCFILSLKFLSSQKQARLGSTIGILGMVIAV
FT                   GVTFFLPDFNHKLPIIATILLGGIIGGIIALKISMTAMPQLVAGFHSFVGLAAVFVAYA
FT                   TILAPENFSIGIAGSLPINSLIEISLGVSIGALTFSGSVIAFLKLQGLMKSSPLKFYGQ
FT                   QYICLLTAIILVLLIILFIRSESIFLFNLIVFLSLLIGVLLIIPVGGADMPVIVSMLNS
FT                   YSGFAAAGIGFTLSNSLLIITGALVGSSGAILSYIMCRAMNRSLIKVIFGAFLPASTGI
FT                   NKDIDDDKIAKTSCPEDAAHLLLNASSVIIVPGYGMAVAQSQHIIKEMVDILERSDINV
FT                   RFAVHPVAGRMPGHMNVLLAEANIDYEKVLELEEINRDFATTDVVLVIGANDVTNPAAK
FT                   NDPSSPIYGMPVLDVEKARTILFIKRSMASGYAGIENELFYHDNTFMLFGDAKKVVEEI
FT                   VKFLNED"
FT   repeat_region   61522..61587
FT                   /note="RPE-7 Full"
FT   gene            complement(61597..62331)
FT                   /gene="ompW"
FT                   /locus_tag="RF_0060"
FT                   /note="RF0060"
FT   CDS_pept        complement(61597..62331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompW"
FT                   /locus_tag="RF_0060"
FT                   /product="OmpW family outer-membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60911"
FT                   /db_xref="GOA:Q4UNE7"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNE7"
FT                   /protein_id="AAY60911.1"
FT                   /translation="MLRIVKKLGIILFVSSISINSFAKSMYDDVDSAPDYDSTPYYENE
FT                   GSLVFKMRLGGVFSSAKQKGLPTPTSPQPVPVGEVAKNGYGGDASTTIFFNNYLATELS
FT                   LGFNVLRTKYTSLAAVAHNYGVNNVKLGKNKPIYMIPATVTGQFHIAPYGGIRPYVGVG
FT                   YHGSYMLTQATGLKIRNGHGLVGQIGVDFYAKDDTLINIDVRQFFLNPKLEYKPNLVGT
FT                   KTVTSKVKLNPLIVSIGIGFTF"
FT   gene            62487..63371
FT                   /gene="sam"
FT                   /locus_tag="RF_0061"
FT                   /note="RF0061"
FT   CDS_pept        62487..63371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sam"
FT                   /locus_tag="RF_0061"
FT                   /product="S-adenosylmethionine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60912"
FT                   /db_xref="GOA:Q4UNE6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNE6"
FT                   /protein_id="AAY60912.1"
FT                   /translation="MNDALKTYLTGIGWFLLSLVSSSANDVMSKYLGTRLHSFEVAFFR
FT                   FFFSSIVLLPFVFYHGKNTLKTSRPFVHILRGLLLFFGMTSWTYGLTIAPVTTATVVSF
FT                   SIPLFTLILAVFFLNENIIWQRWVVTVVGFIGLVVTLKPHTEDFNPEILYFVLAAISFA
FT                   MLDIINKKFVIKESMISMLFYSAIVTAVVSLPVASQYWLTPSGFELALLFVLGSSGSLI
FT                   LFFLLKAFSMVDATATAPYRYLELVISAIAAYFIFSEFPDKSTLHGAVIIIPATLFIIY
FT                   SEKKAMSRKHESQ"
FT   gene            63358..64614
FT                   /gene="proP1"
FT                   /locus_tag="RF_0062"
FT                   /note="RF0062"
FT   CDS_pept        63358..64614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP1"
FT                   /locus_tag="RF_0062"
FT                   /product="Proline/betaine transporter"
FT                   /note="MFS type sugar transporter PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60913"
FT                   /db_xref="GOA:Q4UNE5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNE5"
FT                   /protein_id="AAY60913.1"
FT                   /translation="MNRSKLVFSSGIANTFEWYDYVLFGYFAPIIGAKFFPNDDANTSL
FT                   LQAFLVFAIGYLARPLGGIFFGVIGDRFGRKVALTSALFCMSAPTVLIGILPTYHTIGI
FT                   TATILMICVRILQGLSMGGALTGSISFVIEHTSHKHRGFTGSISTSSICSGLLLGSFVS
FT                   YIVKNILTASQFDSFGWRIPFLLGFFILFASFYIKKNTHETPNFKNLREQKKILQSPLK
FT                   KVITNHWFDILISIFINAPGSIIFYLTTIYLVSFLKISRNFTENEVNSLASLCYVIMIA
FT                   VTLLSGYLSDIIGRRKIFVINLIIIIITTPFLLNNFENGDFTSVIISQFILAILAASYI
FT                   GPEPALQAEFYPTNIRNTALSISYNTATSIFGGTTPLVFEYLVQKTGHVTSAVYYVILS
FT                   CIFALIALYFYKNRSLDKI"
FT   gene            64702..64776
FT                   /locus_tag="RF_RNA03"
FT                   /note="RFRNA03"
FT   tRNA            64702..64776
FT                   /locus_tag="RF_RNA03"
FT                   /product="tRNA-Thr"
FT   gene            65057..65761
FT                   /locus_tag="RF_0063"
FT                   /note="RF0063"
FT   CDS_pept        65057..65761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0063"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60914"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNE4"
FT                   /protein_id="AAY60914.1"
FT                   /translation="MKELIEFLEKTGLKTEADSLRNGGTELNPQSNIGTLGAKKLAAAL
FT                   KDNKSLKYLNLIGSYIGEEGARALAEALKDNESLKELYLTPADISTVTLNRIKEYIQRN
FT                   TDLYYKEQQQYNKQLISSIKANEIKQAESIIPFIDPKYSNSVDENNNTALHYAVDKNLE
FT                   KLSISLINKMSIETISIGNMYNNTALHYATDNGLEVISWFLINNMTQKALDMVNTDGNT
FT                   ALDYAIHNRHLL"
FT   gene            65712..66605
FT                   /locus_tag="RF_0064"
FT                   /note="RF0064"
FT   CDS_pept        65712..66605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0064"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60915"
FT                   /db_xref="GOA:Q4UNE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNE3"
FT                   /protein_id="AAY60915.1"
FT                   /translation="MGIQHWIMPYIIDTYYNRFFSKKMSLEGVKTVNADCTTEYLEKIT
FT                   DYKNLTKYNETREHEKVIGKCFPLPVKLNLPTLSLEEENTSGVEWLAPALVGLGVVGLG
FT                   TFFCYYFYNAYFKKNGNQQASTNNLVKEEKKQVVTQTTSIIQEESLYKILKKINNKLKN
FT                   DDGLAEDNKILMQSIVANVITEVSKLTNESDIKKITTSVKDLLNGRITKTKLKDIKEDV
FT                   DYLIKQQSKLGYDVTVNKVEEIIYDKPLLNHTKLLQAAVDSKLSSDLIYEAINNNDEEL
FT                   ILAGLISVGYDVGTIN"
FT   gene            66725..67645
FT                   /locus_tag="RF_0065"
FT                   /note="RF0065"
FT   CDS_pept        66725..67645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0065"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60916"
FT                   /db_xref="GOA:Q4UNE2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNE2"
FT                   /protein_id="AAY60916.1"
FT                   /translation="MCKFLKGCIEENITKREITMTQKQNAAMEQAIDLLINNDTDVSIL
FT                   FREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSDAQNSRNGYNTKNLITKNGAVEIE
FT                   VPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLIS
FT                   QIIDDIIEDVKLWQSRPLDPVYAIVFFDCLIVKVRQDKRIINKSVYVALGIDLEGRKDI
FT                   LGLWISENEGAKFWLGNFTEMKNRGIQDILIACSDNLNGMSEAIGAVFKSLYLAIDYMT
FT                   KKWSMPIPNWNKAMAHFLIKFDERI"
FT   gene            67629..68300
FT                   /locus_tag="RF_0066"
FT                   /note="RF0066"
FT   CDS_pept        67629..68300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0066"
FT                   /product="Conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60917"
FT                   /db_xref="GOA:Q4UNE1"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNE1"
FT                   /protein_id="AAY60917.1"
FT                   /translation="MTKESRLLEKFTHLIGKTRIFFTVLIIVGNLIYQKFVYLNIFNFY
FT                   ILELSIGAIFYPLTFLLTDLIAEFYGKERANFCVKLAIIFNIIVVLIISLMDKLEATNW
FT                   SNVDNITFHKVFGSYHISFLASTFACYIAQLVDINIYLWIRKITKGKYLWIRNNFSTAI
FT                   SLFIDTFIVIGIMSLFNIFPFDQLGQLVLNSYSFKLFFTVFSTPIFYLAVWLISLFIKK
FT                   G"
FT   gene            complement(68331..73145)
FT                   /gene="sca2"
FT                   /locus_tag="RF_0067"
FT                   /note="RF0067"
FT   CDS_pept        complement(68331..73145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca2"
FT                   /locus_tag="RF_0067"
FT                   /product="Cell surface antigen Sca2"
FT                   /note="209 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60918"
FT                   /db_xref="GOA:Q4UNE0"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNE0"
FT                   /protein_id="AAY60918.1"
FT                   /translation="MSLQNSHSKKYVLTFFMSTCLLTSSFLSTSARAASFTQLANQIPT
FT                   LSGLSEVQRKQKWNSYTLQEKQEAWRRAKLTPDFVQAMIDMQTGFTESDLSSRNNKTRH
FT                   KAREKKSELDLYIAGTKQGFKEKVDGYISQGKIPTPEEAAQNLEIDYDAKKTDNKLEKN
FT                   QNVRRVEKDKKALLDLYIHSITTSVKEKEYITTGQVPELGELEKALNISKEEAKHRRTI
FT                   IRDQVMANERPKLVRSGTVLTKKELHKRFGKDTTTDDTKYIDDITTEVMYTKKQGYVNT
FT                   DFLPKISEIMNEFKVDKGRANLYLNQIKAGIEAKLLADNNQTTTKPFTKHSRTTTNTAG
FT                   ISSGVPFDTGRTKPETKSFDFKRSMYSLLNRKQEDQLSKTEQHLKQQIKLEENKEEFKE
FT                   ILTKNPIDALLFAEQSNLGNSFKQEAISNIDLSKDISRILFTVDDKGNRTILNTILTTT
FT                   PEHKDELIKQAQHHAIQTLPTSISDKDVSDKKKLTLATLAATEDKKVLEEALDNWLSTN
FT                   GYKRKPEVESLISILLSDETTLKAGIDKIFELPVENNVNNNSNKGQNGTPILPPTPPLN
FT                   GSMPPSPPPPLLNGTPTSTAFNNSNPNHKFDLKNFEATYPRLYKSYNEFIQNTTSASQS
FT                   QATTTSNNIPDTKAKMGESLELLKQKVAKQNEVIGLIHNEVTKLYNFSPKTFVNLFNTE
FT                   NEEIIKKIEQIAKREDIQKILQDNDIKITSTFVSKIFNESLEQTKQRLRSSNIINAKQY
FT                   KRIEQYANKQECVTEFLRITNPLEQLKFANKYINILGQSTFNGKLNELIENPNKLTFSQ
FT                   KINFVLQGYQELTREIPTAKANLNKLKQNILEKIEIQQLIANKDISRKDLLDILNNKNP
FT                   ELLKSLLEAKVILEENKLNNSANEVDLKEIIPSLNYLTSEQLTSLINRITIEGVKTALK
FT                   AKWQQENKTVSNNTEKPLIYNNGTPMPPPIPNGNSNFGTNDYLISMGYTQEFIDRMDKV
FT                   KPNNNFGKNHNYTATDFKSNVGKNYYESTSKLGGTDILLTDSQKLENAIKKEVLAKYIE
FT                   EPNRDMQDDSLLKQAFEEKFYYAEDKNTKVIPKPSEVNFDPNFIGPRTEVGQEIYELYE
FT                   QELLKLARDPVFIEYVKNNNNTQKDERELLISFIEQIESKRPELEQKYGSDVQSEDNNQ
FT                   EKKVGHLNMKQFQSLFQQENESANDESSTKDDPQPEDSNKKSEKSDSETALSPRLLSSN
FT                   DSKNDKSSDDKKSLLVLRSSEEESKKDIALESEDEAIDMSFKTEAIAEQDEATQRQQVS
FT                   DDTNRKVAILVKATSTLHKPVHYNILSDRLKVAAIGAGDEEASINRGVWISGLYGINKQ
FT                   GTWKNIPKYQGRTTGVTIGADAEFINSHDVIGIAYSRLEFQIKYNKKLEKTAVNGHLLS
FT                   IYGLKELIKGFSLQAITSYGHNYIKNKSKSINNIIGKYQNNNLSFQTLLNYKYRTKYDL
FT                   HFIPNIGFKYDYSRASNYKEYNVDIENLMNQKKSNQSFESSIGGKIVFKPIATVNNIIL
FT                   TPSLYGNIERHFNNKNTKVNAKATFKGQTLQETIIIPKQPKLGYNIGSNILMSKKNINV
FT                   LLEYNYYTHRKYQSHQGLIKLKVNL"
FT   gene            73318..74697
FT                   /gene="cysS"
FT                   /locus_tag="RF_0068"
FT                   /note="RF0068"
FT   CDS_pept        73318..74697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="RF_0068"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60919"
FT                   /db_xref="GOA:Q4UND9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UND9"
FT                   /protein_id="AAY60919.1"
FT                   /translation="MQIQFHLYNTLSRTKEVFNPQDQTKVKMYVCGPTVYDNPHIGNSR
FT                   SVVVYDLLYRIVIKIFGEQSVKYVRNITDVDDKIIDRAELLSITINELTDKVTQEFHTN
FT                   MAYLGCLLPSIEPKATEHIDVMIEIIERLIAKDHAYIADNHVYFDVLSAPNYTELSNRN
FT                   LEEMFEGVRIENSKTKKHPQDFVLWKPAKPNESANMNFKSPWGFGRPGWHIECSAMSYK
FT                   YLGENFDIHGGGADLIFPHHTNEIAQSRCAFPDSTYAKYWVHNGFLTVNGEKMSKSLGN
FT                   FITVRNLMDKEISGEVVRLFLLSSHYRRPLDYNDKAIEDAKKTLDYWYRAIENINVQKI
FT                   DLPHNFMQSLLDDMNTPLAVKIINDYAKGVFISKTEEEKQLNASAIITCANFIGLMNKT
FT                   PHEWFNSGVDELYINELLNKRLEAKKQKNWLLADQIRNQLLEEKIILEDKPDGTTIWRK
FT                   E"
FT   repeat_region   complement(74751..74820)
FT                   /note="RPE-7 Full"
FT   repeat_region   74907..74992
FT                   /note="RPE-4 Full"
FT   gene            75045..75932
FT                   /gene="rpsB"
FT                   /locus_tag="RF_0069"
FT                   /note="RF0069"
FT   CDS_pept        75045..75932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="RF_0069"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60920"
FT                   /db_xref="GOA:Q4UND8"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UND8"
FT                   /protein_id="AAY60920.1"
FT                   /translation="MSKIPSVNIKELLDAGVHFGHKTSRWNPKMASYIYGERDDVHIID
FT                   LRQSAALMSVALNTIYETVKKDGKILFVSTKIQASDIIAEYAEKCGQYYVNHRWLGGML
FT                   TNWKTIAGSIEKLNKLEKTLENEEALMGYTKKEILDMSRKKEKLLLSLAGIRNLNSKPD
FT                   LLVVIDTNKEHIAINEAVKLNVPIVAVVDTNSNPDNVNYPIPGNDDSIRSIRLYCSLFA
FT                   DAALQGLEESMKASGVDMGAMQEHTDKALTSKNVSKLKQAKKFSKTKNIDEETNTEFEQ
FT                   ALNDADENKNSDNA"
FT   repeat_region   75974..76045
FT                   /note="RPE-7 Full"
FT   gene            76101..77030
FT                   /gene="tsf"
FT                   /locus_tag="RF_0070"
FT                   /note="RF0070"
FT   CDS_pept        76101..77030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="RF_0070"
FT                   /product="Elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60921"
FT                   /db_xref="GOA:Q4UND7"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UND7"
FT                   /protein_id="AAY60921.1"
FT                   /translation="MSEINISAAAVKELREKTGAGMMDCKKALIETSGNFEEAIDFLRK
FT                   KGLAAAAKKAGRIASEGLTAAKVDGLTGVVVEVNSETDFVARNEQFQDLVKDIANLAVI
FT                   AKTIDTLKTSKMQSGKSVEEEIIENIATIGENLTLRRMDILEISEGAIGSYVHNEVVPN
FT                   LGKISVLVGLESNAKDKTKLEALAKQVAVHVAGNNPQSIDDSSLDQALVERERKVFFEK
FT                   SKEEGKPDNIIEKMVEGRIRKFFSEVVLLQQNFLFEPKLTVAEVIKNAEKELGAEIKIA
FT                   KFIRYELGEGIEHEEKNFADEVAAITQG"
FT   gene            77233..78243
FT                   /locus_tag="RF_0071"
FT                   /note="RF0071"
FT   CDS_pept        77233..78243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0071"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60922"
FT                   /db_xref="InterPro:IPR020954"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UND6"
FT                   /protein_id="AAY60922.1"
FT                   /translation="MSRTKEQYAAEIYAAEEHRRRQANSSDGDAELLGVMIVCAGYACY
FT                   KAVEGAVKVTVTGSKIIENVYKIGTGQIEILGTEPESKITYIAKHPSPRGPTNVNQPNA
FT                   TNPVDPSEQTPPNTPTSKREKAKIYGKKLVDSAKIGAKTLSNAYKVTTGKIEVVGPGSD
FT                   FNSNGKEKFIFSDPIQRIVIQKELKRDDGYKCGIALEETIETSLMLRLNNKHIVRNKEF
FT                   RSMILPDTTQDVGGTFELSLILKYSDGSMSKDDPAFLKIHYGRDGKLNKLLLPNTPIIF
FT                   YNQWYPALTVYKGKLCSLPVNSGYYKYLYKKILENNETIEIAHVDSEFTIELLGE"
FT   gene            complement(78264..79658)
FT                   /gene="kdtA"
FT                   /locus_tag="RF_0072"
FT                   /note="RF0072"
FT   CDS_pept        complement(78264..79658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="RF_0072"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60923"
FT                   /db_xref="GOA:Q4UND5"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UND5"
FT                   /protein_id="AAY60923.1"
FT                   /translation="MMLLYYALSFILLPIYFIIILIRLLIGKEDIRRIQERFAIGKHRQ
FT                   VYSLDFLHNEANKERFKGDTERRTAAYTSVREDSSTGSTSKLPLEASYARSLIWIHAAS
FT                   VGESMAALTLISNISKRYPDIRFLVTSWTNSSAKILTAKLPKIAVHQFLPIDNIIFTRK
FT                   FLKNWQPNLGIFIESELWPCTINEGARQCKLLLVNARISDKSFKAWLKRKSFFQLILKN
FT                   FSKIIVQSERDLQKFNELGISDAINLGNIKFANEKLPVNQEELSKLSSHLDNRQVVVFA
FT                   STHPEDEEVILPIIKNLKEQFLDCYIILIPRHPERVKSIIDNCKSHNLSATAKSQNDLP
FT                   VLSDDIYIVDRFGEMGLFFSVATISFIGGSFKQGGHNILEAAYFSNCIIFGPDMSKNTD
FT                   IAKGVLQNEAAIQIKNGEDLLTKLTYLLSPNNSLELKAYRENALKFVENNQKVLDEYLQ
FT                   VITKFL"
FT   repeat_region   complement(79369..79512)
FT                   /note="RPE-1 Full"
FT   gene            complement(79655..80311)
FT                   /locus_tag="RF_0073"
FT                   /note="RF0073"
FT   CDS_pept        complement(79655..80311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0073"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60924"
FT                   /db_xref="GOA:Q4UND4"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UND4"
FT                   /protein_id="AAY60924.1"
FT                   /translation="MRKAFKKFLKNNKYVLSIITILLYWYLRFVYFTSKQKFIFYDNGN
FT                   KEKFLNEQGVIFAFWHNMLALSPAMFIGHRNIYALISPHLDGKILNDLVGKFGCRVIVG
FT                   STNKNPIGALRNIIGKLSQGANIIVTPDGPKGPVYKVNSGTTEIAYRYNKKLIPIVSST
FT                   SRCFRLKSWDKLIIPLPFGIIKIIVGSPLELTNDKIQNHISLEKQLTSLTESLKK"
FT   repeat_region   complement(80345..80412)
FT                   /note="RPE-7 Full"
FT   gene            complement(80419..81648)
FT                   /gene="aatA"
FT                   /locus_tag="RF_0074"
FT                   /note="RF0074"
FT   CDS_pept        complement(80419..81648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="RF_0074"
FT                   /product="Aspartate aminotransferase A"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60925"
FT                   /db_xref="GOA:Q4UND3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UND3"
FT                   /protein_id="AAY60925.1"
FT                   /translation="MSIISTRLNSIKPSPTLAVVKKTLELKKAGVDIIALGAGEPDFDT
FT                   PDNIKEAAIKAIKDGFTKYTNVEGMPLLKQAIKDKFKRENNIDYELDEIIVSTGGKQVI
FT                   YNLFMASLDKGDKVIIPAPYWVSYPDMVALSTGTPVFVNCGIENNFKLSAEALERSITD
FT                   KTKWLIINSPSNPTGASYNFEELENIAKVLRKYPHVNVMSDDIYEHITFDDFKFYTLAQ
FT                   IAPDLKERIFTVNGVSKAYSMTGWRIGYGVGSKALIKAMTIIQSQSTSNPCSISQMAAI
FT                   ESLNGPQDYIKPNALNFQKKRDLALSILKRVKYFECYKPEGAFYLFVKCDKIFGHKTKS
FT                   GKIIANSNDFAEYLLEEAKVAVVPGIAFGLEGYFRISYATSMEELEEACIRIERACGSI
FT                   SIKSSLRGDA"
FT   repeat_region   81722..81787
FT                   /note="RPE-7 Full"
FT   gene            81916..82920
FT                   /locus_tag="RF_0075"
FT                   /note="RF0075"
FT   CDS_pept        81916..82920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0075"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60926"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UND2"
FT                   /protein_id="AAY60926.1"
FT                   /translation="MLGKIKDKIKHYCLTIINIPNFIKNKILEFKNYISDCKYKFSHLA
FT                   ETNYQLGLDHLYRGNLNDALLRFKLVDKFFNPNDSKVYYQLGWVYFLKNNYRQAIEYLE
FT                   KSNEKYKAIFINFLKNYKDITEIPGEIWGKYRDLTAQYYPTIFNNDKNIHLPYRFVNDT
FT                   LKQISDLPDNYSISELGSNIGLVGYEIQKRFPESFTLTGVEISTLMNDLQETYYPNTKI
FT                   YDQIYNIAIDEFLKQNSNKFDIIFSFCGLSFTNNLIEYFNLIYSSLSEQGYFAVCLPNA
FT                   AKTQFSVKRKEFIFNLNEINNILQKNNFTILTSEEIILAENNKYSIIVCKKIT"
FT   gene            82925..83680
FT                   /gene="vacJ"
FT                   /locus_tag="RF_0076"
FT                   /note="RF0076"
FT   CDS_pept        82925..83680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacJ"
FT                   /locus_tag="RF_0076"
FT                   /product="VacJ lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60927"
FT                   /db_xref="GOA:Q4UND1"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UND1"
FT                   /protein_id="AAY60927.1"
FT                   /translation="MRILIILSIILCSLFARADLEYVDNDIYNYNGGRNENGCLEVYDP
FT                   YEKFNRKVFAFNSVLDYIILRPLAIGYKNITNDYVKARVNSFVSNVDTPLTAVNYGLQL
FT                   NYDKTMKSVWRFLINTTLGIGGLFDVAGKVGLPSERQTFGSTLAHYGVAPGPYLVLPII
FT                   GSTNARDMTDSVITNYALNPLMYYTHNDFDLGVLAVSKINDRYVVLPFSDYVMKNSTDP
FT                   YVAIRSALHRAREASVQYPENFKCPKPKN"
FT   gene            83700..84299
FT                   /locus_tag="RF_0077"
FT                   /note="RF0077"
FT   CDS_pept        83700..84299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0077"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60928"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UND0"
FT                   /protein_id="AAY60928.1"
FT                   /translation="MQKIITGLFLLVMTFSAYSSEKVPAGLNDYVTNLVNEASSILNDS
FT                   KLSERVKIAKARELMSQNLDFDWMAKYTLGRNGIKTLSGGQVQEFIKVYSKYVTKSYTD
FT                   LIKDYKGEQPKIVGVRPLSSTDFMVAMNIVSNKEQDPIKVEYLVREMKGNGKDVFKVSD
FT                   IITEGVSLIGAQQDEFTDTLKNQGFEALIQKLESRS"
FT   repeat_region   complement(84322..84391)
FT                   /note="RPE-7 Full"
FT   gene            84478..85359
FT                   /gene="prs"
FT                   /locus_tag="RF_0078"
FT                   /note="RF0078"
FT   CDS_pept        84478..85359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="RF_0078"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="PRPP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60929"
FT                   /db_xref="GOA:Q4UNC9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNC9"
FT                   /protein_id="AAY60929.1"
FT                   /translation="MKILAGSSNKLLASRLAIALNIKYIEPRITYFNDSEIKVEIQESF
FT                   HNEDVIIVQSTSKPVNDRLIELFLLVDAAKKAVANRIILVMPYFGYARQDNINSQNIIP
FT                   AKLIADFLEKLGVNHVITIDLHSDKIEKFFNIPISNLEPINLYIPFLRTYSNFVIVAPD
FT                   KGSINRVQKISNLLNIDSAYINKERDINNNCEMISIIGSVEGKNCILIDDIIDSGETIV
FT                   KAARFLKEHSALSVSAFITHAVLATGSKDKIENSVIDKIFVTDTIEVGDLPPKFYIIPV
FT                   MPIIVKELRNIL"
FT   gene            85356..86744
FT                   /gene="alr"
FT                   /locus_tag="RF_0079"
FT                   /note="RF0079"
FT   CDS_pept        85356..86744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="RF_0079"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60930"
FT                   /db_xref="GOA:Q4UNC8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNC8"
FT                   /protein_id="AAY60930.1"
FT                   /translation="MSLCTLEINLSAIKNNYLLLQDICKTSLVGAAVKANGYGLGAVQI
FT                   SKALIEENCRHFFVASSEEGVNLRKALASWHESVFRHCEKNYTVIRRSNPVKNSVSQNF
FT                   FNYFSGLQQCFAPRNDGSSIHATTPKALDNDVNILVLNGVFEHDALELIEYNLTPVLNN
FT                   LKQIEIWQKFSNLKNRLLPCYLHFNTGINRLGLTHNEIEQLINNRDLLKGLDLQYIISH
FT                   LAVSEEIDNPYNLEQLNRFKTYLQYFPNVKASLANSGGIFLGQDYHFDLARPGAALYGL
FT                   NPVIDLSNNLSYKEEFEGDTERRTAAYINVREDSSTGSTYKLPLEGGYSRGLQNPVTLK
FT                   APIIHLQNLTLDSHIGYNMTFTTERDSVIATLPLGYADGFSRNFSNQGEVFINGRSVPI
FT                   VGRISMDLINIDVTDLPPLDIFLGQEAEIIGNYCTPDKIASIIGTIGYEVLTSLGSRYK
FT                   RIYK"
FT   repeat_region   complement(85597..85693)
FT                   /note="RPE-7 Full"
FT   repeat_region   86210..86353
FT                   /note="RPE-1 Full"
FT   repeat_region   86769..86834
FT                   /note="RPE-7 Full"
FT   gene            86878..87657
FT                   /locus_tag="RF_0080"
FT                   /note="RF0080"
FT   CDS_pept        86878..87657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0080"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60931"
FT                   /db_xref="GOA:Q4UNC7"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNC7"
FT                   /protein_id="AAY60931.1"
FT                   /translation="MLLNIANSVGKRTIKFAQSVGSFSLFSFAAVSSIIRPPLYLSLII
FT                   RQLLFIGFHSLPVVAMTTFFSGAVLALQSYTGFSRFSAESSIATVVVLSLTRELGPVLA
FT                   GLMVAGRVGASIAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVIAAIITMPCLVLIGD
FT                   IIGVMGGYLVGVYKLDFNSTAYLTSTFHYLEPIDVISGLVKAGVFGFIISIISCYSGYY
FT                   SGKGAKGVGRATTSAVVNSSILILISNYLITELFFKV"
FT   gene            87660..88418
FT                   /gene="mkl"
FT                   /locus_tag="RF_0081"
FT                   /note="RF0081"
FT   CDS_pept        87660..88418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mkl"
FT                   /locus_tag="RF_0081"
FT                   /product="Ribonucleotide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60932"
FT                   /db_xref="GOA:Q4UNC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNC6"
FT                   /protein_id="AAY60932.1"
FT                   /translation="MSTKEEFKIKIRSLYKSFANHKVLDGIDLDVKKGSSLVILGGSGS
FT                   GKSVLIKNIVGLIKPDKGKIFIDNVEIQDISSKQKFEIMDGIGFLFQGGALFDSLNIRD
FT                   NITFETRKLSKKEKNDLAGAKLNSVGLSPRILDLYPSELSGGMQKRVALARAICSTPSI
FT                   LFLDEPTTGLDPIMANVINELIIKIQEELGATTITITHDMISAEKIAKEVAMIYQGKIK
FT                   WYGSKDEMRNSDNPYLKQFINGLTTGPIEV"
FT   gene            88420..88668
FT                   /locus_tag="RF_0082"
FT                   /note="RF0082"
FT   CDS_pept        88420..88668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0082"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60933"
FT                   /db_xref="GOA:Q4UNC5"
FT                   /db_xref="InterPro:IPR035116"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNC5"
FT                   /protein_id="AAY60933.1"
FT                   /translation="MLKNLLCIIIFLGINLNVYAINSSSYTTDDIIKIVIILGIVILIF
FT                   SPAKFRIIVIGTMLGLACAYFTYKYIVPIFISSLNGP"
FT   gene            88742..89035
FT                   /gene="rpmB"
FT                   /locus_tag="RF_0083"
FT                   /note="RF0083"
FT   CDS_pept        88742..89035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="RF_0083"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60934"
FT                   /db_xref="GOA:Q4UNC4"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNC4"
FT                   /protein_id="AAY60934.1"
FT                   /translation="MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAG
FT                   EYRLSVNARCISSVEKAGGFDAYILKADDNVLSSNARTIKKKIIQTKTAKSL"
FT   gene            89032..89268
FT                   /gene="rpmE"
FT                   /locus_tag="RF_0084"
FT                   /note="RF0084"
FT   CDS_pept        89032..89268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="RF_0084"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60935"
FT                   /db_xref="GOA:Q4UNC3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNC3"
FT                   /protein_id="AAY60935.1"
FT                   /translation="MKSGIHPEYKKFLIKVESDVFETMSTHPTGEILMDVDFRKHPAWN
FT                   KDSGNVVNQSNKSVSDFNKRFSGLSFGGKKEAS"
FT   repeat_region   complement(89305..89371)
FT                   /note="RPE-7 Partial"
FT   gene            89491..89567
FT                   /locus_tag="RF_RNA04"
FT                   /note="RFRNA04"
FT   tRNA            89491..89567
FT                   /locus_tag="RF_RNA04"
FT                   /product="tRNA-Met"
FT   repeat_region   complement(89670..89787)
FT                   /note="RPE-6 Full"
FT   repeat_region   89831..89926
FT                   /note="RPE-7 Full"
FT   gene            89980..90618
FT                   /locus_tag="RF_0085"
FT                   /note="RF0085"
FT   CDS_pept        89980..90618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0085"
FT                   /product="Hypothetical GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60936"
FT                   /db_xref="GOA:Q4UNC2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNC2"
FT                   /protein_id="AAY60936.1"
FT                   /translation="MTTQKIVHTKSPDGSKLFRHQAKFVAGAMNINQIPNFSLPEIAFV
FT                   GKSNVGKSSLINTICNNKNLAKVSNTPGRTRQINFFNLADKLIIVDLPGYGFANVPISV
FT                   KEQWEVLISYYLRNSYSLRLVNLLIDSRRGIKENDKKVAELLLANKREFQIIFTKSDKV
FT                   TDRKNLNDEAQNFLATLNYSCNVMYVSSRSKEGARELKASLAKCIKPQR"
FT   gene            90566..91489
FT                   /gene="argB"
FT                   /locus_tag="RF_0086"
FT                   /note="RF0086"
FT   CDS_pept        90566..91489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="RF_0086"
FT                   /product="Acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60937"
FT                   /db_xref="GOA:Q4UNC1"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNC1"
FT                   /protein_id="AAY60937.1"
FT                   /translation="MQENLKLVWQNASNLKGKEVDSISSLNNIAIIKNIIKCSSELKNQ
FT                   AIVLKLPAAIIIDDKLFTAFIESVRLLEMCGAKIYIVHDHIDLRSSSLISQIDENFSQK
FT                   ISKISDYSSLNNPIIMEILSSYVNKLIVTKLSSIGCYAVGISGKDANLLQAKKSKLSHR
FT                   KIVNHDVINIGFLSEPIMINPEILLNFEDNNIIPVIAPFANDDQEKTHLLNVNLTVATI
FT                   ASALSAVHLILPYEILQVSETFPYNIKIRDINLLKSMLDDSNNFIEEELIKIAVNALEN
FT                   NNGYVHFVNSKVPNSILSTMFDININ"
FT   gene            91502..91789
FT                   /gene="virB3"
FT                   /locus_tag="RF_0087"
FT                   /note="RF0087"
FT   CDS_pept        91502..91789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB3"
FT                   /locus_tag="RF_0087"
FT                   /product="Type IV secretory pathway, VirB3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60938"
FT                   /db_xref="GOA:Q4UNC0"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNC0"
FT                   /protein_id="AAY60938.1"
FT                   /translation="MAGALASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGI
FT                   MILFIAAALHLVAYIICFKEPRFIELYLNKMSRTSQCPNKFYYGANSYNI"
FT   repeat_region   91846..91918
FT                   /note="RPE-7 Full"
FT   gene            91953..94370
FT                   /gene="virB4_1"
FT                   /locus_tag="RF_0088"
FT                   /note="RF0088"
FT   CDS_pept        91953..94370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB4_1"
FT                   /locus_tag="RF_0088"
FT                   /product="Type IV secretion/conjugal transfer ATPase, VirB4
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60939"
FT                   /db_xref="GOA:Q4UNB9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNB9"
FT                   /protein_id="AAY60939.1"
FT                   /translation="MKLFRTRAAKELRSKQERPTSHFIPYKCHWDSNTILTKDNSLLQV
FT                   IKINGFSFETADDEDLDIKKNVRNALLKNMASGNIVMYFHTIRRRKAVIFDDTEFTYDP
FT                   TVKVPNDFITYLGAEWRKKHAGARSFFNELYVSILYKPDTGGAAIVEYFLKKLRQKSNK
FT                   TAWENDMKEMKENLQEMSTRVVNTFRSYGARLLGVRQTQSGSYCEILEFLSSLINCGDS
FT                   PGPIALPRGTIDEYLPTHRLFFDSRTIEARSPLGKKYAGMISILEYGPNTSAGIFDGFL
FT                   QMPFEFVMTQSFVFANRTVAIGKMQLQQNRMIQSGDKATSQIAEINTALDMATSGDIGF
FT                   GEHHLSLLCSANNIKALEDILSMAAVELSNSGIQPVREKVNMEPSYWGQLPGNMDYIVR
FT                   KSTINTLNMASFASQHNYPLGKIRDNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIG
FT                   PTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIFIRALNGVYTVIDPGLKCNFNPLQ
FT                   LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQAVSGNFRLEKKDRRLSNVIAFLG
FT                   IDTPNSLASRIAMWVGKGSHAKIFDNEVDDIDLQKARVFGFDMTELLKDPVSLAPVLLY
FT                   IFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAA
FT                   KSRISDTLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDSTTRYFLIKQGIDA
FT                   VVAKVNLDGMNNIISVLSGRVETVILLDQIREKYGNDPDKWLPIFYEAVKTL"
FT   repeat_region   94414..94508
FT                   /note="RPE-7 Full"
FT   gene            94545..97961
FT                   /gene="virB6_1"
FT                   /locus_tag="RF_0089"
FT                   /note="RF0089"
FT   CDS_pept        94545..97961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6_1"
FT                   /locus_tag="RF_0089"
FT                   /product="TrbL/VirB6 plasmid Conjugative transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60940"
FT                   /db_xref="GOA:Q4UNB8"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNB8"
FT                   /protein_id="AAY60940.1"
FT                   /translation="MKLFPRSILIILVLSFALNLGLVTKTHAKDTLDSIVDILSGLTCE
FT                   TQGVGDLLRTEFSHTCIVAPFFTFAVMNLVSPVLYMNTFLKLKINDSDLFNDSNFGNFP
FT                   GGQCTRENRIDPKNPELRFALCNNAKLIVSRAKSVAESALAIAKAVLTGGDPWDDIKKA
FT                   WENKKKEYHIPYSGKPGDDGFAFDAGFPVIYWKIIQDKDRICVSTKGFTGDVPVGCKYM
FT                   KEPFPKSMYNSFMDVADKDFIQDPKETPTDPLALVSCSAAGGGCYQKAYNASKTAVVMT
FT                   SPLIECMRQMIARLLISKDVCSFDNVEQVVNLASRQDSALFQFQVGMYKIVTAFLTLYV
FT                   MFFGFKLLLAGEIPPKSEYINFILKMIFVTYFSIGINITPGNGSPYDRLDGMIQWAFPF
FT                   LLDGINGLASWVMNAAPSGLCKFNNLSYDGTVSYIALWDALDCRVAHYLGLDILSTLLV
FT                   ENAYRSHDFLNFDFFSFSAPPYIYLLIPAIISGNMMLVSLALSYPLLVISVAAFMVNAT
FT                   IMCMISIVILGILAPLFVPMFLFTYTRNYFDSWVKLMISFLLQPMVVVTFMITMFSVYD
FT                   YGFYGKCQYKSKLIHNSIENLAQSGGTSSRDVLIFYINNDWDDISQYPDKDAVESCQNS
FT                   LGYMLNNPITTAFNFAKDSVSEIVDSKPGDTPTDKFLAKFQFLSGVVLGPGMFFMSPKV
FT                   LFEKIKNILLALVTACFTLYLMYNFSSQLAEFAADMTEGVALNNVAIKPQAIFKAGMAA
FT                   LAAAGAATKGVDQIASRGGVGDLKAGQGGGVSDNIAKSGGGGPNDNIAASGGTSAPTVT
FT                   TPTASSSVATSSPKTVSSEARSDVVTPPPAPSEAVSPPPASIRTSISTPAPQSNIETES
FT                   VGKIIRDNNQESKKEIDNTPPPQEKVDNAAPQEKVDSTSKGTGVIDYSFNLKEHENPAG
FT                   VKQIRENAEIRDKRAEVEKAWNELVASGGGRIRDQQGEETSERRTNAEKKWNELVDSGV
FT                   VTEIRERDNSVTNKFDKLADELNKSEKAKVEENKNIENDRKENNTTTSPQEKVDSTSRG
FT                   SGVIDYSFNLKEHENPTGVKQIRENAEIRDKRVKVETAWNELVASGGGRVREQEGGEVS
FT                   ERRANAVKTWDELVKSGVVTEKKDNSSNENS"
FT   gene            97948..99966
FT                   /gene="virB6_2"
FT                   /locus_tag="RF_0090"
FT                   /note="RF0090"
FT   CDS_pept        97948..99966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6_2"
FT                   /locus_tag="RF_0090"
FT                   /product="TrbL/VirB6 plasmid Conjugative transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60941"
FT                   /db_xref="GOA:Q4UNB7"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNB7"
FT                   /protein_id="AAY60941.1"
FT                   /translation="MKTLKTLKIFIIICIASVSLASFAGFGESCSSLPTTSDGYLETDT
FT                   AYGYIIRNIDMKDPRGNCNSAASSITFCFKNIEGSSSPCTIYNLNEGDSKKISDLSTDN
FT                   NPDLGANPVLKDIVLTVKKWDNDLCLVMPTSRGPMPVACKSLSATPTPTPPDDENCNIG
FT                   KSCYTGANYSQSLINFSGLAVQCLSETLNKVFFAGNSCSSQDQNSRITNLAAFSTFQGY
FT                   LKRIIGAALILYTMFFAFNMALNKEYASTEKIALFVIKFLLVAYFSIGLGPLDFSGGQP
FT                   TKENGMLKYGLPLLTGAAPDFAQMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRI
FT                   GYYLGLDLLYNIDKNGVLGNSIGNGPGGNNTPIPNFDPDGKKDRPKDLSKAGALRFFAV
FT                   MFGFFMAGNVIILAAGLVFSVIFLSILLYFITHYLVCMITIYVMTYISPIFIPMALFTR
FT                   TKAYFDGWLKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRYDYEKGDIRFSTFE
FT                   LRLPNGGADKCQESFGYKMLQYYAGEGWEEHLLILFPIKSIVKDVVSILAELLCVLVFS
FT                   VIFYYFSKSIGRFASDLTNGPNMDAVTASPTKIVDLVKKGAAFLKDAAMASQGKPSVGD
FT                   KPDVGGKRKEGEQQGGDSESGAGGGLADLASGSGGGK"
FT   gene            99973..102906
FT                   /gene="virB6_3"
FT                   /locus_tag="RF_0091"
FT                   /note="RF0091"
FT   CDS_pept        99973..102906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6_3"
FT                   /locus_tag="RF_0091"
FT                   /product="TrbL/VirB6 plasmid Conjugative transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60942"
FT                   /db_xref="GOA:Q4UNB6"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNB6"
FT                   /protein_id="AAY60942.1"
FT                   /translation="MQSNLLKVLGVLAIVATLVCFIFAALGMIGAVKVGDGCYMRYAPD
FT                   GKGGSDSITGTITLNANANYVNTSKMLPDGTTQLIPDPNRYGEWLNTQVLVENNQPVNL
FT                   QVVGQVSLCLAYVPKDNVQFTESTRPGKSNLDDKGNMIPIPRITDANNPPLSLIMDAKN
FT                   NEWRNIAELYANDRVLVSVSPNFANTDATVEDAFKGTKVTKNCSQGQTSYEPICGKYSV
FT                   YHGEYVNDCEWRDKYWKCNYHHSCDTSFWGGCGLGCPCAFGKICCGEWICDSCGAWVNI
FT                   RTSMPEAYKDDGSVTKAWSDNINNLFFDLFNLECSNNSKTLPNGQCPDAVRDRSPKNLD
FT                   FIKGRCSGTWVEDQCNDGTVSTPELSNYKYFWYTADGKGGKGPTGLIYQMNDAGSVSQA
FT                   LPSKLEFAKFVADTDQPADYKDKDGKYLYKVIYNIPFNSNTEKSYLQYRLWSPTSQDAS
FT                   KNTGGYVLNIKQTKCYRENGNSFNDTFDDRGRVQYIIVKPSENPNTSGKTYSPQGINVN
FT                   SDGKYNFNANEAGYIWMKILNDPSNNLRDYKDSEGNYKVHFSTSLKVGSFTIKVMNPLL
FT                   ELFKTKVQGAATSIFKNMVCYKANDSSSCTNFFTYIKAILILYVMTYGAMFLLGFAKIN
FT                   QKELVTRIAKIGVVSGLMNGNTFEFFNNYLFDAITNFSDAIIANMSGYSLYTSTNTISN
FT                   PFMFLDAVMSKIFFSQTFIAQLLSLLSLGLSGIIYFIITFIAVGIVIITALRAVAVYIM
FT                   AFMATCILIGIAPLFISFLLFDFTRYLFDNWVRFTIRYMIEPVVMMAGIIVLTQLFTIY
FT                   LDFVLGYSVCWKCALPIKIPFIGTILPIALLNVPIFCINWFAPWGMDYMSGMMGVNMQN
FT                   IVALVIIAYGMYGYVEFSGRMVAKLTSAAGPSATEIGGRMSHDAGQKALSPIGMDDKTR
FT                   QGITGRAEARLKQRNKTLDQAEKNRKNTPKEGGEKTNAEPPQPEARG"
FT   repeat_region   102946..103042
FT                   /note="RPE-7 Full"
FT   gene            103135..105807
FT                   /gene="virB6_4"
FT                   /locus_tag="RF_0092"
FT                   /note="RF0092"
FT   CDS_pept        103135..105807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6_4"
FT                   /locus_tag="RF_0092"
FT                   /product="TrbL/VirB6 plasmid Conjugative transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60943"
FT                   /db_xref="GOA:Q4UNB5"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNB5"
FT                   /protein_id="AAY60943.1"
FT                   /translation="MKILKSLVLLVLFMAMPAKADDAFSWMSTSFGGLKSLFGCLEVPE
FT                   FTSFKEGNIGISLSTAGTWQSTGNSVEKGKLLKINWSTSGITPEPRKYLVLYRIDPRFS
FT                   TPQVFIKTYNYSKLQFEALGFPRFVTDNNSATPGAIPPDKDLDALSFTKMSDSVKYFNY
FT                   SNGNSRIEVKAGDVVNISLVGKDNFFSPNTLDNILTQELDSSIFAASALYTQSNLGNFD
FT                   NRIIYSSAKEVCDLIDASRDPDKPSGCSGTGSATKYKSINSNEALVGKPMITRAVQNFM
FT                   GLINSCPANAGINTSPACYYDQGRGMIIKVGGQVIKERDQSFVNSGSTQSSFIYYQATS
FT                   GGTMDFTSDWQVNNMFSNSVLMSDWSRNFSNYANFVDYINKNDWSANFLYFGRYSMIVE
FT                   IGNGANSINPGDQQNISLEYLITSDGTLPDPSVRGTPVDYNFAADAPQDGYLWLRVVNP
FT                   NSNIQGVVSVNYANYTGTTWFSDIIYNGAIKPITDQFRTFSQNFYIKLVKNSAVQNIAK
FT                   AALTLYVTIFGLMFVAGALKLTAVEVITRICKIAIVAFLIREESWSFFNTYFFSAFTNG
FT                   IDFFVTNVVGATSSRANIFGFIDPIFDKYTNGRIWGLLFIELLQIHNGLAFIAIITIYS
FT                   LITYFRAILEVIIGYVIAFIGLTVMISLAPFFIILMLFEKTKSLFDNWISTLLSYVVQP
FT                   TILLIFFLLIDQVLSEQLLKVVVRACWDTLIPIKIGLDLTNLGIPINFSFTLPFLPGIP
FT                   FYVPDVPEISSSNILTNKANTFLVLFTTALLFYSYCLMSYGLVTFVNIVVGMLTNVTPA
FT                   RISGNYQERSDPVGAVMQDIGSVTKPIKKAAMAPARVFKDKIIDQNYKARKPEGGEHTN
FT                   KFLAERNDVPKKEEGERKE"
FT   repeat_region   complement(105825..105901)
FT                   /note="RPE-7 Full"
FT   gene            105951..109418
FT                   /gene="virB6_5"
FT                   /locus_tag="RF_0093"
FT                   /note="RF0093"
FT   CDS_pept        105951..109418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6_5"
FT                   /locus_tag="RF_0093"
FT                   /product="TrbL/VirB6 plasmid Conjugative transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60944"
FT                   /db_xref="GOA:Q4UNB4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNB4"
FT                   /protein_id="AAY60944.1"
FT                   /translation="MNKNIFITLLISSLLLLSGCTGDTCIDPDDFGFIKFNVSSRYNPE
FT                   EITSRQEGDQVAPWRDSAYKVNGYPLTVMVRPWSYILGDKNTSGQLSAWCPWYGQKNNT
FT                   TTLAAFCVKLQPCTFWDNARLDMCTPNPANQNDAMISNPPCIMTDGVGLYFLIAAKNTD
FT                   PNISPDSQRKPQGITQHLGELTSSVGYEFYSISSTGQFLPAGGINYQYKGEDKSKYAQS
FT                   PLYFKIIDKFYDDNSGQYRLVIKSGVTDTRPDPLQFLTDLIKGVLFGKDGIIKKTYQQI
FT                   IDTPGYRMSVSAILTLYIMFTGFSFLIGNINLTHVELIVRILKVSIVSILLSTDKAWTF
FT                   FHDYLFVFFIDGVQQILQIINEAAATGPGSQSLLGLLISPQTLSKLFSLLFVDWLGFIY
FT                   IILYLIALYFIFFLIFKATIIYLTALITIGMIIIMGPIFICFMLFNITRSLFENWLRQL
FT                   ISYALQPIILFAGIAFISMIIRTEIYSTLGFGVCKHDFPNLGPINEIFGSFLEDIDPSL
FT                   GNSIFYWWFPVPMKGGINNFHKAKILVPEDHIIVDDSCKNDPDKCKHCAAYECIDERYI
FT                   ELPFLDLVKDAKRISNFINGKFVQLDGILLIFVSIYLLSKFNDTAISTAQFIAGTSGNL
FT                   TDIQKVNQQSYESAAKQMNRPLSYVAKTVSVPVTTRVSAKLEETSMFFAKGFEDIMMGR
FT                   LEKQALGSSANKAVQNEVKRKYGIDSKDVKMNAITDYENGISGLLKNLPKGNELKAKEL
FT                   SQMKFTQLRDKIAANKYGVKDYAALSEEQKRELDKSLKDANLRELASDANFTKDYQDAY
FT                   KYAHQEMSGRGVGLFGKNIKPLRSWQEMEHRVDTKRKLKEERRVGIGEKLYAGYTGIKR
FT                   GALTAIVGKDLRDAYEGNLTSAEWHDFEYNDPRLRTYSEKLKDDEKAREREELQMHINK
FT                   ETLAAQADILSPEYLARLEKAGRQSDVEYYQELAQRKLIHEVRGRLFEEGEPVMMGDRF
FT                   MREKATDSQMRDMIDNAHRKHAEFIEGDRYTRRQEHYDIMHEKAEGNLEQTYKELKDHF
FT                   KRDDINIEEMPALIAQKIKDTEQGPEVDAKITEELNNFNADVKNYEYSTEVLNKIEDRK
FT                   QAITDEVNAQIDQINKYRENAKMEKYVRPIVNEGRKLRKLEDHLRGMK"
FT   gene            109503..109739
FT                   /gene="vapB2"
FT                   /locus_tag="RF_0094"
FT                   /note="RF0094"
FT   CDS_pept        109503..109739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapB2"
FT                   /locus_tag="RF_0094"
FT                   /product="Antitoxin of toxin-antitoxin system VapB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60945"
FT                   /db_xref="GOA:Q4UNB3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="PDB:3ZVK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNB3"
FT                   /protein_id="AAY60945.1"
FT                   /translation="MNKAKIFMNGQSQAVRLPKEFRFSVKEVSVIPLGKGIVLQPLPNS
FT                   WKDVFQEMAEISSDDIFPEGRKDLPPQKRKYFE"
FT   gene            109736..110140
FT                   /gene="vapC2"
FT                   /locus_tag="RF_0095"
FT                   /note="RF0095"
FT   CDS_pept        109736..110140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapC2"
FT                   /locus_tag="RF_0095"
FT                   /product="Toxin of toxin-antitoxin system"
FT                   /note="Containing PIN domain for nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60946"
FT                   /db_xref="GOA:Q4UNB2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="PDB:3ZVK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNB2"
FT                   /protein_id="AAY60946.1"
FT                   /translation="MIYMLDTNICVYAINKHPDSYYNNLELLAKNNTIAISSIVLAELQ
FT                   YGVSKSKKKEQNQSKLDIFLSRLEIIDFSAKCTFYYGELRTELEQKGLIIGNNDLLIAS
FT                   HAIAENATLVTNNIKEFKRIPNLILENWDK"
FT   gene            110265..111314
FT                   /gene="pta"
FT                   /locus_tag="RF_0096"
FT                   /note="RF0096"
FT   CDS_pept        110265..111314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="RF_0096"
FT                   /product="Phosphate acetyltransferase Pta"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60947"
FT                   /db_xref="GOA:Q4UNB1"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNB1"
FT                   /protein_id="AAY60947.1"
FT                   /translation="MKKQHIINETFLDAILAKKLGTTYTPPKEINDPDFDEAAKHFIDL
FT                   LLRADGFKPVKTAVVHPIDKESLLGAVRAAQFNVIKPVLIGPQHKIESVAKVNNVDLED
FT                   YQVINVEHSHEAAKKAVELAKKREVAAIMKGSLHTDELMSAVVHKENGLRTERRISHAF
FT                   LMAVATFPKPFIITDAAINIRPTLEDKRDIVQNAIDLMHMIKEDKQVRVAVLSAVETVT
FT                   SAIPTTLDAAALSKMADRGQITSAIVDGPLAFDNAISLFAAEAKGISSSVSGNADILVV
FT                   PDLESGNMLAKQLKYLGQAVMAGIVLGARVPIILTSRADPMDMRVISCVLASFIYNHTK
FT                   AKLHIQAGK"
FT   gene            111250..112473
FT                   /gene="ackA"
FT                   /locus_tag="RF_0097"
FT                   /note="RF0097"
FT   CDS_pept        111250..112473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="RF_0097"
FT                   /product="Acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60948"
FT                   /db_xref="GOA:Q4UNB0"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNB0"
FT                   /protein_id="AAY60948.1"
FT                   /translation="MYLLHLSIITLRQSYISKQVNNMKDVILIANAGSSSLKISIFEIQ
FT                   NKKVKDKIYNIFLEKNVNKILFHINKKQESATDIKDDAIEMMIDLFEDWWKKQENLNLI
FT                   ATGHRIVHGGKNFNKPVIVYEKVSKDLTVLIPLSPLHQPYNLQVLDLFLQKYKEISHIA
FT                   CFDTSFHFTNPPITKAFGLPKKYYDKGIIRYGFHGLSYKYVSSHFKEMTKEDLPTKTII
FT                   AHLGSGSSLCAIKNGLSLTSSMGFSVLDGVMMGTRTGNLDPGVVLYLIDHEKMTTKEVT
FT                   ELLYKKSGLLGMSGESSDMRTLLASNSPDAKFAIDLFVYRIVLEIGKLTAALEGVDCLI
FT                   FTAGVGQNSAVIRKMITEKLLWLGIKIDDTKNQKNEHLISTSDSKVKVFAVPTNEELII
FT                   AEEVMKFL"
FT   gene            112672..112956
FT                   /locus_tag="RF_0098"
FT                   /note="RF0098"
FT   CDS_pept        112672..112956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0098"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60949"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNA9"
FT                   /protein_id="AAY60949.1"
FT                   /translation="MKKDSRVNFMQKQVIAKNAEAGYKTALKIEQQAKEAGISLDKDAM
FT                   RRLEKIKSRYIEAAKKAEFQKFQSDQAHKTNKQKAEAFRSGATAAAKKQ"
FT   gene            113044..113748
FT                   /gene="trmD"
FT                   /locus_tag="RF_0099"
FT                   /note="RF0099"
FT   CDS_pept        113044..113748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="RF_0099"
FT                   /product="tRNA (guanine-n1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60950"
FT                   /db_xref="GOA:Q4UNA8"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNA8"
FT                   /protein_id="AAY60950.1"
FT                   /translation="MFILHATILTVFPEMFPGTLGYSLAGQALHKNIWSYDVINIRDFG
FT                   LTKHKNVDDEAYGGGDGLIMRPDVLGSSIDHALSLNPNAEIYYPSPRGRVFTQSFAKEM
FT                   LKNKNLIFLCGRYEGIDERVIEEYNVKEISVGDYILSGGEIPTLTILDCLIRLLPGVLM
FT                   NQNTLSSESFEEVGEFKGGLECGLYTRPEIWRDRAVPSVLLSGNHRLINEWKKEQSRII
FT                   TKLRRPELLKDL"
FT   gene            113767..114183
FT                   /gene="rplS"
FT                   /locus_tag="RF_0100"
FT                   /note="RF0100"
FT   CDS_pept        113767..114183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="RF_0100"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60951"
FT                   /db_xref="GOA:Q4UNA7"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNA7"
FT                   /protein_id="AAY60951.1"
FT                   /translation="MNIIDHFEQENISKLTANKKIPDFEAGDTVKVTVKIIDRSIEKDG
FT                   KEKLTERFQAYEGVVIAKRNRGITSSFLVRKISHGEGVERRFMTYSPIVHSIDVVKYGV
FT                   VRRAKLYYLRQRSGKSARIKERHIPIAKTKAAKA"
FT   repeat_region   complement(114187..114310)
FT                   /note="RPE-5 Full"
FT   gene            114492..115244
FT                   /locus_tag="RF_0101"
FT                   /note="RF0101"
FT   CDS_pept        114492..115244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0101"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60952"
FT                   /db_xref="GOA:Q4UKM2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UKM2"
FT                   /protein_id="AAY60952.1"
FT                   /translation="MNNHLGYSKYNQSDAQNSRNGYNTKNLITKNGAVEIEVPRDRNSS
FT                   FAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLISQITDDIIE
FT                   DVKLWQSRPLDPVYAIVFFDCLIVKVRQDKRIINKSVYVALGIDLEGRKDILGLWISEN
FT                   EGAKFWLGNFTEMKNRGIQDILIACSDNLNGMSEAIGAVFPKTEHQLCIVHQIRNSLRY
FT                   VSYKDRKELAGDLKPIYTLAQKKKHFPL"
FT   gene            115319..115480
FT                   /locus_tag="RF_0102"
FT                   /note="RF0102"
FT   CDS_pept        115319..115480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0102"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60953"
FT                   /db_xref="GOA:Q4UNA5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNA5"
FT                   /protein_id="AAY60953.1"
FT                   /translation="MIFLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNAVFK
FT                   AYIWQLIT"
FT   gene            complement(115583..116431)
FT                   /locus_tag="RF_0103"
FT                   /note="RF0103"
FT   CDS_pept        complement(115583..116431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0103"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60954"
FT                   /db_xref="GOA:Q4UNA4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UNA4"
FT                   /protein_id="AAY60954.1"
FT                   /translation="MCKFLKGCIEENITKREITMTQKQNAAMEQAIDLLINNDTDVSIL
FT                   FREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSDAQNSRNGYNTKNLITKNGAVEIE
FT                   VPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLIS
FT                   QITDDIIEDVKLWQSRPLDPVYAIVFFDCLIVKVRQDKRIINKSVYVALGIDLEGRKDI
FT                   LGLWISENEGAKFWLGNFTEMKNRGIQDILIACSDNLNGMSEAIGAVFPKTEHQLWSLP
FT                   D"
FT   repeat_region   complement(116561..116656)
FT                   /note="RPE-7 Full"
FT   repeat_region   116704..116806
FT                   /note="RPE-4 Full"
FT   gene            complement(116930..117232)
FT                   /gene="secG"
FT                   /locus_tag="RF_0104"
FT                   /note="RF0104"
FT   CDS_pept        complement(116930..117232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="RF_0104"
FT                   /product="Protein-export membrane protein SecG"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60955"
FT                   /db_xref="GOA:Q4UNA3"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNA3"
FT                   /protein_id="AAY60955.1"
FT                   /translation="MIEILLFVHITIAVLLIIVILMQRSGSDGISSISGGNNMGVVSAK
FT                   TVGNFLTKSTIILTTLFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLPIAK"
FT   gene            complement(117487..117729)
FT                   /locus_tag="RF_0105"
FT                   /note="RF0105"
FT   CDS_pept        complement(117487..117729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0105"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60956"
FT                   /db_xref="GOA:Q4UN48"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN48"
FT                   /protein_id="AAY60956.1"
FT                   /translation="MIFLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNAVFK
FT                   SLYLAIDYMTKKWSMPIPNWNAAMAHFLIKFDERI"
FT   gene            complement(117804..118757)
FT                   /locus_tag="RF_0106"
FT                   /note="RF0106"
FT   CDS_pept        complement(117804..118757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0106"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60957"
FT                   /db_xref="GOA:Q4ULY4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULY4"
FT                   /protein_id="AAY60957.1"
FT                   /translation="MCKFLKGCIKENITKREITMTQKQNAAMEQAIDLLINNDTDVSIL
FT                   FREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSDAQNSRNGYNTKNLITKNGAVEIE
FT                   VPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLIS
FT                   QITDDIIEDVKLWQSRPLDPVYAIVFFDCLIVKVRQDKRIINKSVYVALGIDLEGRKDI
FT                   LGLWISENEGAKFWLGNFTEMKNRGIQDILIACSDNLNGMSEAIGAVFPKTEHQLCIVH
FT                   QIRNSLRYVSYKDRKELAGDLKPIYTLAQKKKHFPL"
FT   gene            complement(118779..120992)
FT                   /gene="parC"
FT                   /locus_tag="RF_0107"
FT                   /note="RF0107"
FT   CDS_pept        complement(118779..120992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="RF_0107"
FT                   /product="Topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60958"
FT                   /db_xref="GOA:Q4UNA0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UNA0"
FT                   /protein_id="AAY60958.1"
FT                   /translation="MKEAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRR
FT                   LLYAMLQLRLEPNSGYKKCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQ
FT                   GNFGSIDGDNAAAMRYTESRMTEICTLLMVDIEKDTVDFRPTYDDSDLEPVIMPASFPN
FT                   LLANGSEGIAVGMATNIPPHNLHELCDALVHLIDHPKAEISDMMNFIKGPDFPTGGIII
FT                   DKAELINAAYSTGRGSFRMRSRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKD
FT                   KKIPLVSNIRDESTDIIRLVIEPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNV
FT                   PRVMNILEVLQEFLAHRQNIVTRRSTYLLNKIKHRLEILEGLRIAYLNLDEIIKIIREE
FT                   DEPKAIMMERFKLTEIQVEAILNTRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPK
FT                   ELWKIVKKEIKAVQTKFGLNTVIGARRTSFEEVTLTNQVVDITAFITKEPITIICSKMG
FT                   WVRSLKGHNTDLSTIKYKEGDAEKFIIEAYTTDKILIVSSEGRFFTLLADNISKGKGTG
FT                   ESIKLLVDIGNNDITNILVHKSDQLLLLASSIGKGFLVNSNEVMAQTKTGKQIMNVPDG
FT                   HTCIACLPVNGDSIACIGESRKLLVFNIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKE
FT                   DGLSWNNNGKVKLEKNIIAFLGKRGSTGKLPPMGFHKNNRFSS"
FT   repeat_region   complement(121055..121123)
FT                   /note="RPE-7 Full"
FT   gene            complement(121332..122006)
FT                   /locus_tag="RF_0108"
FT                   /note="RF0108"
FT   CDS_pept        complement(121332..122006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0108"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60959"
FT                   /db_xref="GOA:Q4UN99"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN99"
FT                   /protein_id="AAY60959.1"
FT                   /translation="MINNIFVKIFLVCLICISAIYFGYQYYQNSKPVITIYPDELPTKI
FT                   KPSIIENNQIAAVHSSIYENLIAKDTNIKTVKLLPDPEKPMNIDSRNQSQSNESFDEIS
FT                   NLIALIEPNNNAKNETDLNIIKLEKGSKDKVSNAKNCKNNESYKIQLGSVKSEAEAMQE
FT                   GERIKKKFPKILKNVVITTKKVKYDDGKFFYLILAGDYGSLSQAKAVCKKLAYNKQSCV
FT                   LK"
FT   repeat_region   complement(122033..122102)
FT                   /note="RPE-7 Full"
FT   gene            complement(122140..123870)
FT                   /gene="argS"
FT                   /locus_tag="RF_0109"
FT                   /note="RF0109"
FT   CDS_pept        complement(122140..123870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="RF_0109"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60960"
FT                   /db_xref="GOA:Q4UN98"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN98"
FT                   /protein_id="AAY60960.1"
FT                   /translation="MNIFNQLKQDIIAASKQLYNNQEIANTANIETPKDNFNGDLSSNI
FT                   AMIIAAKESISPREVALKFKEVLTTLPYIASIEIAGPGFINFTIKAESWQASIKDILQH
FT                   EEKFFEIDIDKSRNINIEYVSANPTGPMHIGHARGAVYGDVLARILQKVGYSVTKEYYV
FT                   NDAGSQINDLVSTVLLRYREALGEKITIPAGLYPGEYLIPLGQILAKEYGNKLLTMNEN
FT                   ERFKIVKNFAVEKMLDLNRKDLADLGIKHDIFFSEQSLHDKGEIEGTVKLLTGMGLIYE
FT                   GTLPAPKGKVHEEWDNRVQKLFKSTNYGDSQDRPIEKADGSWSYFASDLAYAKDKIDRG
FT                   ANHLIYVLGADHSGYVKRIEAIVKALGKEQVKVDVKICQLVNFVENGVPVKMSKRLGNF
FT                   ASVQDVNHEVGKDIIRFMMLTRQNDKPLDFDLVKVKEQSRENPIFYVQYAHVRTISILS
FT                   KARELMPESYNNFEEGKYDLSLLSSEEEIEIIKLLASWTKTLEASAKYFEPHRIAFYLI
FT                   NLASRFHSMWNFGKENSDYRFVIESNKELTLARLALASAIQKVIASGLEVIGVEPMDRM
FT                   "
FT   gene            complement(123876..125027)
FT                   /gene="dgt"
FT                   /locus_tag="RF_0110"
FT                   /note="RF0110"
FT   CDS_pept        complement(123876..125027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="RF_0110"
FT                   /product="Deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60961"
FT                   /db_xref="GOA:Q4UN97"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN97"
FT                   /protein_id="AAY60961.1"
FT                   /translation="MLASYASDPLKSRGRLYKELPTSYRNEFERDRDRIIHTNAFRRLQ
FT                   YKTQVFINHEGDHYRNRLTHSLEVSTVARSVANTLNLSSDLAETIALAHDLGHTPFGHA
FT                   GERALNECMKEYNGFSHNAQSLKILTLLEKRYAAYNGVNLTWEVLEGIVKHNGPITDEI
FT                   NEYIAEYNKQNDLELSTYASAEAQIAALADDISYISHDLEDSIGAKIIDFNSLAELKYI
FT                   DQHVFEIKTKFKNISSSCLIYEVVRKLIHELITDLLWQTKENLNKEKITNIDEIRNLNY
FT                   QIVDFTEKTNERIKETKKFLHERVYKSNKITAISLKCTKIVQGLFKVYMDDINLLPVNW
FT                   KMLIDSNETYSKARIIADYIAGMTDRFAIQEYNQLCSLNFNNI"
FT   repeat_region   125097..125168
FT                   /note="RPE-7 Full"
FT   gene            125133..125585
FT                   /gene="iscA1"
FT                   /locus_tag="RF_0111"
FT                   /note="RF0111"
FT   CDS_pept        125133..125585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscA1"
FT                   /locus_tag="RF_0111"
FT                   /product="Iron-sulfur cluster assembly accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60962"
FT                   /db_xref="GOA:Q4UN96"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN96"
FT                   /protein_id="AAY60962.1"
FT                   /translation="MPRRGSASPRNDDLVASTQRHLEKIFIILYNLQDFYKVILVTITI
FT                   TDRAFERVYELVELEKDKNLVLRVSVDSGGCSGLMYNYELVSKDNIEQDDYVITKHNAT
FT                   IIIDPISQKFMLDCTLDFIEELGSSYFNVSNPQAKAKCGCGNSFSV"
FT   repeat_region   125635..125730
FT                   /note="RPE-7 Full"
FT   repeat_region   125769..125799
FT                   /note="RPE-6 Partial"
FT   gene            complement(125851..129921)
FT                   /locus_tag="RF_0112"
FT                   /note="RF0112"
FT   CDS_pept        complement(125851..129921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0112"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60963"
FT                   /db_xref="GOA:Q4UN95"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN95"
FT                   /protein_id="AAY60963.1"
FT                   /translation="MNFSNYPFIKEDIQCIADYLRNNKTIERVFLDNCGINDKQVKILA
FT                   EIFRLNKTITKLSLVSNKAITNIGIKTLLEIKHNNQYKRAELEISPNFNDNSEFQLIPE
FT                   IDILNKNSVNTYLKKTKARNLDSEIENKNLQPLKNYHELKRPFIKNGNKLLKLIAESHN
FT                   EITKTGNSINKLIVMVGMNGVGATTLSCFLSGQKLEEDEDRSLYAKEPKYNEKIHHQAN
FT                   NGYKLVNNFFISDDEGGINIIECPGIHNKPINSIQTILNLYIYRQILELAEKVRFSVVI
FT                   RDNSANDVVDSTYQQFTNIFRDSNGQLTPEIKEQLKDAVSYIISVADYKTNEEKKAKIK
FT                   VEESKLRKDAKRQNLDEGQKFIIEELGKSVNLFKKPSGDTKSFLETLDTKDFFIVIDAI
FT                   SLVVRTIANNEIEAEREQIFSYIEAIFQSKNEEEKNANIVLIDEWQRKILDVLAISKDT
FT                   GDVLPKSASVNFATTIEVISQSKNEEEKNTNITVIDGQKHPDLYVLAPSKGTGDVLPNS
FT                   ASNTNSTITAEEQKNIMTTALKFELQDILSKKNLYEPLIIEQVKKLMSLCIKPFSDTLN
FT                   IKDLSQAKDLNQVKNLNQVKDSSQNKWATIKEIYIKPQKSETQKPILSQVLSNQVKENI
FT                   LTIGKIIINFFQVNKHNIISPFISSDNLNLHQGLDSDTFSNNYSLIQPYLPKKILNKSP
FT                   AQETEESFFPALKEIEELNEIYIKYSDDHLTMVTSFLEIIRKFYESKDISAKIHFQEIL
FT                   GNYVYFLNQQWKALSFCKKLYPQSQKWQPLTEAVDKAKKILIEENLLDIKLKNNGTTKY
FT                   YTEALEWLDKLTGPQVEVVVIAINEIKANAYYYLGMIYENSESQLDWFVAIREYIKTLE
FT                   VDKDFNFLYGHDTIPYISSNICKKIGDLFLVLGKWYKSKNENVSAIKLTHEAMKYFKVS
FT                   LSIADIEESSNILHEIFSILKNKRETKVLCISLEKDLHISVAEFLFQLNLIQKAGLEYL
FT                   RAASRVDKNDKEKQGLVSKALKAFDTDIAKNTAFIRAMLEKGKIEDLSMFTKEVNRTKF
FT                   FSDTQTLVNNFVPLPEPQAIEWPKVQQNQNEQLTNEQKETNKQNDIQPQKQEEVLVQLQ
FT                   QTQQHQPPPLPPENSPLHTVENIQKPDYWYTEDDIKNILEANIDKNKFSIVTHVDLAHP
FT                   EQVRDALRERVHEDLIKNNKIVLMAINTGHGHWVSMAISKDNNTNKVIFKYNDPLGREL
FT                   NDRPDLIELITEVCSEVEIIDLQILQQDNTSDCGVFVCDDLIRQSQSLEILSTEQCGKQ
FT                   GLNLRKSQAETLKQSLIAQQAQEQHVYINVDSNASDDEEDENNNGNNNEVARLPYGDNG
FT                   EVDGLGIASQHNE"
FT   repeat_region   130438..130593
FT                   /note="RPE-8 Full"
FT   gene            complement(130596..131420)
FT                   /gene="kdsA"
FT                   /locus_tag="RF_0113"
FT                   /note="RF0113"
FT   CDS_pept        complement(130596..131420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="RF_0113"
FT                   /product="3-deoxy-8-phosphooctulonate synthase"
FT                   /EC_number="2.5.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60964"
FT                   /db_xref="GOA:Q4UN94"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN94"
FT                   /protein_id="AAY60964.1"
FT                   /translation="MQKVVKLNNIKIGNDLPFVLIAGPCQIEGKDHALFMAEKLVKLTS
FT                   KLEIPFIYKSSFDKANRTSVNGIRGLGIEKGLEILSKVKSEFDCPIVTDVHSESQCTET
FT                   AEIADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDIL
FT                   FTERGACFGYNNLVSDMRSLAIIAELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLA
FT                   KAATAVGIAGMYMEVHQDPDNAPSDGPCMIKLDNLESILIKLKKYDKITKEK"
FT   gene            complement(131456..131773)
FT                   /locus_tag="RF_0114"
FT                   /note="RF0114"
FT   CDS_pept        complement(131456..131773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0114"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60965"
FT                   /db_xref="InterPro:IPR022718"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN93"
FT                   /protein_id="AAY60965.1"
FT                   /translation="MSLTQILLILFVGILVTKPHDIFIIIKEFKKIKAYLINIKSSIIK
FT                   NIDKPLETEQVNFYLKKIINLEGYYHGNYDLTTIKEKYYTLIINNDLIENESTPNITEK
FT                   H"
FT   gene            complement(131776..133443)
FT                   /gene="abcT1"
FT                   /locus_tag="RF_0115"
FT                   /note="RF0115"
FT   CDS_pept        complement(131776..133443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT1"
FT                   /locus_tag="RF_0115"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Two ATP-biding cassettes"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60966"
FT                   /db_xref="GOA:Q4UN92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN92"
FT                   /protein_id="AAY60966.1"
FT                   /translation="MSYQYVYEMVGLSKIINGKRILKETNLSFLPKAKIGIIGPNGAGK
FT                   STLLKIMAGIDKEFEGKATAKIGIKVGYLPQEPYLDASKNVFDNIIEGLHEKKKLIDEF
FT                   NYISNKFAAEVTDEEMQKLFDKQAELQEKIDNCDGWNLEREIEIAMLALRCPPKEADIT
FT                   KISGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVSWLEGYLKHYEGTVIVITHDRY
FT                   FLDNVTEWILEIDRGNCIPWESNYSSWLEQKQKKLALESKEDDDRKKQLNRELEWIRQT
FT                   PKARQSKNKARITAYQELLNKQQEQKTDPTQIIIPNGPRLGDLVIEAEHIAKKFNNKIL
FT                   LSDFSFKVPRGAIVGIIGPNGAGKSTLFNIITGKITPDSGSIKIGQTVKLGYVDQSRDH
FT                   LDDNKTIWEEISEGLDELQLGNRIIKSRAYCAAFNFRGGDQQKKVGQLSGGERNRVHLA
FT                   KLLKEGANVILLDEPSNDLDIDTLRALEDAILDFAGCVLVISHDRWFLDRIATHIISYD
FT                   KENNATWFEGNYQDYHEYMLSTNGESILNPKYKHKKLI"
FT   gene            complement(133635..134495)
FT                   /locus_tag="RF_0116"
FT                   /note="RF0116"
FT   CDS_pept        complement(133635..134495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0116"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60967"
FT                   /db_xref="GOA:Q4UN91"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN91"
FT                   /protein_id="AAY60967.1"
FT                   /translation="MAKNKGLGRGLSSLLGEEVISIESEIIQIINIDKIRPNENQPRKN
FT                   FEYDKIKELADSILNNGLLQPIIVDNNFQIIAGERRWRACKLAKVLEIPVIIKNLDARE
FT                   SMEIALIENIQRTDLTVMEEARGFKYLVENFNYTTEKLAERLGKSRSHIANLLRLNNLP
FT                   QSIQDKVNENILSMGQARCLINHEHAEVMADHIISNDLNVRQTEELVRQWYKNEYTKSP
FT                   NNNNKVGKRFLKDNATDNDLESLVKVLSEKFGIKVTIENYSLGGKLIFHYKNLEELDLI
FT                   LLKLN"
FT   gene            complement(134482..135249)
FT                   /gene="soj"
FT                   /locus_tag="RF_0117"
FT                   /note="RF0117"
FT   CDS_pept        complement(134482..135249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /locus_tag="RF_0117"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60968"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN90"
FT                   /protein_id="AAY60968.1"
FT                   /translation="MKVIAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSS
FT                   TGFGISQQQRKNTIYQVLTNLIKLKDAIISTDIPNLEIITSNTNLSAAELDLTKLKDRE
FT                   YILMKLLEEIKILYDYVIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKT
FT                   IEIVEKKLNPKIKIAGILFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAP
FT                   SYGKPAIIYDYKCSGAVAYIELTKEILERYGEK"
FT   gene            complement(135246..135824)
FT                   /gene="gidB"
FT                   /locus_tag="RF_0118"
FT                   /note="RF0118"
FT   CDS_pept        complement(135246..135824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="RF_0118"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /note="Involved in bacterial cell division"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60969"
FT                   /db_xref="GOA:Q4UN89"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN89"
FT                   /protein_id="AAY60969.1"
FT                   /translation="MMEVPREIIEKLEIFQKLVKKWNKSINLVSDNTIHNFWQRHILDS
FT                   LQLMQYIDNKEIHLVDIGSGAGFPGIVLSIAGVAKVSLIEADLRKCIFLEKASKISNNN
FT                   IQIINQRIEKVEIDCSILTCRAFSKLNTIFNCIKNISVQEKFLLLKGKNYLTEIVEAKE
FT                   MWLFDYLIHQSITCEEGKILEVSNLTKII"
FT   gene            complement(135805..137673)
FT                   /gene="gidA"
FT                   /locus_tag="RF_0119"
FT                   /note="RF0119"
FT   CDS_pept        complement(135805..137673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="RF_0119"
FT                   /product="Glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60970"
FT                   /db_xref="GOA:Q4UN88"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN88"
FT                   /protein_id="AAY60970.1"
FT                   /translation="MLKYDVIVIGGGHAGVEAAAASARLGASTLLITLKPENLGEMSCN
FT                   PAIGGIAKGTLVKEIDALDGLMGYVIDQGGIHYKMLNETRGPAVWGPRAQADRKLYKKA
FT                   MCQILTNYPNLDILYGKVEDIEIKSSKVEAVILNNDSKILCQKIILTTGTFLSGLIHIG
FT                   QKKIPAGRVDEEPSYGLSNTLKKVGFKIARLKTGTPPRIDGRTIDYSKTALQPGDKTPR
FT                   PFSELTSVVNVPQINCFITKTTSETHDIIRENLNKSAMYSGQIEGIGPRYCPSIEDKIV
FT                   RFSTKSEHRIFLEPEGLDDYTIYPNGISTSLPEDVQHKLIKTIPGLENVKVLRPGYAIE
FT                   YDYVDPREISVTLETKKIAGLYFAGQINGTTGYEEAAGQGIIAGINAALAVKDQAPFML
FT                   TRANSYIGVMIDDLTTFGTIEPYRMFTSRSEYRLSLRADNADLRLTELGINIGVVSEKR
FT                   KKIFTKKCEDIEKTKLLLNTLSLTTSKLAKMGIQVAQDGTYKTVLDLFKIPSFNVEQAI
FT                   KIFPMLKEMQNNNILQLLYIEAKYASYLTRQHADINLFQSEEAQLIPKNIDYFKIPSIS
FT                   LEIQEKLSSHKPTTIGVARRISGITPAAITAIIIYLKTKYSDGSST"
FT   gene            complement(137677..138099)
FT                   /gene="ndk"
FT                   /locus_tag="RF_0120"
FT                   /note="RF0120"
FT   CDS_pept        complement(137677..138099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="RF_0120"
FT                   /product="Nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60971"
FT                   /db_xref="GOA:Q4UN87"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN87"
FT                   /protein_id="AAY60971.1"
FT                   /translation="MTIQYTFSMIKPDAIKRNKIGQVNTYLENAGLKIVAQKMKFLTKY
FT                   EAECFYDEHRARPFFNSLVEYITSGAVVLQVLKGEDAIILNRTIMGATNPAEAEAGTIR
FT                   KDLGESIEANSIHGSDSENSAKREIEFFFNKSEIIE"
FT   gene            complement(138129..139418)
FT                   /gene="uhpC"
FT                   /locus_tag="RF_0121"
FT                   /note="RF0121"
FT   CDS_pept        complement(138129..139418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpC"
FT                   /locus_tag="RF_0121"
FT                   /product="Sugar phosphate permease"
FT                   /note="COG2271"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60972"
FT                   /db_xref="GOA:Q4UN86"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN86"
FT                   /protein_id="AAY60972.1"
FT                   /translation="MTDTKPKIKTPRSPYVKKYNSWRIRILYSIIIGYATFYFCRQNFN
FT                   IATPAIREYFGVTKTQIGWILTASSIMYGVSKACNGFISDKVNARIFMVLGLLFVGVIT
FT                   ILIGFADSLWLIGILWIASNWFQSMGWPPATKMLTHWFASKELGTKWAMGATSNQIGGA
FT                   LAMISCGYLIDKFDWRVAFFVPGVVACVVSLFLYNRLRNSPKEVGLSTVEEYKEYPPEA
FT                   IGDYEKLLTPQLLKMVFCNKLIWYVCLANMFVYIIRSGVIYWAPTFLKDLRNISLANVG
FT                   LQIGLYEMIGIPGALIAGVLSDKLFQGRRGPVASICMVLLSLLLVLFWKIPIQSELLSI
FT                   VILSLIGFFVSGPQLLVGIAAADFSTRHAVGTANGLSGLFGYLGAAIAGVGVGWISDNY
FT                   GWNGVFIFFSISALLGGGLFALTWNRSAKK"
FT   gene            complement(139486..140982)
FT                   /gene="tlc1"
FT                   /locus_tag="RF_0122"
FT                   /note="RF0122"
FT   CDS_pept        complement(139486..140982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlc1"
FT                   /locus_tag="RF_0122"
FT                   /product="ADP,ATP carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60973"
FT                   /db_xref="GOA:Q4UN85"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN85"
FT                   /protein_id="AAY60973.1"
FT                   /translation="MNTPKSDNYLSELRKVIWPIEKYENKKFLPMAFMMFCILLNYSTL
FT                   RSIKDGFVVTDIGAEAISFLKTYIVLPSAVIAMVIYVKLCDILKQENVFYVITSFFLGY
FT                   FALFAFVLYPYPDLVHPDPETIESLSLAYPNFKWFIRIVGKWSFASFYTMAELWGTMML
FT                   SLLFWQFANQITKTDEAKRFYSMFGLLANLALPVTSVIIGYFLHEKTQIVAEHLKFVPL
FT                   FVIMITSSFLVILTYRWMNRNVLTDPRLYDPALVKEKKAKAKMSLIDSFKMIFTSKYVG
FT                   YIALLLIAYGISVNLVEGVWKSKVKELYPTKEAYTIYMGKFQFYQGWVAIAFMLIGSNI
FT                   LRKVSWLAAAMITPLMMLITGAAFFAFIFFDSVIAMHLTGILASGPLALAVMIGMIQNV
FT                   LSKGVKYSLFDATKNMAYIPLDKDLRVKGQAAVEVIGGRFGKSGGAIIQSTFFILFPAF
FT                   GFVEATPYFASIFFVIVILWIYAVKGLNKEYQVLVNKTEK"
FT   gene            141399..142298
FT                   /gene="dam"
FT                   /locus_tag="RF_0123"
FT                   /note="RF0123"
FT   CDS_pept        141399..142298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="RF_0123"
FT                   /product="Site-specific DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60974"
FT                   /db_xref="GOA:Q4UN84"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN84"
FT                   /protein_id="AAY60974.1"
FT                   /translation="MKLKVVKNEELSFNEALAMIGQAPLKINSPEIEEDGILKPFIKWA
FT                   GGKRSLIKELCLRLPASYNNYYEPFVGEGALFFALVPDKTIISDINLDLIITYKVIKDE
FT                   ARALIELLAKHNANHSQDYYYAVRKNANSDNPIEIAARFIYLNKTCYNGLYRVNSKGEF
FT                   NVPMGAYINPNILDENNIIACSKALQNAEIIYQDFGNISPKPKDFVYINPPYQPINHTS
FT                   FTKYTKLDFTEADQIKLYEKCRELHKNGVYFMLSNSDSDFIKNLYKSFSIDIVNAPRSI
FT                   NCKSDSRQRTNEVLIRNY"
FT   gene            142802..143476
FT                   /gene="def3"
FT                   /locus_tag="RF_0124"
FT                   /note="RF0124"
FT   CDS_pept        142802..143476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def3"
FT                   /locus_tag="RF_0124"
FT                   /product="Polypeptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60975"
FT                   /db_xref="GOA:Q4UN83"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN83"
FT                   /protein_id="AAY60975.1"
FT                   /translation="MSKLKIAILLTAIIFITGCKSNMKNENNISLPEYVTLNLETLNNF
FT                   EAKTIRVKAKTLNFPLSAEDLRDVSILEKKYDQEENCAGLAAPQISISKCIIIFAVHEN
FT                   EELKKWRPNLKDTMPKTIWINPSYKPIGIDKHEDYEGCFSVENATGPVARFKKIHYHAY
FT                   DINGNQIQGIAEGFLARVIQHEIDHLNGKVFLDYAAPKKIMTKEKYLEKRKKAMEQENI
FT                   KS"
FT   repeat_region   complement(143575..143675)
FT                   /note="RPE-4 Full"
FT   repeat_region   143676..143700
FT                   /note="RR-2 Full"
FT   gene            complement(143745..143921)
FT                   /locus_tag="RF_0125"
FT                   /note="RF0125"
FT   CDS_pept        complement(143745..143921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0125"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60976"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN82"
FT                   /protein_id="AAY60976.1"
FT                   /translation="MLNLGCESAINLDGGGSSTLFMGGKIINNVTGDEDEALGEHTIRP
FT                   VSDAIVIIPNNIK"
FT   gene            complement(143902..144648)
FT                   /locus_tag="RF_0126"
FT                   /note="RF0126"
FT   CDS_pept        complement(143902..144648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0126"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60977"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN81"
FT                   /protein_id="AAY60977.1"
FT                   /translation="MVDGKLFSLRKQLQSLLIIDQNNIQITKASAKISIDIGDKSIIPN
FT                   QVNYFSNPKDITFYNNVWASTTLTPYTNKEILIDQNLIIIDISNHGDNQIPQKGFVLSF
FT                   PKEVSLPIVNINDAVKLNLEFIDKDGKYINLSKTASVVTGIPVLVQNGQNIVDNIKQDD
FT                   PAHARTALGVRNDGTIVIVVAEHIYKQHIKDLKLAQVRSILQKEKGITFEKLTIPEALK
FT                   ILEKHLVNDNVIGQNRTCRLYVKPWM"
FT   gene            complement(144931..145563)
FT                   /locus_tag="RF_0127"
FT                   /note="RF0127"
FT   CDS_pept        complement(144931..145563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0127"
FT                   /product="Tellurite resistance protein-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60978"
FT                   /db_xref="GOA:Q4UN80"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN80"
FT                   /protein_id="AAY60978.1"
FT                   /translation="MSINILIVGNKYKIMKNIQYYNNNAQEFYNRTINADLSDNYKEFI
FT                   SYLPNKAHILDAGCGVGRDTKYFLSQNYQVTAFDGSSEMVKLASKETGINVLHSTFQDI
FT                   DFKELFDGVWAQATLLHVPYNETKDVYKKIHAALKPEGIFYASYGYGSDIIQRDARDFY
FT                   NMNEDTIKPYFDGLFDIVKIWTEKSKRFSPSKEALWLNFIVKKSKTI"
FT   repeat_region   145687..145785
FT                   /note="RPE-7 Full"
FT   gene            145799..146224
FT                   /locus_tag="RF_0128"
FT                   /note="RF0128"
FT   CDS_pept        145799..146224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0128"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60979"
FT                   /db_xref="GOA:Q4UN79"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN79"
FT                   /protein_id="AAY60979.1"
FT                   /translation="MQQRHLLRIRLKVYMIKKIIFGIAILLSLSCFANSTTSDGSKKDA
FT                   AKTNDGTTQKIIDDFSAYAGTIKPEVRKEIQEYRVEIVDINKKKRELYNSLSKEAQNFL
FT                   AEQQKYKQKLSISKLPTEDDSPNNTANSKDNKDTDTK"
FT   repeat_region   complement(146239..146340)
FT                   /note="RPE-4 Full"
FT   gene            complement(146328..146906)
FT                   /locus_tag="RF_0129"
FT                   /note="RF0129"
FT   CDS_pept        complement(146328..146906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0129"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60980"
FT                   /db_xref="GOA:Q4UN78"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN78"
FT                   /protein_id="AAY60980.1"
FT                   /translation="MIYVKYIILGFIMGSSLNLYAANNDIIANKEVIKVEVSNEHLKTL
FT                   NEASTLLISCVDFRLIDETDKLMKQLGLDDDFDKVSLPGASLALVNDKYTYWGKTIEDT
FT                   IGILQQLHNIKQIVFLDHRDCGAYKMLVGQEHLDTREKETAAHAEILNKARNLIKEKFP
FT                   QLKVYTFLMGVDGVVEQIYEDVTLSSVIP"
FT   gene            complement(146922..147467)
FT                   /gene="pgsA"
FT                   /locus_tag="RF_0130"
FT                   /note="RF0130"
FT   CDS_pept        complement(146922..147467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="RF_0130"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60981"
FT                   /db_xref="GOA:Q4UN77"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN77"
FT                   /protein_id="AAY60981.1"
FT                   /translation="MRIDKNLPNYLTIARIMVIPVIILAFYINNSLARKLGALLFVLAS
FT                   ITDFFDGYIARKYNLVTSFGKMFDPIADKLLIGCVIIMLLKKDNVDEIPCLLILAREFL
FT                   VSGLREFLALVKVSVPVSRLAKVKTFLQMFALSILILGSKGSGIIYLDIVGEIILWIAA
FT                   FLTIITGYSYFKACKKYF"
FT   gene            complement(147471..149153)
FT                   /gene="yidC"
FT                   /locus_tag="RF_0131"
FT                   /note="RF0131"
FT   CDS_pept        complement(147471..149153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="RF_0131"
FT                   /product="Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60982"
FT                   /db_xref="GOA:Q4UN76"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN76"
FT                   /protein_id="AAY60982.1"
FT                   /translation="MNNNIINLIAAIILSLSIIFGWQYFVVKPEQKKQQQQIAVQKAEN
FT                   LKKQQLKALVEPATDIVVQEESGVQRIKIESESLTGSISLKGLRFDDLILKKYKQDLSN
FT                   NSPEVRLFSPANTENAYFAEIGLVSNLSSVKLPNNDTIWNSDSEILSPEKPVNLFWVNE
FT                   DGVKFLVTITVDENYLFTIEQTIVNNSDKELPIQSYGLINRKYTAVEKAVNILHQGPIG
FT                   CIDENLKEYSYDDIKDKKSEKFAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQ
FT                   GTERYQVDFISPVQIIKPGENFSIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWF
FT                   YIITKPVFYAMNFFYGYVGNFGVSILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDR
FT                   IKNLYSDDKARLNQEIMALYKKEKVNPVAGCLPILVQIPLFFSIYKVLYVTIEMRQVPF
FT                   YGWIKDLSAPDPTTIFNLFGLLPFSPPSFLMIGAWPILMAITMFLQQKMSPEPADPMQA
FT                   QVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQQYYINKFN"
FT   gene            complement(149311..150477)
FT                   /locus_tag="RF_0132"
FT                   /note="RF0132"
FT   CDS_pept        complement(149311..150477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0132"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /note="Similar to small-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60983"
FT                   /db_xref="GOA:Q4UN75"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN75"
FT                   /protein_id="AAY60983.1"
FT                   /translation="MQYLMDLYHTSSTELVLLFVMLVSLIPVIFLIKRLIFIPVKNYLT
FT                   RHHYDGYERILKKYPIFRYLLHTLLALYFIGWGNVFHPTSFKAHVLLGIKDTIVILYTS
FT                   ISVTMLLLTLIDAFADLYNNRIKAVTKNAPLSLYFQILKIIVTVIAAMVTISYILNISL
FT                   STFLTSLGAAAALLTFVFKDTVLGLLASLQLTTQEIINIGDWVRIGEIEGTVEKITISV
FT                   VTIRNFDQSISTVPTYSILNSNVTNYRGISESGARRVKRVFNINMATINFCDATILKEL
FT                   KKSPYISKDVIDKITLDKEEKDLTNIKLFKLYIQEYLKNNPAVYTEGFTFLVRQLEPTI
FT                   NGLPIEIYIFVKEVNLVGYENIQDNISEHLISILPEFKLKIFQNVGVV"
FT   repeat_region   150619..150683
FT                   /note="RPE-7 Partial"
FT   gene            150719..151498
FT                   /gene="lgt"
FT                   /locus_tag="RF_0133"
FT                   /note="RF0133"
FT   CDS_pept        150719..151498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="RF_0133"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60984"
FT                   /db_xref="GOA:Q4UN74"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN74"
FT                   /protein_id="AAY60984.1"
FT                   /translation="MTFPNINPIIFSIGPLAVSWYSLSYVVGILLGWFYANKIIEKFKP
FT                   QITKKNLEDFITYAVIGIIVGGRLGFVLLYNPSRYFSNPIDILKTYEGGMSFHGGALGV
FT                   IIAAYLFCRKYKINFLSLTDIIAPVVPIGLFLGRIANFINGELYGRITNSSFGMIFPNS
FT                   DLMPRHPSQLYEAFFEGLVLFCILAYATFKHKTLKKYGLNSGIFLIFYALFRIAIEIFR
FT                   EPDIQIGFILDSLTMGQILSVPMLLLGSYLICQSNPK"
FT   gene            151477..152700
FT                   /locus_tag="RF_0134"
FT                   /note="RF0134"
FT   CDS_pept        151477..152700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0134"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60985"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN73"
FT                   /protein_id="AAY60985.1"
FT                   /translation="MSIESKIRQSIEQNGYITCDVLMQEVLQSNPTSYYKQVKSLASEG
FT                   DFVTAPEISQLFGEIIGLWCIKEWQRIGCPKSLSLVELGPGRGLLMRDLLRTAKLVPEF
FT                   YKALSIELIEINQNFIAHQKANLQDINLPISHRSFVEDIPKKPTIIIANEFFDAMPIKQ
FT                   YIKVKELWYERIFVVQPVDGRIKYDKISVNKQLQEYLLRTHIEAKDGAVLEESYTSIEI
FT                   IKFIAQHLKKLSGSCLIIDYGYDLAPGNRTRYQYNPTLQAVKNHKYCPILENLGEADLS
FT                   AHVDFYTLKTVAKNSKINVIDTISQRDFLIENGILLRKQTLQDKLNNRHLFKFAYREEF
FT                   KGDTETLATAAYTLVREDTSLGSTSKLPLEVEFEKMSEQAGIIEKQVERLISSKQMGKL
FT                   FKVLQIMN"
FT   repeat_region   152461..152607
FT                   /note="RPE-1 Full"
FT   gene            complement(152697..153113)
FT                   /locus_tag="RF_0135"
FT                   /note="RF0135"
FT   CDS_pept        complement(152697..153113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0135"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60986"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN72"
FT                   /protein_id="AAY60986.1"
FT                   /translation="MKKTIIFCWLFLSSISYAFAVDCNNAMTQGDMNYCAGEEYKKVDK
FT                   KLNQIYKEILKHISDEQEKVNLLKKSQNLWIKYRDADCEFRSSGVYGGSVYPMILLMCL
FT                   TEKTEERIKEFEAMLKCEEGDSSCPFIIKTQNLD"
FT   gene            complement(153147..153932)
FT                   /gene="sdhB"
FT                   /locus_tag="RF_0136"
FT                   /note="RF0136"
FT   CDS_pept        complement(153147..153932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="RF_0136"
FT                   /product="Succinate dehydrogenase iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60987"
FT                   /db_xref="GOA:Q4UN71"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN71"
FT                   /protein_id="AAY60987.1"
FT                   /translation="MAELRLPPNSVVKKGKEHKEQEEMLKPRKVKIYRYDPDLDENPTI
FT                   DSFEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCSMNIDGTNTLACIKPI
FT                   EEISGDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPTPSNSERLQSIKGRE
FT                   KLDGLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDHTGERLEDLEDP
FT                   SKLYRCHTIMNCTKTCPKGLNPAKAIGKIKSLIAERHGV"
FT   repeat_region   154113..154237
FT                   /note="RPE-5 Full"
FT   gene            complement(154251..154766)
FT                   /locus_tag="RF_0137"
FT                   /note="RF0137"
FT   CDS_pept        complement(154251..154766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0137"
FT                   /product="Site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60988"
FT                   /db_xref="GOA:Q4UN70"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN70"
FT                   /protein_id="AAY60988.1"
FT                   /translation="MLNASLFGVPQARERVYFVCLRKDFSSEYILKYVKPKESYERIFL
FT                   GDILEKEVDKSLYINRDDIVLDKTPVEKQLKPIRIGQVNKGGQGERIYSPFGHSITLSA
FT                   FGGGVGARTGLYYINDKIRRLSINECKYLMGFPQDHYVADGLKGYRQLGNSVIPQIIAN
FT                   IYDSIIAV"
FT   gene            complement(154861..155178)
FT                   /locus_tag="RF_0138"
FT                   /note="RF0138"
FT   CDS_pept        complement(154861..155178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0138"
FT                   /product="Site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60989"
FT                   /db_xref="GOA:Q4UN69"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN69"
FT                   /protein_id="AAY60989.1"
FT                   /translation="MYKFIDLFCGIGGFRKALEAKGLECVFSSDIDKDVQEAYKRNFGD
FT                   KPYGDITEISENKIPKHDILCAGFPCQSFSISGKRLGIDDINGRLFYEIIRISQTIYII
FT                   T"
FT   gene            complement(155204..157111)
FT                   /gene="ftsH"
FT                   /locus_tag="RF_0139"
FT                   /note="RF0139"
FT   CDS_pept        complement(155204..157111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="RF_0139"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60990"
FT                   /db_xref="GOA:Q4UN68"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN68"
FT                   /protein_id="AAY60990.1"
FT                   /translation="MNNQGRSILTWAALFVFVILLFNVFQSDGLLGGRNNITFSDFLTR
FT                   VDEKTVNSVKIQGRVIEGTSNDGSTFNTYAPDYPDLVNRLTSNDVNIEVVPLETRMNTF
FT                   LGFLISWFPMLLLIGVWVFFMRQMHGGGKAMGFGKSKARLLSDKGPKITFKDVAGIDEA
FT                   KEELTEIVDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGS
FT                   DFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQM
FT                   LVEMDGFEANEGVVIIAATNRPDVLDRALLRPGRFDRQIAVANPDINGREQILKVHLKK
FT                   IKYNSTVLARIIARGTPGFSGAELANLVNEAALIAARLGKKEVDMHDMEEAKDKVLMGV
FT                   ARRSIAMSEKEKRLTAYHEGGHALVGLYCPAASPLHKATIIPRGNALGMVQRLPETDEY
FT                   SQNREQMESSIAVYMAGRVAEEIIFGRNKVTSGASSDIKGATNIARAMVTKAGLSDLIG
FT                   PIFHGSSSDDMYGRQPSNETSEATAELIDAEVKKIITQGYEFAKDILTKHIDQLHTLAN
FT                   ALIEYETLSGQQIKNLLSGRALDSEEENKFPFNDSPTIKIDKEKSPEKAKKAKKESTNI
FT                   "
FT   repeat_region   complement(157178..157270)
FT                   /note="RPE-7 Full"
FT   gene            complement(157333..158625)
FT                   /gene="tilS"
FT                   /locus_tag="RF_0140"
FT                   /note="RF0140"
FT   CDS_pept        complement(157333..158625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="RF_0140"
FT                   /product="tRNA(Ile)-lysidine synthetase TilS"
FT                   /note="Formerly cell cycle protein MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60991"
FT                   /db_xref="GOA:Q4UN67"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN67"
FT                   /protein_id="AAY60991.1"
FT                   /translation="MLYEKFEYNINNLIGNFGLSKIAAAVSGGSDSVALLYLANIWAEK
FT                   NNIELSVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFSNLQERAREGRY
FT                   DLMTNLCLELDILVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWYNNIQIIRPLY
FT                   NIPKSELVEYLVSHNIKWFEDESNSSDKYRRNIIRQKLAKGEDYIKADIILQQLKINDL
FT                   LDNKFKPELISAIAEAVKIFEYGFAFLDLVKFDKFSNEVKVQIINFLLIIISGQFRAAR
FT                   FYSVEPILKLITQDVNFKNTLHGCVINRIQNELLIYREFGKKLPESKILLDKSVIWDNR
FT                   FRITRNQETPNCFVTHLSLEDYKMIKKQLDLEPLKNLSCKNHNAIIFTLPIIKILEKVI
FT                   AIPHISYYDNDMWNFEVSFAPNFVSRFTHFC"
FT   repeat_region   158803..158891
FT                   /note="RPE-7 Full"
FT   gene            complement(158904..159419)
FT                   /gene="rplI"
FT                   /locus_tag="RF_0141"
FT                   /note="RF0141"
FT   CDS_pept        complement(158904..159419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="RF_0141"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60992"
FT                   /db_xref="GOA:Q4UN66"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN66"
FT                   /protein_id="AAY60992.1"
FT                   /translation="MEIILIKPVRKLGKIGDMLKVADGFGRNYLLPQKLAIRATEPNKE
FT                   LIVKQKHEFEAKDKQIREEVEKINALIKDQKLVFIRQTSDDGKLFGSVTNKEIADKLSE
FT                   NVSYNIAHSNIILDKQIKFTGIYTVEIRLHAELNAIVTVIVARSESEAQDYLREQKTET
FT                   SEDLAESA"
FT   gene            complement(159431..159718)
FT                   /gene="rpsR"
FT                   /locus_tag="RF_0142"
FT                   /note="RF0142"
FT   CDS_pept        complement(159431..159718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="RF_0142"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60993"
FT                   /db_xref="GOA:Q4UN65"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN65"
FT                   /protein_id="AAY60993.1"
FT                   /translation="MLKSNNASETATRKVGDKTAKKVFFRRRKGCPLSVPNAPVIDYKN
FT                   PELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFVFQAK"
FT   gene            complement(159743..160132)
FT                   /gene="rpsF"
FT                   /locus_tag="RF_0143"
FT                   /note="RF0143"
FT   CDS_pept        complement(159743..160132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="RF_0143"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60994"
FT                   /db_xref="GOA:Q4UN64"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN64"
FT                   /protein_id="AAY60994.1"
FT                   /translation="MFVGDFYIMSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTI
FT                   VKKEYWGLRTLAYKIGNNKKGHYYFLGLDITGNVKEELERKMKLNENIIRFLTIKADSI
FT                   SSEPSQILKNQSTENTPVIDVTINN"
FT   gene            160292..160660
FT                   /locus_tag="RF_0144"
FT                   /note="RF0144"
FT   CDS_pept        160292..160660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0144"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60995"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN63"
FT                   /protein_id="AAY60995.1"
FT                   /translation="MEINSVFDKLLPEVLIIEEKNKKSVNISLSNDIERAGFDIIRAST
FT                   LEKALTYFFSQPLAIIIISAELQENPLITINNVRKINKFSKTPIIFFLPNKQLNLTEID
FT                   DNVLFFYKPFLSEQIVVL"
FT   gene            161139..162332
FT                   /gene="aco1"
FT                   /locus_tag="RF_0145"
FT                   /note="RF0145"
FT   CDS_pept        161139..162332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aco1"
FT                   /locus_tag="RF_0145"
FT                   /product="Acyl-CoA desaturase 1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60996"
FT                   /db_xref="GOA:Q4UN62"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN62"
FT                   /protein_id="AAY60996.1"
FT                   /translation="MLSKLNKPALFALIFYPIFIISLVVKYSFDYGIGLTEAIFIIASY
FT                   YINNITVGIGLHRLWSHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQD
FT                   QDPHTPLKFDNKFLGFMWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIA
FT                   AFMNIVVPLFIGYLVGGTILSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKQYYKGT
FT                   AGDIWWMTLFLLGENWHNYHHAFPSDYRNGAKWYHFDVHKWIIFLMSKIGLASELERTT
FT                   KVRIQAKMQETLSYLSEKQKQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSF
FT                   VEIQESLKNLAEQVSSATQITEKPSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKVSN"
FT   repeat_region   162382..162446
FT                   /note="RPE-7 Full"
FT   gene            162528..163697
FT                   /gene="gcp"
FT                   /locus_tag="RF_0146"
FT                   /note="RF0146"
FT   CDS_pept        162528..163697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="RF_0146"
FT                   /product="Sialoglycoprotease"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60997"
FT                   /db_xref="GOA:Q4UN61"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN61"
FT                   /protein_id="AAY60997.1"
FT                   /translation="MIKILGIESSCDDTAVSIITENREILSNIIISQNTEHAVFGGVVP
FT                   EIAARSHLSNLDKALKNVLKESNTKLTEISAIAATSGPGLIGGVIVGSMFARSLSSAFK
FT                   KPFIAINHLEGHALTARLTDNIPYPYLLLLASGGHCQFVAVLGLGKYKILGSTIDDAIG
FT                   EAFDKVAKMLNLAFPGGPEIEKRAKLGDPHKYKFPKPIINSGNCNMSFSGLKTAVRTLI
FT                   MSLKELNDAVINDIAASFQFTIGEILSSKVQDAIIAYERVVNDYYENIDYTTQLNLKSF
FT                   RQDEFKEEPAEHTKVREHRLYPQNSLGSSFLNDAIVIAGGVAANKYLQEILSNCAKTYG
FT                   YQLIYPPIRLCTDNAAMIAYAGLERYNNKLFTPLNFCPKARWSLEDISK"
FT   repeat_region   163350..163465
FT                   /note="RPE-3 Full"
FT   gene            163787..164278
FT                   /locus_tag="RF_0147"
FT                   /note="RF0147"
FT   CDS_pept        163787..164278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0147"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60998"
FT                   /db_xref="InterPro:IPR035354"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN60"
FT                   /protein_id="AAY60998.1"
FT                   /translation="MSNNNYENIYKAFNCFSEATNSAYSAVNNFLELPNVFNKYPTVIS
FT                   LIFSKTAKLDSNITNIIKNGVIIYEISTTLIGAVNSFYKDKKLVDKILKDGQNAIDKLI
FT                   ETTTYLSPIVTDITNSYLVDPYKEEKTLLFDLQIPNSTSNDCYKLSGTESITLAEIECY
FT                   "
FT   gene            complement(164347..165120)
FT                   /locus_tag="RF_0148"
FT                   /note="RF0148"
FT   CDS_pept        complement(164347..165120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0148"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAY60999"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN59"
FT                   /protein_id="AAY60999.1"
FT                   /translation="MYNDDEIDYETAEEILKEIYSLNELEELKKQDGVELEEYVDAYNE
FT                   AELDDNNSITFREFFALKDFKETGYMRLYDKTKESYEMQRALIILTNDQYQMSQGQVEN
FT                   LTIWRGETREKSEVGIFNIGNEYSTERFMFTTSEQSIINNHMSDELKPHQINIKYEIEM
FT                   NSPLVGTDISSILNDGEKEIVVLPNTKFEITNVKHEDDHTLCISMKNKPIIYDTWKSNF
FT                   DLWLSNIEQLVSTNTDISVETYTLGSDALQIDIIT"
FT   gene            complement(165277..165633)
FT                   /locus_tag="RF_0149"
FT                   /note="RF0149"
FT   CDS_pept        complement(165277..165633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0149"
FT                   /product="ClpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61000"
FT                   /db_xref="GOA:Q4UN57"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN57"
FT                   /protein_id="AAY61000.1"
FT                   /translation="MEYVKAVFKPEFLNRLDEIILFHRLNRNNIHDIVKIQLESLKKIL
FT                   LAQNILLEFDESALNYLAEKGYDPSFGARPLKRLIQREIQNNLAKMILAGEISSGNTVK
FT                   IAREKEELRIKIID"
FT   gene            complement(165727..167853)
FT                   /locus_tag="RF_0150"
FT                   /note="RF0150"
FT   CDS_pept        complement(165727..167853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0150"
FT                   /product="ClpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61001"
FT                   /db_xref="GOA:Q4UN57"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN57"
FT                   /protein_id="AAY61001.1"
FT                   /translation="MNIDKFTAHAKSVIASSQSIAAKNDHQQILPLHLLSSLLSEETGI
FT                   IQTLINNTGGNINLLKDQVQLELNKIPKVQVEGGGQVYSSAEALKVLEKASSIAKDSGD
FT                   SFVTIERIFEALTYGNTIAGKILTNNGINSKKLAAAILQFRKGKKADTESAENSYDALK
FT                   KYGRDVTELAESGKLDPIIGRDEEIRRTVQVLSRRMKNNPVLIGEPGVGKTAIIEGLAQ
FT                   RIFSKDVPESLMNCRIIELDMGALIAGAKYRGEFEERLKAVLGEIKESSGEIILFIDEL
FT                   HLLVGTGKTDGAMDASNLLKPMLARGELHCIGATTLDEYRKYIEKDAALARRFQPVYVS
FT                   EPTASDTISILRGIKEKYELHHAVRISDSAIVAAATLSNRYITDRYLPDKAIDLIDEAC
FT                   SRMKIELSSKPEELDELDRRIIQIKIELAALKKENDEHSKKKITHLTEELEKLESKSYD
FT                   MKAKWQAEKSKLQQAQKLKEELERARIDLERAERDANLAKASELKYGIIPEIMKKIQEA
FT                   ESMDNKGLLKEIVSESDIASIISRITGIPIDTMLSSERERLLVMEQKLRESVIGQDEAI
FT                   KGVSDAVRRSRAGIQDINRPLGSFLFLGPTGVGKTELTKALASFLFDDRNAILRIDMSE
FT                   YMEKHAISRLIGAPPGYIGYDQGGVLTEAVRRRPYQVILFDEVEKAHPDIFNIMLQILD
FT                   EGRLTDSQGITVDF"
FT   gene            167966..169132
FT                   /locus_tag="RF_0151"
FT                   /note="RF0151"
FT   CDS_pept        167966..169132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0151"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61002"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN56"
FT                   /protein_id="AAY61002.1"
FT                   /translation="MLSSLKKQFDNDKAFLLNHTKEFLTTSGVGVPLETNRAKIEEAVE
FT                   KGSFTEALQGLEILRHEKTGIKLTKIEGKNGETSILIRDGRNNPNEKIVLGTEAFEMQY
FT                   LNAIRGAIDIAKTENKPELALKLNKEAVKFINSFNALNMEKSQENISKNMQTEIDNVAE
FT                   LLGTNGIKNAHKKLNVAKDFQNFNDEHCNIVTLSKVTNDEGKEHIVVEAEVAFKGLTKE
FT                   QKQEYQNREGKNWYNVMPEWERKLVDQYADTIQNGRHVIPTQLRQIVGMKNAFEKIGAI
FT                   TDKDGKNFETLLISKHAGTLASISNDIDSRQKITDLNARQAQEWLEDGVTIHTNTLNSG
FT                   PIGAGNDPTIVDQTKKSMENVGGKNTNTPLNLFRLIGVTNNFSGVVIL"
FT   gene            169613..169948
FT                   /locus_tag="RF_0152"
FT                   /note="RF0152"
FT   CDS_pept        169613..169948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0152"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61003"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN55"
FT                   /protein_id="AAY61003.1"
FT                   /translation="MLSKQVVFYAGGATIGCYGTKKENKRAIPKSRKETLAGIMEVTAK
FT                   TNKIEDKKKMDKKIDAKYEKNHPKESIVIHSDKKVVKPLTKSVSQLKPSITPPVKFNKS
FT                   QNIGMEK"
FT   gene            169948..170673
FT                   /gene="phbB"
FT                   /locus_tag="RF_0153"
FT                   /note="RF0153"
FT   CDS_pept        169948..170673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="RF_0153"
FT                   /product="Acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61004"
FT                   /db_xref="GOA:Q4UN54"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4KMS"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN54"
FT                   /protein_id="AAY61004.1"
FT                   /translation="MSEIAIVTGGTRGIGKATALELKNKGLTVVANFFSNYDAAKEMEE
FT                   KYGIKTKCWNVADFEECRQAVKEIEEEFKKPVSILVNNAGITKDKMLHRMSHQDWNDVI
FT                   NVNLNSCFNMSSSVMEQMRNQDYGRIVNISSINAQAGQVGQTNYSAAKAGIIGFTKALA
FT                   RETASKNITVNCIAPGYIATEMVGAVPEDVLAKIINSIPKKRLGQPEEIARAVAFLVDE
FT                   NAGFITGETISINGGHNMI"
FT   gene            170700..172304
FT                   /locus_tag="RF_0154"
FT                   /note="RF0154"
FT   CDS_pept        170700..172304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0154"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61005"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN53"
FT                   /protein_id="AAY61005.1"
FT                   /translation="MIKQILKDIKTLCKSCNYEGAFNKLAEIKGLVGYIQYYHYGNGII
FT                   YTSQAETNNDITEKQQLYFKAEISFRKTAQYKSIPKNTYFLLGKILCKVGKFKEAKIVL
FT                   EQYTPSQKNQKEFQEILSQIPPEPNKTTNSPLLTRENDLSKSQLILINNSDYVTRQEHN
FT                   ELKSSMLELSQEVTEIKLTIADIKKMLVDANIPLTATINNQINGLKDINPRLEEYYKYF
FT                   NMALHNVFIAASAVSSGLVVPDAGHLERVGPMYWAKIFCYAADVGSAGFLHPIFNAIIA
FT                   VLHDAGDNMFNSKEEVKLVDVLTKFCKMINKQKDMTVPIGQELQRLALFFANLRSAEIT
FT                   KNNETEFSNFFTDKLPMQNKFFRYDTNNTKEMNSKPMEKVALQDAISLISYMHKNAEDI
FT                   LKSKEPFLTQILTTVEKKFHKSWDDIKKTTPGNVEYDLWQIEKQLPESEIITEKAKTGQ
FT                   LTSINIPYFLFDFSKSYFPMISLSGIRRGILIKNILKINLRQKSKAASSYSWHIKYLDT
FT                   AMKHASNILVIMINIRS"
FT   gene            172226..172612
FT                   /locus_tag="RF_0155"
FT                   /note="RF0155"
FT   CDS_pept        172226..172612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0155"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61006"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN52"
FT                   /protein_id="AAY61006.1"
FT                   /translation="MAYKIFRYGNEACLKYFGDNDKYKELIKQVLKDYPHLFFREEAIN
FT                   ICIKNETDRKKALDAIKLESSDKFFVDCFQKVFPNLNFVKVMVKLEPKPQFEHGPVFES
FT                   DAIEVLFLDIDENGAITIVGDVKQ"
FT   gene            172626..173948
FT                   /locus_tag="RF_0156"
FT                   /note="RF0156"
FT   CDS_pept        172626..173948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0156"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61007"
FT                   /db_xref="InterPro:IPR020183"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN51"
FT                   /protein_id="AAY61007.1"
FT                   /translation="MTSIYHILDNVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDNCCN
FT                   FARFTEPALNISLMVSKEELTSPHLIPETTKLFQNLYRNSASDQKIKSIFNNLKQQIQK
FT                   LQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNS
FT                   GMQSTNGKDVAIFVSCGGNPFAENNKDYPMYGNGWPAVARLQIIAAQELGHFADIKRDD
FT                   KGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNA
FT                   NKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVKKFKTDKYMALMIEAMFKDMQANLS
FT                   PNAEVYKNKNPEIEEAVACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLIT
FT                   SYNAVTGENYKRDFKKPKNGLFSRINIFRNKKLVLKPVREL"
FT   repeat_region   173975..174096
FT                   /note="RPE-5 Full"
FT   gene            174157..174444
FT                   /locus_tag="RF_0157"
FT                   /note="RF0157"
FT   CDS_pept        174157..174444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0157"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61008"
FT                   /db_xref="GOA:Q4UN50"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN50"
FT                   /protein_id="AAY61008.1"
FT                   /translation="MTSLSITLPDNIAKASNEIAKKLGLSRTAFIRQAIIHELNNLQSQ
FT                   FEQDDIIKSFNAMKKSKKYLEEMTEMTEITENLNSELLEEKEKWWSKKKY"
FT   gene            174533..175486
FT                   /locus_tag="RF_0158"
FT                   /note="RF0158"
FT   CDS_pept        174533..175486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0158"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61009"
FT                   /db_xref="GOA:Q4UMN7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMN7"
FT                   /protein_id="AAY61009.1"
FT                   /translation="MCKFLKGCIEENITKREITMTQKQNAAMEQAIDLLINNDTDVSIL
FT                   FREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSDAQNSRNGYNTKNLITKNGAVEIE
FT                   VPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLIS
FT                   QITDDIIEDVKLWQSRPLDPVYAIVFFDCLIVKVRQDKRIINKSVYVALGIDLEGRKDI
FT                   LGLWISENEGAKFWLGNFTEMKNRGIQDILIACSDNLNGMSEAIGAVFPKTEHQLCIVH
FT                   QIRNSLRYVSYKDRKELAGDLKPIYTLAQKKKHFPL"
FT   gene            175561..175803
FT                   /locus_tag="RF_0159"
FT                   /note="RF0159"
FT   CDS_pept        175561..175803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0159"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61010"
FT                   /db_xref="GOA:Q4UN48"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN48"
FT                   /protein_id="AAY61010.1"
FT                   /translation="MIFLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNAVFK
FT                   SLYLAIDYMTKKWSMPIPNWNAAMAHFLIKFDERI"
FT   repeat_region   175813..175945
FT                   /note="RPE-8 Full"
FT   gene            176012..176338
FT                   /locus_tag="RF_0160"
FT                   /note="RF0160"
FT   CDS_pept        176012..176338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0160"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61011"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN47"
FT                   /protein_id="AAY61011.1"
FT                   /translation="MPLSRIFSFRSKNKETNTPKNLKIAHPKPINESEYANSLAGEVVT
FT                   IKLNEQSHNFIKSEKVVLTSFKPPSSQSKDEFDPILKDVENILKDFEVFLDNIDTKALG
FT                   EIDS"
FT   repeat_region   complement(176407..176483)
FT                   /note="RPE-7 Full"
FT   gene            complement(176566..178065)
FT                   /gene="tlc5"
FT                   /locus_tag="RF_0161"
FT                   /note="RF0161"
FT   CDS_pept        complement(176566..178065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlc5"
FT                   /locus_tag="RF_0161"
FT                   /product="ADP,ATP carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61012"
FT                   /db_xref="GOA:Q4UN46"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN46"
FT                   /protein_id="AAY61012.1"
FT                   /translation="MLSTSSRSFKSKFRAAFWPVHNYELGKFIPMSALMFCILFNQNIL
FT                   RILKDSILISEISAEIAGFAKVYCVTPAAALFVIIYAKMINRFTFEKIFYYLSAFFISF
FT                   FVLFAFVIYPNIHVFHVHPDNLADWMERYPHFKWYISLVGNWGYIVYYSLAELWPNIFY
FT                   VLLFWQFANELTTTEEAKRFYTFFSLFGNSSLILVGFLMMNLSSEDTIIKKFMSISDSK
FT                   ITLVQVSTTIVAIVAIVCCVLVRFISKNVFTNPLFYAKAKSGRSTSERMGLIKSFKYIA
FT                   KSKYLWLLLICSAAFGFAINLVEAVWKAKIKELYPTVNTYAEFNSLYILWTGVAIMVMT
FT                   IIGNNVMRMHNWFVAAVISPVIIMVTGILFFVLIVFDQQILSLFDGAILMSPLALAVSI
FT                   GGIQNILAKGTKYSIWDTSREMLYIPLDDELKTKGKAAVDVISAKVGKSSSGLVQSIIF
FT                   TLVPTATFTSISPILMVVFTFVCLAWIYAVRKIYFEYQKIA"
FT   gene            178289..179338
FT                   /gene="phbC"
FT                   /locus_tag="RF_0162"
FT                   /note="RF0162"
FT   CDS_pept        178289..179338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbC"
FT                   /locus_tag="RF_0162"
FT                   /product="Poly-beta-hydroxybutyrate polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61013"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022439"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN45"
FT                   /protein_id="AAY61013.1"
FT                   /translation="MLDSNKLQEYFDLYNNYAKIHNLGNKYLESGKIVMQTEHYRVLYY
FT                   SVSSRGLSTGSSNKKYKKLDLSRFMLDPVDKPRDDNTFLITPSIFNSPEIFFLARDKNF
FT                   IENLRSYGEVYLIDWLEIGEPKYLLDDYVHKIIEVIDSLKIKDINLMGHCIGGNIAIAA
FT                   KILMPKFIKTLTLLTCPWDFSHFFYIRMLHRYLKLDSGIENLPIIPKIHIQILFFLLFP
FT                   DYFNAKLKKFFSITAGKEQELAFRIENWLMSGNNISKGVYNQIMQNILDENMFINLKWK
FT                   IDNFIIDPSLIDCPVYIVGAEDDQIVPKSSILPLQKLLKNSKLIEVKGGHISYLINDKL
FT                   DKLFKEYTL"
FT   repeat_region   complement(178427..178529)
FT                   /note="RPE-4 Full"
FT   gene            179335..180513
FT                   /gene="paaJ"
FT                   /locus_tag="RF_0163"
FT                   /note="RF0163"
FT   CDS_pept        179335..180513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaJ"
FT                   /locus_tag="RF_0163"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61014"
FT                   /db_xref="GOA:Q4UN44"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN44"
FT                   /protein_id="AAY61014.1"
FT                   /translation="MTKPVYITHAKRTAFGSFMGSLSTTAAPMLAAHLIKDILQNSKID
FT                   PALVNEIILGQVITGGSGQNPARQTLIHAGIPKEVPGYTINKVCGSGLKSVALAANSIM
FT                   IGDNEIVIAGGQENMSLGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAEN
FT                   ISKQFNISRQEQDEFALSSHKKAAKAQLAGIFKDEILPIEVTIKKTTSLFEHDETVRPD
FT                   TSLEILSKLRPAFDKNGVVTAGNASSINDGAACLMVVSEEALKKHNLMPLARIVSYASA
FT                   GVDPSIMGTAPVPASQKALSKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMDKVNIN
FT                   GGAIAIGHPIGASGGRVLITLIHSLRRAKAKKGLVTLCIGGGMGMAMCVESV"
FT   gene            complement(180581..181243)
FT                   /locus_tag="RF_0164"
FT                   /note="RF0164"
FT   CDS_pept        complement(180581..181243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0164"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61015"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN43"
FT                   /protein_id="AAY61015.1"
FT                   /translation="MQNNKVIIEYIVSSIWSSWNPINWSPSMQIATLSYILSCLIDGND
FT                   AYPIEDAQIINNDQEWLKINQTYTFYNTQFPSSRYVELAKEIPICLKRLKIFHKFDDEN
FT                   YVPNEALASHKLINNFSNLLKHFKLTPLIDPTGFNPNYFMVWSWAKNLGNIPKYFGQKL
FT                   KRVCNNIEEAENYWESYEPETFSNSSAFHEFISTITHCNDALLGCSDIKSDIYYNKL"
FT   gene            181625..184711
FT                   /locus_tag="RF_0165"
FT                   /note="RF0165"
FT   CDS_pept        181625..184711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0165"
FT                   /product="Superfamily I DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61016"
FT                   /db_xref="GOA:Q4UN42"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN42"
FT                   /protein_id="AAY61016.1"
FT                   /translation="MKDAPFEKLDKKELGKELEINLNEYEVVVHWHVYLGYLKWSAAEI
FT                   DLLKKTQNINELDQEFLNDYNNKNYQEQPTITPIAGLTIDENGKYVEHSMIISTAAYAL
FT                   GKIMKEDFQGKELKDLANFVDNNNILIDEVFAESEKIYFMDKPQDSALGRILDLEMINI
FT                   MIDLLVQKLEIDRKYLFSRSEICVRRVTSQKKKKDKSVIFTPPSLEMFNSFFLIPLDLV
FT                   RNNIEKFEPESAIAKYLGKEDKPDSIDVLERQEALQKLLAPLEMQPARWCSSPKNSLAA
FT                   LQAAAVNEVLSPTSEKLFAVNGPPGTGKTTILFDIMANIYVGRALNLISLEEPKNGFQK
FT                   GKISHSTPDFDYHISSLKPELQNYGMVVASSNNNAVENISNEISLYSKIDELYHEDLSY
FT                   FKQLVCVEDKEKNWGMFATPLGNLKNKKKFINSFWKFKDDEKGNDEDYTMLQYLNLLIG
FT                   NKCKDRAPGHYKPKYCNSSEELNKAWSEACTNFKKIHSKINKIYNNISSVIELNKERRN
FT                   ILEKNNIVNKHNIKDYEEEKAHLESILIHARNEIMINTTKINDYNLNYFKVFYKLFKTE
FT                   KYLAYSNLLQQQEEKVNYEKAIITKINNFKRLIDISKLLSEPYKFLEDENFNIKDFEEN
FT                   LFWKNWQENSEDLNKITPYFNPKFEILRSALFVSAVKLHEIFINANADSFWHSLKYFFD
FT                   ITINSLGKPEMNKIAWQNFFMIIPVVSTTFHSFDRMFATAKHNEVPWLFIDEAGQIPPQ
FT                   FAASAIYKSKKVVVVGDPLQTEPISILKQDLIKKLCENFKVSYRDWSPSEVSLQNLADR
FT                   TSLYQTKIDDVTVGFPLLVHRRCQNPMFKICNKIAYGNKMIFATSKCKSNIRAILGASK
FT                   WIDVEENNVQRYKYESETEFQKLLELLKQVLKEKNGDDLLKQIYIITMYKGYSEFIRKK
FT                   LKGIFDNSRFDKAIKEFGYKNIGTIHAFQGKEADTVIMVLGAQHPLDKGARNVMTDKPN
FT                   VLNVGISRAKNNLYVIGNLEIWLKHKYMPEIYNMLGDKE"
FT   gene            complement(184769..185701)
FT                   /locus_tag="RF_0166"
FT                   /note="RF0166"
FT   CDS_pept        complement(184769..185701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0166"
FT                   /product="Sugar kinases"
FT                   /note="Ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61017"
FT                   /db_xref="GOA:Q4UN41"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN41"
FT                   /protein_id="AAY61017.1"
FT                   /translation="MQYLKSVKVPKGESVVISKDIAAKISRDLKPISKQLGGSVNNTAA
FT                   GLANLGTRVSFLGSVAYDNLGKQYIEAIEKYRIYSLIRKVNSSKETGVVNIIISPDGER
FT                   TMLAYPGISRDLPPLDYKIIKDYKIILLEGYLWHEDGDDDALKEFLHIAKNNEVITAFT
FT                   FGSYKQVKKYRKKWSELIKEIDIIFSDREQIYALFKNTNWDEVVNNLQKYDTIFVVTDN
FT                   KNGAHIIYRDQKIYIPAYNIKYITDTTGAGDQFAAGFLYGFLNNYDLEKCRQFGTKTAA
FT                   KIIQQIGAKPLKITKLNSVKFLFKQYTLK"
FT   repeat_region   186129..186227
FT                   /note="RPE-4 Full"
FT   gene            186920..187402
FT                   /locus_tag="RF_0167"
FT                   /note="RF0167"
FT   CDS_pept        186920..187402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0167"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61018"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN40"
FT                   /protein_id="AAY61018.1"
FT                   /translation="MKEQKLFINDMNYMNQHYTIKIFGFVPNSSFQKKIELFCIFNNES
FT                   FGLSYVPITETLQFRLTRNFFVKLDLETINARENINILNALSCDAQNQWYAAKDGEEVS
FT                   VHYANLQEIKGLRDLVENDKVKLSSHDKTETLELIAQYEQTYPDLIKLMGEEDDII"
FT   gene            187685..187969
FT                   /locus_tag="RF_0168"
FT                   /note="RF0168"
FT   CDS_pept        187685..187969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0168"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61019"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN39"
FT                   /protein_id="AAY61019.1"
FT                   /translation="MHSSFEWDEEKNNINIEKHNVSFYEAQKAFLDIKRIILEDIDHSI
FT                   TEKRYFCLGQVDGNILTVRFMFRGNHIRIFGAGYWRKGKRIYEQENKIH"
FT   gene            187908..188189
FT                   /locus_tag="RF_0169"
FT                   /note="RF0169"
FT   CDS_pept        187908..188189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0169"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61020"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN38"
FT                   /protein_id="AAY61020.1"
FT                   /translation="MEQDTGVKVREFMSKRIKYTDGEIGEVKIVKDFLPHPRELLLKDD
FT                   SVKVTISLSKESVEFFKSEAATAHVPYQKMIRMLLDKYTKHYKENKRA"
FT   gene            complement(188193..188284)
FT                   /locus_tag="RF_RNA05"
FT                   /note="RFRNA05"
FT   tRNA            complement(188193..188284)
FT                   /locus_tag="RF_RNA05"
FT                   /product="tRNA-Ser"
FT   gene            complement(188363..189682)
FT                   /locus_tag="RF_0170"
FT                   /note="RF0170"
FT   CDS_pept        complement(188363..189682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0170"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61021"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN37"
FT                   /protein_id="AAY61021.1"
FT                   /translation="MKISFSFFKQLLELLTSDWRSYLNKVITELEKLALTDTNDTFLKE
FT                   ECYRKIALIKGYIKEGEYPWYVVPFDKKDNASLLLTNIHMLELDYLNQNTVKAVKNMLR
FT                   NNFKDIYNPEIYIIANYEEPIIKNYTITDKIAKGKIITFEDLNIKYEAHTNEELTYIDD
FT                   IVNDIRKLDTDLVAELSKIIKFIHQFYFVDSVITQCTIIFMAAYFEELQNFHQNLDNLN
FT                   FIVPSQKYQTEYQPKNYKNFINIEAITWNRFLVKYQKLFDNLGEEHSEILFSICSDNED
FT                   FVELLISDSMNLSLNKRIEIIKYLINEYKNDIESIYPIALQLFNICDDKDGLVKFLTAS
FT                   SYNLSLQKRVEIIEYLIGKYKNDTKSIYYITEQLFNICNDNTNIKTIETEIERFYKYVE
FT                   YYRSWDGLPSYWHMDFKGLPGFDTKSLIIGNSALSENDYE"
FT   gene            complement(189855..190796)
FT                   /gene="fabD"
FT                   /locus_tag="RF_0171"
FT                   /note="RF0171"
FT   CDS_pept        complement(189855..190796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="RF_0171"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61022"
FT                   /db_xref="GOA:Q4UN36"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN36"
FT                   /protein_id="AAY61022.1"
FT                   /translation="MKTAFIFPGQGSQLIGMGKDFYDNFKPAKEAFQIVDEALNRKLTD
FT                   IIFNGTSKELTLTTNAQPALMAVSMAIINIIKAETGKSLDSLCDYAAGHSLGEYSALCS
FT                   TESISLETTAKLLHIRSTSMQEACPEGEGSMAACINIPLQKLEEILEDINKINLCQIAN
FT                   DNIEGQIVISGKTAAIDHAISIIKDLGYKAIKLKVSAPFHCSLMKPAEEKMRVALDKAV
FT                   INKPLIPVIQNYTAKPTLDPTEIKQNLILQICGRVRWRETLELFNTLDITHIVEIGAGS
FT                   VLTNMLRKINYPYKLSNISNLEELQNFLDTLS"
FT   gene            191256..191573
FT                   /locus_tag="RF_0172"
FT                   /note="RF0172"
FT   CDS_pept        191256..191573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0172"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61023"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN35"
FT                   /protein_id="AAY61023.1"
FT                   /translation="MVFTLITNIQLEKFAEFISNLPKKRSEFKDYFHSEEQKDGFFKED
FT                   AYKKVVNKGKLVEKFQNSHKYNYEEIEQNVHELQAYLGSYEYKCDIPKSDLLGHDYYYN
FT                   A"
FT   gene            191748..192215
FT                   /locus_tag="RF_0173"
FT                   /note="RF0173"
FT   CDS_pept        191748..192215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0173"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61024"
FT                   /db_xref="GOA:Q4UN34"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN34"
FT                   /protein_id="AAY61024.1"
FT                   /translation="MKFIMFDQLNILYPLLISIFIFLVVVVFSKITMYKKTLKEKNLSI
FT                   IQFYLDKKFLHNHLNKNLKSPRTENYANSFLENIKSYFKLDDIKVISQKELESDQELSS
FT                   LFKEKLEEVAASFLDETKKDITTLYEVLHANKESQDQEEHRLYIYIYRLNK"
FT   repeat_region   complement(192910..193053)
FT                   /note="RPE-1 Full"
FT   repeat_region   193069..193168
FT                   /note="RPE-4 Full"
FT   gene            complement(193206..195653)
FT                   /locus_tag="RF_0174"
FT                   /note="RF0174"
FT   CDS_pept        complement(193206..195653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0174"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61025"
FT                   /db_xref="GOA:Q4UN33"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN33"
FT                   /protein_id="AAY61025.1"
FT                   /translation="MSNLQQQASDPNYSVWVSASAGTGKTKILTDRFLRLLITGVEPAN
FT                   ILCLTFTNAASIEMQARINSRLKHLSLCDTKKLEEELFLMSGNKPLPQEIENAKTLYDK
FT                   ILNSNEPLNIYTIHAFCQKILKTFPLEAGITPEFKILEETKLQDIFLNIRNEIYLSDEH
FT                   NDLIKILLNRFHEITLQDIFTEIIEQKIKFKKLFTHKTIPKEISNKRLALGELNNIYDK
FT                   VKNLFAEYDLEIEPKEIFFTKDGKKRKSFLSKELIRKYLKLLLELEKITSEIYRLDELR
FT                   RIEELEYHTNLLTKLAHIILKKYDFYKEENNLLDYDDLIYYTEKLLNNKTTHEWLLHKL
FT                   ESEINHILVDEAQDTSPQQWNIITTLITEFNAANKPNNSTFIVGDDKQSIFSFQGADLH
FT                   NFSLVNEQLKTNLTNANKKFKNITLEYSYRSCAEILQFTHNVLKNIKSNYPSLFLSDNP
FT                   LISSFRTHQGFITVWPLVTSEKQEELFWALPEDYENSKSAADLLIEKIVNFIQEQIESK
FT                   EILPSTASRISEKDFMILVRKRDEFSNNLIKELSKAKLKVEISDRINLKENLTIMDLIS
FT                   VAKFVLLSDDDLNLAGLLKSPIIGMNEKQLYELLVNKTDNSLWDNLSACEEIYAKLNSL
FT                   IVIYKISTVENFFDLVVNNLNLREIYDDDMINELLTLSKNYTNDIDNSLQGFIAWFENN
FT                   DIYIKRDMEHSDKIRVMTVHGSKGLEAPIVILCDSTTLPVSSNKFIWDDKGEMFFSANI
FT                   VDTPEFLQELKEAEKLKDLQEYIRLLYVAMTRAKDRLIICGFSNKAAAPENCWYEIVKQ
FT                   TFN"
FT   repeat_region   195714..195780
FT                   /note="RPE-7 Full"
FT   gene            complement(195793..196473)
FT                   /gene="surf1"
FT                   /locus_tag="RF_0175"
FT                   /note="RF0175"
FT   CDS_pept        complement(195793..196473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surf1"
FT                   /locus_tag="RF_0175"
FT                   /product="Surfeit locus protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61026"
FT                   /db_xref="GOA:Q4UN32"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN32"
FT                   /protein_id="AAY61026.1"
FT                   /translation="MKTNLVVLITFTILISLGFWQLSRLKEKKLFLASMQANLTSPAIN
FT                   LAEIQDSLPYHKVKITGQFLPNKDIYLYGRRSMSSGKDGYYLVTPFKTIEDKVILVARG
FT                   WFSNRNKIIITQATNDRQHEIIGVTMPSEKTRSYLPANDIKNNVWLTLDLKEASQTLEL
FT                   NLEDFYIIAEGKDISNLDILLPLSINHLAAIRNDHLEYALTWFGLAISLIVIYVIYRRN
FT                   VISV"
FT   repeat_region   196527..196599
FT                   /note="RPE-7 Full"
FT   gene            complement(196606..197295)
FT                   /gene="dnaQ"
FT                   /locus_tag="RF_0176"
FT                   /note="RF0176"
FT   CDS_pept        complement(196606..197295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="RF_0176"
FT                   /product="DNA polymerase III epsilon chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61027"
FT                   /db_xref="GOA:Q4UN31"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN31"
FT                   /protein_id="AAY61027.1"
FT                   /translation="MSSLREIILDTETTGLDPRQGHRIVEIGAIEMVNKVLTGRNFHFY
FT                   INPERDMPFDAYRIHGISGEFLKDKPLFHTIADDFLEFISDSKLIIHNAPFDIKFLNHE
FT                   LSLLKRAEIKLLELSNAIDTLVMARSMFPGSKYNLDALCKRFKVDNSGRQLHGALKDAA
FT                   LLAEVYVELTGGRQSAFKMVDKSVETNNLATNQVNNKTEQATIVIKPTKEELQKHKEFL
FT                   SSILKTA"
FT   repeat_region   197386..197481
FT                   /note="RPE-7 Full"
FT   repeat_region   197497..197523
FT                   /note="RR-1 Full"
FT   gene            complement(197541..198116)
FT                   /gene="coaE"
FT                   /locus_tag="RF_0177"
FT                   /note="RF0177"
FT   CDS_pept        complement(197541..198116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="RF_0177"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61028"
FT                   /db_xref="GOA:Q4UN30"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN30"
FT                   /protein_id="AAY61028.1"
FT                   /translation="MLAIGITGSYASGKTFILDYLAEKGYKTFCADRCIKELYQDLSVQ
FT                   TQILKLLPELESFNIGKISNLIYNNDLAREKLQNFIYPLLIDKLILFKKENANSKFGFA
FT                   EIPLLYEAKFDKYFDFVVTIYCSEEIRMQRAITRTSFDIEIYNKIKEIQLSQESKIAKA
FT                   DFAINSGVDMLDLEKQIEKLILVIARKL"
FT   gene            complement(198110..198922)
FT                   /locus_tag="RF_0178"
FT                   /note="RF0178"
FT   CDS_pept        complement(198110..198922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0178"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61029"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN29"
FT                   /protein_id="AAY61029.1"
FT                   /translation="MLPNLGIIAGRGSLPYLIASNYTKQGGKCYIAAIKDEADIEQIKD
FT                   FEYKILKIGMIGEAIKYFKDNEVQNIIFIGGVNRPNFKNLSVDKIGGLLLFKIVGQKIR
FT                   GDDNLLKIVAAFFESYGFKVISSNEIYKNQQDNSNIITDITLTNSDKNDIELGVKLLNH
FT                   LSSFDIAQSVIVENGYILGIEAAEGTDNLIARCADLRKKPYGGVLVKIPKLGQDNRLDM
FT                   PTIGPDTIKNLAKYNYKGVAIQKNNVIIVEEELTIKLANEHKIFITKC"
FT   gene            199037..199594
FT                   /locus_tag="RF_RNA06"
FT                   /note="RFRNA06"
FT   misc_RNA        199037..199594
FT                   /locus_tag="RF_RNA06"
FT                   /product="tmRNA precursor"
FT                   /note="Two pieces of RNA molecules"
FT   repeat_region   complement(199114..199246)
FT                   /note="RPE-1 Full"
FT   repeat_region   199274..199398
FT                   /note="RPE-5 Full"
FT   gene            199563..200099
FT                   /locus_tag="RF_0179"
FT                   /note="RF0179"
FT   CDS_pept        199563..200099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0179"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61030"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN28"
FT                   /protein_id="AAY61030.1"
FT                   /translation="MPGNRKTPHNSYTYFYFFRMNIEYKKFVNEYMLEFVKKILTKIQL
FT                   ENLYWDQLIYISYRTDNPAVILPSKVKQAYPKQITIVLQYQFENLIVNDTGFSLTVSFD
FT                   GVKEIIYVPFDALISFVDSNNNYSLTFNQSLNIQENHQHEEEISSNKSYKTSLSPNPNV
FT                   IMLDKFRNSSKPKPS"
FT   gene            200109..200567
FT                   /gene="rnhA"
FT                   /locus_tag="RF_0180"
FT                   /note="RF0180"
FT   CDS_pept        200109..200567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="RF_0180"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61031"
FT                   /db_xref="GOA:Q4UN27"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN27"
FT                   /protein_id="AAY61031.1"
FT                   /translation="MDSKVVIYTDGACAGNPGPGGWGALLQFNDTSKEIFGYELDTTNN
FT                   RMEITAALEALRILKKSCNVEIYTDSKYLQQGITAWIHNWIKNNWCKSNNEPVKNADLW
FT                   QKLYAELSKHTIIWKWVKGHANNSGNIAADKLAVQGRETAIEILKCRG"
FT   gene            200555..200854
FT                   /locus_tag="RF_0181"
FT                   /note="RF0181"
FT   CDS_pept        200555..200854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0181"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61032"
FT                   /db_xref="GOA:Q4UN26"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN26"
FT                   /protein_id="AAY61032.1"
FT                   /translation="MSWIDKFFITFFHKKVGEDEFLNQYYESRNIDYLGRPRRFVIYKN
FT                   VNEPTKIPPSWHAWLHHLVNEIPKNIQLFPWQKNNKIVKKPPKTSNLKYSRWQP"
FT   gene            200880..201329
FT                   /locus_tag="RF_0182"
FT                   /note="RF0182"
FT   CDS_pept        200880..201329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0182"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61033"
FT                   /db_xref="GOA:Q4UN25"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN25"
FT                   /protein_id="AAY61033.1"
FT                   /translation="MKQNIIETIIGFVVLIIALLFLIFAYKTGSSIASSKGYQVTANFQ
FT                   SAEGIAVGSDVMISGIKIGSVKKITLDPNSFYASVYLNINDDVKIPKDSKAQVVTSGLL
FT                   GGKYISIVPGNDDENLAANEEIRYTQSAINIESLINKIVSSFGSK"
FT   gene            201491..201775
FT                   /locus_tag="RF_0183"
FT                   /note="RF0183"
FT   CDS_pept        201491..201775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0183"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61034"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN24"
FT                   /protein_id="AAY61034.1"
FT                   /translation="MKESNSNSAKEDIEGIKKDIESLVSRLRNLKGKSGDILDEQLGNL
FT                   SSVMEHYKDKGIDKGKANVVDLCESTRDHPLRNLAYAFGAGVLLAILMK"
FT   gene            201784..202236
FT                   /locus_tag="RF_0184"
FT                   /note="RF0184"
FT   CDS_pept        201784..202236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0184"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61035"
FT                   /db_xref="GOA:Q4UN23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN23"
FT                   /protein_id="AAY61035.1"
FT                   /translation="MLKSLIYELLKSSIKQEEKSYGKPFVYFFNILGLVLIIIANYCYC
FT                   SDSMEFYFLMQSGIISIISSIVIEAVRCYLKYKNRYRTLDSLRSKSRELVGSISTPFTD
FT                   LVSTKTLIRYLPTIIRYVPSTVLTFLVCTYIKRKFLKNVTYPLLGK"
FT   repeat_region   202337..202453
FT                   /note="RPE-6 Full"
FT   gene            complement(202588..203118)
FT                   /locus_tag="RF_0185"
FT                   /note="RF0185"
FT   CDS_pept        complement(202588..203118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0185"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61036"
FT                   /db_xref="GOA:Q4UN22"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN22"
FT                   /protein_id="AAY61036.1"
FT                   /translation="MLFQSLNLYSILVAGLTATIIVFMRQLSYYKQQIINKDLKMVPAY
FT                   FDKKMLYKILNNNCDRYSALEMIKSYFKLKTARSLSYEELQNHQQLSELFGDSLNYFID
FT                   DFISKSDKSVVANKAFSIQDEYNNTHKLYVFLEKNKISDKTHQMLIYVKVPYIMTKDDE
FT                   ESLNTFIHLAKIM"
FT   repeat_region   203257..203334
FT                   /note="RPE-8 Partial"
FT   gene            203457..204767
FT                   /gene="proP10"
FT                   /locus_tag="RF_0186"
FT                   /note="RF0186"
FT   CDS_pept        203457..204767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP10"
FT                   /locus_tag="RF_0186"
FT                   /product="Proline/betaine transporter"
FT                   /note="MFS type sugar transporter PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61037"
FT                   /db_xref="GOA:Q4UN21"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN21"
FT                   /protein_id="AAY61037.1"
FT                   /translation="MLGYEKEQRSLTREQKEATGILSTATFLEYFDLMLYVHLAVLLNE
FT                   LFFPKYDSSAASLLSAFTFCSTFIFRPLGAYVFGRIGDKLGRKSTVIMTTTLMALSCII
FT                   MANAPTYEQVGYFAAVLITICRAIQGMASVGEIVGAELYLTEITKPPIQYPVVSFIAVA
FT                   SVIGTTAALAIASLVTTQGFNWRLAFWIGAIIAVVGGYARTHLRETPDFVDASARLLRK
FT                   YEKANIDKKELKNDEIFNQKPNKKTTIYFFIMSCAWPICFYYTYITCGKVLKNSFGYSA
FT                   AQVIHHNFIISMFHLASMSLICFLSYKIYLLKILRVKLALLFIFILFSPYLLKSTTTPF
FT                   QLLLIQIGLIICSFDTVPAVSIFFRHFPVFKRFTYSSMIYAVSRALMYIITSFGIIYLT
FT                   KYLSQYGLFVVMVPLLIICMFGLNHFQKLEKEAGYSW"
FT   gene            complement(204700..205218)
FT                   /locus_tag="RF_0187"
FT                   /note="RF0187"
FT   CDS_pept        complement(204700..205218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0187"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetase-like protein SpoT4"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61038"
FT                   /db_xref="GOA:Q4UN20"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN20"
FT                   /protein_id="AAY61038.1"
FT                   /translation="MLAEFVADEAPKLFTSNMINTALLHDTIEDTELTAEMITEIFEIE
FT                   VARHVEGLTRIKPYGKISAEESLNLLIKQKRYDTVLIKLFDRIHNVQTLAAKSPEKAKK
FT                   IILETFKKFLVVAIHLECYEIEEKFNEICYRFLYKDKFSQQKQISLFTMNNLLLFPTFE
FT                   NDLDQTYKL"
FT   gene            complement(205261..205431)
FT                   /locus_tag="RF_0188"
FT                   /note="RF0188"
FT   CDS_pept        complement(205261..205431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0188"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetase-like protein SpoT4"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61039"
FT                   /db_xref="GOA:Q4UN19"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN19"
FT                   /protein_id="AAY61039.1"
FT                   /translation="MEDISSWKEKFKICVYAKKLIDKLEYLNTKVKNPVDIEEIKKGIY
FT                   YVRKYHGLQMR"
FT   gene            complement(205556..205795)
FT                   /locus_tag="RF_0189"
FT                   /note="RF0189"
FT   CDS_pept        complement(205556..205795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0189"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61040"
FT                   /db_xref="GOA:Q4UN18"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN18"
FT                   /protein_id="AAY61040.1"
FT                   /translation="MENKEEETLTSELIIDEEEEKRLKAQNARKELKLILITFAIILTS
FT                   FLTFCYFFFNYIEEKAAEYKLQQEQEAKVNNKIE"
FT   gene            206476..206877
FT                   /locus_tag="RF_0190"
FT                   /note="RF0190"
FT   CDS_pept        206476..206877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0190"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61041"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN17"
FT                   /protein_id="AAY61041.1"
FT                   /translation="MTSTKKIIIFLTPLSNSKDRKRRKELLNSYCRQNNFTILKILEQS
FT                   SFDHAILRELVAQILHEPKGTITAFIEDKLLNTPNSIVLFSVIGTLYLLGLIKTEIYNK
FT                   SYTELKLCGSILDDFLSIATFNLNFYIPG"
FT   gene            206923..208008
FT                   /gene="tgt"
FT                   /locus_tag="RF_0191"
FT                   /note="RF0191"
FT   CDS_pept        206923..208008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="RF_0191"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61042"
FT                   /db_xref="GOA:Q4UN16"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN16"
FT                   /protein_id="AAY61042.1"
FT                   /translation="MSKFSFNIHHQHKKARNGVITTAHGEIRTPAFMPVGTRGTVKAML
FT                   PESVAETGADILLGNTYHLMLQPTAERIARLGGLHKFMNWDKPILTDSGGFQVMSLSKL
FT                   RKITEEGVSFSSHINGDKYMLTPERSTEIQHLLGSTITMAFDECTPYPATFEEAKTSMQ
FT                   LTTRWANRSRNAFVKRDGYAQFGIIQGSVYEELREQSARDLVELDFEGYAIGGLAVGEG
FT                   QELMFKVLDYAPDFLPQNKPCYLMGVGKPADIIGAVRRGIDMFDCVIPTRSGRNGQAFT
FT                   KYGTVNIRNSKYADDNEPLEHDCLCPACKNYSKAYLHLLVRIGEILGAMLMTWHNLTYF
FT                   QNLMSRIRKYIKLGKDFDFDS"
FT   repeat_region   complement(208049..208167)
FT                   /note="RPE-6 Full"
FT   gene            208171..210291
FT                   /gene="ligA"
FT                   /locus_tag="RF_0192"
FT                   /note="RF0192"
FT   CDS_pept        208171..210291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="RF_0192"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61043"
FT                   /db_xref="GOA:Q4UN15"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN15"
FT                   /protein_id="AAY61043.1"
FT                   /translation="MLFLINTTKSLKKHDFLMQNIDLISEEEAKKLLEELADKIAAYNH
FT                   AYYIEDNPLVSDSEYDQLFNTNLKLEQKFPHLVLENSPSKKIGAKITNKFAKITHQIPM
FT                   LSLSNAFDEQDVRDFVDRIKNFLRLDEFAPIFCEPKIDGLSFSAIYKNGLLTTGATRGD
FT                   GYVGEDITANIKTIKNFPHKIDNAPEFLEVRGEIYIEKQDFLNLNKEQEEQGRDKFANP
FT                   RNAAAGSLRQLDASITAQRSLKYFVYSGGVTEQNLASSQEQLLIKLKEFGFSVNEISKL
FT                   TNSEEEIFTFYEYLKTNRENLPYEIDGVVYKLNDFALQNRMGFIARSPRFATAHKFPAI
FT                   IGRTKLLSITVQVGRTGTLTPVAELEPIEIGGVTVSRATLHNFQEIMRKDVRIDDYVFL
FT                   QRAGDVIPKITGVDIGKRPNDTIAFDTPLFCPSCNSKLHYAPEDIIIRCDNGLNCPAQN
FT                   YERIRHFVSKNAMDIEGLGRKQVEFLIDKGLISNPLDIFFLKEKNDSSLTKLENMDGWG
FT                   KKSVENLFKNIEQSKNVSLPRFIYALGIRHIGEQNAKLLAREFGSYANFIAQMELLSKN
FT                   DLDIYQKLNDLEGIGDKILVDIIDFFDVKENTTLIKKLGEVLNIEDYKETREQSSLTGK
FT                   IIVFTGSLPTISRAEAKATAEKLGAKVAASVSSNTDLVVAGVDAGSKLKKAKELNIKII
FT                   GEEEWLTLIKNV"
FT   gene            210363..210773
FT                   /locus_tag="RF_0193"
FT                   /note="RF0193"
FT   CDS_pept        210363..210773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0193"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61044"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN14"
FT                   /protein_id="AAY61044.1"
FT                   /translation="MNKEMESQIVIYQDENGEVNVDVQLYDDTVWLTQNQLAKLFDRDR
FT                   TVITKHINKILKEGELDNAVCANFAHTAADGKIYQVEYYNLDAIISVGYRVNSRRGIAF
FT                   RKWATNLLKEYLIKGYSNTVFTKDCTVNYTMI"
FT   repeat_region   211062..211184
FT                   /note="RPE-6 Full"
FT   gene            211237..212007
FT                   /locus_tag="RF_0194"
FT                   /note="RF0194"
FT   CDS_pept        211237..212007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0194"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61045"
FT                   /db_xref="GOA:Q4UN13"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN13"
FT                   /protein_id="AAY61045.1"
FT                   /translation="MNYRHIYHAGNFADIVKHLVLISILEQLKKKEKPFAGLGLYDLNS
FT                   EAASKTLESDTGINKLLQATNPIPLLLQTFLNIINIAGENHYPGSPFIIKQLLRPNDRL
FT                   IACELHPSDYLSLKQLLPINAHNIDAYNAIKAFLPFKENRGLIFLDPPFEVRNEFQKLL
FT                   EALKKIKLRVLNNPVLIWYPIKDLPLIRDFYHNYKNIGFKETMIIEYELLNSDKNMVKC
FT                   GLMLINPPNIKEELEKLTKYLSASLNLKFTYHTR"
FT   repeat_region   complement(211997..212117)
FT                   /note="RPE-5 Full"
FT   gene            212154..213008
FT                   /locus_tag="RF_0195"
FT                   /note="RF0195"
FT   CDS_pept        212154..213008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0195"
FT                   /product="Periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61046"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN12"
FT                   /protein_id="AAY61046.1"
FT                   /translation="MSFQKYIFLLFIVFLVQGCSSIKESSDTTLLSTTSSQLKQKYKIS
FT                   HADLVVQYDLTNKNSKCIYAKNLGLIINNPKQNKIFLQKFHNKNPAEFNKAAEIKIADI
FT                   KTVVTKLNSKYKFLSKPEASYFAKKQTHRNNISELTKLDKIISTIPLMMPEYEPKITSH
FT                   YGTRKSPHKKKRKKKCFHSGIDLQAKKAAPIYAAASGIVIKAARAPDYGNFVEIKHGRK
FT                   FVTKYAHLKEMSVKEGNKIKRGQFIGIQGKTGNATGEHLHFEILLDNKAINPFDFIFNC
FT                   RKC"
FT   repeat_region   complement(213016..213095)
FT                   /note="RPE-7 Full"
FT   gene            213170..214147
FT                   /gene="lpxK"
FT                   /locus_tag="RF_0196"
FT                   /note="RF0196"
FT   CDS_pept        213170..214147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="RF_0196"
FT                   /product="Tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61047"
FT                   /db_xref="GOA:Q4UN11"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN11"
FT                   /protein_id="AAY61047.1"
FT                   /translation="MIKLLYPEFWQKRNIIAYLLLPISLIYQFLGYLRASLARPIMLPA
FT                   KVICVGNCSVGGTGKTQIVMYLAKLLRAKNVSFVIVTKAYGSNLKSATTIHQGHTALEV
FT                   GDEGVILAKYGTVIATKNIKEILPLINELKPDIIIIDDFLQNPYFHKDFTIVSVDSQRL
FT                   FGNGFLIPAGPLRQYPNKALDTADLIFLVSSTNDKIPNILTPYIDKLINAQIIPSSDVD
FT                   KTKNYFAFSGIGNPERFFSTLKNYGLNITGYKIFPDHYNYLQADLENLYSLAKEHNATL
FT                   ITTRKDHIKFNDLNNNIVCLDVELSINNPDLLNEKIFKKAQIFN"
FT   gene            214110..214982
FT                   /gene="htrB"
FT                   /locus_tag="RF_0197"
FT                   /note="RF0197"
FT   CDS_pept        214110..214982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="RF_0197"
FT                   /product="Lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61048"
FT                   /db_xref="GOA:Q4UN10"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN10"
FT                   /protein_id="AAY61048.1"
FT                   /translation="MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGI
FT                   LFAVNKIARRNIKAVFGDMCDVEKIIDQTWDNFGRFIGESAYVNKMSEAELENRAEIIG
FT                   IENIKKLGEQPFLLFSGHFANWDIGLNLLHKSYPKFAVIYRKANNPYVNKLINESRTSD
FT                   KLRLIPKGPDGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTANAIAKIALQY
FT                   KYPIIPCQIIRTKGSYFKVIVHPQLKFEQTGDNKADCYNIMLNINQMLGEWVKQNPSQW
FT                   FWFHNRWKK"
FT   repeat_region   complement(214986..215109)
FT                   /note="RPE-5 Full"
FT   gene            complement(215125..215592)
FT                   /gene="bcp"
FT                   /locus_tag="RF_0198"
FT                   /note="RF0198"
FT   CDS_pept        complement(215125..215592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp"
FT                   /locus_tag="RF_0198"
FT                   /product="Bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61049"
FT                   /db_xref="GOA:Q4UN09"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN09"
FT                   /protein_id="AAY61049.1"
FT                   /translation="MTLELGKKAPDFSLHIGNDKVIKLSDLKGKFIVLYFYPKDDTPGC
FT                   TIEAQDFNRLKPEFDKLNTVIIGVSKDKLDSHDKFKEKYSLGFDLASDANSNLCEQLGV
FT                   WIEKSMFGKKYMGIDRATFLLDKKGIVKHIWRSVNAKNHAQEVLEKLKTLL"
FT   repeat_region   215720..215863
FT                   /note="RPE-1 Full"
FT   gene            215882..216166
FT                   /locus_tag="RF_0199"
FT                   /note="RF0199"
FT   CDS_pept        215882..216166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0199"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61050"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN08"
FT                   /protein_id="AAY61050.1"
FT                   /translation="MRTIGEALEELHKNLKNSAEIITADFNKKCHKVADKLSVKINDLE
FT                   KYTKDSKDHLLETIKEQYKSLTKELQDYQKIKDDKVEEYRQTLVKNLMI"
FT   gene            216217..216678
FT                   /locus_tag="RF_0200"
FT                   /note="RF0200"
FT   CDS_pept        216217..216678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0200"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61051"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN07"
FT                   /protein_id="AAY61051.1"
FT                   /translation="MKRILITLGATATLLLTPSIFADSPTKDETKVNEVQTEEVATSST
FT                   KTITENLQELKDNLTKLAQTGADKFNQTLSDTYDQIAQSVAEIKKNVKDQKDKEGEELQ
FT                   KSIDDVKAKMEDYKKAGSKKQEEIRQHLVDKLEELNKNINEYNKEKANS"
FT   repeat_region   complement(216688..216761)
FT                   /note="RPE-7 Full"
FT   gene            216818..217105
FT                   /gene="himA"
FT                   /locus_tag="RF_0201"
FT                   /note="RF0201"
FT   CDS_pept        216818..217105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="himA"
FT                   /locus_tag="RF_0201"
FT                   /product="Integration host factor alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61052"
FT                   /db_xref="GOA:Q4UN06"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UN06"
FT                   /protein_id="AAY61052.1"
FT                   /translation="MTITKEKIATMLSSKLGFSNNLCEEIVNTVFFNILEIAKEQKLTL
FT                   KNFGSFEVKQKNPRPGINFHTKSPIIIESKKNLRFIPSTKLKALINEHDK"
FT   gene            217095..217541
FT                   /locus_tag="RF_0202"
FT                   /note="RF0202"
FT   CDS_pept        217095..217541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0202"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61053"
FT                   /db_xref="GOA:Q4UN05"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR016597"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN05"
FT                   /protein_id="AAY61053.1"
FT                   /translation="MTNNRLIDSLQNEANKEEFEGNTEALATAAYTQVTEDASTGLTYK
FT                   LPLEASYAKSLTKKYYSASEVTKHLNIALHQLRYLETKIPDLSNYKINNRKYYTVNDID
FT                   LLQKSLKKDITSPSTDKVHILLTNFHNLSLQIKKILADSSMTCV"
FT   repeat_region   217115..217261
FT                   /note="RPE-1 Full"
FT   gene            217545..218528
FT                   /locus_tag="RF_0203"
FT                   /note="RF0203"
FT   CDS_pept        217545..218528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0203"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61054"
FT                   /db_xref="GOA:Q4UN04"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN04"
FT                   /protein_id="AAY61054.1"
FT                   /translation="MSYYVLKERKEHIMTIRQMVKPVIIGISGPELTDAERDLFEEHNP
FT                   LGVILFRRNIRKNDNGEQDKETLIKLIADIKEVLGENTIISIDQEGGRVKRLIAPTFYD
FT                   APAAKDFTNPQTCKHNYSTIGKELREVGINLDFAPVADLIHEGADKIVGDRSFGSEPEV
FT                   VVPLCLAAIDGLQEEKVGACIKHIPGHGRAKVDSHIGLPIVDTSLKELEDTDFKVFKEL
FT                   AKHDNIKLAMTAHIIYKALDSENPATLSKKVIDYIKNNIGFKGLIISDAIDMKALSGSM
FT                   ADITKGVLDAGVDIVLECTGEFNKMSEVLGSVSESSIDKFSDLLIA"
FT   repeat_region   complement(218577..218654)
FT                   /note="RPE-7 Full"
FT   gene            218905..219510
FT                   /gene="spoT11"
FT                   /locus_tag="RF_0204"
FT                   /note="RF0204"
FT   CDS_pept        218905..219510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT11"
FT                   /locus_tag="RF_0204"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61055"
FT                   /db_xref="GOA:Q4UN03"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN03"
FT                   /protein_id="AAY61055.1"
FT                   /translation="MICDIINLLKEDLNKADIENEIYMRLKEPYSVLKKMKRKEVPVDG
FT                   LKDLIACRIIVKSKALCYNALDVVKSSPHLDWLYTKDYINRPKSNGYQSLHNIMQLLHS
FT                   KRNFEIQIRSEDMHKDAELGRAAHLNYKEEQDRHLKKVFDVSNDTILSKARQMVKQFEG
FT                   LEEQIVEYEKEIMRIWDTKYDEMLKWENTAEVLIFNEE"
FT   repeat_region   complement(219556..219692)
FT                   /note="RPE-6 Full"
FT   gene            219976..224940
FT                   /gene="rompB"
FT                   /locus_tag="RF_0205"
FT                   /note="RF0205"
FT   CDS_pept        219976..224940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rompB"
FT                   /locus_tag="RF_0205"
FT                   /product="Outer membrane protein B"
FT                   /note="cell surface antigen Sca5, 168 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61056"
FT                   /db_xref="GOA:Q4UN02"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR022095"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN02"
FT                   /protein_id="AAY61056.1"
FT                   /translation="MAQKPNFLKKLISAGLVTASTATIVAGFAGSAMGAATQQNRTTVG
FT                   AATTVDGAGFDQTAAPANLAVAPNAVITANANNGINFNTPAGSFNGLFLDTANNLAATV
FT                   SEDTTLGFITNAANNGNFFNFTLGAGKTLTITGQGITAGQAAATKNAQNAVAQVNGGNA
FT                   IANNDLSGVGTIDFGAAPSTLVFNLTNPTTQRAPLILGDNAVIANGANGTLNVTNGFIQ
FT                   VSDETFATIKTINIGDGQGFIFNTDATAGNALNLQVGGATINFNGTDGTGRLVLLSNAA
FT                   GGGATDFNVTGSLGGNLKGIIEFNTTAVAGQLIANAGPANAVIGTNNGAGRAAGFVVSV
FT                   ANGNAATVAGQVYAKDMVIQSTNAGGQVNFGHIVDVGTDGTTAFKTAATTVAITQNSNF
FT                   GAVDFGNTASQITVPDTKVLTGNFTGDASNNGNTAGVITFAANGTLASGNADANVAVTN
FT                   KITAIEAAGVGVVQLSGTHTAELRLGNAGSQFKLADGTIINGNVNQTVLVGNAALANGA
FT                   IQLDGSATITGDIGNGAGNAAPIQGITLANDASKTLTLGGANIIGANAGGTIDFQANGG
FT                   TVKLTSTQNNILVDFDLAITTDKTGVVDASSLINAQTLTISGNIGTIAANNKTLGQFNI
FT                   GSSKTALNSGDVAINELVIGNNGSVQLAHNTYLITKTTNAANQGKIIFNPVVNDNTTLA
FT                   AGTNLGSEANPLAEINFGSKGVNGDTILNVGQGVNLYATNITTTDANVGSFSFTVGGTN
FT                   IVSGTVGGQQGNKFNTVELDNGTTAKFLGNAIFNGETTIEANSILQIGGNYTADKVESA
FT                   DGTGIVEFVNTTPITVTLNKQAGPVDDLKQITVSGRGNVVINEIGNAGNDHGAATDTIS
FT                   FENVSLGAALFLPNGIPLDGLTIKSTVGNETATGNFDVPRLIVSGVDSVIADGQAIGDQ
FT                   DNIVGLGLGSDNSITVNATKLYAGIGSVNNNQGTVTLSGGIPNTPGTIYGLGIENGSPK
FT                   LKQVTFTTDYNNLGSIIATNATINDGVTVTTGGVAGTDFDGKITLGSVNGNANVRFVDG
FT                   TFSDSTSMIVTTKANNGTVTYLGSALVGNIGSSDTPVASVKFIGSDDGAGLQGNIYSQV
FT                   TDFGTYDLSVLNSNVILGGGTTAINGEIDLLTNTLTFASGTSTWGSNTSIETTLTVANG
FT                   NIGHIVIAENAQVNATTTGTTTINVQDNANANFSDTQTYTLIQGGARFNGTLGGPNFAV
FT                   TGSNRFVNYGLIRAANQDYVITRTNNAANVVTNDIANSPFASAPGVGQNVTTFVNSTNT
FT                   AAYNNLLLAKNSADSANFVGAITTDTSAAITNAQLDVAKDIQAQLGNRLGALRYLGTPE
FT                   TAEMAGPEAGAIPAAVAAGDEAVDNVAYGIWAKPFYTDAHQSKKGGLAGYKAKTTGVVI
FT                   GLDTLANDNLMIGAAIGITKTDIKHQDYKKGDKTDVNGFTFSLYGAQQLVENFFAQGSA
FT                   IFSLNQVKNKSQRYFFDANGKMNKQIAAGNYDNMTFGGNLMVGYDYNAMQGVLVTPMAG
FT                   LSYLKSSDENYKETGTTVANKQVNSKFSDRTDLIVGVKVAGGTMNITDLAVYPEAHAFV
FT                   VHKVNGRLSKTQSQLDGQVTPFISQPDRTAKTSYNIGLSASIRPDAKMEYGIGYDFNAA
FT                   SKYTAHQGTLKVRVNF"
FT   repeat_region   complement(225119..225252)
FT                   /note="RPE-6 Full"
FT   repeat_region   complement(225329..225425)
FT                   /note="RPE-7 Full"
FT   gene            225597..227831
FT                   /locus_tag="RF_0206"
FT                   /note="RF0206"
FT   CDS_pept        225597..227831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0206"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61057"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN01"
FT                   /protein_id="AAY61057.1"
FT                   /translation="MKKYILGIIVLLISGTIFAQSQISNLVVPVSYFINHVSQLEKLKE
FT                   NLNKYKQSSVVGGNGMGKTQLARMYAYENKENYNIIWFIDCNLNIEQQLLKLSKAINTE
FT                   VKSPVISEDMAVMRKDLIAYLASKDKWLLVFDNLKIGENKKIEDFINWEYNGNIIVCSQ
FT                   DDELLSNIIKANAFTKSETALLAKNILENKNPELINFLTQEFGGYPILVVQGAQILNQV
FT                   QGLNLVEEYKKKIKASKDKIELNIKLVSNELNPSAKRLLDGIALLNNQSFSKELLNSIT
FT                   EDKNSLDDDIYQLSKFALISNIEPNEVNPIFEMHDVIAEKILQINGDKGNKEYLERSVT
FT                   NLLNSIPKSLVKGRIFRNAKTISDNIEIITKNAEKYDISIYKILELKLNLLIQYANSSD
FT                   LYNSKKLVNWFDKNDQKGKFKLWTMNNEEKFAYAAYLGRIGWYYRTWSDPKKAIEYDTK
FT                   AKQVFDEVKGYDSIKCNVVFGSAISNIQLGNLEEAEKNIQIMEAMFDQNLVDQTDIATI
FT                   YYAKAKLFNIQGKNYEALRRIDDSINACIENGMKLQDLFLTGSYLIKVDVLNNLKKHQE
FT                   ALSLLEQVYDMNKSSKKEENQVFGRIFTQKSRAKLRLGDVTEALEYAKKAKAIFFNDPT
FT                   RPNKEIIISPDIDLAKTFVAEGDALVLLNQNEEAVDAYATAENIYWNNYKENMKNVYEI
FT                   SNMYLAAAKASCTLPKKFWYEKFRNNQIEKFGADHPNSIKILNLKCDGSN"
FT   gene            complement(227828..229849)
FT                   /gene="ccmF"
FT                   /locus_tag="RF_0207"
FT                   /note="RF0207"
FT   CDS_pept        complement(227828..229849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /locus_tag="RF_0207"
FT                   /product="Cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61058"
FT                   /db_xref="GOA:Q4UN00"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UN00"
FT                   /protein_id="AAY61058.1"
FT                   /translation="MSEIGNFLLLTTMCLSGMSIVFGLLTRHCERLKGAWQSHEVIQKL
FT                   LRLPRRHFGPPPNDNIINFSFYASASCSILAFFTLVYAFIISDFSLQNVFLNSSTLKPL
FT                   IYKIAGSWSSHEGSMLLWFCLLQIVSCCYIFLLKDNRLKFLSIIILSAIQLFFSSFIYF
FT                   TSNPFNVFSFAPKEGLGLNPMLQDIALSIHPPLLYLGYVSYVVPFTIVCAAMLFHSSSM
FT                   SFLRKQESINDIKLLKTFSNIGILFTTIGISLGSWWAYRELGWGGFWFFDPVENISLFP
FT                   WLSGIMLHHSIIVTTKTNRIAPLHNWTIILSIVTFLLVIFSTFLVRSGFITSIHSFAFS
FT                   PERGIYLLGIFLIMGIGSIGLYTTTSLRGGASALTKQSQETIRDCRSHFRGFAMTNCGN
FT                   AILLGNIFFLLSLIVLIAATLYPPIYSLFDDKPIIIGETFFINNFIIFVIPILCTIGLF
FT                   ATKSSIKKHIIILILSLIITYFISLKVTFSVISILTIIASIFLMLHNVHYLLIKTNYFR
FT                   NRLKASTASMTLGHFGFALIAFSITMNALLQSEMDFTGKIGASKTFNEFKITLQNIKFA
FT                   QGKNYYRQIAEFWLEDNSRNITILKPENRLYIVEKSLSQESDIYSYLSYDLYAVLSNID
FT                   GDIIHAKIYYKPMMSFIWLGIILTASGFFIALIRKNSS"
FT   repeat_region   228691..228755
FT                   /note="RPE-7 Full"
FT   repeat_region   complement(229129..229186)
FT                   /note="RPE-6 Partial"
FT   repeat_region   complement(229673..229746)
FT                   /note="RPE-7 Full"
FT   gene            complement(229842..231116)
FT                   /locus_tag="RF_0208"
FT                   /note="RF0208"
FT   CDS_pept        complement(229842..231116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0208"
FT                   /product="Hemolysin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61059"
FT                   /db_xref="GOA:Q4UMZ9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMZ9"
FT                   /protein_id="AAY61059.1"
FT                   /translation="MTTILVIVIIIMIALSALFAATETAITASSPGKIHKLKIAGNKRA
FT                   KTVLEVLKKKEKVIGTLLIGNSLINTVCTTIATTLFISFLGDNGPIVASGVMAFIIIVF
FT                   AEVVPKAIAVAKPEQLALKMASTIVIFLKLFKPINIALDYITKIFCFIFRINLNPQISG
FT                   TEEVRGVIEHYHQEGGVYKSDRNMLGGILDIRNMTVSEIMTHRSSIIALNIDLPHEVII
FT                   KTLLSGAHTRIPLWQDNRDNIIGILNLKDLLKALYENNNDAKKVDINKLLTPPWFIPEN
FT                   ALVVDQLHAFRERNNHFACVVDEYGDLQGIITLEDVIEEIVGPITDEHDRLNNEIIKKS
FT                   NTEFIIKGTTTIRDINRELDWNLSDEDANTIAGLIIHKIARIPNQGEVIEIFNFKIIIL
FT                   KKIANKIDSVKITVLPTTEETISSE"
FT   repeat_region   complement(231187..231313)
FT                   /note="RPE-5 Full"
FT   gene            complement(231378..233237)
FT                   /locus_tag="RF_0209"
FT                   /note="RF0209"
FT   CDS_pept        complement(231378..233237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0209"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61060"
FT                   /db_xref="GOA:Q4UMZ8"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMZ8"
FT                   /protein_id="AAY61060.1"
FT                   /translation="MAEPIIFTLLLGNKDQILERINNQEAQNKLPIIPLQVNKESHISD
FT                   KERIFSEILEKSLKEGKTPIFNIQLNNNNVKPIFRVQDLINSQNLNIKTTITFDQYNSL
FT                   TQNPDLEAYWKQIMEKVDHVFFTNEADQNLAIADGIVPKDKTTTITDISLVTSVFNNLV
FT                   YDREIDQLLSGTIPDKAKLDKLIKTAKNQGGRVIIETWPLSADEATNLITAKFGIRSED
FT                   QIYGLKLEINEILKDPNNAAENFKKYVSQISRQFQKDLGKAEVNPIDFNFNTKKVMKDR
FT                   AEDIQKEQTTPYEPLQEIQPQQQGFFRRVFNYFKDIVTSFKETIFGKKEEPKTQESTTP
FT                   TTEAMTQEQQVVAVPPITQPEQQASVSNTKPWEELGITQKMYEASLQAEKQLIKSLIEP
FT                   KIPEKKSSPIINTEDTEAQAGIYNTENIKQPKYLYTEDDIKNILEANIDKNKFSIFHHA
FT                   SLEEPEILKDTLHATGEGLLLDNKSAIIPLNTGHKHWLLLTASKDDKGNINFIYNDPYG
FT                   EPLETRPKVTEYINEVYPGAKIIDLNTKQQENAYDCGVFVCDSAIKFSKGQKILTTEES
FT                   KGQGINLRKAQANTLLMQQQAQEIVRPLKTNSVQQSSNKFHKN"
FT   gene            complement(233302..233967)
FT                   /gene="lolD"
FT                   /locus_tag="RF_0210"
FT                   /note="RF0210"
FT   CDS_pept        complement(233302..233967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolD"
FT                   /locus_tag="RF_0210"
FT                   /product="Lipoprotein releasing system ATP-binding protein
FT                   LolD"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61061"
FT                   /db_xref="GOA:Q4UMZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMZ7"
FT                   /protein_id="AAY61061.1"
FT                   /translation="MNNTVLILKNISKHYSQGKTIVRVLDDLNLTVNEGELIAIIGSSG
FT                   SGKSTLLHIAGLLDKPTNGQVIIPNSKYQKYHLIRLHYLGFIYQQHHLLKDFTALENVI
FT                   MPRLISGLDQKEAIEDATKILDDLGLGKKLYNMPGELSGGEQQRVAIARSLINKPKIIL
FT                   ADEPTGNLDPKTTNEVFNLFLKVAREQNTAVIMVTHNHELAHKMDKLYKLKHGLLNIA"
FT   gene            complement(233960..235207)
FT                   /locus_tag="RF_0211"
FT                   /note="RF0211"
FT   CDS_pept        complement(233960..235207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0211"
FT                   /product="Lipoprotein releasing system, transmembrane
FT                   protein"
FT                   /note="LolC/E family"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61062"
FT                   /db_xref="GOA:Q4UMZ6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMZ6"
FT                   /protein_id="AAY61062.1"
FT                   /translation="MINNNFIFKIAFRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVV
FT                   MSVMNGFHIELTKNIIGLNGDIVINRQGGSIDNYEEIKAKLLKQDYVKHVTFIAHGQAL
FT                   ALGKSNNSGVLVKGMKLKDLSLRNEIFKNVNFGSFDDFHGKNVIALGEQLASNLGVTIG
FT                   DKIRLISPNSVSTALGSMPRSKEFKIIAIFNSGMYDYDLTTILMPLTAAQNFLSLGDDI
FT                   NLIEINSLDPDKALAYSYKIQSLLGPNLYVFNWQTLNSQFLSALAVERTAMFTILSLII
FT                   TVAAFNIISSLFMLVKDKTSDIAILRTMGASTKQIMLIFIYNGMFIGLLGTTLGVILGV
FT                   TFSYNIQTIKNYLERITGTKIFEAAIYFLYSLPSKVRAEDIILITSLSIILCFLATIYP
FT                   SYRASKLNPVDALRYE"
FT   repeat_region   complement(235236..235294)
FT                   /note="RPE-7 Full"
FT   gene            complement(235334..236509)
FT                   /gene="bcr2"
FT                   /locus_tag="RF_0212"
FT                   /note="RF0212"
FT   CDS_pept        complement(235334..236509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcr2"
FT                   /locus_tag="RF_0212"
FT                   /product="Bicyclomycin resistance protein"
FT                   /note="MFS type drug exporter"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61063"
FT                   /db_xref="GOA:Q4UMZ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMZ5"
FT                   /protein_id="AAY61063.1"
FT                   /translation="MKLLITVIIMEILAGAEIDLFVPSFPEIQDTFNLSTFMTELLLGV
FT                   NLTAYCITSLIVGNLGDRYGRRPIIILGLLIFNLGSLFCVFANNYEAILFGRFLQGCGI
FT                   SSVAVLVYVVLADIYSVQEQQKLMGILNGTITLSMAFAPVLGSYVNLFWGWRGNFALLF
FT                   TLGLISLILGILFIPKREVNKKIRISLKEYIPIFKSPKAIYYILTMIFLAQGYWIFIGI
FT                   APILYMLDLGVTLEYFGLYQGAMAALFSIMSFSSGYCFKKFGIRNCFYFGVIFIILFLL
FT                   GNSILVIYNINNPLTITIVTLLLSLGVIYPINILWPLLLEAIPDGKARMTAMFTAARLI
FT                   LTAFGLQLVGFLYNGTFTPLGITISIVTLFGLITLPKLFKYDKVFEISDRV"
FT   repeat_region   complement(236591..236685)
FT                   /note="RPE-7 Full"
FT   repeat_region   236934..237068
FT                   /note="RPE-8 Full"
FT   gene            complement(237094..237342)
FT                   /locus_tag="RF_0213"
FT                   /note="RF0213"
FT   CDS_pept        complement(237094..237342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0213"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61064"
FT                   /db_xref="InterPro:IPR024247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMZ4"
FT                   /protein_id="AAY61064.1"
FT                   /translation="MKNLLKILLILAFASPVFASSMQMPDPASVTTTQIQAMSTDDQQA
FT                   WVASLTADQYNMLSPDVQKWVMENTTDAQKQALGINQ"
FT   repeat_region   237544..237620
FT                   /note="RPE-7 Full"
FT   gene            complement(237670..239415)
FT                   /gene="msbA2"
FT                   /locus_tag="RF_0214"
FT                   /note="RF0214"
FT   CDS_pept        complement(237670..239415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA2"
FT                   /locus_tag="RF_0214"
FT                   /product="Multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61065"
FT                   /db_xref="GOA:Q4UMZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMZ3"
FT                   /protein_id="AAY61065.1"
FT                   /translation="MTFFLMDIKLLYRLIKYLKFYKKDLIIVMISLLSVSASLLLIGSV
FT                   FRNLVDNGLSQNHILSVDKSILYICLLIIILSIASFFRSYFINNVAEKAVNQIRKDAYS
FT                   NLITYEIEEFEELKIGDIISRLTNDIDQISTLIVNFLSFFIRNSVMLIGGVTLMFFESF
FT                   KLASIVIITIPILLIPLIKFGKHVKALSKKALESKSLLASDIDETFNNIRAIYAFNNQT
FT                   NKITDFDTKLQNYLTYCKTRLKIRALFFAISIAIIFLAITLVVWIGASDIVKGNLSAGQ
FT                   IISFIYYAIIAGFSSGGIFELLSEIHLPLAALERIITIIDKTPITHNSYLELNNSDPIS
FT                   IEFKNVDFTYHSRPNLRIINNMSLKINADKFIGIVGRSGGGKSTLMQLLLRFYRQESGT
FT                   ILINNQDITLSNPAEIRKLIAYVPQEANIFSGTIKSNIIFGNTQASDDDINEIIKITGI
FT                   EEFAAKLHDGINAKIGERGVRLSGGQKQRIAIARALLRKPQILLLDEAMSALDTMSEQK
FT                   LLESIKEIMKGKIIISIAHRISSIESADYILVIDKGGVAASGSHNDLSKNSEIYRNICR
FT                   EQLTV"
FT   repeat_region   239473..239568
FT                   /note="RPE-7 Full"
FT   gene            complement(239600..239676)
FT                   /locus_tag="RF_RNA07"
FT                   /note="RFRNA07"
FT   tRNA            complement(239600..239676)
FT                   /locus_tag="RF_RNA07"
FT                   /product="tRNA-His"
FT   gene            239786..240031
FT                   /locus_tag="RF_0215"
FT                   /note="RF0215"
FT   CDS_pept        239786..240031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0215"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61066"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMZ2"
FT                   /protein_id="AAY61066.1"
FT                   /translation="MKQYIKLINKAKQNPKGLSFSEFHTLMTKCGWVKDRQKGSHQIRY
FT                   SPKGDRLSIQTLGNMAKEYQVQQFLNFEKGNEDENK"
FT   gene            240012..240383
FT                   /locus_tag="RF_0216"
FT                   /note="RF0216"
FT   CDS_pept        240012..240383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0216"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61067"
FT                   /db_xref="GOA:Q4UMZ1"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMZ1"
FT                   /protein_id="AAY61067.1"
FT                   /translation="MKMKTNDAFDGFTIELFKDTDGDWLARFEELPNVSAFGNSPEKAL
FT                   QELQQAWTLMKESYISHNQSIPLAPSRKEYSGQFNVRVDKRVHRALVLEALRAKISLNA
FT                   LVSQKLTLSVNNEKSSYSS"
FT   gene            240358..241032
FT                   /gene="exsB"
FT                   /locus_tag="RF_0217"
FT                   /note="RF0217"
FT   CDS_pept        240358..241032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exsB"
FT                   /locus_tag="RF_0217"
FT                   /product="Trans-regulatory protein ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61068"
FT                   /db_xref="GOA:Q4UMZ0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMZ0"
FT                   /protein_id="AAY61068.1"
FT                   /translation="MKKAVILVSGGADSATVLAIAREMGYEIHAMSFNYGQRNNAELRK
FT                   VKELIKEYNVKQHKIVYIDLRAFGGSALTDNNIDVPHYHDVNELPEDVPVTYVPARNTI
FT                   FLSYALGYAEVIGAKDIFIGVHTSDSANYPDCRPEYIKSFEEMANLATNIGNRITIHTP
FT                   LIDMAKEQIIKTGLELGVDYKNTISCYDPTEDDLSCGNCLACMIRLDAFKKNNVQDPIN
FT                   YV"
FT   gene            241029..241580
FT                   /gene="rimJ"
FT                   /locus_tag="RF_0218"
FT                   /note="RF0218"
FT   CDS_pept        241029..241580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimJ"
FT                   /locus_tag="RF_0218"
FT                   /product="Ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61069"
FT                   /db_xref="GOA:Q4UMY9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMY9"
FT                   /protein_id="AAY61069.1"
FT                   /translation="MINREYLYAPFPALDLNDIVLRALVEDDAQDYFNYMSKSEMAIYI
FT                   TDSNRPKDLEEAREEIRYWSSLYKNHRSFYWGIALKDDNKLIGTAGFNIINLEHHRAEI
FT                   SYDLDPSFWGQGMMLKSIKNILKFADYIGIIRVQATVITDNFRSINLLERCGFAREGIL
FT                   KKYEIVANEHKDYYMYGRVV"
FT   repeat_region   241618..241689
FT                   /note="RPE-7 Full"
FT   gene            241731..243008
FT                   /gene="clpX"
FT                   /locus_tag="RF_0219"
FT                   /note="RF0219"
FT   CDS_pept        241731..243008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="RF_0219"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61070"
FT                   /db_xref="GOA:Q4UMY8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMY8"
FT                   /protein_id="AAY61070.1"
FT                   /translation="MVVEADKKELICSFCSKKQHEVKKLIAGPAVFICDECIDLCTDIM
FT                   KEESKVALKQITSSIPTPQKICAILNDYVVGQDQAKKILAVAVYNHYKRLEYVQSGNND
FT                   VELNKSNILLIGPTGSGKTLLAQTLAKILDVPFTMADATSLTEAGYVGEDVENILLRLL
FT                   IAAEFNIAKAQKGIIYIDEVDKIARKSENPSITRDVSGEGVQQALLKIMEGTVASVPPQ
FT                   GGRKHPQQDFVQLDTSNILFICGGAFMGIDSIITARTNHSSIGFAANVNIDKEKNNSEI
FT                   LKSLEIEDLTKFGLIPEFIGRLPIVTTLDELDKDALITILTKPKNAIVKQYQKQFELDD
FT                   AELVIEAAALEAIAEKALAKKTGARGLRSILEHLLLDSMYKVAELKKQRVTITKEVVNG
FT                   LVEPIMTSLISTKSNKKQPIIEDIPA"
FT   repeat_region   complement(243119..243214)
FT                   /note="RPE-7 Full"
FT   gene            complement(243353..243817)
FT                   /locus_tag="RF_0220"
FT                   /note="RF0220"
FT   CDS_pept        complement(243353..243817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0220"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61071"
FT                   /db_xref="GOA:Q4UMY7"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMY7"
FT                   /protein_id="AAY61071.1"
FT                   /translation="MDYLFIKTIHIISSTILFGTGIGTAFFMWWTNKTGDLNAKAYAAR
FT                   TTVIADLLFTTPTVIIQPVSGIILVNMLGYNYSDLWLILTYIGYIIAGSCWLPVVWIQI
FT                   QLRNMAFEALKQRTPLPEKYYKLFKLWFYLGWPAFISLIIIFFLMVFKPL"
FT   gene            complement(243817..245112)
FT                   /locus_tag="RF_0221"
FT                   /note="RF0221"
FT   CDS_pept        complement(243817..245112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0221"
FT                   /product="Putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61072"
FT                   /db_xref="GOA:Q4UMY6"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMY6"
FT                   /protein_id="AAY61072.1"
FT                   /translation="MRILITGANGFIGSYITAELLKNNYEVICCVRDVESTKKKFPTAE
FT                   VIYCDFNIDLTPQSWINRLNNIDIVINVSGVLASSHANNIENVHVNGPKALFKACTLTN
FT                   VKRIIHISALGIDDEKNTAYALTKKATEAYLQKLENIDWVILQPSLVYASGCYGGTSLF
FT                   RGALATLPYFIPLIGDGLQQFQPIHIDDLTKVIIHCIEREGKIHKLLKIVGPDIVTMKD
FT                   ILLGFRRWLGVNPGRLIKIPLIFIKIAAKLGDFLKIGPINSTAYNMLLQPNIADKKDFI
FT                   DFTSIIPRNLQQGFATEPLTVQSIWHARLYFLKPVIKIVLGLFWIMTGIISSIFAYDAS
FT                   MQIIISLGFDKQIAPYILYGSCFTDIILGILLIIKNKISRICSLQILLILAYTLLLTYL
FT                   KPILWLDPLGPIFKNIPIILLTLVLMAIERDK"
FT   repeat_region   complement(245137..245283)
FT                   /note="RPE-1 Full"
FT   gene            245558..247486
FT                   /locus_tag="RF_0222"
FT                   /note="RF0222"
FT   CDS_pept        245558..247486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0222"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61073"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMY5"
FT                   /protein_id="AAY61073.1"
FT                   /translation="MSNKLEVIIKYYNDISNLGVRLWKTTTALASFNLGEVLKIWFCDK
FT                   NFKDLTILDQSFIYTQYLETMLSKVAATGKYQDENIGHSHWSNCFEEINNQDHFLDTKL
FT                   QKLIGVENKNIIDSMLDNIGDINSLEFSTIVTKAQVFLKNNLDQSENLIKAAKEIDAMA
FT                   YPLTREYFLYRYIAKAILLTNTLNVSSSYEAEFNIVKKAHLNFANYLNSLEQSLTRIEK
FT                   ATNKDHKIASWLTEKSDLVSNHSGKIAATYAALIAGVIALRSYVIDEEDPWYELCALPT
FT                   TSLAMLQILLSFPGTVLSNRQTKEINNNMFQALENNNDNENAEDIKFLFDCTPSFANDA
FT                   VNTTAICFRYAANLGLQPIDLLNNDIVNRIIVYTALRWSAAAGVVEEQSKVTNFMQNKL
FT                   IKFLHDKIVPALIENKKFTAEEIKPYFQLLYKHSEKDKNTQIKLQAIYNKLTNQDIDFN
FT                   NIESDISAYHGWKSTAMCSAIATLILDYICFYFRNPELEFYEDPMFYASTSVKLMRLAS
FT                   LLVSTYCGNKVIENITGEKLTNDVFFQKFYYNDAARLTVAIVPLIMFESIKDLKFLSLA
FT                   TLIDVLTTAISDLNVGKAISSAGKNIAEKTATTLTWLNKIASGTNDDTVINIDATEEVP
FT                   FLGSVHF"
FT   gene            247570..248766
FT                   /locus_tag="RF_0223"
FT                   /note="RF0223"
FT   CDS_pept        247570..248766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0223"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61074"
FT                   /db_xref="GOA:Q4UMY4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMY4"
FT                   /protein_id="AAY61074.1"
FT                   /translation="MRIKNKSKLVLIFPFILLAVILPIYLLLEIYDLGKNGIYRKDLYQ
FT                   GLYYNFSSLSLQKQLEKYNYTVQLPKNPNAPYRIAILCRHDRLACMRIQQAANNLGWES
FT                   LFISISTNMHPIDIFRMYSIVRQFNPDFTISAADFGKVGDIRHYFILHFPCLRNNAKYL
FT                   IDIALVPYYCPKPIKSDGLLAVTDFKKINQYYEDISIPIIDFKFSRPKTEFIKINYSRL
FT                   FMCGYNWDNTRSGLKYKKLYKLLDKRKDVDMYGPRSGWLLLNSYRGFIPYNDQLFVDTI
FT                   RKSGIGLALHSEDHIMENFPSGRVLELVSSSALVIVDEMPWAKETFGDNILYIETLNKS
FT                   PEEIYSQINQHLEWIKSHPEEAYEKAKKAHQIYLDKFTMEQILTNVANMHNNIVSREN"
FT   gene            248777..249691
FT                   /locus_tag="RF_0224"
FT                   /note="RF0224"
FT   CDS_pept        248777..249691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0224"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61075"
FT                   /db_xref="GOA:Q4UMY3"
FT                   /db_xref="InterPro:IPR021047"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMY3"
FT                   /protein_id="AAY61075.1"
FT                   /translation="MYKVILIIFMIIWGTINVYDSSFIRFFYYRFLPVEKITKLDVISD
FT                   ENLQTGKLEMSKHKVVFAGITRSNAPHLPNAMRHIEYIGQFFSDYRIIIFENDSTDSTK
FT                   LMLNLWQLINHKVKIISQDFFNQKRPSIKFLADIRNKYLEILNTSEFDEFDIVIILDMD
FT                   IGYGIDIRGILDSFSKIDRWDVVCSNGIFNSKGQMYDAFAFRNEEFSYTPYEYNLKTGK
FT                   SYFDTENLALMQKIYPPDSDLLPVNSCFNSLTIYKRKFFENCFYDSIKEDCEHVYLHEC
FT                   MRSKHNARIFMNPVQIIRYEHYR"
FT   gene            complement(249707..250993)
FT                   /locus_tag="RF_0225"
FT                   /note="RF0225"
FT   CDS_pept        complement(249707..250993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0225"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61076"
FT                   /db_xref="GOA:Q4UMY2"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMY2"
FT                   /protein_id="AAY61076.1"
FT                   /translation="MPYLLPITAAALLILLALIIWFYVKTKTFKTQLQFLSEQNLEISN
FT                   NNQLLNQEKIGCLQKIEQLKCKVEYQEQTIKDSEKIREESFSSAKAALFDLGKDLSKQL
FT                   IEIHKMENNAARELAEKNIATASGKFNSEFERLITMVGALNKDIEQSKGTVDLIKQSLL
FT                   SPIGAGLLAEITLENILKSSGLRPNLDFIMQYGLTTTDSGKLRPDALIFLPSGNLMVID
FT                   SKASKFLVDEQDNSGNLSKTMNYHLKSLANKDYAENILTNLNKKDQNFNNVITLMFLPT
FT                   EQAVEKVIAADPEFLQKAWSCNIFPVGPAGLMNMLSFAKFQITDHRRSENYKVIIEEVR
FT                   KLLSSIGTMADYSQKIGNNLHNMVTNYDKFAASFNRNFMSRVKNIHKLGIDSGNKAMPA
FT                   ALERYQIVSSKSEIIEVEAENPPQIEEKL"
FT   repeat_region   251104..251203
FT                   /note="RPE-6 Full"
FT   gene            251243..252448
FT                   /locus_tag="RF_0226"
FT                   /note="RF0226"
FT   CDS_pept        251243..252448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0226"
FT                   /product="Predicted ATPase"
FT                   /note="AAA+ superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61077"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMY1"
FT                   /protein_id="AAY61077.1"
FT                   /translation="MDRLYKKQVEEYLTNYGKLVFISGARQVGKTTISKQVIKPNPNSI
FT                   YLNWDYLEDRNKILNKHAELFESLLSTVSDKKPCLILDEIHKYKDWKNLVKGFYDKFGE
FT                   NIEFIITGSAKLNIYKKGGDSLMGRYINLTVHPLSVSEIAKNFDNNTDYIKSPKNITID
FT                   EFEALINFGGFAESYLKATAKFHRIWSNQRFEQLFREDVRNTEDINNIYALELLASIIN
FT                   EQAGSSISYTNLANKVRVSDQTIRRWLSLLEKHYYCFAIKPWSKNVVKSLIKEPKIYLW
FT                   DWSQIKDIGARFENLVASHLLKAVYFWNETGLGDFGLYYLRDKQKREVDLVITKDEKPW
FT                   ILVEAKVSDSTVSSSLKYFHELLKPEFSFQVIQNKQAISGSCFDKSGLWIVPAITFLSQ
FT                   FV"
FT   gene            complement(252508..253239)
FT                   /locus_tag="RF_0227"
FT                   /note="RF0227"
FT   CDS_pept        complement(252508..253239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0227"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61078"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMY0"
FT                   /protein_id="AAY61078.1"
FT                   /translation="MYCYAYLLEHNWRYVFLNDEQVKRYRISEKKALSLYQLMKDTHEL
FT                   LGKNNINYWIEGGTLLGAVRHQGIIPFDDDLDIGIMHEDEIHLQQILPQFEQLGYRVKH
FT                   NKIYVICGERCLNIFVFHKENDKFVHFNQSMRNKYPNDFFYDYELYPLKKYKFGSIEVY
FT                   GPSEYKEHLNRQYLEWDKYVIIYSPHSLHLPFLSNIKKKTKFILTPELLKPAQPLGPLE
FT                   DKVNIVNSATFIGMCEDMAYN"
FT   gene            complement(253385..254149)
FT                   /locus_tag="RF_0228"
FT                   /note="RF0228"
FT   CDS_pept        complement(253385..254149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0228"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61079"
FT                   /db_xref="GOA:Q4UMX9"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMX9"
FT                   /protein_id="AAY61079.1"
FT                   /translation="MRTKVIKLKSMLSFKNIIGLILIIFAGIFFYAYILEHDWRYVTLR
FT                   DEQVKKYRISEEKAIALYQLMKDTHELLGKNNINYWIEGGTLLGAVRHQGIIPFDDDLD
FT                   IGIMHEEEIHLQQILPQFEQLGYTVSYERAYNICKKACLDIFIFHKEQNKFIYTNLAAR
FT                   DKYPKSSFYDNELYPLKKYRFGSIEVYGPADPIGNLNRQYPEWDKYAVIEHSHSLHLPF
FT                   LSNIEKKTKFILTPELLKPAQPFSPLEDRISF"
FT   gene            complement(254106..256685)
FT                   /gene="valS"
FT                   /locus_tag="RF_0229"
FT                   /note="RF0229"
FT   CDS_pept        complement(254106..256685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="RF_0229"
FT                   /product="Valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61080"
FT                   /db_xref="GOA:Q4UMX8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMX8"
FT                   /protein_id="AAY61080.1"
FT                   /translation="MKEFPKNYNFTENEKKWQQIWQEKQIYAYDPNISKDEIYVVDTPP
FT                   PTVSGQLHIGHVYSYTQTDFIVRFQRMMGKNIFYPMGFDDNGLPTERLVEKQKQIKAYN
FT                   MSRSEFIKICEEVVASEEEKFRSLFNQIALSVDWSLEYQTISPLSRKISQMSFLDLVKK
FT                   GEVYRNDQPILWDPVDGTALAQADIDDKEKTSFMNYITFEIEEDDRPFSKFAYREEFVG
FT                   NTEHSTAAYIKVREDASTGLTHKLPLEVEFGKRSITIATTRPELLPACVAVFYHPDDKR
FT                   YKHLAGKSAITPLFNGKVPLLADPLVQQDKGTGLVMCCTFGDQTDITWWKTHNLPLKTI
FT                   VTKKGTIDFPHDIAIDGLKIKEARTKIIDILKEQNLLTKQEEITHTVKCAERSGAPLEI
FT                   LTVPQWFVKTISHKEALLKRASELNWHPKNMKIRLESWINSISWDWCISRQRYFGVPFP
FT                   VWYSKRVGEEGKILYADISQLPVDPLKDLPIGYSKEEVEPDLDVMDTWATSSVSPQLST
FT                   HGISDDFTVNKERHDKLFPMELRPQAHEIIRTWAFYTILKAHLHQNTLPWKNIMVSGWC
FT                   LAEDRSKMSKSKGNVLVPEKLLEQYGSDVIRYWSANSKLGADTAYSEDVMKNGKRLVNK
FT                   LWNAAKFVSIHFEKLKDKDKQAKLLDVKEKITNEFDQWMINKLVELVKLATNELQNYEY
FT                   ANAMHLTEKFFWAIFCDNYLEISKNRAYDEENKNPSGQYSSILTLYHTMQILLKLFAPF
FT                   MPHITEELYQILYSDKSVHEKGNWVNYGDLNYKIDAKGAEGLLEILDIVRKFKAEKNLS
FT                   IKAPIKLLEVSGIELSAELTEDLKNVTSAEEIQFEDQGDKIKVNVIL"
FT   repeat_region   complement(255918..256061)
FT                   /note="RPE-1 Full"
FT   gene            complement(256803..257744)
FT                   /locus_tag="RF_0230"
FT                   /note="RF0230"
FT   CDS_pept        complement(256803..257744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0230"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61081"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMX7"
FT                   /protein_id="AAY61081.1"
FT                   /translation="MVKKLKHDSLVKTIMTDPIAAQEFLEYYLPDDFKNLVDLSKITVE
FT                   QESYIEESLNKRYSDIIYKISTHNKKEAFVYVLVETQSTIDYWAALRLWKYTLLLCERH
FT                   KRGKDKLTLVYNLVIYNGKEIYNAPSNLWSLFTDSVMSKKLMTEDYQLVDLQAMSDDEI
FT                   VKKKHLGMLEYMIKHIHMRDMIKLWEKFLTEFKHIIILDKEKGYIYLRSFLWYTDTKLS
FT                   KQKQPELVQVFTKHLSSKDKESIMKTIADTYRDEGRQEGVVQGKEIGKAEGEHNKAIII
FT                   AKEMFTQGFKIPVIAKVTGLQETFVRSVVKSH"
FT   gene            257835..258677
FT                   /gene="ubiA"
FT                   /locus_tag="RF_0231"
FT                   /note="RF0231"
FT   CDS_pept        257835..258677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="RF_0231"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61082"
FT                   /db_xref="GOA:Q4UMX6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMX6"
FT                   /protein_id="AAY61082.1"
FT                   /translation="MINKLLLTLKLMRADKPVPYILVFFPALFGLLLANPSNTELAYLL
FT                   PLFILGSITTRSSGCIINDIFDRKFDKHVARTKDRPLASDAVSVSYAIFILFILSIISL
FT                   YILLLLNKTAIYTGFFAVIMISLYPLTKRITYFPQVFMGFTFKLGALIAYAAVQNKLDA
FT                   AAIIMYLACCFWATGYDTIYGYMDIKDDKKIGVKSLSIYLENKHPKFWLYVCYIGFILL
FT                   FILATKIANNNSDYLPILAALILLILQVATLDTRNPADCMTRFRANNYVGLLLSLVFY"
FT   gene            258743..259204
FT                   /locus_tag="RF_0232"
FT                   /note="RF0232"
FT   CDS_pept        258743..259204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0232"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMX5"
FT                   /protein_id="AAY61083.1"
FT                   /translation="MLRNNTYKKSFAALIKDPTAEFYYSAYFLCFIEKFTDPLVSRGEK
FT                   YRLYTDSKKFWSSSEYNSQKVYNREDVNSMIFDKVAEKYGTKDKSAFKEYIHIIRNNYM
FT                   DIEYAGHIRAGCESYKIPKFCRLVNDDCYKELTDIIGVTPDAYLEAVSH"
FT   gene            complement(259201..260595)
FT                   /gene="proP4"
FT                   /locus_tag="RF_0233"
FT                   /note="RF0233"
FT   CDS_pept        complement(259201..260595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP4"
FT                   /locus_tag="RF_0233"
FT                   /product="Proline/betaine transporter"
FT                   /note="MFS type sugar transporter PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61084"
FT                   /db_xref="GOA:Q4UMX4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMX4"
FT                   /protein_id="AAY61084.1"
FT                   /translation="MTEKQVHARPPRLVDSLLFLKLCRSIPIFHLLVVYMSNSLSKRDF
FT                   SILIGNAMDHFDTALYGFLAPLLAGIFFPNHDKVVALILTYSVLATSLFTRPVGSYFFG
FT                   VIAKKYDGVFALSHSLIGVAFTTSLIGLIPSHAQIGWLAPLLLVLLRTLQGIYSEGECA
FT                   IAKLYILENKEEKKAFKASYLYQTSTMVGIILASFISTIVLNVEYNEYWRLCFIFGGFT
FT                   ALIGYFLRKSGNYTSLRATKRSVAISGILPKIASPKPTVFPRNDVVSSLLLDLNTIWNS
FT                   KLSILRISFVVGFSYMTYIVPFVFMNSFIPLITDISIETMMKFNTEFLIFDMVMIPIIG
FT                   HLTKKFHYLKILNGTLILMSLSIIPLWLFLNNSSIWYVNFVRIWIIILGVGFLAPLNCW
FT                   LNDLFKTADKYMLVGIGSSIGASLIGRLTPSICLMLWHVTGSSLSIAVYIAVISMVTLW
FT                   AVRAER"
FT   repeat_region   complement(259798..259864)
FT                   /note="RPE-7 Full"
FT   repeat_region   260530..260567
FT                   /note="RPE-5 Partial"
FT   repeat_region   complement(260591..260687)
FT                   /note="RPE-7 Full"
FT   repeat_region   260702..260820
FT                   /note="RPE-5 Full"
FT   gene            260929..261549
FT                   /gene="tmk"
FT                   /locus_tag="RF_0234"
FT                   /note="RF0234"
FT   CDS_pept        260929..261549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="RF_0234"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61085"
FT                   /db_xref="GOA:Q4UMX3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMX3"
FT                   /protein_id="AAY61085.1"
FT                   /translation="MNNLKQGKFITFEGGEGIGKSTQSQMLYEYLKSQNTPVILTREVG
FT                   GTAVAEKMREILVHEELLPMSELLQAMAARYDHMVRKIIPALQDGHIVICDRFIDSTAC
FT                   YQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEPDTAIERVNLRNMSNKFDVRGIDF
FT                   YKKIYDCFKELSNRFPERIKTIKASDLSPLEVHELIKKHLYTR"
FT   repeat_region   complement(261539..261662)
FT                   /note="RPE-5 Full"
FT   gene            261691..263229
FT                   /gene="metG"
FT                   /locus_tag="RF_0235"
FT                   /note="RF0235"
FT   CDS_pept        261691..263229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="RF_0235"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61086"
FT                   /db_xref="GOA:Q4UMX2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMX2"
FT                   /protein_id="AAY61086.1"
FT                   /translation="MKNTYYITTPIYYVNDVPHIGHAYTSVASDVIARFIRLCGFDVMF
FT                   LTGTDEHGQKVEKAAINKNIDPQKFTDHTSESFRHLMNVMNISNDDFIRTTESRHKEAV
FT                   AIFWQKLLDNGTIYEGFYEGWYAVRDEAFFDESELTSDGLAPTGAPVEWVKEPSYFFNL
FT                   SKWQDKLLEFYEANPDFIRPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVI
FT                   YVWLDALASYISALGYPDKQSNYGKFWPADLHVVGKDILRFHAVYWPAFLMAAEIPLPK
FT                   TIMAHGWWTNEGQKISKSLGNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLV
FT                   TRINSELSNKIGNLLQRTTAFVYKNNDGKVPLLMQGIIDKIYELPILKTASKFAEQNIL
FT                   LMEKTEINKVLENIINLSEEANIYIDSEAPWNLKKTDPEKMSEVLYTLLEVLRYIAIML
FT                   QPFIPSSANKMLDQLGVNKEERLFKHLIRDYALRAGSSILEPAIIFPRFEGDVV"
FT   repeat_region   complement(263259..263358)
FT                   /note="RPE-6 Full"
FT   gene            263371..264243
FT                   /gene="tatD"
FT                   /locus_tag="RF_0236"
FT                   /note="RF0236"
FT   CDS_pept        263371..264243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="RF_0236"
FT                   /product="Putative deoxyribonuclease, hydrolase"
FT                   /EC_number="3.1.21.-"
FT                   /note="TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61087"
FT                   /db_xref="GOA:Q4UMX1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMX1"
FT                   /protein_id="AAY61087.1"
FT                   /translation="MLIDSHCHLNLLTKDTDLDSVIQRALENNVQYMQTICTKIEDLPI
FT                   VLEIAEKYENVFASVGVHPCEVNSSISHCEALQVLWQSQEAWTRLPRQDYVSPRNDAEV
FT                   IIKLTKHPKIIGIGETGLDYYHQPYDKKLQQDSFVAHIHAASATNLPIIVHTREADEDT
FT                   IDILTSEMRNSKFPGLIHCFTSSKNLATKMLDIGLYISMSGIITFKNATDLQEIVKYVP
FT                   LDRLLIETDSPYLAPTPMRGKQNEPAFVRYVAEKVAELKNITSKEVANITTRNFKTLFS
FT                   KFEKHIRLI"
FT   repeat_region   263609..263673
FT                   /note="RPE-7 Full"
FT   repeat_region   complement(264227..264348)
FT                   /note="RPE-5 Full"
FT   gene            264478..265485
FT                   /locus_tag="RF_0237"
FT                   /note="RF0237"
FT   CDS_pept        264478..265485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0237"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61088"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMX0"
FT                   /protein_id="AAY61088.1"
FT                   /translation="MEFDRKNAIISFLKENEDQKFTSYGIAEWLVENYIEEARLKANAS
FT                   TNKRLLEAKTQEEKDKEIIGIYAGEISSSKLSAERRQEPNIRIELKPKLKFYYSQNPDY
FT                   YVNNEQATEPKINANKEDKITEEQVCDTLALYLQNKLKIHNMPIKHNFSSNKQGTKGNK
FT                   WLHPDWVGMEVLNEKWGLLIKDCAKYYAGKQARLWSFEAKTKINRSNLREYFFQALSNS
FT                   SWAHYGYLVAADLIESRQNDTRHELEMLCTRYGIGFILVDIENPEDSKISIPARERPEI
FT                   DWNMANRLAEENKDFENYINNIDTFYKKQKVNDSTWFNINDHVNKIPKQNKKKK"
FT   gene            265649..266926
FT                   /locus_tag="RF_0238"
FT                   /note="RF0238"
FT   CDS_pept        265649..266926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0238"
FT                   /product="Poly-beta-hydroxyalkanoate depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61089"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMW9"
FT                   /protein_id="AAY61089.1"
FT                   /translation="MMNCDLSTNYTYYILEGLRAQIAPIHLGIKILKEAYEHESLEDNG
FT                   FARIMHSYLTLCERMTRKYEKPEFNILETIIDDKTYNINEKVILKKSFCELRHFQKIGF
FT                   KKELPKLLIVAPMAGHHATLLRSTVQELLPYTDIYITDWTEASFVPLEAGHFDMDDYID
FT                   YVMEFINFIGPNVHTMAVCQPTVPLLAAISLMSESNSPNVPSSMILMGGPIDARKNPTA
FT                   VNEFAQSKSLEWFCKMVTMQVPPNYPGHGRKVYPGFLQLAGFMSLNLFRHIDSHLELWQ
FT                   SLLNSDYKKADHTIKFYDEYLAGMDMPAEFYLQTIDEVFQQFSLARGKLVSEKRPIDLK
FT                   HITKCALLGIEGELDDIAAVGQTKAALKLCSNIPESMKRYHLQKGAGHYGVFSGSKFKQ
FT                   FIVPIIKDFIYEFDKTNFKQSKLKAV"
FT   repeat_region   complement(267055..267079)
FT                   /note="RPE-6 Partial"
FT   gene            complement(267222..267482)
FT                   /locus_tag="RF_0239"
FT                   /note="RF0239"
FT   CDS_pept        complement(267222..267482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0239"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61090"
FT                   /db_xref="GOA:Q4UMW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMW8"
FT                   /protein_id="AAY61090.1"
FT                   /translation="MSYNMENTTEEQIIISEFKNDEEIDEEEKRLKTEDSRKQLKAILI
FT                   TFGIILTGFLTFTYFFFNYIEEKAEEYKQQQQQEIQKTNKS"
FT   repeat_region   complement(267588..267734)
FT                   /note="RPE-1 Full"
FT   gene            complement(267971..268354)
FT                   /locus_tag="RF_0240"
FT                   /note="RF0240"
FT   CDS_pept        complement(267971..268354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0240"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61091"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMW7"
FT                   /protein_id="AAY61091.1"
FT                   /translation="MNDLEKAKILFTALFNGKSDSSPNYKIYEKAFLNNILSSEEIKLE
FT                   IIKGNNEACYILAKTYEIINRNPQDEYNSMLLILIGSKLGNTECTQLVYSYPTKYTSFE
FT                   STVNNFIQNYIGDPNYNNMYNHG"
FT   gene            complement(268356..269393)
FT                   /gene="manC"
FT                   /locus_tag="RF_0241"
FT                   /note="RF0241"
FT   CDS_pept        complement(268356..269393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="RF_0241"
FT                   /product="Mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61092"
FT                   /db_xref="GOA:Q4UMW6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMW6"
FT                   /protein_id="AAY61092.1"
FT                   /translation="MRIKPVIIAGGSGKRLWPLSSKDKPKQFKKILSDLTLLQQTLNRN
FT                   KFLGQPTIITSKKYESITKEQAAEIDVEIELITEPLQKNTVVCAIITALSAKAQGFDIV
FT                   VLLPSDHHIADNLNYLNTINKALHYVNEFGICTIGIPINFISAEYGYINTGLSIAENVY
FT                   LVDHFIEKPILEQAKKHFQSNEYFWNSGIFVYDINFFLNLAMNLQPDLFCIVEKALNTA
FT                   IKNEKSLAIDDEAYNEIEAISIDNAIMEYISGMVMIKADFVWNDLGTWHSLLQVKHQNI
FT                   NDNYCEGNVVTSNTTNSFISSNNKLTTVVGLDNVIIIDTMNGLLVADKSKMNEIKELVM
FT                   KIEQN"
FT   gene            complement(269457..270287)
FT                   /gene="mutM"
FT                   /locus_tag="RF_0242"
FT                   /note="RF0242"
FT   CDS_pept        complement(269457..270287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="RF_0242"
FT                   /product="Formamidopyrimidine-DNA glycosidase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61093"
FT                   /db_xref="GOA:Q4UMW5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMW5"
FT                   /protein_id="AAY61093.1"
FT                   /translation="MPELPEVETLKNSLKDKLIELIIENVELKRDNLRYKLSPLLASEI
FT                   SNTNILDVRRRAKYLIIDFNNDYSLIVHLGMSGRFTLQPSNYETKKHDHVIFDLSNGEK
FT                   LIFNDTRRFGMIYNFKTNFLEKELFNNLGVEPLSDSLTLEYLKSKLITRKIPIKNLIMD
FT                   NRIIVGVGNIYASESLYLARIHPDKLGSNLRDDEIESLIKSIREVLAKAITAGGTTLKD
FT                   FVNGDNKPGYFTQQLTVYGRERQNCLNCSSTIIKTKHSGRSTFYCRTCQYSEFT"
FT   gene            270316..271062
FT                   /gene="ubiE"
FT                   /locus_tag="RF_0243"
FT                   /note="RF0243"
FT   CDS_pept        270316..271062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="RF_0243"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61094"
FT                   /db_xref="GOA:Q4UMW4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMW4"
FT                   /protein_id="AAY61094.1"
FT                   /translation="MNQTNFGFKKVDYTKKQGLVNSVFSNVADKYDLMNDLMSFGLHRL
FT                   WKDEFSRQIPNLNSHILDVASGSGDIALKLAKKARDRGNNIALTLSDINEEMLKNAKKK
FT                   AIDLNLFQNLKFTVASAEELPFSDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKF
FT                   ICLEFSKVKESYFKDFYKFYSFSIIPTIGQAITGNKEAYEYLVESIELFPSQDEFRIML
FT                   KEAGFEEVSYKNLSGGIVAIHSAYKI"
FT   gene            271059..272495
FT                   /gene="ubiB"
FT                   /locus_tag="RF_0244"
FT                   /note="RF0244"
FT   CDS_pept        271059..272495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="RF_0244"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61095"
FT                   /db_xref="GOA:Q4UMW3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMW3"
FT                   /protein_id="AAY61095.1"
FT                   /translation="MISNFFNLIRIFRIISKKRILIDSRSPKYFRFIGYILALFSAPLS
FT                   LFKKPHEDYGKRLIDCLSELGPIYIKFGQTLSTRPDLVGAEIAGYLRLLQDKLPPFDGG
FT                   VARKLIASLRGDIYVDEAISASKQKIATHSTNAHNDALPFLHFDDRPVAAASISQVHKA
FT                   QLATGEYVAVKILRPGIHKKYNRDIKLLYFLAKIISKFSKAKRLKPIKVVDKFHETMRF
FT                   ELDLRLEAAASSELMDNMRNDINVINPKIYWDLTSENILTTEWLEGTSIYDTSLLKEMG
FT                   LEPAKIAQNFAVMFFNQAYRDGFFHADLHAGNILVNKQGKIILLDFGIMGRLKEKDRLA
FT                   VAESLFGFLNRDYKLVAKVHLRAGYIPSNTDLDLFAQSCRAVTEPILGTPTKNISIGKL
FT                   LAHLFKITEDFGMEVQPELLLLQKTLIMVEGIGRQLDGNVNMWQLAEPWIKKWAVKNLS
FT                   SEAKLLRLVKHYLDSLEDIV"
FT   repeat_region   complement(271391..271454)
FT                   /note="RPE-7 Full"
FT   gene            272876..273322
FT                   /locus_tag="RF_0245"
FT                   /note="RF0245"
FT   CDS_pept        272876..273322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0245"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61096"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMW2"
FT                   /protein_id="AAY61096.1"
FT                   /translation="MPAEVLKRGYKFGTIPPESLPKITELWPNPYYYDWIQGNKEHNNP
FT                   DIDPQVMENIVSLCGEVSMDLPVNSDTKGVPAEVLKYEYNVSTIEQKPLSKIMELCPDP
FT                   DYYYHRIQKNEKYNNPDIDFQVTKNIISLCGEVSIDLPVNEELQ"
FT   gene            273434..275215
FT                   /locus_tag="RF_0246"
FT                   /note="RF0246"
FT   CDS_pept        273434..275215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0246"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61097"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMW1"
FT                   /protein_id="AAY61097.1"
FT                   /translation="MSKSQEQESIDNIRQQLDEVYKNLSWVEAGWVAIGSETGNKKYDE
FT                   LNKQYLDLNKDNLGIIQSVIQAVGDVPSALQFTWEASQVLPDLALELNNLRKARSATTN
FT                   VDAGCKIIADAESLIKKCAAVLHSETISNSSKETILQSKVIPYLLTPILNKRLNKITKN
FT                   FQTSETEKINILDKISPKFVRELSTLGVDLISKALESDLNPKLQEIYKNIKQKNESSQG
FT                   VILKNIHDIITSDKVKPLLNHDLVQFLKNPDNQKELVQITENIINNKAQKIAKPELIAN
FT                   TVALLANSSEKLIESTPSAIKAYSQLKENQRWTKINLNMEGLDTETKKELLKGKKPQIV
FT                   ELVKNAKKIIDNLAPVLEKELPQYLDSNKQDILDVLKHPKVIERIESKGEDPEFIHKAL
FT                   DASMPFVKDVLPSITKLSSLALSDSDKVADIIQKAQLIKSLPKEEKSKEVKELISTLIE
FT                   IKNNNPEISKIIEKDLPELLTKHASSLGPVVDEFLNKTPKGQKLKLDGEKLVKIAGKHA
FT                   PELIKIADKFSKHEYGKIIVPALKLLSDPKVLGVVAETIVNLGKSKFSKDKEAVGSHTS
FT                   KVLEERQREIGKDGRGT"
FT   gene            275336..276478
FT                   /locus_tag="RF_0247"
FT                   /note="RF0247"
FT   CDS_pept        275336..276478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0247"
FT                   /product="Predicted ATPase"
FT                   /note="AAA+ superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61098"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMW0"
FT                   /protein_id="AAY61098.1"
FT                   /translation="MIERDYYLTHIKDSFEIFPICAILGPRQCGKTTLAHAYIKQLKED
FT                   EKSYFFDLEDPAHLDQFKNLKTTLEPLNGLIVIDEIQRQPEIFPYLRVLADYSNKKFLI
FT                   LGSASGELLRQSSESLAGRIEYTELTPFNLIEINDFRELWLRGGFPKSYLAKNYVQSLR
FT                   WRNSYITSFIERDLPSLGISLNAHVMRQLWLMLAHNHGQLLNYSELGRSLGLTDMTIKR
FT                   YTEILEQTFMIRLLKPWYENISKHQVKAPKVYIRDSGILHALLGIHEHDWYVHPKRGLS
FT                   FEGFVIEELIRKFKTDAEYFFWRTQTGAELDLLIIKNGKKYGFEVKNADAPSITKSMYT
FT                   VLADLQLEHLYIVTAGNNTYKKTEKISVVGIENLSNLQLG"
FT   gene            complement(276622..277965)
FT                   /locus_tag="RF_0248"
FT                   /note="RF0248"
FT   CDS_pept        complement(276622..277965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0248"
FT                   /product="Conserved GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61099"
FT                   /db_xref="GOA:Q4UMV9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMV9"
FT                   /protein_id="AAY61099.1"
FT                   /translation="MTKKIITLVGRPNVGKSTLFNRLSIRKKAIVHDLPGVTRDRKYTE
FT                   GKIGSFEFLLIDTPGLEENPDSMGERLIEQTTKAILEADLICFMVDGRSGILPDDKLLG
FT                   SFVRKYNKPAILIVNKCEKAFDFDKEYYKLGFDSMVAISAEHGTGLIDLYDEIIAKLPE
FT                   EESIETNIADPIKRDCLQIVVSGRPNAGKSTFINALINDERLLTGPEAGITRESIEIDW
FT                   QYKNNHIKLIDTAGLRKKSTITESLEKLSASDAINSIKFANTVILMIDALAPLKQQDLN
FT                   IASHVVNEGRSIVIVVNKWDLVKESEKEAFQEEFYYQINTHLPQVKGVPVLFISAINKQ
FT                   NIEQVLDACLKIYKIWNKKITTSKLNEWLNFTTEAHPLPLQKGGKRVRVKYMTQTKTRP
FT                   PTFKLFSNNPEKITDSYTRYLVNNMREAFDMPGIPIRFTYVKTKNPYV"
FT   gene            complement(277968..278381)
FT                   /locus_tag="RF_0249"
FT                   /note="RF0249"
FT   CDS_pept        complement(277968..278381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0249"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61100"
FT                   /db_xref="GOA:Q4UMV8"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMV8"
FT                   /protein_id="AAY61100.1"
FT                   /translation="MNVIACVDISARHELRSRRLHGNLMKYPEIASSKLTVSPRNDEKI
FT                   RNKHMSPKFMKFYEKYMTIVGTIGNFMFYVQAHKIFTCKSSASVSMPAFTISAIALCSW
FT                   LIYGILIKNTPIIIANIVGFIGALLVLLTIIIY"
FT   repeat_region   complement(278256..278321)
FT                   /note="RPE-7 Full"
FT   gene            complement(278385..279167)
FT                   /gene="xth2"
FT                   /locus_tag="RF_0250"
FT                   /note="RF0250"
FT   CDS_pept        complement(278385..279167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth2"
FT                   /locus_tag="RF_0250"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61101"
FT                   /db_xref="GOA:Q4UMV7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMV7"
FT                   /protein_id="AAY61101.1"
FT                   /translation="MKIATWNINSIKTRLNLLRNFLSKENPDILLLQEIKCETEKFPFD
FT                   ELSDLPYNFYVHGQKSYNGVAIISKFPADEIIKDFPNNYCSDQARFLEIKLSLPIGFCN
FT                   IISLYAPNGSFVGSDKFVAKLAFYDNFINYLSTKKSFDEKTIIGGDFNIAPFDIDVYSP
FT                   KALAETTCFTEIEQKKLRTILNSGFEDLYRLRHPSKQEFSWWDYRAGCFEQNKGMRIDM
FT                   ILGCNNTIDYLENCYMDYNLRTQEKPSDHIPVIASFKR"
FT   gene            complement(279164..280246)
FT                   /locus_tag="RF_0251"
FT                   /note="RF0251"
FT   CDS_pept        complement(279164..280246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0251"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61102"
FT                   /db_xref="GOA:Q4UMV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMV6"
FT                   /protein_id="AAY61102.1"
FT                   /translation="MKGTVYGDPKFTDFLYNEKNQDIIRIYQNNMELINGLIKKEIDGF
FT                   ISDRIVGAVNILGRTMDRNILEVPLNIKTPLHLMFSKKTVSLNIVEQFNFAIDDFLASN
FT                   EYKKIIKTYIYHILLPKSIDSRWCHVIGLLGCLAFAFSGIILSSRKNSTLFGTFLFAVL
FT                   PSVSSCIMLDLIVNHDTGHLNFYFTPSYFYYIFVVVLLGFTIIKLFSYYNKQIAEDNYL
FT                   EQSLNNIVAICDSFGQATFIIIGVAMVIIHKIEPLSFWGPFFAFITANCGAILRDFIMK
FT                   ENSIKRVPRGVSIEITVLWGIAFSVLLDMYGSNPNYHTIKYSMIIVISGAFITSLLVYH
FT                   FGFLEWRFRNEKLEDIEKQT"
FT   gene            complement(280301..280735)
FT                   /locus_tag="RF_0252"
FT                   /note="RF0252"
FT   CDS_pept        complement(280301..280735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0252"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61103"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMV5"
FT                   /protein_id="AAY61103.1"
FT                   /translation="MKILKLFIFILLISKNFYALSIGANEQQATLECEGTADKKTLINA
FT                   WYINEPYQYLIATSNGHTTVSGMDIELINAIAAKIGINIEYNQDSWYQDQLDIQSGNAD
FT                   MTAGVTYTTERSNYAYFSKPYRLEELSLFIIEPLAKKLNF"
FT   repeat_region   complement(280785..280850)
FT                   /note="RPE-7 Full"
FT   gene            complement(280857..282245)
FT                   /gene="xseA"
FT                   /locus_tag="RF_0253"
FT                   /note="RF0253"
FT   CDS_pept        complement(280857..282245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="RF_0253"
FT                   /product="Exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61104"
FT                   /db_xref="GOA:Q4UMV4"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMV4"
FT                   /protein_id="AAY61104.1"
FT                   /translation="MHYSQLKKTKNKMLDNFIANQATKEFSVSEISNKIKELLENNFGY
FT                   IKVKGEISGLKIASSGHAYFNLKENTAILACTCWRPILAKIKFPLNDGMEVVISGKLSS
FT                   YAGNSRYQLSVDNLQPAGLGAMLQILNERKARLEKEGLFNKIRIPIPFLPDKIGVITSI
FT                   TGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEAIEGFNNLEEINKPSVIIVAR
FT                   GGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDYTLIDLAADKRAPTPTAAAEFAV
FT                   PVRSILNNTLQSYEKILLNNTSRLIKYHEQNIINYDKIHRYLSHYMNNKQQLLDETGFN
FT                   LLDALPCFIELQETKIKSFSKERVNPAKILNYKTLELTHQTAYLSKSANNTLKNFEYKL
FT                   ELNSTLLASLDYNNVLKRGFAIVKGETGNFLSSKITAANEKIFNIKFSDGEIKVVRNTV
FT                   IASD"
FT   repeat_region   complement(282251..282316)
FT                   /note="RPE-7 Full"
FT   gene            282464..284605
FT                   /gene="ostA"
FT                   /locus_tag="RF_0254"
FT                   /note="RF0254"
FT   CDS_pept        282464..284605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /locus_tag="RF_0254"
FT                   /product="Organic solvent tolerance protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61105"
FT                   /db_xref="GOA:Q4UMV3"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMV3"
FT                   /protein_id="AAY61105.1"
FT                   /translation="MLLRIICLLIIIIFSLISFADLSKNGQNIKISNMIADFVEYNESQ
FT                   DLIYAKGNIRIITDEYLLTADNLLYDIKNDILWAEGNIRIKNKQNRIIEGDKAVLKDEF
FT                   KKGIISEFILLSGDNNLLIAKLAERIDENNLKLHHAEFTPCDVTCNRNPIWQIAAKDTY
FT                   IHSEEHRIVYKNVFFEVYGVPIFYLPYFFHPTPTAPATSGLLVPDVKNKGFGIPLYLRA
FT                   KPNMDFTLTPRIFSKYQTYELEARYRPNDTDNMNFQGSYGKLPYFLKKDGNVVKNKKVS
FT                   SYHYIASGNFISTDKVYDYCFRVERTSDKAYLKNYYNNYASYLTSKIFLNKIHEADYFS
FT                   AEGLSFQGLGSNDSKYTDPLVLPKINTKNVINLNDNDNSHIVVENNTLMYKERIGKQVA
FT                   RTSLQLSFMHNVLTSSGQIFDFVAKDRGDFYLARRAYLDKTRESKSFQRNIPELQTLWR
FT                   YPLVGNITKTINLLIEPVVSFTMGRKLSKKDKKFVIIDPAKYELSEKNIFLSNRYSGID
FT                   CHDFGNRLSYGLNTSIAKEENYLKLFLGQSRNTRYSIDLPADDTENVGQILGNLSNNLE
FT                   VFYSFRKDKYFRPIRDEVGGNFNYDKINLLGSFIQLTNLKKYYSVESIKVSNNRVRQFY
FT                   GDINYQLAENWIIGFGARIDLSRRSPNLLTRTIRVTYAKDCVRITAKIYSDYLADGSRG
FT                   IKKTTSSPTISIGLKVLNM"
FT   repeat_region   284656..284748
FT                   /note="RPE-7 Full"
FT   gene            284807..285697
FT                   /locus_tag="RF_0255"
FT                   /note="RF0255"
FT   CDS_pept        284807..285697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0255"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61106"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMV2"
FT                   /protein_id="AAY61106.1"
FT                   /translation="MKKLLLIIITVFFAFNVAQASLPNIVASVNYEPITLNEFRARKKM
FT                   IMALNNVESLTPAQDKQLSDLAIKSLIDESLLFQYAGDREIPQEEIDNAIKSIEDHNKM
FT                   PHGSLLQYLKSRSVNPDSFISQIKSELIKMNILSSLSRSVQVSNKEIDVAILSSDQKDV
FT                   EISMQVFTSKDGGNKAFTQMNNLKNRLKKCADVKKSLYDNFATMQIITDKLSKIEGVKQ
FT                   TIVKDLSSDKASNVFEVNNKFEIILVCSKKILNVNEDENNYVVNFLTNKKISQKAQKMF
FT                   ENMRKKAVIKIMLPS"
FT   repeat_region   complement(285733..285848)
FT                   /note="RPE-6 Full"
FT   gene            285842..286573
FT                   /gene="ksgA"
FT                   /locus_tag="RF_0256"
FT                   /note="RF0256"
FT   CDS_pept        285842..286573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="RF_0256"
FT                   /product="Dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61107"
FT                   /db_xref="GOA:Q4UMV1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMV1"
FT                   /protein_id="AAY61107.1"
FT                   /translation="MTYHMLPSIAKHAASHQINPLKKHGQNFIFDSSLCDKIVRASNLA
FT                   ENSRVLEIGPGTGGLTRSILQKNPASLTVIETDERCIPLLNEIKEYYPNLNIIKQDALK
FT                   INLTDLGYDKVTIISNLPYHIGTELVIRWLKEARLITNMTLMLQKEVVERICAMPSTKA
FT                   YGRLSVICQLITKVEKCFDVAPTAFYPPPKVYSAIVKLIPLENPPSIALINKVEQITKL
FT                   AFAGRRKMIKSSLKNLVPNIH"
FT   repeat_region   286766..286868
FT                   /note="RPE-4 Full"
FT   gene            complement(286922..287164)
FT                   /locus_tag="RF_0257"
FT                   /note="RF0257"
FT   CDS_pept        complement(286922..287164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0257"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61108"
FT                   /db_xref="GOA:Q4UMV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMV0"
FT                   /protein_id="AAY61108.1"
FT                   /translation="MENKEEESNILPKFIIDEEEEKRLKAENSKKELKLILITFAIILT
FT                   SFLTFCYFFFNYIEEKAAEYKLQQEAEAKKLDKTE"
FT   repeat_region   287364..287498
FT                   /note="RPE-8 Full"
FT   gene            complement(287526..288056)
FT                   /locus_tag="RF_0258"
FT                   /note="RF0258"
FT   CDS_pept        complement(287526..288056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0258"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61109"
FT                   /db_xref="GOA:Q4UMU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMU9"
FT                   /protein_id="AAY61109.1"
FT                   /translation="MLFQSLNLYSILVAGLTATIIVFMRQLSYYKQQIINKDLKMVPAY
FT                   FDKKMLYKILNNNCDRYSALEMIKSYFKLKTARSLSYEELQNDQQLNELFGDSLNYFID
FT                   NFISKSDKSVVANKAFSIQDEFNNTHKLYAFLEKNKILDKTHQMLIYVKVPYIMTKDDE
FT                   ESLNTFIHLAKIM"
FT   gene            288352..289113
FT                   /locus_tag="RF_0259"
FT                   /note="RF0259"
FT   CDS_pept        288352..289113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0259"
FT                   /product="Protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61110"
FT                   /db_xref="GOA:Q4UMU8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041780"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMU8"
FT                   /protein_id="AAY61110.1"
FT                   /translation="MQINKQQEKGPFDIIGDVHGCYDELKNLLEKLGYRIKKGNKYIIT
FT                   HPQERRIIFVGDLVDRGPNSPEVLRLVMDSVSSSIAFCVNGNHDDKLKRKLQGRNVVIA
FT                   NGLQETLEQLENESAEFKASVLEFLESLSSYYILDNEKLAVSHAGIKEKDLGRSSERIS
FT                   KFCMYGATIGEIDEFGLPLRYPWDQEYQGNTLIVYGHTPVCEAQWLNNTINIDTGCVFG
FT                   GKLTALRYPEKELVSVDAAKIYYKPIKPFKK"
FT   gene            complement(289490..290131)
FT                   /locus_tag="RF_0260"
FT                   /note="RF0260"
FT   CDS_pept        complement(289490..290131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0260"
FT                   /product="TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61111"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMU7"
FT                   /protein_id="AAY61111.1"
FT                   /translation="MLSSESHINEIKEYDLALKMLDKAIEYDSKYIDAYYLKGVILTKI
FT                   QEYNQAIHCFDKVIIFDPTNAYAYFNKGYALVTLGKNELAVIAYSEGLEIAPNDSLAYF
FT                   YLGLALQNLKKYELALEAYNKAVELNLEISTLYFNIGNIYYDLEKYRLAIEMYNKAIQY
FT                   DLNDFIFYINRGNAYRNLNLYDKAFESYNKAIELKPDDFRAYVNRGIVFN"
FT   gene            complement(290780..290865)
FT                   /locus_tag="RF_RNA08"
FT                   /note="RFRNA08"
FT   tRNA            complement(290780..290865)
FT                   /locus_tag="RF_RNA08"
FT                   /product="tRNA-Leu"
FT   gene            complement(291012..291140)
FT                   /locus_tag="RF_0261"
FT                   /note="RF0261"
FT   CDS_pept        complement(291012..291140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0261"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61112"
FT                   /db_xref="GOA:Q4UMU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMU6"
FT                   /protein_id="AAY61112.1"
FT                   /translation="MQNYLTLRHLSINKSITCKRKYYFLKLIYHIITILSLFKLII"
FT   gene            291256..291468
FT                   /gene="cspA"
FT                   /locus_tag="RF_0262"
FT                   /note="RF0262"
FT   CDS_pept        291256..291468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="RF_0262"
FT                   /product="Cold shock-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61113"
FT                   /db_xref="GOA:Q4UMU5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMU5"
FT                   /protein_id="AAY61113.1"
FT                   /translation="MATNIVGKVKWYNSTKNFGFIEQENGGKDVFVHKSAVDAAGLHSL
FT                   EEGQYVIFDLEEKQGKAYAVNLRIK"
FT   repeat_region   complement(291816..291950)
FT                   /note="RPE-8 Full"
FT   gene            292119..292355
FT                   /locus_tag="RF_0263"
FT                   /note="RF0263"
FT   CDS_pept        292119..292355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0263"
FT                   /product="ATP-dependent RNA helicase RhlE"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61114"
FT                   /db_xref="GOA:Q4UMU4"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMU4"
FT                   /protein_id="AAY61114.1"
FT                   /translation="MDYIMKNFNLSEELIIALETMNITEPTEIQKQSIPVAMTGSDILA
FT                   SSQTGSGKTLAYLLPLIDSFIKNKNYCFNSCSD"
FT   gene            292303..293364
FT                   /locus_tag="RF_0264"
FT                   /note="RF0264"
FT   CDS_pept        292303..293364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0264"
FT                   /product="ATP-dependent RNA helicase RhlE"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61115"
FT                   /db_xref="GOA:Q4UMU3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMU3"
FT                   /protein_id="AAY61115.1"
FT                   /translation="MIHLLKIKTTALILVPTRELATQIHSTLNKVTTSYKINSAVLIGG
FT                   EPMPKQFMQLKKNPKVIIGTPGRIIDHLNRGSLKIDRIGITVLDEMDRMLDMGMKEQLE
FT                   EINKFLPEKRQVLMFSATMPKHIIAVSQKYLNNPIRITVGATNKAAAEIKQESMHVSDK
FT                   EKFSELTKQLGNREGSVIIFVKTKRSADQLAKMLKYENHKAEAIHGDLSQRQRERVILS
FT                   FRKSNHRIMVATDVAARGLDIPHTQHVINYDLPMCPEDYLHRIGRTGRAGATGHALSFI
FT                   SPDDVIRWRAIDRLVNKGETTPRSEFRSDKNNRKRSFGKRVGGEGKKFNSFDNNRKKTF
FT                   DGNSYGNKRKKVS"
FT   repeat_region   293384..293420
FT                   /note="RPE-7 Partial"
FT   gene            293766..294725
FT                   /gene="ampG2"
FT                   /locus_tag="RF_0265"
FT                   /note="RF0265"
FT   CDS_pept        293766..294725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG2"
FT                   /locus_tag="RF_0265"
FT                   /product="AmpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61116"
FT                   /db_xref="GOA:Q4UMU2"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMU2"
FT                   /protein_id="AAY61116.1"
FT                   /translation="MVSCICCVYILTNFNPNTHFIPFALCLVAVAFFSSIYDMLLQSSQ
FT                   MLLITNKNWGISEAACTTGFRIGILIAGSGALYLSTIISWQDVYRSMAILCIPSLLLII
FT                   IYPLKFKDKTIINDFDRFWYAFYDFIKKPKWLIIVSFMLLYRLQDNFLSIMPNMFYLDI
FT                   GYTKKDLALGYKAFGMCAAILGGFIGGFLCRKYEYFYLLKRALIYHALSSLSFLFLYFY
FT                   NRDITSLYIAVFFQEFTKGLTMSPFFSYQLRCCSSKYCITQIALITSIAYISTILFGSI
FT                   SGYAATYLGWTYFFLVAGFCFIPAYILIKYLPPYVIPS"
FT   repeat_region   294753..294854
FT                   /note="RPE-4 Full"
FT   gene            complement(294891..296111)
FT                   /locus_tag="RF_0266"
FT                   /note="RF0266"
FT   CDS_pept        complement(294891..296111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0266"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61117"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMU1"
FT                   /protein_id="AAY61117.1"
FT                   /translation="MPKKFTTRKGDIYTIDTPNEENLFKSVINKNTSEAFRYISQFNFP
FT                   LSDNIKTIRYFAIDEDKPNNVGTSHSTLSLIAVINNDLETLNLLINFGFDINNHSGINY
FT                   ITPLGLAADKGYKEIVKLLCEQDDIKVQNALYYAIRGENKSIEIIDLLVQKGAIIKPEH
FT                   IELAISHSNLSVFEYLFEKKLPDIEKNNLKLIGSSPAISSIDCILGEASKYQNTEVIKF
FT                   LLSSGYKPEQKYIDEFFVSAADNGRLKTCITLKANIEEHTRLEGLSKYQNYLKDKYHDY
FT                   YKTHIIFLSKFSYTDEPVEMFMFDNESNLLLLSMSRPLRSKLSSKDSYIIHDAIKEIFN
FT                   NTHLNIKELELARFKARIEFIKITTDEDLVPLSNKLAPLFSPELIHDLSKLEEELFPEV
FT                   KLAGLAD"
FT   repeat_region   296272..296420
FT                   /note="RPE-1 Full"
FT   gene            296481..297053
FT                   /locus_tag="RF_0267"
FT                   /note="RF0267"
FT   CDS_pept        296481..297053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0267"
FT                   /product="NifU-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61118"
FT                   /db_xref="GOA:Q4UMU0"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMU0"
FT                   /protein_id="AAY61118.1"
FT                   /translation="MFIQTEDTPNPDAIKFFPGQEISSEQPVFFSDISEVKGRSKLAES
FT                   LFYINNVKSVFFGSDFITVTKQAESNWQVIKPEVLMVIMDHFVSGFPVFEESTKADNVN
FT                   HNLDGLSEIEKQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTIT
FT                   LKNGIESMLKHFVPEVREVEAVEEDFE"
FT   gene            complement(297194..297682)
FT                   /gene="ecoT"
FT                   /locus_tag="RF_0268"
FT                   /note="RF0268"
FT   CDS_pept        complement(297194..297682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecoT"
FT                   /locus_tag="RF_0268"
FT                   /product="Ecotin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61119"
FT                   /db_xref="GOA:Q4UMT9"
FT                   /db_xref="InterPro:IPR005658"
FT                   /db_xref="InterPro:IPR027438"
FT                   /db_xref="InterPro:IPR036198"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMT9"
FT                   /protein_id="AAY61119.1"
FT                   /translation="MQNKIILLLTLCFLNTYLLANSDKTLKDIAPYPLPTDSQKRYVIH
FT                   LPTESNEEKLKVELQATKNAMKDCNRVWFGGKLETKTLEGWGYNYYIIDQVSDQPASTM
FT                   MACPGIKATIKPVSVFLGDETFLRYNSKLPIVVYAPKEVELHYVIWHQNDIINSAKEG"
FT   gene            complement(297700..298611)
FT                   /locus_tag="RF_0269"
FT                   /note="RF0269"
FT   CDS_pept        complement(297700..298611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0269"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61120"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMT8"
FT                   /protein_id="AAY61120.1"
FT                   /translation="MNIISEQHKKELLEITENFPADIASLINYVDKTFKCHIHDLSLSD
FT                   QKNLKFFIAKSFAKQIDTCKTKEHAQNFLQELQELWEDLFEEILEDKPVYSLDIDGATY
FT                   SAELDFTELNQNNMLNTRFSETSLDFNLIETLPNFSSDKTKYRTELAFTELKQNNFANI
FT                   YLEKQQYNSQTILISNIQNNHNNYILFPKIINLEEQVTIDVLNNLLLLGTYNKCNFFES
FT                   NNGSEIYFRLPNNERLAMKVFSLNNQPILKENKLENAILFLSKKINENGDVDYSESFSA
FT                   DIAEGKINSSYITPLGEIMDFN"
FT   gene            complement(298620..299978)
FT                   /gene="ftsZ"
FT                   /locus_tag="RF_0270"
FT                   /note="RF0270"
FT   CDS_pept        complement(298620..299978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="RF_0270"
FT                   /product="Cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61121"
FT                   /db_xref="GOA:Q4UMT7"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMT7"
FT                   /protein_id="AAY61121.1"
FT                   /translation="MVLNIKAPENIVLKPTITVFGVGGAGSNAVNNMISANLQGANFVV
FT                   ANTDAQSLEHSLCTNKIQLGVSTTRGLGAGASPEVGALAAQESESEIRSYLENSNMVFI
FT                   TAGMGGGTGTGSAPVIARIAKELGILTVGVVTKPFHFEGGHRMKTADKGLIELQQFVDT
FT                   LIVIPNQNLFRIANEQTTFADAFKMADDILHAGVRGVTDLMIMPGLINLDFADIKAVMS
FT                   EMGKAMMGTGEASGEDRAIKAAESAISNPLLDHSSMCGARGVLINITGGSDMTLFEVDN
FT                   AANRIREEVDNLDANIIFGSTFNPELKGIIRVSVVATGIDADKVPTYKPAIAETTNIVP
FT                   EETYNEPIVQPTQIEEIPDFNSYSTENIEITDSPINQNFIGNEKELGLHANSFNKSEDD
FT                   SPKPSFLGKIWGSLRASNNQTLERKNIVVNTLDQDNKESDIHDIPAFLRKKRD"
FT   repeat_region   300055..300188
FT                   /note="RPE-8 Full"
FT   gene            complement(300217..300642)
FT                   /locus_tag="RF_0271"
FT                   /note="RF0271"
FT   CDS_pept        complement(300217..300642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0271"
FT                   /product="Toxin of toxin-antitoxin system"
FT                   /note="Containing PIN domain for nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61122"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMT6"
FT                   /protein_id="AAY61122.1"
FT                   /translation="MSSKPFIADCSITASWFFNDERDEYSDFTLDYCYKFRAVVPFLWK
FT                   FEVTNTILIAAKRARITSAKIIKTIDFLNSLPINISNFDFPMYEIMNTARANNLTSYDA
FT                   TYLLTAMHERLPITTNDKALIKACHNNGVLLLKENLS"
FT   gene            complement(300639..300887)
FT                   /locus_tag="RF_0272"
FT                   /note="RF0272"
FT   CDS_pept        complement(300639..300887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0272"
FT                   /product="Antitoxin of toxin-antitoxin system Phd"
FT                   /note="COG4118"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61123"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMT5"
FT                   /protein_id="AAY61123.1"
FT                   /translation="MKQNLSNQINLLEAKTHFSDLRQRVQDGEQITICKHNTPVAKIIP
FT                   ITQKPKMDNIVEQIREFSKGNTLAPYTIKELRDEGRR"
FT   gene            complement(300991..302376)
FT                   /gene="fumC"
FT                   /locus_tag="RF_0273"
FT                   /note="RF0273"
FT   CDS_pept        complement(300991..302376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="RF_0273"
FT                   /product="Fumarate hydratase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61124"
FT                   /db_xref="GOA:Q4UMT4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMT4"
FT                   /protein_id="AAY61124.1"
FT                   /translation="MKNYRTESDSFGEIQIEEKFYWGAQTQRSLENFKIGKQKMPEILI
FT                   RALAILKKCAAQVNYEFGDLEAKIATSIDKATDRILEGEFEDNFPLVVWQTGSGTQTNM
FT                   NMNEVIASIANEELTSKKGGKSPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLIPA
FT                   LNNLLTSLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKV
FT                   YLLAQGGTAVGTAINSKIGFDIKFAEKVAEFTKQPFKTAPNKFESLAAHDALVEFSGTL
FT                   NTIAVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCSQV
FT                   MGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARIN
FT                   DLRDKSLMLVTALNPHIGYDNAAKIAKEAHKHGITLKEAAKKLNLLSEEEFDKIVVPEK
FT                   MIG"
FT   gene            complement(302373..302825)
FT                   /locus_tag="RF_0274"
FT                   /note="RF0274"
FT   CDS_pept        complement(302373..302825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0274"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61125"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMT3"
FT                   /protein_id="AAY61125.1"
FT                   /translation="MKRGPNEQIIESFEKQLDIFINELTEEEITTAILNNFFDKVINNL
FT                   KNESLINDTIFDIYQGKAVITKPIYSDYIESSEPKYNEHWQKFYSFNRNLMIESTLIFI
FT                   AKNLKKASLTDKLYYSFAKLAQQLDLNVVSDHFMKKIDNYITFNNL"
FT   gene            complement(302936..303658)
FT                   /locus_tag="RF_0275"
FT                   /note="RF0275"
FT   CDS_pept        complement(302936..303658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0275"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61126"
FT                   /db_xref="GOA:Q4UMT2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMT2"
FT                   /protein_id="AAY61126.1"
FT                   /translation="MQNKKLDSKNCYYMYGKHPVFSALNNPKRQIENILCTREIFDTNK
FT                   KLIGTRSYEIVNNDILSKLLENQTHQGIAAKVRPIFSYNLEDVDIKNPKCKIAILDQIT
FT                   DTQNIGAIIRSSAAFDIDAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLRSCMNY
FT                   LKKHGFWIIGLTGSANDYFTDKLISDKMALVFGSEDKGIRRLVEETCDYLAKILISKRV
FT                   ESLNVSNAASIIFHSLHK"
FT   gene            303850..303935
FT                   /locus_tag="RF_RNA09"
FT                   /note="RFRNA09"
FT   tRNA            303850..303935
FT                   /locus_tag="RF_RNA09"
FT                   /product="tRNA-Tyr"
FT   gene            304105..304178
FT                   /locus_tag="RF_RNA10"
FT                   /note="RFRNA10"
FT   tRNA            304105..304178
FT                   /locus_tag="RF_RNA10"
FT                   /product="tRNA-Gly"
FT   gene            304264..305448
FT                   /gene="tuf"
FT                   /locus_tag="RF_0276"
FT                   /note="RF0276"
FT   CDS_pept        304264..305448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="RF_0276"
FT                   /product="Elongation factor EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61127"
FT                   /db_xref="GOA:Q8KT97"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8KT97"
FT                   /protein_id="AAY61127.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTSLTAAITIVLAKTGGAKAT
FT                   AYDQIDAAPEEKERGITISTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLAKQVGVPAMVVFLNKVDMVDDPDLLELVEMEVRELLSKYGF
FT                   PGDEIPIIKGSALQALEGKPEGEKAINELMDAVDSYIPQPVRATDKLFLMPIEDVFSIS
FT                   GRGTVVTGRVESGIIKLGEEIEIVGLKDTQKTTCTGVEMFRKLLDEGQAGDNVGILLRG
FT                   TKREEVERGQVLAKPGSIKPHDKFEAEVYVLSKEEGGRHTPFTNDYRPQFYFRTTDVTG
FT                   TIKLPADKQMVMPGDNATFTVELIKPIAMQEGLKFSIREGGRTVGAGVVTKINN"
FT   gene            305544..305861
FT                   /gene="rpsJ"
FT                   /locus_tag="RF_0277"
FT                   /note="RF0277"
FT   CDS_pept        305544..305861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="RF_0277"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61128"
FT                   /db_xref="GOA:Q4UMT0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMT0"
FT                   /protein_id="AAY61128.1"
FT                   /translation="MKNKIKIRLKSFDHRSLDQATKEIVSAVKRTFANINGPIPLPRKI
FT                   ERFTVNRSPHVHKKSREQFEIRKHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIELESG
FT                   E"
FT   gene            305862..306509
FT                   /gene="rplC"
FT                   /locus_tag="RF_0278"
FT                   /note="RF0278"
FT   CDS_pept        305862..306509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="RF_0278"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61129"
FT                   /db_xref="GOA:Q4UMS9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS9"
FT                   /protein_id="AAY61129.1"
FT                   /translation="MRTGIIAQKIGMTSVFNDKGERISLTLVKVDDCQVVGHKTLEKHG
FT                   YNALVIGIKDKKISRVTKPMKQVFANAKISPKTKLKEFRISEENFIDIAASLEVDYFTA
FT                   GQFVDITATTIGKGFAGSMKRHNFRGLEASHGVSISHRSHGSTGQRQDPGKVFKGKKMA
FT                   GHMGCNQVTIQNLKIFAVDKERKLIMIQGSIPGHKNSYLSVKDAIKKISITV"
FT   repeat_region   complement(306517..306650)
FT                   /note="RPE-8 Full"
FT   gene            306782..307405
FT                   /gene="rplD"
FT                   /locus_tag="RF_0279"
FT                   /note="RF0279"
FT   CDS_pept        306782..307405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="RF_0279"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61130"
FT                   /db_xref="GOA:Q4UMS8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS8"
FT                   /protein_id="AAY61130.1"
FT                   /translation="MKTKILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAM
FT                   SGNHKTKTVSEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHATKLPKK
FT                   VRKLGLIHALSEKFAEGKLLVIDSLKLDKPKTSVLVNILNKFQGKSFFVIDGNEVDTNF
FT                   SLAAKNIYNTVIVPQIGANVYDIIRHEYVLLSQEAVSVLEERLR"
FT   gene            307402..307698
FT                   /gene="rplW"
FT                   /locus_tag="RF_0280"
FT                   /note="RF0280"
FT   CDS_pept        307402..307698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="RF_0280"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61131"
FT                   /db_xref="GOA:Q4UMS7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS7"
FT                   /protein_id="AAY61131.1"
FT                   /translation="MSSYKYYDLIRKPIITEKTTTLSEQNKYAFYVDKFAEKLTVKKAI
FT                   EEIFKVKVKKVNILNVKGKKKRFKGIIGTQINRKKAIVTLEKDHNIDFAGGIK"
FT   gene            307699..308520
FT                   /gene="rplB"
FT                   /locus_tag="RF_0281"
FT                   /note="RF0281"
FT   CDS_pept        307699..308520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="RF_0281"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61132"
FT                   /db_xref="GOA:Q4UMS6"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS6"
FT                   /protein_id="AAY61132.1"
FT                   /translation="MALKNFNPITPSLRELVQVDKTSLWKGRPLKSLTKGISKTGGRNN
FT                   QGRITSWHRGGGHKKLYRIIDFKRNKIDISAIVERIEYDPNRTAFIALIKYEDGEYSYI
FT                   LAPQKLSVGDRVISSQDADIKIGNCLPLKFIPTGTTLHNVEMKVGKGGQIARSAGTSVD
FT                   LVGKDSGYAQIKLRSGEFRLVPLDCKATIGSISNPDQKNINLGKAGRNRWLGWRPHVRG
FT                   VAMNPVDHPHGGGEGKTSGGRHPVTPWGFPTKGKKTRKNKRTSKFIVKKRK"
FT   gene            308545..308823
FT                   /gene="rpsS"
FT                   /locus_tag="RF_0282"
FT                   /note="RF0282"
FT   CDS_pept        308545..308823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="RF_0282"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61133"
FT                   /db_xref="GOA:Q4UMS5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS5"
FT                   /protein_id="AAY61133.1"
FT                   /translation="MARSIWKGPFVDGYLIKKVQKLMESGKSEMIKTWSRRSTILPIFV
FT                   GFTFSVHNGNKFIPVSVNEEMVGRKLGEFAPTRTFHGHGADKKVKRK"
FT   gene            308832..309191
FT                   /gene="rplV"
FT                   /locus_tag="RF_0283"
FT                   /note="RF0283"
FT   CDS_pept        308832..309191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="RF_0283"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61134"
FT                   /db_xref="GOA:Q4UMS4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS4"
FT                   /protein_id="AAY61134.1"
FT                   /translation="MVQENKNFATAKAKSIRVSPRKLNLVAAFIRNMKVSEALVQLTFS
FT                   PKKIAKVVKDCLQSAVANAENNLGLDIDRLVITKATVGKALVMKRVMPRAKGRATRINK
FT                   FFSNLYITVTEKEDN"
FT   gene            309193..309846
FT                   /gene="rpsC"
FT                   /locus_tag="RF_0284"
FT                   /note="RF0284"
FT   CDS_pept        309193..309846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="RF_0284"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61135"
FT                   /db_xref="GOA:Q4UMS3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS3"
FT                   /protein_id="AAY61135.1"
FT                   /translation="MGQKVCAHGFRVGPTLIKGWDSVLYAEKHYKTLFIQDLKIRDLIN
FT                   KGFNQAQVSRVLIERPSNKSIIININAKKPNIIIGRNGSEIDKIKKAIEKMTSLKEVYI
FT                   NIHEVRKFNIDAAIVAQTIALQLEKRVSFRKAMKTAIQASFKQGGQGIRVSCSGRLGGA
FT                   EIARTEWYIEGRMPLHTLRADIDYSTAEAITTYGIIGVKVWIYKGEYTENKRYN"
FT   gene            309861..310271
FT                   /gene="rplP"
FT                   /locus_tag="RF_0285"
FT                   /note="RF0285"
FT   CDS_pept        309861..310271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="RF_0285"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61136"
FT                   /db_xref="GOA:Q4UMS2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS2"
FT                   /protein_id="AAY61136.1"
FT                   /translation="MLAPKKQKFRKAHKGRVASKAKAGTTLAFGSFGLKSIDGWRVTAR
FT                   QIEAGRKAATRCMKRQGRLWIRIFPDVPVSKKPAEVRMGKGKGSPEFFAVRVSPGRIMF
FT                   EIEGVEENVALRALELASAKLPVRTRIVRRYE"
FT   gene            310264..310479
FT                   /gene="rpmC"
FT                   /locus_tag="RF_0286"
FT                   /note="RF0286"
FT   CDS_pept        310264..310479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="RF_0286"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61137"
FT                   /db_xref="GOA:Q4UMS1"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS1"
FT                   /protein_id="AAY61137.1"
FT                   /translation="MNDLKLLRSKLSTETIEELYKNLNLLKKELFNLRFQQALGELKNT
FT                   SRFSLVKKSIARIKTELTKRSNSEEY"
FT   gene            310466..310714
FT                   /gene="rpsQ"
FT                   /locus_tag="RF_0287"
FT                   /note="RF0287"
FT   CDS_pept        310466..310714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="RF_0287"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61138"
FT                   /db_xref="GOA:Q4UMS0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMS0"
FT                   /protein_id="AAY61138.1"
FT                   /translation="MRNIKMPKRVLQGVVISSKADKTVTVKVERKFKHPIYKKFVKVSK
FT                   KYAAHDSENKYQEGDKVSIIESRPISKTKTWLVVNGE"
FT   gene            310789..311157
FT                   /gene="rplN"
FT                   /locus_tag="RF_0288"
FT                   /note="RF0288"
FT   CDS_pept        310789..311157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="RF_0288"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61139"
FT                   /db_xref="GOA:Q4UMR9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR9"
FT                   /protein_id="AAY61139.1"
FT                   /translation="MIQMQSILEVADNSGAKKVMCIKVLGGSHHMVAKLGDVIVVSVKE
FT                   AIPGGKVKKGDVYKGVIVRTKTGVVRPDGSTIKFDKNALVLLNKQDEPIGTRVFGPVTR
FT                   ELRAKKYVRIMSLAEEVL"
FT   gene            311158..311487
FT                   /gene="rplX"
FT                   /locus_tag="RF_0289"
FT                   /note="RF0289"
FT   CDS_pept        311158..311487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="RF_0289"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61140"
FT                   /db_xref="GOA:Q4UMR8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR8"
FT                   /protein_id="AAY61140.1"
FT                   /translation="MIKLKVKKGDEVVVITGKHKGKKGKILKVFPEDSKVIVSGVNLVK
FT                   KHTKPNQMSEGGIITKELPIHISNIAHIDPKTGNPTKVAFKFLEDGSKVRVAKKSGEII
FT                   GKEGK"
FT   gene            311487..312026
FT                   /gene="rplE"
FT                   /locus_tag="RF_0290"
FT                   /note="RF0290"
FT   CDS_pept        311487..312026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="RF_0290"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61141"
FT                   /db_xref="GOA:Q4UMR7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR7"
FT                   /protein_id="AAY61141.1"
FT                   /translation="MLRFKELYQQKIIENLQKEFSYKSKHEIPQIKKIVINMGVGEAIA
FT                   DSKVINNAVNDLTLISGQKPVVTLARKSIATFKLRESMKIGCKVTLRKDRMYDFLERLV
FT                   IVALPRVKEFRGFSYKSFDGKGNFTFGLKEQIVFPEINYDKIDTIRGMDITIVTSAKTD
FT                   KESKFLLSGFNLPFYN"
FT   gene            312044..312349
FT                   /gene="rpsN"
FT                   /locus_tag="RF_0291"
FT                   /note="RF0291"
FT   CDS_pept        312044..312349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="RF_0291"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61142"
FT                   /db_xref="GOA:Q4UMR6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR6"
FT                   /protein_id="AAY61142.1"
FT                   /translation="MAKVSSIKKNESRKKKSQSLHNKRSALKSKIYDKNISLEERFSLV
FT                   MSLAQLPRNSSSTRIRNRCELTGRPRGVTRKFGISRNKLRELIGRGLVPGVVKSSW"
FT   gene            312369..312767
FT                   /gene="rpsH"
FT                   /locus_tag="RF_0292"
FT                   /note="RF0292"
FT   CDS_pept        312369..312767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="RF_0292"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61143"
FT                   /db_xref="GOA:Q4UMR5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR5"
FT                   /protein_id="AAY61143.1"
FT                   /translation="MSMTDNVADMLTRIRNAYKSKLINVSFPSSKIKTSILDVLQKEGY
FT                   IKDYVTTQKNNISYTEVALKYSVNGDASICEIHRVSKPGKRVYSAIKDLKGYYNNMGIY
FT                   ILSTPYGVMSDREAHIKNVGGEVICKVF"
FT   gene            312777..313310
FT                   /gene="rplF"
FT                   /locus_tag="RF_0293"
FT                   /note="RF0293"
FT   CDS_pept        312777..313310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="RF_0293"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61144"
FT                   /db_xref="GOA:Q4UMR4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR4"
FT                   /protein_id="AAY61144.1"
FT                   /translation="MSRVGKLPITIPEGVKVGLNDLEVKISGPKGELSKTFKGNIAISL
FT                   EENKLLVKPLAANKNARAMWGTARSIISNMVTGVKEGFKLKLEINGVGYRAMVKGKYLN
FT                   LMLAKSHNTKIEIPSDIKIEVPKQNIIILEGTDKEKLGQFASIIIKQRPPEPYKGKGIK
FT                   FENQFIPRKEGKKN"
FT   gene            313326..313682
FT                   /gene="rplR"
FT                   /locus_tag="RF_0294"
FT                   /note="RF0294"
FT   CDS_pept        313326..313682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="RF_0294"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61145"
FT                   /db_xref="GOA:Q4UMR3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR3"
FT                   /protein_id="AAY61145.1"
FT                   /translation="MRSAKLKFEKRRSRIRHKISKTSNRVRLSIFKSGRHIYAQIIDDS
FT                   KSITIASASTLDKKIKKFKKSHCNIENAIKVGEEIAKKADSAGIKEVVFDRGGYKYHGV
FT                   VKALADAAREKIKF"
FT   gene            313700..314230
FT                   /gene="rpsE"
FT                   /locus_tag="RF_0295"
FT                   /note="RF0295"
FT   CDS_pept        313700..314230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="RF_0295"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61146"
FT                   /db_xref="GOA:Q4UMR2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR2"
FT                   /protein_id="AAY61146.1"
FT                   /translation="MSKVKKNEETLSEVLVDVNRVTKVVKGGRRFAFSAYVVVGDKAGR
FT                   VGAGHGKAKEVNEARGKAKQAAKKRMMKVPLYQNRTIHHDVVGKSGAAKVILRRAKAGT
FT                   GVIAGGSMRAIFDSLGVHDIVAKSIGSTNVYAMISATFDALNKLASPKSIAMRRDKKVN
FT                   EISVKSSDIQVNE"
FT   gene            314223..314447
FT                   /gene="rpmD"
FT                   /locus_tag="RF_0296"
FT                   /note="RF0296"
FT   CDS_pept        314223..314447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="RF_0296"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61147"
FT                   /db_xref="GOA:Q4UMR1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR1"
FT                   /protein_id="AAY61147.1"
FT                   /translation="MNNVALSIGEVMNNKINNIKITQVKSAIGRKYDQRLTLVGLGLNK
FT                   INKSVILENTNSIKGMVEKVKHLLKIENM"
FT   gene            314461..314922
FT                   /gene="rplO"
FT                   /locus_tag="RF_0297"
FT                   /note="RF0297"
FT   CDS_pept        314461..314922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="RF_0297"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61148"
FT                   /db_xref="GOA:Q4UMR0"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMR0"
FT                   /protein_id="AAY61148.1"
FT                   /translation="MKLNELYNNIGAKKNKKRIARGIGSGKGKTGGRGIKGQKSRSGVA
FT                   IKGFEGGQTPMIKRLPKRGFNCISTKKYNIINIYNIEEALADGRLSAADTITKEKLVEV
FT                   GVVNNKNNKKLVKLLSICSDDFASPLSLKLDAYSSKAKDLIEKAGGKLL"
FT   gene            314926..316227
FT                   /gene="secY"
FT                   /locus_tag="RF_0298"
FT                   /note="RF0298"
FT   CDS_pept        314926..316227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="RF_0298"
FT                   /product="Preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61149"
FT                   /db_xref="GOA:Q4UMQ9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMQ9"
FT                   /protein_id="AAY61149.1"
FT                   /translation="MGQNFSKKSGNDLVSRIVFTILILIVCRFGSFIPIPGIDSIALSS
FT                   VAEKNQSGILGMFNMLSGGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGE
FT                   VGKRKVNQLSRYLTVLLASFQAYGVAISLESIVTNTGPVVILAGFFFRVTTVITLVVGT
FT                   MLLMWLGEQITQRGIGNGTSLIIFIGIISGVPSAIISMFELSRKGALSPLIALAVCIGV
FT                   VVLIAIIIFFEKAQRKLLVQYPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLF
FT                   PATLANFSNSNSETMGMLTYYLGHGKPVYILLYVALIMFFSFFYTAIVFNSEETANNLR
FT                   KYGAYIPGKRPGKNTSDYFDYILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSF
FT                   LIVVNVVLDTMTQIQTYLFSSKYEGLMKKVKLKN"
FT   gene            316243..316881
FT                   /gene="adk"
FT                   /locus_tag="RF_0299"
FT                   /note="RF0299"
FT   CDS_pept        316243..316881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="RF_0299"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61150"
FT                   /db_xref="GOA:Q4UMQ8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMQ8"
FT                   /protein_id="AAY61150.1"
FT                   /translation="MIVIFLGPPGAGKGTQGKKIAKKIDLPHIAIGDIFRTIIKTSTSE
FT                   AELINNYVKQGELIPNEIVNQVIKNFLLSSEYKNGYILDGYPRNLEQAKFFESFIKEKI
FT                   KIIYFDVSDELLIKRVLGRYSCKNCGKIYNSYFLQPKTDNVCDVCGSSTFDYRKDDNEE
FT                   VIKKRIEVYKTETYPLIDYYKNSGNFYIVDGSKNEQEIEIDIQKILKIN"
FT   gene            316940..317317
FT                   /gene="rpsM"
FT                   /locus_tag="RF_0300"
FT                   /note="RF0300"
FT   CDS_pept        316940..317317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="RF_0300"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61151"
FT                   /db_xref="GOA:Q4UMQ7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMQ7"
FT                   /protein_id="AAY61151.1"
FT                   /translation="MARIASVNIPDNKRLVVSLTYIYGLGPAMAAEICNKAKISKDKKV
FT                   KELTDQELISLRNIIESEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTH
FT                   SNARTRKGKAIAIAGKKKAVK"
FT   gene            317342..317725
FT                   /gene="rpsK"
FT                   /locus_tag="RF_0301"
FT                   /note="RF0301"
FT   CDS_pept        317342..317725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="RF_0301"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61152"
FT                   /db_xref="GOA:Q4UMQ6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMQ6"
FT                   /protein_id="AAY61152.1"
FT                   /translation="MNQTVKVKKKKKTITLGVVHIRASFNNTIVTFTDIQGNTISSASA
FT                   GGNGFKGARKATPYAAQVTIDRASEKAKEYGLKTISIRIGGPGAQRESAMRALFGQNFV
FT                   VTSILDVSSIAHNGVRPPKRRRV"
FT   gene            317744..318766
FT                   /gene="rpoA"
FT                   /locus_tag="RF_0302"
FT                   /note="RF0302"
FT   CDS_pept        317744..318766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="RF_0302"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61153"
FT                   /db_xref="GOA:Q4UMQ5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMQ5"
FT                   /protein_id="AAY61153.1"
FT                   /translation="MLSLSKNWNTLIKPNKVAYENFPETNNKAKIVVEPLERGFGLTLG
FT                   NAMRRVLLSSLQGAAITSIKIPAIEHEFSSIPGVKEDVSEVILNIKGIEVKMHVAEKRI
FT                   MKLKATGPCVITAGMIETGHDVEILNPDHVICNLAKNKQLEMELTCKVGKGYVLSTNSY
FT                   EDNLPIGEIAIDALFNPVKSVTYKVENTRVGQVTDYDKLIMFVETNGDLLPEMAVGLAA
FT                   RILQEQLQLFISFEEQEEDKQVKTDALPFSPYLLKRVDELELSVRSANCLKNDNIIYIG
FT                   DLVKRTESDMLRTPNFGRKSLNEIKEILAKFNLRFGMDVPDWPPENIQELSNRYEDSYN
FT                   "
FT   gene            318779..319159
FT                   /gene="rplQ"
FT                   /locus_tag="RF_0303"
FT                   /note="RF0303"
FT   CDS_pept        318779..319159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="RF_0303"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61154"
FT                   /db_xref="GOA:Q4UMQ4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMQ4"
FT                   /protein_id="AAY61154.1"
FT                   /translation="MRHKIKGRKLNVTSSHRQAMLANMAVALVTHEQIKTTLPKAKELR
FT                   PYIETLITKAKKADLTVRRSVLSKIKDKKAVEKLINILGTRYKDRPGGYTRIIKAGFRY
FT                   GDLAPIAYIEFVDRDINAKGNI"
FT   gene            319208..319480
FT                   /gene="rpsT"
FT                   /locus_tag="RF_0304"
FT                   /note="RF0304"
FT   CDS_pept        319208..319480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="RF_0304"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61155"
FT                   /db_xref="GOA:Q4UMQ3"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMQ3"
FT                   /protein_id="AAY61155.1"
FT                   /translation="MANHSSAKKAARQTVKRTLINKKRSSAIKTFIKKVAHEISLGNKE
FT                   NANLALSVAQSKIMQGVKKNIIKLNTASRKISRLSKQIKSLNESK"
FT   gene            319592..319667
FT                   /locus_tag="RF_RNA11"
FT                   /note="RFRNA11"
FT   tRNA            319592..319667
FT                   /locus_tag="RF_RNA11"
FT                   /product="tRNA-Val"
FT   repeat_region   319842..319943
FT                   /note="RPE-4 Full"
FT   repeat_region   complement(319963..320096)
FT                   /note="RPE-6 Full"
FT   repeat_region   complement(320212..320280)
FT                   /note="RPE-4 Partial"
FT   repeat_region   complement(320503..320618)
FT                   /note="RPE-3 Full"
FT   gene            320871..321293
FT                   /gene="spoT5"
FT                   /locus_tag="RF_0305"
FT                   /note="RF0305"
FT   CDS_pept        320871..321293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT5"
FT                   /locus_tag="RF_0305"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61156"
FT                   /db_xref="GOA:Q4UMQ2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ2"
FT                   /protein_id="AAY61156.1"
FT                   /translation="MKDISSWKEKFEVCVYAKKLLDKLEDLNTKVKNPVDIEEVKKGIY
FT                   YARKYHGSQMRQSGDPYYSHPIEVTIMLAEFVAEEVPKLFTTIMLQAALLHDTIEDTEL
FT                   TEEMINDIFGAEVAVNTGRKMIQIFNKHRLKNDTVS"
FT   gene            complement(321311..322111)
FT                   /locus_tag="RF_0306"
FT                   /note="RF0306"
FT   CDS_pept        complement(321311..322111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0306"
FT                   /product="Transposition helper protein, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61157"
FT                   /db_xref="GOA:Q4UMQ1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ1"
FT                   /protein_id="AAY61157.1"
FT                   /translation="MNLQHQRIEELCHSLNLMQIAENYLDIAQSSSKEDSSYTDFLESI
FT                   LKTELLARQHRSKSILTKMAGFPAIKTLDDFDYDFATGIKHKVLEGLRSLSFVERQENI
FT                   ILLGPSGVGKTHIAIALGYAATQCGIKTKFTTAADLMLILNAGLNQGNLDSIFKRVILP
FT                   YKLLIIDEFGYLPLKPEQANLLFQVIAKRYEKGSIILTSNLPFGQWHNSLAQDSALTAA
FT                   ILDRLLHHSTILNIKGDSFRLKDKKKTGLVPIEIINKQEDNFMT"
FT   gene            complement(322108..322551)
FT                   /locus_tag="RF_0307"
FT                   /note="RF0307"
FT   CDS_pept        complement(322108..322551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0307"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61158"
FT                   /db_xref="GOA:Q4UMQ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ0"
FT                   /protein_id="AAY61158.1"
FT                   /translation="MVLGIHRFNKGMLDFAKHYSFRLKVCRPYRAQTKGKVERFNRYIR
FT                   ESFYNPLVTKLKTSELVLDVDTANSEVLKWLRDTANLRVHRTTGAIPAERLKLERNHLQ
FT                   PLPLDYSGSHPTVLEIMRDKGERFSTVSLQHSLCIYQSILEAL"
FT   gene            complement(322526..323137)
FT                   /locus_tag="RF_0308"
FT                   /note="RF0308"
FT   CDS_pept        complement(322526..323137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0308"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61159"
FT                   /db_xref="GOA:Q4UMP9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP9"
FT                   /protein_id="AAY61159.1"
FT                   /translation="MIILEQIMEIKILNKHGKSLRSIAREVGVSVNTVRKYLKYDGSPK
FT                   YKDRSELVTKLAPYKDYLSERIKSAHPVSLPGTVLFQEIKELGYTGGITQLRDYLRSIK
FT                   PVAKQEDIIRFETASGKQMQVDWIEFRKGKDPLSAFVATLGFSRASYIEFVNNEKLITL
FT                   IECHKRAFDYFGGVPEEVLYDNMKTVILDRDTYGPWDTPF"
FT   gene            323763..325040
FT                   /locus_tag="RF_0309"
FT                   /note="RF0309"
FT   CDS_pept        323763..325040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0309"
FT                   /product="MFS type sugar transporter"
FT                   /note="PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61160"
FT                   /db_xref="GOA:Q4UMP8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP8"
FT                   /protein_id="AAY61160.1"
FT                   /translation="MLNAKNVNSNIPLKVALFTSLGSGLEYYDFVIYGMMAKYLSDIFF
FT                   SVNDSISSMIQTFIVFAVGYLFRPFGGTIIGMIADTYGRKKTFVVVMLTMGFSTMGIGL
FT                   LPTYNQIGIIAPIGLLVCRLCQGISLGAELPGATTIISEYAPTGKLGSVMLSSISIGAL
FT                   MATAMVATLNKLYSYQEIIEGAWRIPFICGGILAIISYYIRKNISETPEFLQEKNREQT
FT                   DTNLLIPLKLLLSQNLVNIAIGLGLVFFHANLVIINLYFPVYLNKYFNYELVDIYSSMT
FT                   ISMITSFIFTIIFGWLSDYVSKLKILLCSLILFSIFLFVSFALLNKGTFWSLQIFFIIY
FT                   QLFISLFFTSYMPILSRLFATKMRYTAIALIYNSAYSVASFIPVIASYLLEQYNSPLIL
FT                   GIFFIISIALSLISVITIQNKKINYY"
FT   gene            complement(325405..327525)
FT                   /locus_tag="RF_0310"
FT                   /note="RF0310"
FT   CDS_pept        complement(325405..327525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0310"
FT                   /product="Tetratricopeptide repeat domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61161"
FT                   /db_xref="GOA:Q4UMP7"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026270"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP7"
FT                   /protein_id="AAY61161.1"
FT                   /translation="MSNSNNKLDKNFDKALLCLEEEKYETAIKYFDKVLNQDPFLSSAY
FT                   SNKAFALKQLCRIEEALEVLDTAIKINPKISGYYDNRGIVLSILGLYEEAIKSYDQALK
FT                   LDSLDVLTFINKGWTLNNWGKYRKALSVLDKAIELDPTDIKAYANKAISLEKLGKFDEM
FT                   VHMYNKALEINPNYSELYFDRAKALIDIGEKEKALIDINKAIEINPNEIEFYHKKGWIL
FT                   SELYKYDEAIECCDKIIEIDSLEPYGYFNKGSMLRLNKKYEEAIEAFNMAINLMPTEAE
FT                   LYYLKGRCLYELKRYKEAVKEFNKAIKFEPDISSYYYKGQALYRLKEYKKAIEAYNHAL
FT                   SYPQYDNYTYYFKALSLKKLERYEEAIEVFNEALKIDSKDERTLSAKGQVLNELMRYEE
FT                   AIKVFDKAIRIDPKNRNAIYAKGEALAKLMRYEEAIKAFDKTIRIDPNYWKPYAKGWVY
FT                   NRLAKYKNAINYFNKVIELGKAEAYTYYEIALASYNLKRYKTAIINYDKAIELGIKALD
FT                   LKVSTYSTKGDCLYNIKNYEAALESYNKVIELDPANYVHYYDKAYTLDNLKRYEEALEN
FT                   YDKVILLNPSYSSAYINKADIFCKLKKYPKAIDCSNQALAIVTDDDAAYYNKGLALIKL
FT                   QQYEEGIENLDKSIKLDPDYPYAYYYNAIALNKLKKPDLAIEYINKAIELAPKNKVYQK
FT                   LYKELLNSARRS"
FT   gene            327859..328122
FT                   /locus_tag="RF_0311"
FT                   /note="RF0311"
FT   CDS_pept        327859..328122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0311"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61162"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP6"
FT                   /protein_id="AAY61162.1"
FT                   /translation="MVNIMSIKLDPYEQDIEDNFEKQQKIDDPALIALLQKAAKAHLNN
FT                   KRSITIRVAEHDIEAIKIKASKHGLPYQTYLNMLIHSDATKL"
FT   gene            328129..328413
FT                   /locus_tag="RF_0312"
FT                   /note="RF0312"
FT   CDS_pept        328129..328413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0312"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61163"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP5"
FT                   /protein_id="AAY61163.1"
FT                   /translation="MTKFRYNHEKNAKLLLERNIGFDEIIQSINDGNLLGAKLHHDQEK
FT                   YKGQQILYVKIIDQVYAVPFVEEEDNTIFLKTLYPSRKAKKEFLGNNTQ"
FT   gene            complement(328455..328733)
FT                   /locus_tag="RF_0313"
FT                   /note="RF0313"
FT   CDS_pept        complement(328455..328733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0313"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61164"
FT                   /db_xref="InterPro:IPR018964"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP4"
FT                   /protein_id="AAY61164.1"
FT                   /translation="MKRILQKIASIIAPPPKLTVSLHMVTFLWQSSKNIDLKMEVKSFS
FT                   NRLVTLVLPMPFVISTGDEFTIIAGCDKASRTCIVKFNNIINFRGEP"
FT   gene            complement(329513..330196)
FT                   /locus_tag="RF_0314"
FT                   /note="RF0314"
FT   CDS_pept        complement(329513..330196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0314"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61165"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMP3"
FT                   /protein_id="AAY61165.1"
FT                   /translation="MLIKNKYKHSMFPVNQNNIIEENEEIKFDLIDTDIEIPFNYLTYI
FT                   LNSTSYITPEILFDGFKVVLPFYQDVQLKPLFELAFDQDVNINSQNKDNGCTFLHYSVE
FT                   DVKVLYDNIPQFLLEKGADPNIQNKDGNTPLHILINRDFFSSKEIYVAKLLIQYGADIE
FT                   LKNLLGWTPIQCFIQAGNIKLKALLQLVKACKDNDFSKLDITTKDIKEFLDWQISITPE
FT                   NSKFF"
FT   gene            330585..330965
FT                   /locus_tag="RF_0315"
FT                   /note="RF0315"
FT   CDS_pept        330585..330965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0315"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61166"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP2"
FT                   /protein_id="AAY61166.1"
FT                   /translation="MKLSIRIKRDTDLGRENEQKIILKPGCKFTLEEGSFIDIENDTLC
FT                   NSYVLLGMVDLRTITLAPHSKLSIESSSIGFKNDDLVNYVLTPDDNGSYVLTPNMTILN
FT                   LSGLRLDSDILIGNTVHTPWEV"
FT   gene            331551..331808
FT                   /locus_tag="RF_0316"
FT                   /note="RF0316"
FT   CDS_pept        331551..331808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0316"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61167"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP1"
FT                   /protein_id="AAY61167.1"
FT                   /translation="MLLIAKNMNLACLKHIEFTNPFDHESLRKLVKLVIAKEIKPVTVI
FT                   INGLSIYESINKILLTVLGTLELSELIKISTYSVTKNSIY"
FT   repeat_region   332549..332649
FT                   /note="RPE-2 Full"
FT   gene            333059..333709
FT                   /locus_tag="RF_0317"
FT                   /note="RF0317"
FT   CDS_pept        333059..333709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0317"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP0"
FT                   /protein_id="AAY61168.1"
FT                   /translation="MNKNLKRLFVTTAIITSLASTNNAHATGLVTQFWDVVHNLKNARN
FT                   PFEKVEAVKEVKEHLQYRQEWINEPEDMTGSLLLNTSFIKKTLIEPKDGENNPEVEAVI
FT                   GILNELEPLRQAAKKEKEEKEKLKALKLEKKQALEAQKREEEQRIKADLARKQQEEAEA
FT                   KLKKEEAKENEQKKWEAEKKELKSLRDLVLGSQPLNDLQKLQFTELERKRKEK"
FT   gene            333654..334712
FT                   /locus_tag="RF_0318"
FT                   /note="RF0318"
FT   CDS_pept        333654..334712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0318"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61169"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMN9"
FT                   /protein_id="AAY61169.1"
FT                   /translation="MIYRSYNLLSWKEKEKKNEQAEKMAKQKQQREAEQAENEKNDNLC
FT                   LDLATNLKNRAKGLWGDKIEEDNDEDDYKANDRDNNPQLPSYEKDTYNNVPFTQLSPAK
FT                   QEKIIQEYKKGELERFYYEKAQAETTNKKNTWEKVPPVVKKAITDKYAEDKQKKIIEYY
FT                   YINYYKHNKRSFDQLSLEQRKQVERAFNNFIDKEEVKESYEWECDKNIRKIHSEDPQFK
FT                   YNVAFFELNNGLQIRKKEEYIQKKENKERKKQEDAVKAKKSAEEQVQRTRELKELILKV
FT                   GAPPPPPNAEIGLQNNKIKELESKIRENKTNNGTKEERKRLKEELEKSKAELEALKKEQ
FT                   EEERIRVLKERN"
FT   gene            335000..336001
FT                   /gene="sca11"
FT                   /locus_tag="RF_0319"
FT                   /note="RF0319"
FT   CDS_pept        335000..336001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca11"
FT                   /locus_tag="RF_0319"
FT                   /product="Cell surface antigen-like protein Sca11"
FT                   /note="37 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61170"
FT                   /db_xref="GOA:Q4UMN8"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMN8"
FT                   /protein_id="AAY61170.1"
FT                   /translation="MQTAAKKDEEIVNTMYNPTIVHNMNQLNSNIISNRIMHTTLPASA
FT                   VAAGDEDEKVLDKGIWLASIYGTNKQGVQKEFIGYKGRTSGGTIGFDVGFENVNDLLGI
FT                   AYTKLDSKFKSKGKNLNTKIDSHIVALYGQKELPKNFMMQAMFAYNHNIINSKINRLGT
FT                   VANGKYKNNNYNFEGLLSYNYLLNSSISLTPNIGIKYGYSKDGQYQEGNTGIQSLSVAA
FT                   KKHNLWSSVLGGKVILTPQKIYKNINITPALQASVENYFHNTSKKLHTKVKWKDKEINE
FT                   TVALPKQPKIGYNIGASVLTEKDKVSVLLEYNCHLQKKYQSHQGFIKLKINL"
FT   gene            336125..337078
FT                   /locus_tag="RF_0320"
FT                   /note="RF0320"
FT   CDS_pept        336125..337078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0320"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61171"
FT                   /db_xref="GOA:Q4UMN7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMN7"
FT                   /protein_id="AAY61171.1"
FT                   /translation="MCKFLKGCIEENITKREITMTQKQNAAMEQAIDLLINNDTDVSIL
FT                   FREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSDAQNSRNGYNTKNLITKNGAVEIE
FT                   VPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLIS
FT                   QITDDIIEDVKLWQSRPLDPVYAIVFFDCLIVKVRQDKRIINKSVYVALGIDLEGRKDI
FT                   LGLWISENEGAKFWLGNFTEMKNRGIQDILIACSDNLNGMSEAIGAVFPKTEHQLCIVH
FT                   QIRNSLRYVSYKDRKELAGDLKPIYTLAQKKKHFPL"
FT   gene            337153..337395
FT                   /locus_tag="RF_0321"
FT                   /note="RF0321"
FT   CDS_pept        337153..337395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0321"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61172"
FT                   /db_xref="GOA:Q4UMG4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMG4"
FT                   /protein_id="AAY61172.1"
FT                   /translation="MIFLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNAVFK
FT                   SLYLAIDYMTKKWSMSIPNWNKAMAHFLIKFDERI"
FT   repeat_region   337530..337624
FT                   /note="RPE-7 Full"
FT   gene            337867..339015
FT                   /locus_tag="RF_0322"
FT                   /note="RF0322"
FT   CDS_pept        337867..339015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0322"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61173"
FT                   /db_xref="GOA:Q4UMN5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMN5"
FT                   /protein_id="AAY61173.1"
FT                   /translation="MFRKMPLILMAIIIAIILFNPLMSLEVKRLLYSISLSIKSIIGLF
FT                   LPLIIFGLLFKSVVMLAKDATRIVFLILLLVCGSNFCSTFISHYVGIYIYQFDLSMISP
FT                   IENDSLKPLWLLNFPNIISNDKIVFSSIILGFISSKFCAEIAIGLAFKIEAFVAKILRL
FT                   FIYIIPLFIMGFIVKLQFDEVLGIIIKDYMFIFVTIAFAQFGYIFLAYFILSNCRVKEF
FT                   IASLSNMMPASISGFSAMSSVISMPLSIIGAENNTNNKALARTVVPITVNIHLVGDCFA
FT                   IPILAYAILKSYGLAEPTLFNYLIFAFYFVLAKFSVAAIPGGGIIVMLPILEQYLGFNT
FT                   NMMSLITALYILFDPVITCANVLGNSAFVKLIDNIYSVTQKA"
FT   repeat_region   complement(339036..339104)
FT                   /note="RPE-8 Partial"
FT   gene            339315..339500
FT                   /locus_tag="RF_0323"
FT                   /note="RF0323"
FT   CDS_pept        339315..339500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0323"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61174"
FT                   /db_xref="GOA:Q4UMN4"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMN4"
FT                   /protein_id="AAY61174.1"
FT                   /translation="MMWLLIAIGLTVSVLIIGVVSMAIGGKFDKKFSSKLMTLRVFFQA
FT                   VAIFLLIIIYFYKVKL"
FT   gene            339942..340469
FT                   /gene="def1"
FT                   /locus_tag="RF_0324"
FT                   /note="RF0324"
FT   CDS_pept        339942..340469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="RF_0324"
FT                   /product="Polypeptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61175"
FT                   /db_xref="GOA:Q4UMN3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMN3"
FT                   /protein_id="AAY61175.1"
FT                   /translation="MSILPIVTAPDDRLKQKSQPVLEFTDQTRKFMDDMVKTMYHEDGG
FT                   GLAAVQVGVLKRIMVIDIKDHDPIERPKDFYPLFIVNPEIIEKSEELITANEGCISVPE
FT                   QRIEVARPESIKIRYLDYHGKSQELEANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVV
FT                   LRKLKKLKNNIV"
FT   gene            340466..341377
FT                   /gene="fmt"
FT                   /locus_tag="RF_0325"
FT                   /note="RF0325"
FT   CDS_pept        340466..341377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="RF_0325"
FT                   /product="Methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61176"
FT                   /db_xref="GOA:O33523"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33523"
FT                   /protein_id="AAY61176.1"
FT                   /translation="MKVIFMGTPEFAVPALKKLITHHEVKAVFAQQPKAKGRGLNLAKS
FT                   PIHQLAFEHQIPVYTPSTLRNDKTINLINKINADIIVVIAYGFIVPKAILEAKKYGCLN
FT                   IHPSDLPRHRGAAPLQRTIIEGDRKSSVCIMRMDAGLDTGDILMKEDFDLEERTTLEEL
FT                   HNKCANLGAELLIKTLANIDNIVPIKQSSDGVTYAHKLTKEEGKINWYESAYKIDCKIR
FT                   GMNPWPGAYFSYNDKIIKILEAEYLNAEHHFTSGTVISDKLEIACGSGILRVKKLQQES
FT                   KKALNIEEFLRGTNILKDTILK"
FT   gene            341684..344444
FT                   /locus_tag="RF_RNA12"
FT                   /note="RFRNA12"
FT   rRNA            341684..344444
FT                   /locus_tag="RF_RNA12"
FT                   /product="23S ribosomal RNA"
FT   repeat_region   complement(344585..344636)
FT                   /note="RPE-6 Partial"
FT   gene            344706..344824
FT                   /locus_tag="RF_RNA13"
FT                   /note="RFRNA13"
FT   rRNA            344706..344824
FT                   /locus_tag="RF_RNA13"
FT                   /product="5S ribosomal RNA"
FT   gene            346352..346606
FT                   /locus_tag="RF_0326"
FT                   /note="RF0326"
FT   CDS_pept        346352..346606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0326"
FT                   /product="unknown"
FT                   /note="Similar to short-chain dehydrogenases of various
FT                   substrate specificities"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61177"
FT                   /db_xref="GOA:Q4UMN1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMN1"
FT                   /protein_id="AAY61177.1"
FT                   /translation="MPGCIRNYDEKIARQEMEVNYFAPLHLINAFSENLIKNNNCAIVN
FT                   IISIGGLYPSPVYVTYSASKSALYSLTQAIRIEMMMYTR"
FT   repeat_region   complement(346596..346718)
FT                   /note="RPE-5 Full"
FT   gene            346617..346991
FT                   /locus_tag="RF_0327"
FT                   /note="RF0327"
FT   CDS_pept        346617..346991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0327"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61178"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMN0"
FT                   /protein_id="AAY61178.1"
FT                   /translation="MATSSFADNPHVLVCTLRLSASRLLALFQIELRLPILHLLGVYSH
FT                   LIPVFGVYPGPIDTDMAKDIEVKKETSANVALRVFDAMEQGILDITTDALSDNFISYLN
FT                   KDPKLIEVLKKEFNRNKYYD"
FT   gene            complement(347355..348407)
FT                   /gene="n2B"
FT                   /locus_tag="RF_0328"
FT                   /note="RF0328"
FT   CDS_pept        complement(347355..348407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="n2B"
FT                   /locus_tag="RF_0328"
FT                   /product="Putative ATPase n2B"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61179"
FT                   /db_xref="GOA:Q4UMM9"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMM9"
FT                   /protein_id="AAY61179.1"
FT                   /translation="MSKSSTSLILDSKQAALLEELKQLAAELNKPKSLFKFFNQNSLKS
FT                   GIYLYGPVGSGKTMLMNSFFEEISISKIIIHYQNFMQEIHKSMHKLQTENQKDIIPKIA
FT                   KNYAKHTKLLCIDEFEIKDITDAMIIGRLFNELIKQNIFIFITSNTSPNNLYKDGLQRE
FT                   SFLPFIKIINNTFYVKYLDNHHDYRFDKALGVKGARIIYPLTLENQNKLEEIITDISDN
FT                   NLISQNIQVLGREISFQKVHKRILVTDYNELFTRDLSYIDYGNICQNFNVIIVKNVQII
FT                   PSDDTNTAVRFINFIDNAYFYKILLFMSLEDSPNKIYQGSARAAEFKRTISRLNEMNSE
FT                   SYLLENDFKN"
FT   gene            complement(348404..349108)
FT                   /locus_tag="RF_0329"
FT                   /note="RF0329"
FT   CDS_pept        complement(348404..349108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0329"
FT                   /product="Nucleotidyltransferase domain"
FT                   /note="Putative kanamycin nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61180"
FT                   /db_xref="GOA:Q4UMM8"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMM8"
FT                   /protein_id="AAY61180.1"
FT                   /translation="MNSITEYSFLTNLTKLPFIEEIWLFGSRGRGDNHERADIDIAILC
FT                   PNASKEDWQQVLEIIYDADTLLKIDCVRFDTLNDDDKFKQNIIDFKKILYKKGEILMEK
FT                   IFWQDYFKTLGQAIQCLHEVIERTKIDKDPIFLDAAIQRFEFVIELFWKVLKKILTYEE
FT                   IDSTTPRDVMSKAFQFNIIDDEQMWLEILKDRNVTSHVYKYEDAKQVFENIKIYLLILE
FT                   KTYNKLDKKYFG"
FT   gene            complement(349105..350208)
FT                   /gene="queA"
FT                   /locus_tag="RF_0330"
FT                   /note="RF0330"
FT   CDS_pept        complement(349105..350208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="RF_0330"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61181"
FT                   /db_xref="GOA:Q4UMM7"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMM7"
FT                   /protein_id="AAY61181.1"
FT                   /translation="MKLSDFDFDLPTELIAQYPASERDNSDLLIATTPPIKTKFYNIID
FT                   YLKEGDLLVFNNSKVIKAKLNLERNITINLNQKLSDDSWSAFAKPARKLNIGDEFYSDN
FT                   HKVIITEKFAMGEIKVKFELDNISVFEFLDKYGEMPLPVYIRRSKRHGEEEESSDEAIS
FT                   SQNPEIATESKRTPSNDDKLDSLRYQTIYSQIEGSVAAPTAGLHFTKEILDKLKAKGVQ
FT                   IAFVTLHVGAGTFLPVKTENIHEHKIHTEYCSITPETAEIINKAKQERRRIIAVGTTTL
FT                   RTLESSCNNGVVKAGSFETDIFITPGFKFQTTDMLLTNFHFPKSTLFMLICAFAGFKEM
FT                   HELYKYAIKEKMRFFSYGDATVLYRKV"
FT   repeat_region   349696..349760
FT                   /note="RPE-7 Full"
FT   gene            complement(350581..352350)
FT                   /gene="abcT3"
FT                   /locus_tag="RF_0331"
FT                   /note="RF0331"
FT   CDS_pept        complement(350581..352350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT3"
FT                   /locus_tag="RF_0331"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61182"
FT                   /db_xref="GOA:Q4UMM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMM6"
FT                   /protein_id="AAY61182.1"
FT                   /translation="MIKYPTLSKSTFSLGIYFLKFDKVKITLLTVICILLGMIPAIDSI
FT                   LLQKIIDLIESFSDENANNLLSSMIYWAVFYALWWESINIAYRSYDYLYLKTMPVIKGK
FT                   ILNELYNYTQYHSHKFFQDNLAGHISNRITETARSFEMIISIFGEKILRKLAIIVFALI
FT                   ALYSVHYVFATIFILWITVFLGLSVLFSDKINKYSLNYARSQSFVAGSIVDAISNINAV
FT                   RMFTAHKFERQHLETRVENAVADEQTMQFFMFKLRYALGTSCSIMIFIMIYYLSKLRSE
FT                   LSISIGDCVLVLTLCINVADDIWDLTQEIGDMFEQIGAFNQGLSLMAPHIITDIENATP
FT                   LDIKEGIIEFRNVTFNYHHNNNLFRNKSVLIPSKQKVGLVGFSGSGKTTFISLLTRLHD
FT                   IEDGMILIDNQNIKNVTQDSLRKAISLIPQEPVLFHRTILDNIRYGKKEATLEEVIIAA
FT                   KAAHIHDVIDNLPDGYDTMCGERGNNLSGGQRQRIIIARAILKNAPILILDEATSSLDS
FT                   ETESLIQESMDYLMQNKTVIVIAHRLSTLLNMDRILVFEKGSIIDDGSHAELLKNSKLY
FT                   QKLWNSQVKGLIV"
FT   gene            352534..352806
FT                   /locus_tag="RF_0332"
FT                   /note="RF0332"
FT   CDS_pept        352534..352806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0332"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61183"
FT                   /db_xref="InterPro:IPR022715"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMM5"
FT                   /protein_id="AAY61183.1"
FT                   /translation="MQEKELSNNFLEEQEKSKEDDSPFFDVKYICQASLLITDSIRKGY
FT                   DVTQLPNGDINVTEVRIVNVHYNWNSEKGKFVKTNQIEFNNSKGG"
FT   repeat_region   352915..352988
FT                   /note="RPE-7 Full"
FT   gene            353016..354386
FT                   /gene="cydA"
FT                   /locus_tag="RF_0333"
FT                   /note="RF0333"
FT   CDS_pept        353016..354386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="RF_0333"
FT                   /product="Cytochrome d ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61184"
FT                   /db_xref="GOA:Q4UMM4"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMM4"
FT                   /protein_id="AAY61184.1"
FT                   /translation="MEFDQVLLSRIQFAFTISFHIIFPAFTIGLASFLAVIEGLWLKTK
FT                   KPVYQEIYKFWVKIFAVTFGMGVVSGVVMSYQFGTNWSNFSDKVGNVLGPLLGFEVFTA
FT                   FFLESSFLGIMLFGFNKVSKKVHFISTLIVAVGTVISAFWILAASSWMHTPAGYELRGD
FT                   GFFFPLNWLEIIFNPSFPYRFFHMITAAYLTTSFVIGGVASFYLLNNRYKEHAKIMLFM
FT                   AVLMALIVAPIQIFIGDLHGLNTLKYQPVKVSTMEGIWNTEKGAAFNLIGFPDGEEEKT
FT                   KYAVEIPYASSLILTHSLDGEVKGLKEWSKEERPPVLVVFFSFRIMIGIGFLMVFTGIA
FT                   GLYLYLKKRLYATKWFQYWYILMSPSGFIAVLAGWFVTEVGRQPYIVYNILKTADTVSP
FT                   VLGKYVFISLIAFVVVYVIIFGAGIYYIMHLIKKGIEAIDNKETYGEIGLNNPLLEK"
FT   gene            complement(354395..354664)
FT                   /locus_tag="RF_0334"
FT                   /note="RF0334"
FT   CDS_pept        complement(354395..354664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0334"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61185"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMM3"
FT                   /protein_id="AAY61185.1"
FT                   /translation="MFRPIYTKSFEKDIKLAIKRGKDLNKLKMLIELLVNKTALPIKYR
FT                   DHQLIGNFIGRRECHIEPNWLLIYKIDNECIIFERTGTHSDIFK"
FT   gene            complement(354668..354928)
FT                   /gene="relB1"
FT                   /locus_tag="RF_0335"
FT                   /note="RF0335"
FT   CDS_pept        complement(354668..354928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relB1"
FT                   /locus_tag="RF_0335"
FT                   /product="DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61186"
FT                   /db_xref="GOA:Q4UMM2"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMM2"
FT                   /protein_id="AAY61186.1"
FT                   /translation="MTKSAFIRARVDPELKEEAENVLDELGITPTQAVTMLYKYVAREH
FT                   KWPTTIKIPNAVTLKTFESTDNKIGLIASNNTKKMFKKLGI"
FT   gene            355088..356107
FT                   /gene="cydB"
FT                   /locus_tag="RF_0336"
FT                   /note="RF0336"
FT   CDS_pept        355088..356107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="RF_0336"
FT                   /product="Cytochrome d ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61187"
FT                   /db_xref="GOA:Q4UMM1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMM1"
FT                   /protein_id="AAY61187.1"
FT                   /translation="MLNFAPYIDLPLIWGGLIATAICLYVLLDGFDLGVGILFPFAPTD
FT                   DCRHKMINSIAPFWDGNETWLVLGGGGLFAAFPLAYSLLMPALYIPIALMLLGLIFRGV
FT                   AFEFRFKAHIGHRYIWDYAFHFGSMLAVFCQGLMLGTFVQGIEIEGREFAGGSFDFLTP
FT                   FSVMTGIALIFGYALLGATWLILKTEKKTQDWAYKSALYILFYVALFMGLVSLWVPFLN
FT                   NHINHRWFSVPNIHYLSIVPIVTALIFIKLIKAVKQKKEVKPFIYTILLFLLGYLGLAI
FT                   SIWPYIVPYKVTLETAAAAPESQSLLLIGAGIFLPVILGYTFYCYYIFRGKSSHHPIY"
FT   repeat_region   complement(356303..356417)
FT                   /note="RPE-6 Full"
FT   gene            356452..357303
FT                   /gene="lgtF"
FT                   /locus_tag="RF_0337"
FT                   /note="RF0337"
FT   CDS_pept        356452..357303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtF"
FT                   /locus_tag="RF_0337"
FT                   /product="Beta 1,4 glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61188"
FT                   /db_xref="GOA:Q4UMM0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMM0"
FT                   /protein_id="AAY61188.1"
FT                   /translation="MEKISAFIITKNEAARIARAINSVKNIVDEVIVVDSESTDDTVAI
FT                   AEQLGAKVIVKPWLGYVGQKSFAESLCVNDWILNIDADEELSKELQDEIEYIFASHNQD
FT                   RYLAYQIKLLIMHRNDQKPRMFAPFNKCTRLYNKKFASFANTVNSTTHDSVVFNKDVDF
FT                   AGKIYLLNEAAYHYSGTSIEQLVTKANFYSSEQAKDLVKQGKKLSNFRLTTEMIWWFFK
FT                   AFFIRRYFVFGFDGFVDSMIFAFARFLRLAKLRESLLKSKNVIARSEATWQSRKNNKNS
FT                   TN"
FT   repeat_region   357263..357356
FT                   /note="RPE-7 Full"
FT   gene            357382..358620
FT                   /gene="mpp"
FT                   /locus_tag="RF_0338"
FT                   /note="RF0338"
FT   CDS_pept        357382..358620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpp"
FT                   /locus_tag="RF_0338"
FT                   /product="Mpp"
FT                   /EC_number="3.4.-.-"
FT                   /note="similar to mitochondrial protease"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61189"
FT                   /db_xref="GOA:Q4UML9"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UML9"
FT                   /protein_id="AAY61189.1"
FT                   /translation="MKENFNISKLKNGLTVLTYNMPYVDSVAINLITKVGSRYENSEEE
FT                   GISHFLEHMAFKGTTTRTAKQIAEEFDEIGGHFNAYTGHEKTIYYARVLSENCDKALNI
FT                   LADIIQNSIFAEEEIAKEYQVILQEIAHSQDNPDDLIYEKFYSSVYKDQPLGKPILGAS
FT                   KTLSSFTKEHFLSFIDKHYNAGNLYLSVAGNVDHDKIVSSAERLFSSLKQGEKSNFLPA
FT                   KYIGGNSFINKDLEQTTLILGFEGTPYINLERLYRTQLLAIIFGGGMSSRLFQHIREKL
FT                   GLAYAVGSYNSTYSDSGVFTIYASTAHDKLELLYKELKTEITKMTEKVNEEEMIRAKTQ
FT                   LRSNLLMAQEKVAYKSEEIGKNYAAFGKYIPPEEIMEIITNIKADDIINTANKIFSSIT
FT                   TSAIIGPNDLRGF"
FT   repeat_region   complement(358638..358707)
FT                   /note="RPE-7 Full"
FT   gene            358801..359511
FT                   /gene="purC"
FT                   /locus_tag="RF_0339"
FT                   /note="RF0339"
FT   CDS_pept        358801..359511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="RF_0339"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61190"
FT                   /db_xref="GOA:Q4UML8"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UML8"
FT                   /protein_id="AAY61190.1"
FT                   /translation="MKTQLYKGSSKILYSAEEDFLLIMAFSDNVTLESGEIIEISGKGV
FT                   LNNNISSFLMDKLEMNGIENHFIEKINMREQLIQYVEVFPVQVIISSVACGRFVKEFGM
FT                   DEGYVFDKPIIDFKVRSREFKYPIVNEYQILNFGWLTRDEIKAVKEQALRIYDFLSGLF
FT                   IGVGIRLVECKLEFGRVFNGEESIIMLTDEISPDNCRLWHINSNEKLGFELLENEPNKA
FT                   FESYQLIADRLKEK"
FT   repeat_region   359623..359692
FT                   /note="RPE-7 Full"
FT   gene            359753..361354
FT                   /locus_tag="RF_0340"
FT                   /note="RF0340"
FT   CDS_pept        359753..361354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0340"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61191"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UML7"
FT                   /protein_id="AAY61191.1"
FT                   /translation="MKIRFIIISFIALILVGWGYAAYKFEHQSKENIISILDEYGEYVT
FT                   YDSIKVNKYGFSITLNKVMLKPIDFYFDEIVIRHIPFLNITKIDSYGNDVKITIAQDEK
FT                   NIFYSPDHHTTIWFRKSLFNREPDYWKLSLSDNKSTLYSSLDAEKLAESDISNSVITNT
FT                   KTSDNLNLLILDGENTVSFISENYRGNLYDKIFEFLRDKIANDSDTASFEYGLTKLDIL
FT                   NLPISYNSKLKLKYSDELLALGKLLIQNFSLNQKQDENMHAVIFMQMLGELVKGKPFLF
FT                   SCDIERKGKVESYLYKLNIEKDKIFDFALNSKSTIEPSETYQKTAVEALGSYFSNGLNK
FT                   RAELDKIFKLTSPITQEDGEKVMGVFAKINNSEFNLKGEFDPEAKKLSGKTNLVMDDFN
FT                   FAIDIDMPNLDNPLNLESVIKLSDPNAFINNFVNYTDNAVIPVLNKMEGSKEFALNLGK
FT                   QSSVIKQYGFRAIEAFSKNSELKDGESLVVDVKGKDTGLTFNDKAIDQIFGDARVLEFM
FT                   NAMAQIEQERKQVVGK"
FT   repeat_region   complement(361427..361569)
FT                   /note="RPE-6 Full"
FT   repeat_region   361584..361719
FT                   /note="RPE-1 Full"
FT   gene            complement(361731..362054)
FT                   /locus_tag="RF_0341"
FT                   /note="RF0341"
FT   CDS_pept        complement(361731..362054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0341"
FT                   /product="Integrase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61192"
FT                   /db_xref="GOA:Q4UML6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UML6"
FT                   /protein_id="AAY61192.1"
FT                   /translation="MNITILLYMAWGDIDLQNKIWNISNIKKEKSRYLSLTDEAIQILY
FT                   RRKQKSNSLWVFPAKNKINHMVKPTPTLRKIVKETGYKDLTFNNLSKTLEKLTDPLRAS
FT                   IKL"
FT   gene            362753..363364
FT                   /locus_tag="RF_0342"
FT                   /note="RF0342"
FT   CDS_pept        362753..363364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0342"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61193"
FT                   /db_xref="GOA:Q4UMP9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP9"
FT                   /protein_id="AAY61193.1"
FT                   /translation="MIILEQIMEIKILNKHGKSLRSIAREVGVSVNTVRKYLKYDGSPK
FT                   YKDRSELVTKLAPYKDYLSERIKSAHPVSLPGTVLFQEIKELGYTGGITQLRDYLRSIK
FT                   PVAKQEDIIRFETASGKQMQVDWIEFRKGKDPLSAFVATLGFSRASYIEFVNNEKLITL
FT                   IECHKRAFDYFGGVPEEVLYDNMKTVILDRDTYGPWDTPF"
FT   gene            363339..363782
FT                   /locus_tag="RF_0343"
FT                   /note="RF0343"
FT   CDS_pept        363339..363782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0343"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61194"
FT                   /db_xref="GOA:Q4UMQ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ0"
FT                   /protein_id="AAY61194.1"
FT                   /translation="MVLGIHRFNKGMLDFAKHYSFRLKVCRPYRAQTKGKVERFNRYIR
FT                   ESFYNPLVTKLKTSELVLDVDTANSEVLKWLRDTANLRVHRTTGAIPAERLKLERNHLQ
FT                   PLPLDYSGSHPTVLEIMRDKGERFSTVSLQHSLCIYQSILEAL"
FT   gene            363779..364579
FT                   /locus_tag="RF_0344"
FT                   /note="RF0344"
FT   CDS_pept        363779..364579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0344"
FT                   /product="Transposition helper protein, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61195"
FT                   /db_xref="GOA:Q4UMQ1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ1"
FT                   /protein_id="AAY61195.1"
FT                   /translation="MNLQHQRIEELCHSLNLMQIAENYLDIAQSSSKEDSSYTDFLESI
FT                   LKTELLARQHRSKSILTKMAGFPAIKTLDDFDYDFATGIKHKVLEGLRSLSFVERQENI
FT                   ILLGPSGVGKTHIAIALGYAATQCGIKTKFTTAADLMLILNAGLNQGNLDSIFKRVILP
FT                   YKLLIIDEFGYLPLKPEQANLLFQVIAKRYEKGSIILTSNLPFGQWHNSLAQDSALTAA
FT                   ILDRLLHHSTILNIKGDSFRLKDKKKTGLVPIEIINKQEDNFMT"
FT   gene            364624..365790
FT                   /locus_tag="RF_0345"
FT                   /note="RF0345"
FT   CDS_pept        364624..365790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0345"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61196"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UML2"
FT                   /protein_id="AAY61196.1"
FT                   /translation="MLIKYLYHFSTGVDTEKHLLVKDGMLSAEEIESIISNYLLLEILA
FT                   SSYSRENNINEDRIIEARIIVRRLFEIARNYYEDDKQKGINELGAINYTKATYLLNENI
FT                   QKSLKQKQLSFKDIDYVVGNELEKLCELIAGNSAILTLNNDQIHSSNDFFDLAILGRLE
FT                   ETLKKLSEDFTVNDERIKFYRTLTEENDKKFFFENWKLIKWFSDTITYEKLLQLLPSKK
FT                   FLLDLLKDKNLYKLAEKMTIAKNELLEMSQEAQENYLKEIKIEDCLDVHLDSMNINTLR
FT                   LVLESNTILTNISFNSDTNVIIETGKSLNIAGLLTIGSGSTLNISGEGTLTLGSNIVSK
FT                   NIIENINYKGITPEILLNNTIALNLNFTEENIYNNSDTIILGNIDSEI"
FT   gene            365976..367403
FT                   /locus_tag="RF_0346"
FT                   /note="RF0346"
FT   CDS_pept        365976..367403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0346"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61197"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UML1"
FT                   /protein_id="AAY61197.1"
FT                   /translation="MQKILLKGPDVSMKNKTPDIKEIKTLDELLSGPGEYFINAHGSEF
FT                   FYKPTNLGLWGKIKSYFMPEPSYLSMSIFSDEDTTSVLDITLLNKIQNNTTENHCNIVH
FT                   IFSCHSGAAQHHLDYVQGNMVLCTYNKACDANIILLAQNNYDARTKNDSSLIEYIRDNF
FT                   HLLAASNFSISYKLDNQIHNFSLSAGKIKNMKSIEELLAFLHKKYEAFVKFYKNIHSEY
FT                   HESYPEIFNLNIETEPKELAQAELIRVFSRVVTLETYNFNKSSLDKVKTMLNQKGLNTD
FT                   LSIDKAIEKGNFKLLSCLLNYGNTKIASSNLNKAIEKGDLAILKAVLEHSTTKIESYSL
FT                   DKAIEKGDLAILKAVLEHSTTKIESYSLDKAIEKGDLAILKAVLEHSTTKIEFYNLDKA
FT                   IEKGDLDVLKAVLEHPTIEVNSYTISTAEETHNLEIIELVKNYSAVNTITSEETTIDTA
FT                   LTVVEEVPALGEGIEGA"
FT   repeat_region   367506..367602
FT                   /note="RPE-7 Full"
FT   repeat_region   complement(367681..367705)
FT                   /note="RR-2 Full"
FT   repeat_region   367707..367806
FT                   /note="RPE-4 Full"
FT   gene            complement(367899..368255)
FT                   /gene="rnpA"
FT                   /locus_tag="RF_0347"
FT                   /note="RF0347"
FT   CDS_pept        complement(367899..368255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="RF_0347"
FT                   /product="Ribonuclease P"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61198"
FT                   /db_xref="GOA:Q4UML0"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UML0"
FT                   /protein_id="AAY61198.1"
FT                   /translation="MSITSLKNQKEFELINKLGKKFHERYFILVIAKKLPKIFLESKYN
FT                   TFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSDSKLKAIKFAMIIIPRKGFEEINFS
FT                   HLNCELSKIILRNI"
FT   gene            complement(368275..368409)
FT                   /gene="rpmH"
FT                   /locus_tag="RF_0348"
FT                   /note="RF0348"
FT   CDS_pept        complement(368275..368409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="RF_0348"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61199"
FT                   /db_xref="GOA:Q4UMK9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMK9"
FT                   /protein_id="AAY61199.1"
FT                   /translation="MKRTFQPSNLVRKRRHGFRSRMATPTGRAILRKRRAKGRHKLSA"
FT   repeat_region   complement(368455..368522)
FT                   /note="RPE-7 Full"
FT   gene            complement(368562..368915)
FT                   /gene="rplT"
FT                   /locus_tag="RF_0349"
FT                   /note="RF0349"
FT   CDS_pept        complement(368562..368915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="RF_0349"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61200"
FT                   /db_xref="GOA:Q4UMK8"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMK8"
FT                   /protein_id="AAY61200.1"
FT                   /translation="MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQY
FT                   AYRDRRNRKRDFRGLWIQRINAAVREHGLVYSQFMGALKKAEIDIDRKVLAELAVNNSD
FT                   GFASIIEQAKAHI"
FT   gene            complement(368936..369142)
FT                   /gene="rpmI"
FT                   /locus_tag="RF_0350"
FT                   /note="RF0350"
FT   CDS_pept        complement(368936..369142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="RF_0350"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61201"
FT                   /db_xref="GOA:Q4UMK7"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMK7"
FT                   /protein_id="AAY61201.1"
FT                   /translation="MPKLKTKSAVKKRFKLTASGKVIASQAGKKHFMRRRTKAQIRNLR
FT                   GTTILCPQDGYNIKKYFLPYGIN"
FT   gene            369344..370021
FT                   /gene="nrdG"
FT                   /locus_tag="RF_0351"
FT                   /note="RF0351"
FT   CDS_pept        369344..370021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="RF_0351"
FT                   /product="Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61202"
FT                   /db_xref="GOA:Q4UMK6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMK6"
FT                   /protein_id="AAY61202.1"
FT                   /translation="MFGQNPKRSILNGDGTKLEVQSIFKTIQGEGIFVGCPAIFIRLGG
FT                   CNLACNFCDTEFEDFKLVDIAEILNKVESLALNSKNEKSINLVVITGGEPMRQPIELLC
FT                   QKLLDQDFKIQIETNGTLYRSLPNEVSIICSPKAGKNGYSKIREDLLPKISAVKFIIAK
FT                   NILEYSLIPEVGQTSYNIPVFVQPMDQNDQSLNDENNELAVKLALESGARLSLQTHKFL
FT                   GIE"
FT   repeat_region   complement(370082..370183)
FT                   /note="RPE-4 Full"
FT   repeat_region   complement(370202..370338)
FT                   /note="RPE-6 Full"
FT   gene            370434..371045
FT                   /gene="rplY"
FT                   /locus_tag="RF_0352"
FT                   /note="RF0352"
FT   CDS_pept        370434..371045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="RF_0352"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61203"
FT                   /db_xref="GOA:Q4UMK5"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMK5"
FT                   /protein_id="AAY61203.1"
FT                   /translation="MSEILELEAKSRTEFGTGASRALRREGRVPAIIYGAGKTPVSISL
FT                   EEKEITKYYRKPAFISQLINLTIDKKKYKVLPKAVELHPVTDIVRHVDFVFLEEKTQKM
FT                   EVPVVYEGKERALGVKRGGYFNIVKRRVTLLCDVNNIPRNVTIDVTNMPIATSLKSSKI
FT                   ELPKGCSFTTKKEFVLATIIGRRGAKTEAEGEQQAAEAGK"
FT   repeat_region   371138..371216
FT                   /note="RPE-7 Full"
FT   gene            371329..371886
FT                   /gene="pth"
FT                   /locus_tag="RF_0353"
FT                   /note="RF0353"
FT   CDS_pept        371329..371886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="RF_0353"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61204"
FT                   /db_xref="GOA:Q4UMK4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMK4"
FT                   /protein_id="AAY61204.1"
FT                   /translation="MILVIGLGNPGKEYQYTRHNIGFIAIEKIANQYNSSFSIKKKFNC
FT                   EIAETISDGQKIIFIKPTTYMNLSGKSVISVKTYYNIQSAKIFVIHDDIDLETGRIKFK
FT                   TGGGNGGHNGLKSIDGVIGNNYNRIRVGVGRPQNNQDVADYVLNNFLKSEYETALQAID
FT                   RIANNFDLILENKLEEFKNKIV"
FT   repeat_region   371914..371983
FT                   /note="RPE-7 Full"
FT   gene            372019..372447
FT                   /locus_tag="RF_0354"
FT                   /note="RF0354"
FT   CDS_pept        372019..372447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0354"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61205"
FT                   /db_xref="GOA:Q4UMK3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMK3"
FT                   /protein_id="AAY61205.1"
FT                   /translation="MTQDFEIVYAEEMDKTHRTIIIEALNKDAREKKGLVGDIESFSFS
FT                   CLDQDKNFVAGISGMSSWGGFYIDSLFVNENIRNQNYGTLLMQKAEDLARERDCNFIHL
FT                   VTMDFQAKPFYEKLGYKIEFAMHGYEKDSIMYYLRKDL"
FT   gene            372444..373541
FT                   /gene="ychF"
FT                   /locus_tag="RF_0355"
FT                   /note="RF0355"
FT   CDS_pept        372444..373541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="RF_0355"
FT                   /product="GTP-binding protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61206"
FT                   /db_xref="GOA:Q4UMK2"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMK2"
FT                   /protein_id="AAY61206.1"
FT                   /translation="MTLKLGIVGLPNVGKSTLFNALTASQLADAANYPFCTIEPNSSKV
FT                   LVPDERLQRLANLAGSGKIIPSYIEFVDIAGLVKGASKGEGLGNKFLSHIREVDAILHV
FT                   LRCFEDEDITHVHNKVDPIHDLEVIETELILADIESVEKRLATSEKRLKSGDKTMAEQI
FT                   ELLKEVYKVLADGKPARVLNEALGADNLKQLQLITSKPVLYICNVLEKDAAIGNEFTKL
FT                   VAERAKKENAKSVVISSKIEAEIALLESMEEKEEFLKFIGLEETGLSKVIKEGYNLLNL
FT                   KSFFTIGPKEAHSWTFKDGTLAPSAAGIIHTDFEKGFIRAEVIGYEDYINLGSEAKAKE
FT                   VGKMRLEGKEYKMQDGDIVHFRFNV"
FT   repeat_region   373598..373677
FT                   /note="RPE-7 Full"
FT   gene            373713..373967
FT                   /locus_tag="RF_0356"
FT                   /note="RF0356"
FT   CDS_pept        373713..373967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0356"
FT                   /product="unknown"
FT                   /note="Similar to NT (nucleotidyltransferase) domain and
FT                   HEPN (higher eukarytoes and prokaryotes nucleotide-binding)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61207"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMK1"
FT                   /protein_id="AAY61207.1"
FT                   /translation="MKTILPDRSLKIQARLNFIVSQILDIAQDKIAMIILYGSFARGDW
FT                   VRDLPNGYHSDTDILIILKKSKYKGHATLRLKDNIYKRF"
FT   gene            374148..374489
FT                   /locus_tag="RF_0357"
FT                   /note="RF0357"
FT   CDS_pept        374148..374489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0357"
FT                   /product="unknown"
FT                   /note="Similar to NT (nucleotidyltransferase) domain and
FT                   HEPN (higher eukarytoes and prokaryotes nucleotide-binding)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61208"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMK0"
FT                   /protein_id="AAY61208.1"
FT                   /translation="MPWSEMKEIAKDYYEEWFRSGCGFLIDCKYPLERGELNKSAFYLH
FT                   QATESFYSSILLVFSNYKPKLHDIEELGGRAANYNSELWEVFPQANEEQKECFELLKKA
FT                   YVDARYDKN"
FT   repeat_region   complement(374643..374738)
FT                   /note="RPE-7 Full"
FT   gene            374871..376088
FT                   /gene="bcr1"
FT                   /locus_tag="RF_0358"
FT                   /note="RF0358"
FT   CDS_pept        374871..376088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcr1"
FT                   /locus_tag="RF_0358"
FT                   /product="Bicyclomycin resistance protein"
FT                   /note="MFS type drug exporter"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61209"
FT                   /db_xref="GOA:Q4UMJ9"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMJ9"
FT                   /protein_id="AAY61209.1"
FT                   /translation="MKIIAKIPAWMLLCLFILSPTTETIYTSGLPSLTKYFGIDGGITQ
FT                   TTSTLYFLGFALGILTLGRLSDIYGRRPIALLGLFIYVISSIISIFAVNIEMLMIARFV
FT                   QAFGVSVGSVIGQAMARDSYQGSELSYVYASLSPWLLFIPSLGSSIGGYIIEYSSWHYV
FT                   FVFFSLTGTILLALYYKVLPETNSYIDFSQSSKYFEVLQVIIKDKILWLYAFIIGAFNG
FT                   IYYGFFIEAPFIFIDKMKVSSSFYGKLAFLLSFAAIFGGFLGGYLIKKRHVHDKKVMGL
FT                   GFIFSLCGCILFAVNAFILEVVSASHSLAIAMIFVPMMIHMVGHNLLIPMTLRYALVDY
FT                   AKVTGTAGSIFGAIYYVVIAAVTYLVSKIHSETISNFALLCFVLSISSAISFYCIWVLY
FT                   KKKHKL"
FT   repeat_region   complement(376101..376238)
FT                   /note="RPE-8 Full"
FT   gene            376272..377855
FT                   /locus_tag="RF_0359"
FT                   /note="RF0359"
FT   CDS_pept        376272..377855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0359"
FT                   /product="Site-specific recombinases"
FT                   /note="Cassette chromosome recombinase B"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61210"
FT                   /db_xref="GOA:Q4UMJ8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMJ8"
FT                   /protein_id="AAY61210.1"
FT                   /translation="MQKRKIAAKTIIISRVSTKRQQQSGYSLTVQTLDSKEYCTDNNLD
FT                   ILKIYEFAESATTGKRKKFMEAINFAASQKEIVAVVADKIARLQRSFNELEMLEKFIND
FT                   EKIELHFCLDKVVIHKYSMSHERMKWNAGIIAAKYCADYARDNMNCSIKHKLHHGEWIS
FT                   IPPVGYLHNANTTKKGRDRIFIDPNRAPLIKRIFELYAKGIYTLPEILEKTKEWGLTNL
FT                   RGNKGYLCTTYLLQIIQNPFYYGVMYYKKGDKYYPHLYEPIISKELFDKCAIVLKEGNK
FT                   FKESNKDYIFRGLIKCANTGKVATSDTKQKTYANGNVGVWNYLRIWDVDNPKKSIYIPE
FT                   KKVLDDIESVLISMQLEPKFLEKVINYIKNSIDIEQEYYKKRKQELEVESAEFKMRIDR
FT                   IKDLFSDNTFSREEYEWKLLEYTQKYQEIKNEIEMCNKADDSTKLISLVKIASSAYQTF
FT                   IDLIAEEKRKLINLIFFDLKHDAEKLHYKLRPPFGNFIDLSKRKWKDIMYDLLTTTNHR
FT                   TQINDTFFYI"
FT   gene            complement(377964..379613)
FT                   /gene="pat1"
FT                   /locus_tag="RF_0360"
FT                   /note="RF0360"
FT   CDS_pept        complement(377964..379613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pat1"
FT                   /locus_tag="RF_0360"
FT                   /product="Patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61211"
FT                   /db_xref="GOA:Q4UMJ7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMJ7"
FT                   /protein_id="AAY61211.1"
FT                   /translation="MAEKIDKRAFPKFDPRKEDKFLEDSSPQTKAYINIHEAGGLESVH
FT                   KLPPEVEREINSNIKTNRVLALSGGGIKGISELMALIEIEERTGKSITELFPIISGTSV
FT                   GGLIAALLTIPKEPGSKEAKYSAREALEIFKSSANDIFPDTFLGSVKQLFTHKYSQKPL
FT                   KELLEKYLGDNRMDNTTSRLVIPVNDLTTNGGELEIFDSFHGYSPHVRVKDVLLATTAA
FT                   PTYFKPIMDKAAVQGHEYASGTPYTYADGGLDANRPANEVLKLLKKGYIHKEQSHIREE
FT                   KTLTREEQKEILDNTMVCAFNFSNDIEPTSSIPKIGFDGVIGWLVKGKLVSRLMNNMEN
FT                   SSTIEVKNDLSGEDEFFEIGLPITKETESLDDASPKNIEKLEEIGRKYVAENSEQIQRL
FT                   CDTLIDNLNKEQAANQPVDLIDEGFEEEEDIANNEDAVNTPIAQALDSKDIKDIEPGKE
FT                   ELLAGIKEFFNPFIEKNPEAKADIENFLHEIKNWTLEEIENGIVSFKEASLKWQAEQNS
FT                   LDVFSSCSMEALKEEMDLEGIDDEVSNHEILA"
FT   repeat_region   complement(379431..379594)
FT                   /note="RPE-1 Full"
FT   gene            379803..380123
FT                   /locus_tag="RF_0361"
FT                   /note="RF0361"
FT   CDS_pept        379803..380123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0361"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61212"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMJ6"
FT                   /protein_id="AAY61212.1"
FT                   /translation="MLSNPSNIDPKLLAKEVNTMMPLVEKDLADVEDTITYGKEQLFKF
FT                   VKDKKIMEALAFMYCFEGNTGQTLDIKELCTTNDLLYRDDFSTLTETLDTLTPLIGIFF
FT                   SE"
FT   gene            380508..381962
FT                   /locus_tag="RF_0362"
FT                   /note="RF0362"
FT   CDS_pept        380508..381962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0362"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61213"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMJ5"
FT                   /protein_id="AAY61213.1"
FT                   /translation="MHCVFYTNYPIPKIFTLAEGITAQHAKKVLLLELQSSNINLKGIS
FT                   NNPLNFTIHNSKGLLAFAEMIGRNNKNQLKHRILEEVNSDLSTICKISNTKEETFTINH
FT                   IVHYKTGNVQTDVPGLGKYDEILSKFEQKPEYKHAIIKRIFEVVHAKESTQNIEELPRK
FT                   LNYFAEKLTHLLFVAETHRNNATLFTAPMFLELIDKNSIFLLYKEFFPMSAEHTVAQTR
FT                   GILKNYKYMLPNSCPIDYDTTNVQNGNLLLIKEGNILIEWLSKKLNNYKLANIARIFDI
FT                   LASMQFYKNMDNVKINDIKSFLEKVHELENYPTDLLDSLNQNLTALILKVNNIGERNLK
FT                   LTKTKLLEKKDFSRDLKNLIEITYLEFTESLKNIEGFLAQKQASLKKEIKKILPEILQI
FT                   LCDKIKEWYDIDTPEYAKDVLKDITLKFNQTISPRKRLKLSFSKKVDMYKENDDDSNQT
FT                   VETTSIDDSMKKYYELIGEHTNTICD"
FT   gene            complement(381949..382596)
FT                   /locus_tag="RF_0363"
FT                   /note="RF0363"
FT   CDS_pept        complement(381949..382596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0363"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61214"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMJ4"
FT                   /protein_id="AAY61214.1"
FT                   /translation="MDSCFCRNDINSNVTKPKCHKNDIDIYQMPSKNNSVKEIFSRLSG
FT                   KYRINRIIDNYGYGEGIAYFLQLNSQSFRQDKFKSKPAERTKVREQRLDSKNLLVSSFV
FT                   NDAVPESLNELIYKEELQIHYNDYTHKILANKEYKYILENNNIVKYFAKAENSLFHRLD
FT                   FIDNSRATGSHLCGSDEYNATYIFLNPDSFTLNYQVLGPQKDYNINTVFNRI"
FT   repeat_region   complement(382283..382398)
FT                   /note="RPE-3 Full"
FT   repeat_region   382568..382673
FT                   /note="RPE-6 Full"
FT   gene            complement(382683..384074)
FT                   /gene="dnaA"
FT                   /locus_tag="RF_0364"
FT                   /note="RF0364"
FT   CDS_pept        complement(382683..384074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RF_0364"
FT                   /product="Chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61215"
FT                   /db_xref="GOA:Q4UMJ3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMJ3"
FT                   /protein_id="AAY61215.1"
FT                   /translation="MSTNQIILTDQGDNYVNVWSHVAQDLYNHYGETLYNSWFSKVNFI
FT                   ESSLNTVILCAPTNFVRDWIKSKYSMVILQLFQHYNNTIKSIEIITKELPGTTQTVIEL
FT                   PTKTFADIGSSELNSENIFSTLDVRFTFDNFVVGAPNELAYAAARAVAESSGAVSESNP
FT                   LFLYGGVGLGKTHLMHAIGWYIKQNNPSRKVIYMSAEKFMYQFVKALRNKEVISFKEKF
FT                   RSVDVLMIDDIQFICGKDSTQEEFFHTFNTLIDNNRQMVISCDRSPSDLDNIEDRIKSR
FT                   LGWGLVADVHSTTYELRLGILESKIEQMNVKIPKDVIDFLASKIVSNVRELEGALNKVI
FT                   AHSNFTLKEITLENTQNILRDLLRSNERIITVEDIQKKVASRYNIKLSDMSSSRRLREV
FT                   ARPRQIAMYLSKALTPKSLADIGKKFGKKDHTTVMHAIKKVEELLENDIELREEINLLM
FT                   KILQN"
FT   gene            complement(384075..384446)
FT                   /gene="pspE"
FT                   /locus_tag="RF_0365"
FT                   /note="RF0365"
FT   CDS_pept        complement(384075..384446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspE"
FT                   /locus_tag="RF_0365"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61216"
FT                   /db_xref="GOA:Q4UMJ2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMJ2"
FT                   /protein_id="AAY61216.1"
FT                   /translation="MSVQNICSTKAYDILISNDNAFLVDVRTKEEWQQVGIPHLDNKNK
FT                   LVFLSWQLNKDFEDNFLSIIKDKIDAAIFFLCRSGYRSFIAANFIANMGYKNCYNISDG
FT                   FEGNNQDKGWKQNNLPWQF"
FT   repeat_region   complement(384489..384560)
FT                   /note="RPE-7 Full"
FT   gene            384688..384951
FT                   /locus_tag="RF_0366"
FT                   /note="RF0366"
FT   CDS_pept        384688..384951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0366"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61217"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMJ1"
FT                   /protein_id="AAY61217.1"
FT                   /translation="MNKLNKNSLQKKLFYRSKNRGCKEMDYILGSFAEKYLSLMDEKKL
FT                   GSYSLILDQNDNDLYNWINNKSSAPSYLDAEIIDKLRKIAKI"
FT   gene            384963..388391
FT                   /gene="mfd"
FT                   /locus_tag="RF_0367"
FT                   /note="RF0367"
FT   CDS_pept        384963..388391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="RF_0367"
FT                   /product="Transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61218"
FT                   /db_xref="GOA:Q4UMJ0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMJ0"
FT                   /protein_id="AAY61218.1"
FT                   /translation="MLQQKFPATAKSFFATHNFTKNLKQDFILSSSNEDEALQLYKQAL
FT                   FFSSNENIYYFPSYDTIPYDHTSPNANILSRRAEILTKLTTNNSNGKLLITYAANLLNK
FT                   LPPKDFFSKYFLKLSPKMKFTTDELAMFLVENSFTRNASSIDVGEFAVRGEIIDIILPG
FT                   PKAYRINFSWDYIESIKEFDIDTQISTKSCSELVISPANEIVLNSETNGNFKNNYLRNF
FT                   GVNHTDNPLYEAVISGRKFAGYEQLLPLFYNSCSSLVDYLNDPIFIFDNLSKQAILEFE
FT                   HSYNDFYSARSEVNKLKFNSFYPTLSPTDLYFTASEITELLEQKNNIFISYENSEQATL
FT                   IENISSASFIEKKTVFDKLFEIIKAHSSKKIVIGAASLSGLERIKSITQNYEYKYNEIN
FT                   KLDEAKASVINVGIIPLNQSFYTKEYLFITASELLEEKSSSTNTNKKLKNILLELDNLA
FT                   EGEFVVHKDHGIGQFLKLEALEIKGKLHDFLKILYAGNDKLYIPVENIEVIKKYGNDNA
FT                   ELDKLGSSSWQRSKAKLKNRIKEIALHLIQIAAKRKLNSSASVEFDLEEYDKFCANFPF
FT                   SETEDQLTAINDIKEDLRNGMLMDRLICGDVGFGKTEVAMRAVFMVAKSLNEHLPQVAV
FT                   VVPTTILCSQHFSRFIERFKGFGLNIKQLSSVISAKEAKIIRSELESGKINIIIGTHSL
FT                   LHKNTKFFNLKLLIIDEEQHFGVGQKEFLKSLKSSSHVLAMSATPIPRTLQMSMTGLKE
FT                   LSIIATPPLNRLEVRTMVMPFDPVIIRDALLREHFRGGRSFYVVPRIKDIEDIEKQLKQ
FT                   IVPELSYKIAHGKMTPSKIDEVMSEFYAGKFDILVSTTIIESGIDIAEANTMVIHKADM
FT                   LGLSQLYQLRGRIGRGKVRGYAYLTVASHKKMTSHSLRRLEIIQNSCALGSGFTIASHD
FT                   MDLRGFGNLIGEEQSGQIKEVGTELYQEMLEEQIAIFKDEPIVSEQLFIPTINLGLSVF
FT                   IPDNYISDSALKLGLYRRIGNLSNEIEVEKFKDEMIDRFGSLPIEFNNLLDIVKIKLLC
FT                   FKLNIENLDSGDNGFVIKFYKNADMTDKILKFVSTYSNQAKIKPDNKLVYIKKLVDKNI
FT                   IVEVNQLLWKLGGCRLDVIPNTSLRGAKRRGNLIK"
FT   repeat_region   388371..388440
FT                   /note="RPE-7 Full"
FT   gene            388467..390059
FT                   /gene="murE"
FT                   /locus_tag="RF_0368"
FT                   /note="RF0368"
FT   CDS_pept        388467..390059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="RF_0368"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61219"
FT                   /db_xref="GOA:Q4UMI9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMI9"
FT                   /protein_id="AAY61219.1"
FT                   /translation="MPYNLKQLFQKHNVKGLSINSKTVKENDIFFAIKGQNVDGNDFIN
FT                   EVLNQAVALVITDNKKNTIIDDKVIYVEDVQVALYEAIEIFYPKKPKNLIAVTGTNGKS
FT                   SVVSYIAQTYSLLGKKAASIGTIGVEIFGCDNLINDVPELTTLDYLSFRKIAHNLAENN
FT                   IEYLAFEASSHGLNQARLGEIKVNTACFTSFSQDHLDYHHTKENYLLAKLKLFTRHLFK
FT                   PAYREEFKGDTEHSTTAYILVREDASTGSTSKLLLEAKFGKMSTEYLLQGGLAILNSDI
FT                   AEIEFVKDYLRNHNIKFITVGKKGDVQITKINGSLKAQNINFIFNNRECSFNTSIIGSF
FT                   QASNLLIAALSIHYIGFDFNKIIEILTQVKPVKGRMERIGNTNIFVDYSHTPDALEKAL
FT                   TELKNVKLRDSRLNVVFGCGGNRDKTKRSLMGQIAARLADNVIITDDNPRHEDPKLIRA
FT                   EIISGIEKADYTEIANREEAIKYGINNLKQDDILLIAGKGHENYQIIGDKKLPFDDAEI
FT                   VRKLMSLRGKAKP"
FT   repeat_region   389118..389261
FT                   /note="RPE-1 Full"
FT   repeat_region   complement(390032..390096)
FT                   /note="RPE-7 Full"
FT   gene            390179..391528
FT                   /gene="murF"
FT                   /locus_tag="RF_0369"
FT                   /note="RF0369"
FT   CDS_pept        390179..391528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="RF_0369"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61220"
FT                   /db_xref="GOA:Q4UMI8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMI8"
FT                   /protein_id="AAY61220.1"
FT                   /translation="MIWNSETLSKALAITISNSINCNEVQFNSKDVKKGDLFIVLQGNR
FT                   DGHDYVLDAIDKGAAAVIVSKQVEINDKDKIILVDDCFETLQKMALYKRENSKAKFIAI
FT                   TGSVGKTSTKEALKILLQYDSLVFASRGNFNNRLGLLINLASMADDTEYAIFELGMNHK
FT                   GEIRELVQILKPNIAMITNISEAHLEFFNSLEEIAEAKCEIFENFSKNDIAVINADINC
FT                   YNKIVSILKNLSINRVYNFGISHNTPAQLVLYENLGEQVHLKYKINNKSLEITIPFIPR
FT                   HFAENYTAILLIIDILGKDIEIAANHLANIPPNKGRGEIINIQNSRIICDYYNASPQSM
FT                   KAALEYLKQVPAENKTAIIGDMLELGENSKRLHEELVPYILDAGCSKVYLVGVNTKYIY
FT                   DLLPPKIVKKYFKNVDELITHITDLFESNELILIKGSRGIKLDKIVDYYK"
FT   repeat_region   complement(391571..391643)
FT                   /note="RPE-7 Full"
FT   gene            391722..392807
FT                   /gene="mraY1"
FT                   /locus_tag="RF_0370"
FT                   /note="RF0370"
FT   CDS_pept        391722..392807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY1"
FT                   /locus_tag="RF_0370"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61221"
FT                   /db_xref="GOA:Q4UMI7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMI7"
FT                   /protein_id="AAY61221.1"
FT                   /translation="MLYNLLLPHIHNSHIANLFHYITFRSGLAIIITLSLSFITGPILI
FT                   KFLRSLQKNGQPIRSDGPESHQTKAGTPTMGGIMIILSSCLSTLLLADLTNKYIWITLF
FT                   GFISFGIIGFMDDYAKVTKNNHYGVRGKSKLLLQGIISLIICILLEYLDKNPSHLLNVP
FT                   FFKNLSLDLGYFYIVFAIFVIVGSSNAVNLTDGLDGLATVPIAFTAGSFALISYLVGNL
FT                   IYSNYLQLTYIPNTGELTVLCAGLVGSCLGFLWFNAQPAEVFMGDTGSLSLGGVLGIIS
FT                   VITKHEIVLAIVGGLFVIETASVILQVYYFKATKGKRIFKMAPLHHHFEKHGWAESKVV
FT                   IRFWIISVIFALIGLSSLKLR"
FT   repeat_region   complement(392812..392936)
FT                   /note="RPE-5 Full"
FT   gene            393024..394613
FT                   /gene="rickA"
FT                   /locus_tag="RF_0371"
FT                   /note="RF0371"
FT   CDS_pept        393024..394613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rickA"
FT                   /locus_tag="RF_0371"
FT                   /product="Actin polymerization protein RickA"
FT                   /note="Activating the Arp2/3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61222"
FT                   /db_xref="GOA:Q4UMI6"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMI6"
FT                   /protein_id="AAY61222.1"
FT                   /translation="MYGVAKEIDINKLLAQENNALNTILSQVNELCEQNKKLQGLIEIQ
FT                   NETKELEKEHNRSLPWFKRLVKTVSNVKYIFVKSEEQLTNEAIKYNNKILKDIDNKIYN
FT                   IAEKSAPLKQELQEEIEKNFKDLTKKDLSKEQRERLSEVYFSYKSKPERFSALNMTNPL
FT                   QFIKAEELEKQYNSLNATKQNIQNLISENSNIKELKEIQKQVAEIREEIPYTFFEKLNN
FT                   IWQNVKNVFVNNSEQVLAKNKESNTRAIRKIDEQLYKTKHKFEELIENKERNINDIIAK
FT                   LPDNEELQKIVSNLANHMTSKKEPILTTSSIAKPLENNVTPPPPLTKNNIPPPPPPPPL
FT                   SKNNILPPPPPPMPTMAPAQTETLSKPVGVTTTVKKLENQPRPSIDTSDLMREIAGPKN
FT                   LRKVEKTDVKTQDSRDLLLQSIRGEHKLRKVEFDPNTGKPVAHSHSKPAQNVSKPNGVA
FT                   SILARRVAMEMSDSSSSSGSESDSGNWSDASVNSNKPKALKTRGERDAKTTTHAQKILS
FT                   NRSSQKPSFVRS"
FT   repeat_region   complement(394721..394848)
FT                   /note="RPE-6 Full"
FT   gene            complement(394865..395455)
FT                   /locus_tag="RF_0372"
FT                   /note="RF0372"
FT   CDS_pept        complement(394865..395455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0372"
FT                   /product="Tryptophan repressor binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61223"
FT                   /db_xref="GOA:Q4UMI5"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMI5"
FT                   /protein_id="AAY61223.1"
FT                   /translation="MENKMVKVAIVYYSGYGHTAKVAEELHKSVKEAGANVSIIPINKD
FT                   KPDNIDWDLLDNADAIVFGVPTYMGSLAGPFKTFMDSTSAKWAEQKWKDKITAAFTNSA
FT                   SYSGDKLCSIQQLFHFAMQHCMIWVGQAEAAPNFADHEMPDPDKINRLGSWSGLMTQSN
FT                   HKSSPDITPTVGDLKTANLFGKRIVEVTKKFKG"
FT   repeat_region   395500..395577
FT                   /note="RPE-7 Full"
FT   gene            complement(395612..396247)
FT                   /gene="scoB"
FT                   /locus_tag="RF_0373"
FT                   /note="RF0373"
FT   CDS_pept        complement(395612..396247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scoB"
FT                   /locus_tag="RF_0373"
FT                   /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase
FT                   subunit B"
FT                   /EC_number="2.8.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61224"
FT                   /db_xref="GOA:Q4UMI4"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMI4"
FT                   /protein_id="AAY61224.1"
FT                   /translation="MAWSKEEIYQITAEELKDGLYVNLGIGMPTHVANYIPKGVNVIFQ
FT                   SENGMLGMGPFPYKGEEDPDLINAGKQTITAIPESSYFDSSFSFGMIRGSHVDLTILGA
FT                   MQVSQKGDLANWTIPGKMVKGMGGAMDLVANTKRVVIIMEHNAKDGGAKLLKECSFPLT
FT                   GKKVVNRIITDLGIFDIDKDEMILVRKADDVTIEEIKSKTEAEFIVGL"
FT   gene            complement(396251..396949)
FT                   /gene="scoA"
FT                   /locus_tag="RF_0374"
FT                   /note="RF0374"
FT   CDS_pept        complement(396251..396949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scoA"
FT                   /locus_tag="RF_0374"
FT                   /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61225"
FT                   /db_xref="GOA:Q4UMI3"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMI3"
FT                   /protein_id="AAY61225.1"
FT                   /translation="MNKIYPSAEAALEGLLYDGMTIMSGGFGLCGIPENLINALLNSNV
FT                   QNLTIISNNCGVDNFGLGLLLQTKQIKKMISSYVGENKIFEQQYLDKVLELELNPQGTL
FT                   AERIRAGCMGIPAFYTKTGIGTIVEEGKETKEFNGEKYIMETALQADLAIIKGFKADKS
FT                   GNVIYNKTARNFNAAMAGAAKVTVCEVEEIVEVGELDPNNIHTPNIFIQRLIIGEKYEK
FT                   RIEQLTVREK"
FT   gene            397107..397949
FT                   /locus_tag="RF_0375"
FT                   /note="RF0375"
FT   CDS_pept        397107..397949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0375"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61226"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMI2"
FT                   /protein_id="AAY61226.1"
FT                   /translation="MKLNKLNLTIAACLLYSSSVLATASNIDDDMTIQENSKKNYSYVI
FT                   TYDKDMSSRTSSDAAMSLIEGYRQLDDAMFADSDNIAMKILSYITRFTATSWIMVGNHE
FT                   IGGHGARAREFDLKVTKYEVDPFEGTTYFKTKDFNSLQIHKQIAIDTGGIQASYLLSEN
FT                   IKDRYMTINKINPTYGIGYLWTRLDQASYIFSTKFDGKDKDGNDINAYVKAINSIYGKN
FT                   YITKNKIRSYAYLDLFDPFLVYSGYSFVMNTNLNDIPMIELGPVKYYLRLEQYLLHMV"
FT   gene            398123..398311
FT                   /locus_tag="RF_0376"
FT                   /note="RF0376"
FT   CDS_pept        398123..398311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0376"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61227"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMI1"
FT                   /protein_id="AAY61227.1"
FT                   /translation="MLTATPLKESCKQGGLGAVNFELSLNETFKIVGSGGYKTAGFIEG
FT                   MPLKSSAILRAGLKLDL"
FT   repeat_region   398391..398457
FT                   /note="RPE-7 Full"
FT   gene            complement(398471..399109)
FT                   /locus_tag="RF_0377"
FT                   /note="RF0377"
FT   CDS_pept        complement(398471..399109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0377"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61228"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMI0"
FT                   /protein_id="AAY61228.1"
FT                   /translation="MEVNMLTNQQENLDPVLLQNTAKELGSNFQKALDEDNVEDFKKLM
FT                   FEMIDFINMSSIQPNFNIILDEKSLIKIAKLAPITSLAFLTKICLPSEQSHSSIIYKAL
FT                   TDCIQSQEITGTQTFVSLLFRLTGNDIKDDNKYLYEGLKTGNIEIVKNLLSYINLDQEA
FT                   FNIAMEKGRAIKDFICQRDEKLYHGGFFKQYLASETQVDITGDSESHPE"
FT   gene            399211..401334
FT                   /gene="recG"
FT                   /locus_tag="RF_0378"
FT                   /note="RF0378"
FT   CDS_pept        399211..401334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="RF_0378"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61229"
FT                   /db_xref="GOA:Q4UMH9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMH9"
FT                   /protein_id="AAY61229.1"
FT                   /translation="MYMLSILEKFLFAPVKTFINIREDTVSALKRLGIDNIRDLLFYLP
FT                   VSYQNKILSPNLTGVRDGEIIQTEVVIESVNLPKKGNQPLKITASNDTGSLLLVFFHRP
FT                   PPFIFNKLKVGTSHIISGKVQFFDHYLQISHPEFVTNPKLAKEIEPIYSLTYLLSNKQL
FT                   YSYIIKAMDIFEEKCKGLEDKEVKDYLDEVLQSLKMLHSLCHSRPLCHSRVGGNPEKMD
FT                   PAVWPRDDTVAAKKQLAAKELIANQISLLNVRTQIAGKQGNIYPKAAGIQANILNELGF
FT                   ELTSYQKQVIEEIELEQSDKVEMMRLLQGDVGSGKTLVALLTMVNTVEAGFQATLMAPT
FT                   DLLANQHYEFFVKALKNTNIRVGLLTGKILGAARKNIMIQLENGEIDILVGTHALFQEK
FT                   VSFKKLGYIVIDEQHRFGVQQRLNLINKGVNPDVLVMTATPIPRSLALTMFGDMTISKL
FT                   MGKPKNRLPIATNTMSVNKIEHIIEAINKKLVAGERVYWICPLIEQGEKEGPEEDGLLM
FT                   DVMNRFDSIENIYRGYVGIIHGKMKNEQKDQIMKQFKEGEIKILVATTVIEVGIDVPEA
FT                   TLIVIENAEQFGLAQLHQLRGRVGRGSLQSYCILLYNPKRLGKVARGRFEIMKQTNDGF
FT                   YIAEQDLKLRGSGEILGVKQSGEMEFFFADLAKDYDLLLKAHKFAEIGSKGNLNFVNFQ
FT                   IKLFAKSQVSELV"
FT   repeat_region   399837..399871
FT                   /note="RPE-6 Partial"
FT   repeat_region   401403..401499
FT                   /note="RPE-7 Full"
FT   gene            402914..403759
FT                   /locus_tag="RF_0379"
FT                   /note="RF0379"
FT   CDS_pept        402914..403759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0379"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61230"
FT                   /db_xref="GOA:Q4UKV6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UKV6"
FT                   /protein_id="AAY61230.1"
FT                   /translation="MPYKERTKTGLPRKIDKPRYKITNWSQYNDSLRKRGMVSLYFPEG
FT                   DLESLFINAQPYVEGESGRATTYQVPYIQLIYTLYRLFGFGQRQITGYFEDLWRGKGLE
FT                   IPVPSFGHLCDLFSQIPLEVKQFCNKLAGRIKNGEAISLILDSTGLRFNTASNWYATKY
FT                   NKVCKNKPWQKMHISIDPAMNIHNVEITDCHTADIEMLEYLIPGNISADRVIADGAYYS
FT                   IEGVEKLSNRGITPVIPPPRNAKIYGQDNTIWHDKVVRYISKKVTFMHFIKNTVMELGH
FT                   "
FT   gene            403887..404390
FT                   /gene="spoT6"
FT                   /locus_tag="RF_0380"
FT                   /note="RF0380"
FT   CDS_pept        403887..404390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT6"
FT                   /locus_tag="RF_0380"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61231"
FT                   /db_xref="GOA:Q4UMH7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMH7"
FT                   /protein_id="AAY61231.1"
FT                   /translation="MCCSQNRIITSKRSQYIPFRTKPFRTDIIVTSILHDCIEDTLLTK
FT                   EMIVKEFGYKIANQVEDLTRVKNDKKISSAEIVKILYQQKKKELLLIKLFGRLHNIQTV
FT                   GAKIPEKGWKTILETLQSFLTIATYLKVPRVARQLYTHCLNIAANYKKLNVLRVLQDKI
FT                   FISE"
FT   gene            404476..408015
FT                   /gene="spoT13"
FT                   /locus_tag="RF_0381"
FT                   /note="RF0381"
FT   CDS_pept        404476..408015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT13"
FT                   /locus_tag="RF_0381"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases homolog"
FT                   /note="Containing ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61232"
FT                   /db_xref="GOA:Q4UMH6"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMH6"
FT                   /protein_id="AAY61232.1"
FT                   /translation="MLYQNITNNSCINQALELYHKYCYDKTTYPDQIHTITKALQLDSS
FT                   SFTAVLLHENIQHLNLEDYNHFNNNIIYLVDVINKLSTIHYKPYAEQYIHFHELLLTIN
FT                   PKLQETAILTSLVPLLHKVSIFNLEYNNTNAQHISEIITNCYIPYLLSYTAHNDLAYLL
FT                   QDLCFKIQYPEERNRILHYMYWLYPDIDNIIHNIEQQFGNIFRKLNIKASLSYRIKSPY
FT                   SIWIKTLVKDIHITALNDILAFRAIVPNKKACYDVSKLIHLHYNTITSQFVDYIRYPKN
FT                   NGYQSIHLVISGGNKGNIELQIRSTTMHRQTQYGSAHHTYKVNKYYVSRTNNNVSVVLF
FT                   NITLSYSNRILSVYVSIVTITSTINNNLYTDYNTIPSFTQYTQHSTNFVDNDITTCTLS
FT                   RTTTPEYITYYNNNLSLLIKDTNTIPYNFFLNINLNLSNTVEYKLVPLAVVQIPASNLL
FT                   FEHNSVFINITYKPILAECAFPATITYTKRHEDSNIRSIFKLFEHNSVFINITYKPILA
FT                   ECAFPATITYTKRHEDSNIRSIFKPPSPTYNTLLATINDKVVLEQYGQKEFLSTTINTN
FT                   ITQMLPIITLLVDPSELNKRINDISDSNKDQLLRLGLQLGCVESVPLLITHGANPNATN
FT                   CHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQ
FT                   ANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLV
FT                   SLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVE
FT                   SGNLDLVSLLIHNGANVNNAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHF
FT                   AAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNS
FT                   GETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTD
FT                   INTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSL
FT                   LMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFN
FT                   SLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADINLETMLPDDQT
FT                   DSIINLCGDLRIS"
FT   gene            408615..408980
FT                   /locus_tag="RF_0382"
FT                   /note="RF0382"
FT   CDS_pept        408615..408980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0382"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61233"
FT                   /db_xref="GOA:Q4UMH5"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMH5"
FT                   /protein_id="AAY61233.1"
FT                   /translation="MARAYSYDLRVLVIKSIETGKTIKEVSNLFSITIIEWKKLKKCTG
FT                   DVKARSGYHTGHRRIIRDIEGFKKFIALNCDKTTIELANIWNQKISASTISRLLNKLGY
FT                   SYKKNLSSSQKRYWFKE"
FT   gene            409021..409488
FT                   /locus_tag="RF_0383"
FT                   /note="RF0383"
FT   CDS_pept        409021..409488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0383"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61234"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMH4"
FT                   /protein_id="AAY61234.1"
FT                   /translation="MYIDESGIEDNSCREYGWSVIGKRCYGEKVYQHKSRISMIAGLCH
FT                   KEIIAPIIFDGNCNSNIFETYVRDILIKELRHGQIVVMDNINFHKNSEVKRLIESVGCS
FT                   ILFLPTYSPDLNPIEHYWFKIKNEIRKNASKFEQFLDAVYYTLKKVTNLSH"
FT   gene            409542..410249
FT                   /gene="spoT15"
FT                   /locus_tag="RF_0384"
FT                   /note="RF0384"
FT   CDS_pept        409542..410249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT15"
FT                   /locus_tag="RF_0384"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61235"
FT                   /db_xref="GOA:Q4UMH3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMH3"
FT                   /protein_id="AAY61235.1"
FT                   /translation="MKKIEGYQTNFEICIYAKKLLDKVIYLNSVVKVPPVSVLEVKKAI
FT                   YYAKKYHGSQMRQSGEPFYSHPIEVAYMISDYLFRTDVIVTSILHDTIEDTELTKEEVA
FT                   EEFGWKVASQVMDLTRIKENGIKISSAEMVEMLYKEKKHDILLIKLFDRLHNIQTIGAK
FT                   SPEKAKKIITETLISFIVLMPYLGISSLEKHFYRLCLNATHQNRLKENTLFTNNLRKFW
FT                   SYFKHNTEAINII"
FT   gene            complement(410278..410706)
FT                   /locus_tag="RF_0385"
FT                   /note="RF0385"
FT   CDS_pept        complement(410278..410706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0385"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61236"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMH2"
FT                   /protein_id="AAY61236.1"
FT                   /translation="MLVRPRKTDSLMSTYIHRSISINNGIYWSNLEPVNLLNPDSAIDA
FT                   INLGDDTLLLTYNRVINNRKSRNILSVATSYDEGLNWHPITIRNSIYPEGDIEYSNILS
FT                   EEYSYPTIIMSPDNNEIHVIYTFNRINLKHKVFQLLPK"
FT   gene            complement(410918..411367)
FT                   /locus_tag="RF_0386"
FT                   /note="RF0386"
FT   CDS_pept        complement(410918..411367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0386"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61237"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMH1"
FT                   /protein_id="AAY61237.1"
FT                   /translation="MFILETKIEEFILNNSDLKDVHAATIFAFDDKKLITSFFGKTRSE
FT                   SGKSEENNSIWISLGFKSNNHYQWTTPERIVSPQYFRDHHIPLKQDNGIISCGNPVITF
FT                   FNNQLLIFSKIGPYPRTWSGILSRSYDQGLTWQKPELLWYSRTST"
FT   gene            complement(412009..412245)
FT                   /locus_tag="RF_0387"
FT                   /note="RF0387"
FT   CDS_pept        complement(412009..412245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0387"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61238"
FT                   /db_xref="GOA:Q4UMH0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMH0"
FT                   /protein_id="AAY61238.1"
FT                   /translation="MLTIESTNRQIRKIIKNKGVFPDDKSIQKIIFLALTNASKKWTMP
FT                   IKNWAMALNQFAILCDTNLQNWANGEVILTQTS"
FT   gene            complement(412324..413124)
FT                   /locus_tag="RF_0388"
FT                   /note="RF0388"
FT   CDS_pept        complement(412324..413124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0388"
FT                   /product="Transposition helper protein, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61239"
FT                   /db_xref="GOA:Q4UMQ1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ1"
FT                   /protein_id="AAY61239.1"
FT                   /translation="MNLQHQRIEELCHSLNLMQIAENYLDIAQSSSKEDSSYTDFLESI
FT                   LKTELLARQHRSKSILTKMAGFPAIKTLDDFDYDFATGIKHKVLEGLRSLSFVERQENI
FT                   ILLGPSGVGKTHIAIALGYAATQCGIKTKFTTAADLMLILNAGLNQGNLDSIFKRVILP
FT                   YKLLIIDEFGYLPLKPEQANLLFQVIAKRYEKGSIILTSNLPFGQWHNSLAQDSALTAA
FT                   ILDRLLHHSTILNIKGDSFRLKDKKKTGLVPIEIINKQEDNFMT"
FT   gene            complement(413121..413564)
FT                   /locus_tag="RF_0389"
FT                   /note="RF0389"
FT   CDS_pept        complement(413121..413564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0389"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61240"
FT                   /db_xref="GOA:Q4UMQ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ0"
FT                   /protein_id="AAY61240.1"
FT                   /translation="MVLGIHRFNKGMLDFAKHYSFRLKVCRPYRAQTKGKVERFNRYIR
FT                   ESFYNPLVTKLKTSELVLDVDTANSEVLKWLRDTANLRVHRTTGAIPAERLKLERNHLQ
FT                   PLPLDYSGSHPTVLEIMRDKGERFSTVSLQHSLCIYQSILEAL"
FT   gene            complement(413539..414150)
FT                   /locus_tag="RF_0390"
FT                   /note="RF0390"
FT   CDS_pept        complement(413539..414150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0390"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61241"
FT                   /db_xref="GOA:Q4UMP9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMP9"
FT                   /protein_id="AAY61241.1"
FT                   /translation="MIILEQIMEIKILNKHGKSLRSIAREVGVSVNTVRKYLKYDGSPK
FT                   YKDRSELVTKLAPYKDYLSERIKSAHPVSLPGTVLFQEIKELGYTGGITQLRDYLRSIK
FT                   PVAKQEDIIRFETASGKQMQVDWIEFRKGKDPLSAFVATLGFSRASYIEFVNNEKLITL
FT                   IECHKRAFDYFGGVPEEVLYDNMKTVILDRDTYGPWDTPF"
FT   gene            complement(414568..415761)
FT                   /gene="proP"
FT                   /locus_tag="RF_0391"
FT                   /note="RF0391"
FT   CDS_pept        complement(414568..415761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="RF_0391"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61242"
FT                   /db_xref="GOA:Q4UMG6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMG6"
FT                   /protein_id="AAY61242.1"
FT                   /translation="MAVVINELFFPKTDPQVASLLSAAAFCSTYLLRPFAALVLGWIGD
FT                   NIGRKATVIITTFIMAISCFIMATLPTYAEKGIVVSWIMIICRMSQGVSSMGEIVGAEL
FT                   YVTETTKPPVQYTYVGIINIAAQWGGIMALAFGIISITYLFNWRYAFWGGTIIALVGFI
FT                   ARTNLRESTEFIDAKRRIKNTLENFGINDKELSFKEYVEEKINIKTILAYFFLVNSGSA
FT                   CFYLTYIYCASLLKTNFNYTALEIMKNNFCLAIAQLILMITLVLLTKKFHPLKLLKVRA
FT                   IIFLICMPSSIYLLNNITTSSSLSKIQLLLVMTSITTSTAVSILYKNFPIFKRFTFTTL
FT                   IYAFSSIFIYVVTSFGIAYLVNMLGTYGILLIMIPVGVAFYWGVTHFESLEKVRYNY"
FT   gene            415778..416731
FT                   /locus_tag="RF_0392"
FT                   /note="RF0392"
FT   CDS_pept        415778..416731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0392"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61243"
FT                   /db_xref="GOA:Q4UMG5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMG5"
FT                   /protein_id="AAY61243.1"
FT                   /translation="MCKFLKGCIEENITKREITMTQKQNAAMEQAIDLLINNDTDVSIL
FT                   FREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSDAQNSRNGYNTKNLITKNGAVEIE
FT                   VPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLIS
FT                   QITDDIIEDVKLWQSRPLDPVYAIVFFDCLIVKVRQDKRIINKSVYVALGIDLEGRKDI
FT                   LGLWISENEGAEFWLGNFTEMKNRGIQDILIACSDNLNGMSEAIGAVFPKTEHQLCIVH
FT                   QIRNSLRYVSYKDRKELAGDLKPIYTLAQKKKHFPL"
FT   gene            416806..417048
FT                   /locus_tag="RF_0393"
FT                   /note="RF0393"
FT   CDS_pept        416806..417048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0393"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61244"
FT                   /db_xref="GOA:Q4UMG4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMG4"
FT                   /protein_id="AAY61244.1"
FT                   /translation="MIFLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNAVFK
FT                   SLYLAIDYMTKKWSMSIPNWNKAMAHFLIKFDERI"
FT   gene            complement(417071..417208)
FT                   /locus_tag="RF_0394"
FT                   /note="RF0394"
FT   CDS_pept        complement(417071..417208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0394"
FT                   /product="Major facilitator family transporter"
FT                   /note="Small fragment"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61245"
FT                   /db_xref="GOA:Q4UMG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMG3"
FT                   /protein_id="AAY61245.1"
FT                   /translation="MLGYEKEQRSLTRKQKEAIGLICFGTFFEYFDLMLYIHMAVSLPD
FT                   "
FT   repeat_region   complement(417352..417486)
FT                   /note="RPE-1 Full"
FT   gene            complement(417504..418850)
FT                   /locus_tag="RF_0395"
FT                   /note="RF0395"
FT   CDS_pept        complement(417504..418850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0395"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61246"
FT                   /db_xref="GOA:Q4UMG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMG2"
FT                   /protein_id="AAY61246.1"
FT                   /translation="MDDIEVIQRRNLERIISQETVKSKDDLYIIEQERIQKLMNRGTNA
FT                   LKNHEQQPNSEHKAQANSRTSNILNSIKTSKTWSNIKKISNITGKILFNKTTASVLGLI
FT                   ASSIMLATIAPATAPFMFVSAAAMATSIVGKAIIDVVHTRKIRLLTQENKLLVKHRDDL
FT                   SKQQALLKIDPKLKDILKDDLYIHNDPNQTKGKNTQNTKSLFIASVITNGISNIVNVAG
FT                   VSAAIIGGGVAQIISSINIGLQSLKGSKDSVNQIQDRIKLIKELNHNINQEKQKTDMGN
FT                   YKNIQELAEIGYKQAVQTEALTALLQDKNYFKFTDQEKQQRFNQLSEEITLRTALEYAD
FT                   TKKITSQNIIVDILKDINRTHNPFYKQPEQITTHKSVLTKAVENTNTNDHKEYKTIQLK
FT                   KKLELSGTENIVNRIGKQLINNNTISNKNTDTPNNYIKRITKKDLGLIR"
FT   gene            419230..419463
FT                   /locus_tag="RF_0396"
FT                   /note="RF0396"
FT   CDS_pept        419230..419463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0396"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMG1"
FT                   /protein_id="AAY61247.1"
FT                   /translation="MSNTPKLENHYNKLLQDIMLKTLEQNKTVETYLIQEDFSSALDEL
FT                   QKINEKLEEYCKIFSLLEIIKTELSEEDKLYN"
FT   gene            complement(419509..420339)
FT                   /locus_tag="RF_0397"
FT                   /note="RF0397"
FT   CDS_pept        complement(419509..420339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0397"
FT                   /product="MFS type sugar transporter"
FT                   /note="PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61248"
FT                   /db_xref="GOA:Q4UMG0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMG0"
FT                   /protein_id="AAY61248.1"
FT                   /translation="MCASLGLTVALGVATLVTSYSFNWRIAFWVGAGIALIGSAARTTL
FT                   RETPDFVDAKRRIQETIKDSNIIDVAKIKNNPVLQEKVNKKTAIYYFLIQLAQPVWFYF
FT                   AYIHCSNILKDSLHYTAEAVIHQNFTISIVEFFVALALTCLCYKFHPLKILKTQLVIFL
FT                   TFLLFSPLILDNITQGWQILLIQLIVVTFSPSEFPAIPIFHKSFPVFKRFTYASFIYAS
FT                   SRAAMYVISSFGLVYLTERFNNLGLLMIVIPIIIGYSLGISHFKKLEVEAGNYY"
FT   gene            complement(420329..420532)
FT                   /locus_tag="RF_0398"
FT                   /note="RF0398"
FT   CDS_pept        complement(420329..420532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0398"
FT                   /product="MFS type sugar transporter"
FT                   /note="PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61249"
FT                   /db_xref="GOA:Q4UMF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMF9"
FT                   /protein_id="AAY61249.1"
FT                   /translation="MSFSCIVMANLPTYAQVGASTAWIVTICRIVQGMSSMGERVGAEL
FT                   YLTESVGVLKRFPAVAFVGDVC"
FT   gene            complement(420584..420823)
FT                   /locus_tag="RF_0399"
FT                   /note="RF0399"
FT   CDS_pept        complement(420584..420823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0399"
FT                   /product="MFS type sugar transporter"
FT                   /note="PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61250"
FT                   /db_xref="GOA:Q4UMF8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMF8"
FT                   /protein_id="AAY61250.1"
FT                   /translation="MLGYEKKQKNLNREQKQAIGLLSIGTFLEYFDLMLYVHMAVLLNE
FT                   LFFPQYDTHVNRLLAAFSFCSTFIFRPLGALLFG"
FT   gene            complement(420889..421557)
FT                   /locus_tag="RF_0400"
FT                   /note="RF0400"
FT   CDS_pept        complement(420889..421557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0400"
FT                   /product="DnaA-like protein"
FT                   /note="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61251"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJN7"
FT                   /protein_id="AAY61251.1"
FT                   /translation="MQQYIFRFITSNKYHPDEFIVSSSNEQAYNIIKNWQCNFGVNPYK
FT                   FTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFFNEEILEKYNAFIIENIENWQEPALL
FT                   HIFNIINEKQKYLLLTSSNKSRNFTLPDLSSRIKSVLSIALNSPDDELIKILIFKHFSI
FT                   SSVTISGQIIDFLLVNLPREYSKIIEILENINYFALISKRKITTSLVKEVLNKYNHKIL
FT                   "
FT   repeat_region   421614..421753
FT                   /note="RPE-6 Full"
FT   gene            complement(421791..422846)
FT                   /gene="perM"
FT                   /locus_tag="RF_0401"
FT                   /note="RF0401"
FT   CDS_pept        complement(421791..422846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="perM"
FT                   /locus_tag="RF_0401"
FT                   /product="Permease PerM homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61252"
FT                   /db_xref="GOA:Q4UJN6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJN6"
FT                   /protein_id="AAY61252.1"
FT                   /translation="MNRTAIFWLVFLGLFISGFMLISDAVKPFFIAFIISYLLQPAIGF
FT                   IASKFKISNKFASSIIYLIFLSIFFLSLTILVPIIYGQIFTFINNIPKYKNYLQAEILP
FT                   PIMAKIYSIEPDIADKIKNSLSDFINSIFTILGSIANNFWRYTIITINIFVLFLLIPII
FT                   LFYFLRDWAKIIANMKSLLPIKTRPKTLEILSAINNLLSAYIRGQLNICLLLSTYYSIA
FT                   FTVIGIDLALLLGILTGFLVIIPFLGTFISFLLTLIIGYLNFGVTSKLLYIMIIYLVGN
FT                   ICESYILTPKIIGDKIGLHPLWIIFSIFACGSLFGIIGIFFAIPIAGITKILLLNLIKF
FT                   YKSSKFYRTDG"
FT   gene            complement(422858..423397)
FT                   /gene="grpE"
FT                   /locus_tag="RF_0402"
FT                   /note="RF0402"
FT   CDS_pept        complement(422858..423397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="RF_0402"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61253"
FT                   /db_xref="GOA:Q4UJN5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UJN5"
FT                   /protein_id="AAY61253.1"
FT                   /translation="MIDDNIENNEQTINDIAEDIVETANPEITELKAEIEELKDKLIRT
FT                   TAEIDNTRKRLEKARDEAKDYAIATFAKELLNVSDNLSRALAHKPANSDIEVTNIIAGV
FT                   QMTKDELDKIFHKHHIEEIKPEIGSMFDYNLHNAISQIEHPDHAPNSIITLMQSGYKIR
FT                   DRLLRPATVQVVKKSE"
FT   repeat_region   complement(423466..423586)
FT                   /note="RPE-5 Full"
FT   gene            423624..424343
FT                   /gene="rph"
FT                   /locus_tag="RF_0403"
FT                   /note="RF0403"
FT   CDS_pept        423624..424343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="RF_0403"
FT                   /product="Ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61254"
FT                   /db_xref="GOA:Q4UJN4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UJN4"
FT                   /protein_id="AAY61254.1"
FT                   /translation="MRQSGRKSNQLRPISLELSPLINAEGSCLIKIGNTHVMCSATCET
FT                   TVPPFLRGQNQGWVTAEYGMLPGSTSQRIKREAAQGKQGGRTQEIQRLIGRNMRCVIDL
FT                   KKLGERQIIIDCDVINADGGTRTAAITGSYVALHLAIRSLMKKRILKVNPLISQIAAVS
FT                   CGIYKGEAILDLDYLEDSDAEVDSNFVFAGNGNLIEVQGTAEKEPFSEEQFIAMLKLAK
FT                   GGAAELFKLQNQVLLGA"
FT   repeat_region   424442..424516
FT                   /note="RPE-7 Full"
FT   gene            complement(424532..424807)
FT                   /locus_tag="RF_0404"
FT                   /note="RF0404"
FT   CDS_pept        complement(424532..424807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0404"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMF7"
FT                   /protein_id="AAY61255.1"
FT                   /translation="MNDQKYRNITFTKESRIANINISPDKITIGANQRVTFKSLGNIEE
FT                   LILGPHSSVKVIDLNHKVFINNTNRDKIIILSGEDTNFYDNPYASI"
FT   gene            424949..425257
FT                   /locus_tag="RF_0405"
FT                   /note="RF0405"
FT   CDS_pept        424949..425257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0405"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61256"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMF6"
FT                   /protein_id="AAY61256.1"
FT                   /translation="MALRLYYCLICLIIIFYINKVHASAWLLVQGRYRYIVGGNKVNKI
FT                   SKNEKKQREEAVLYLRERVTYLWESLKKVSDQPSLHAKILRQIKRLEQKSRIIILPR"
FT   gene            425322..425858
FT                   /locus_tag="RF_0406"
FT                   /note="RF0406"
FT   CDS_pept        425322..425858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0406"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61257"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMF5"
FT                   /protein_id="AAY61257.1"
FT                   /translation="MYKEDKFLNEKNISTDASIYYKLKLFEDKDFVISAQPKILMSKSK
FT                   KLKEDFLGEVSLLMGMSKNILSVTIFNQNIFSFGHSINNLSSKKMYYNFSTCEGIKFKN
FT                   GIMLTSFTKYHTRQNYGYVYDSSVYEQLGIAKIINFGEENKNSITTQIGYFWDHSLSNK
FT                   KYKISGISFSAWLDV"
FT   gene            425843..427777
FT                   /locus_tag="RF_0407"
FT                   /note="RF0407"
FT   CDS_pept        425843..427777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0407"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61258"
FT                   /db_xref="GOA:Q4UMF4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMF4"
FT                   /protein_id="AAY61258.1"
FT                   /translation="MVRCIDEDVILRIIRDKNLLGKKQITSLKAIIEEAIIDNEIMIDI
FT                   LYENKILPLISNISYIKIYNYSYIQAYVVHGYFIYEDGQGNKITAINDLKILFSHDNFF
FT                   KSIMLIKKYYFYKLLEKNFSHLTSIKAKYALEFKAGSIIAKNINYANKVIIFFAMFIAT
FT                   LIYLPTLFHIVNNISYCLQNILKSLLFVRAASMSFPRKRESSQTYKKQVFYRFILSRIC
FT                   NFCTKIKVILLDSHFRGNDIEECRNDVRPYIYDEASTIQNHKASSQIAQNEKKALPIYT
FT                   ILVPLYKELSKLRSIIKNISLINYPKDKLDVKIIIEDDDYLMIKELALYNLPSYFHVIF
FT                   VPKSLPRTKPKALNYALEYSRGEYLVVYDAEDKPETDQLLKALAMFRNLPSEYVCLQAK
FT                   LNFYNKNENVLTKLFNIEYSLWFEYILKGLSLLKLPTPLGGTSNHFKTDILNKLGGWDA
FT                   YNVTEDAELGIRIYSQNYKVAILDSYTLEEAPNSLGNWLNQRSRWIKGFLQTFFVFKAR
FT                   KDKYRKFTLLQVITIYIFIGLSTYNFWSLPFIIFSIAINKNSIINYLWLINSIFSLLYL
FT                   YSTALYILKNSLKSGKVKFQDIVALVLWGSYFILHTIASYKAVFEIIFCPFKWSKTKHG
FT                   TSLEDFEQE"
FT   repeat_region   complement(426428..426567)
FT                   /note="RPE-6 Full"
FT   gene            427894..428193
FT                   /gene="groES"
FT                   /locus_tag="RF_0408"
FT                   /note="RF0408"
FT   CDS_pept        427894..428193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="RF_0408"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61259"
FT                   /db_xref="GOA:Q4UMF3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMF3"
FT                   /protein_id="AAY61259.1"
FT                   /translation="MEVKMSFKPLHDRIAIKPIEHEEKTKGGIIIPDTAKEKPMQGEIV
FT                   AVGNGIRNKKGEIHPLELKIGDKVLYGKWAGTEIEIKGEKLIVMKETDVFGIIN"
FT   gene            428223..429866
FT                   /gene="groEL"
FT                   /locus_tag="RF_0409"
FT                   /note="RF0409"
FT   CDS_pept        428223..429866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="RF_0409"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61260"
FT                   /db_xref="GOA:Q4UMF2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMF2"
FT                   /protein_id="AAY61260.1"
FT                   /translation="MAKLIKHGSEGREQVLKGVDILADAVKVTLGPKGRNVLIEQSFGS
FT                   PKITKDGVTVAKSIELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNK
FT                   LVAAGYNPMDLKRGMDLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAK
FT                   AMEEVGKEGVITVEEAKNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLF
FT                   EKKLSNLQPMLPILEAVVQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFG
FT                   DRRKAMMEDIAILTKGELITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKN
FT                   IEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDAL
FT                   AATRAAVEEGVVAGGGVTLLHASQTLRNLKVDNKDQQAGIEIVIEALKDPLKQIVENAG
FT                   ENGGVVVGKLLEHKDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITT
FT                   ETLIVDEPSDKEDSIPPMRGGMGGMGGMDF"
FT   repeat_region   complement(430073..430166)
FT                   /note="RPE-7 Full"
FT   repeat_region   430240..430342
FT                   /note="RPE-4 Full"
FT   repeat_region   430649..430780
FT                   /note="RPE-8 Full"
FT   repeat_region   complement(430911..430996)
FT                   /note="RPE-8 Partial"
FT   repeat_region   431126..431179
FT                   /note="RPE-8 Partial"
FT   gene            431261..431665
FT                   /gene="spoT12"
FT                   /locus_tag="RF_0410"
FT                   /note="RF0410"
FT   CDS_pept        431261..431665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT12"
FT                   /locus_tag="RF_0410"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61261"
FT                   /db_xref="GOA:Q4UMF1"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMF1"
FT                   /protein_id="AAY61261.1"
FT                   /translation="MLQRVIKHLNHNLSEHDITAQITGRIKHPISILYKLYRKGIKLEE
FT                   LTDIFAIRIVVIDEEKCYKALKVVHDLYEHEKDKFKNYILNPKPNGYQSLHTIITTEDN
FT                   YKIEIQIRDHKMHYHAESGEAAHWKYKETL"
FT   gene            431595..432923
FT                   /locus_tag="RF_0411"
FT                   /note="RF0411"
FT   CDS_pept        431595..432923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0411"
FT                   /product="Chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61262"
FT                   /db_xref="GOA:Q4UMF0"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMF0"
FT                   /protein_id="AAY61262.1"
FT                   /translation="MIIRCIIMQRAVKLHTGNIKKHYNHNFDKLVLGFSVINGDKGEKE
FT                   AIIKLSADQLGLQKFEMTTVGNWDMLAAYVNCGFPAYAGEDYPNLYTQQKAQGVLGAFP
FT                   NLKKASPEGTKFALSVGGWTMSEAFHEMAKSPAARKIFNDSIVKFIEKFPMYKQIDVDW
FT                   EYPGAAGNSNPHGPEDGGNYTLLVKELRETLNAKGHTDVVIAIAAADPAKLALSNLKDL
FT                   VDAGVTQIHLMTYDLFGGTYGEGKLAHYTNLYSRDGDNKEWSINQSVKYLIEELKIPAK
FT                   CVHIGYAGYSRSAREVEIESVSPLKGTYKVDPQIVGTFENGVTEQNDVYFNYFDPSTGK
FT                   GKNGFILYTDTVANADFLYNPTSKVFMSIDTPRTVKAKAEYAKKHGLGGIFTWTVDQDN
FT                   GALSNAAHEGLGHKCVKQNIDMSTFYFEGETELVGYSSDTIVL"
FT   repeat_region   complement(432956..433049)
FT                   /note="RPE-4 Full"
FT   gene            complement(433091..433627)
FT                   /locus_tag="RF_0412"
FT                   /note="RF0412"
FT   CDS_pept        complement(433091..433627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0412"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61263"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UME9"
FT                   /protein_id="AAY61263.1"
FT                   /translation="MKDCIKKVAFVLSGLFIITGTFIVYRVENADASSAPKKYGAWTLN
FT                   CTLNNEKKQLCFLSQQINNLEKDKEKEILAIYHIGYFNGEQEEQELKIIEIVPSNVQIP
FT                   AGTVINSGDKRISAGKYVNCTVNGCQALAVITKDDLDMILSNDNYLELITADGKQAKIS
FT                   FIKDGLKEGLKALSR"
FT   gene            complement(433624..435015)
FT                   /gene="gltX2"
FT                   /locus_tag="RF_0413"
FT                   /note="RF0413"
FT   CDS_pept        complement(433624..435015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX2"
FT                   /locus_tag="RF_0413"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61264"
FT                   /db_xref="GOA:Q4UME8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UME8"
FT                   /protein_id="AAY61264.1"
FT                   /translation="MTNVITRFAPSPTGFLHIGSARTALFNYLFARHHNGKFLLRIEDT
FT                   DKERSTKEAVEAIFSGLKWLGLDWDGEVIFQSKRNNLYKEAALRLLQEGKAYYCFTSQE
FT                   EIERQRQKALENKQHFIFNSEWRDKDSSTYPTDIKPVIRLKVPREGSITIHDTLQGDVV
FT                   IENSHIDDMVLLRADGTATYMLAVVVDDHDMGITHIIRGDDHLTNAARQIAIYHAFGYE
FT                   VPSMTHIPLIHGADGAKLSKRHGALGVEAYKDMGYLPESLCNYLLRLGWSHGDDEIISM
FT                   TQAIEWFNLDSLGKSPSKLDFAKMNSLNAHYLRMLDNDSLTSKTVEILKQNYKISEKEV
FT                   SYIKQAMPSLLVRSETLLDLAKLARIYLINSPIIYEQEAKEIIENCDKDLIKQVIEGLN
FT                   KIEQFDKESVQNKFKEIATHNGLKLNDIMKPVRALITGMTASPSVFEIAEILGKENILK
FT                   RLKII"
FT   repeat_region   435151..435269
FT                   /note="RPE-6 Full"
FT   repeat_region   435315..435380
FT                   /note="RPE-7 Full"
FT   gene            complement(435355..436089)
FT                   /gene="ubiG"
FT                   /locus_tag="RF_0414"
FT                   /note="RF0414"
FT   CDS_pept        complement(435355..436089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="RF_0414"
FT                   /product="Ubiquinone biosynthesis O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61265"
FT                   /db_xref="GOA:Q4UME7"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UME7"
FT                   /protein_id="AAY61265.1"
FT                   /translation="MSSIDKKELEKFEKISHNWWNKDGEFGILHRINPIRLEYIIEKIT
FT                   SHYNDISKLEILDVGCGGGLIATPLAAQGFNVTAIDALQSNIETASTYAKENGVKVNYL
FT                   QSTIEELQSDKLYDVVICLEVIEHVENVQQFILNLVGHIKPNGMAIISTINRTKKAYVL
FT                   GIIVAEYVLGWVPKNTHDYSKFLKPSEIYEMLTDTDIEIKELKGLVYDPAKNEWKLSND
FT                   IDVNYFMCLGRKTNRHCKEITK"
FT   repeat_region   436109..436192
FT                   /note="RPE-4 Full"
FT   gene            436227..436988
FT                   /gene="znuB"
FT                   /locus_tag="RF_0415"
FT                   /note="RF0415"
FT   CDS_pept        436227..436988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="RF_0415"
FT                   /product="Zinc/manganese ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61266"
FT                   /db_xref="GOA:Q4UME6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UME6"
FT                   /protein_id="AAY61266.1"
FT                   /translation="MTLIILALILISCIFAPLGCIALWKRYIYFGDGLAHSSFLAASIS
FT                   IIAHFPLIYSGIIVAILFSFFVFIFKNNSEKNAVINLISSFMLAVALVISYFTSLQNNI
FT                   VNLLFGDILSVSFNDLIILGVVLITIISFIVYFYNQILLIIINRDIAVIKGLKVNIIEL
FT                   IFLLLLSLSVFSAIKIVGALMVTAVLLIPAMIARFIAYSPSQMIIISILISLFINFCAA
FT                   LSSFYFDLPLTPLFIILGTFIYGLLYLKRLL"
FT   gene            436985..437320
FT                   /locus_tag="RF_0416"
FT                   /note="RF0416"
FT   CDS_pept        436985..437320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0416"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61267"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UME5"
FT                   /protein_id="AAY61267.1"
FT                   /translation="MNKNEFTEYVKELLEPYGSVAVRAMFGGYGIYKGGVMIGIIKSNE
FT                   LYFKSDLSTYEYFQSFGSEPFIYQSKGKLVTLSYWKVLSEIMEDQELLGKWFKLALNAA
FT                   INSQKKK"
FT   repeat_region   complement(437370..437436)
FT                   /note="RPE-7 Full"
FT   gene            complement(437462..440884)
FT                   /gene="aas"
FT                   /locus_tag="RF_0417"
FT                   /note="RF0417"
FT   CDS_pept        complement(437462..440884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="RF_0417"
FT                   /product="2-acylglycerophosphoethanolamine acyltransferase"
FT                   /EC_number="6.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61268"
FT                   /db_xref="GOA:Q4UME4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UME4"
FT                   /protein_id="AAY61268.1"
FT                   /translation="MDTNKLYLFKDRRFLPNFIVQLCGCLNDNILKNALVILITYGITG
FT                   TLSKYNNLLVLIANATFVLPFIIFASIAGQIADKYERASLIKIIKICEIGIIAFAIYGF
FT                   YHNNLLILFCSICLMGIHSTFFGPIKYSVLPDHLNKDELLGANGFVEAGTFIGIFIGTI
FT                   IGSYYTISNNFIIYSLITIAFLGFITSLFSPKSKNANRDIKINFNIIDESINMIKYAKA
FT                   KKHIYLAILGISWFWFIGAAIISQIPLLAKITFKADENVANLFLAVFSLGVGVGSFLCS
FT                   KIFEDEITVKYLFISALGISIFGIDLFFASRISSVNYEPTQLKSILVFLSKRHNWRIVI
FT                   DLFFLAAIGGLYIVPLFAILQHYANPAHRSRIIAVNNLINSIFMVGSTIILSLLFYLNF
FT                   TIPWIILFISLANIIVTIYIYRLIPEVKIIPFKLLRRIFQICFDLMYKVEVKGFENFQK
FT                   AGKKVVVVANHISYLDPPLIATYLREEMTFAISPDIQKIWWIKPFLRMARTLPVDPSNP
FT                   MAIKTLVKEVQKDQKVAIFPEGRISVTGSLMKIYEGPGMIADKAGATVLPVRIDGTQFT
FT                   HLSKLKNILKRKIFPKITITVLPPVKFANMDAASNQERRSYISRTLYDIMADMMFESSD
FT                   YKNTLFSSLIEAAKIHGFKKKIVDDFENNAVTYRDLILKSFILGDLIKKNNIFGRNLGL
FT                   MLPNTTNTLITFYAMQSSGYVPAIINWSSGISTIINSCKLAQIKVVYTSKQFIEKANLH
FT                   ELITNLLDFGIKIIYLEDFKNQIGTALKLKAKIGSYFAQTYYNYFCRNHEDEKPAVIIF
FT                   TSGTEGEPKAVLLSHRNLQTNRYQITAKVPFSPEDIVFNSLPLFHCFGLGGAIITTLNG
FT                   IKLFLYPSPLNYRSIPEVIYDIGATILISTDTFLNGYANYAHPYDFYSLRYIFAGSEKL
FT                   KESTRQFWLNKYGIRIFEGYGITEASPIIACNTPMHNKAGTVGRLLPKIDYKLEKVEGI
FT                   NEGGRLFIRGPNIMLGYLDLEGHRTYKEWYDTGDIVKIDSEGYITILGRLKRFAKIVGE
FT                   MISLTKIEELASEIAPDSLHAAISIADKTHGEKIILLTTGSDINRENFADTVSKAQISL
FT                   LHLPKVIITDSEIPLLASGKIDYLEIMKNVDRF"
FT   repeat_region   complement(440929..440998)
FT                   /note="RPE-7 Full"
FT   gene            441542..443086
FT                   /gene="pccB"
FT                   /locus_tag="RF_0418"
FT                   /note="RF0418"
FT   CDS_pept        441542..443086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="RF_0418"
FT                   /product="Propionyl-CoA carboxylase beta chain precursor"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61269"
FT                   /db_xref="GOA:Q4UME3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UME3"
FT                   /protein_id="AAY61269.1"
FT                   /translation="MNQSNIISPELLDERKNIARQGGGEARINAQHQKGKLTARERIEV
FT                   LLDPNSFTETGMFVSHRCNNFGMQDKKFLGDGVVTGHGTINGRLVFIYSQDFTVLGGSL
FT                   GEYHAKKICDIIDQAIATGAPVIGINDSGGARIQEGVDALAGYGELFQRNVLASGVIPQ
FT                   ITLIMGPCAGGAVYSPALTDFIFMVKNSSYMFVTGPDVVKTVTGEEVNQEKLGGARMHT
FT                   TKSGVADLAFNNDIEALLEIRKFFNFLPSSNRSPLPVRSTIDPADRVDMSLSTLIPNTP
FT                   NKPYDMKELVERIVDEGEFFELQPDFAKNIIIGFGYMEGYPVGFVANQPLHLAGCLDIN
FT                   ASRKAARFIRFCDAFNIPIVSLVDVPGFLPGTSQEHDGIIKHGAKLLYAYAEATVPKIT
FT                   VITRKAYGGAYIVMNSKHLRGDINYAWFNSEIAVMGAEGAAEIIFKEECKDPEAKKQKI
FT                   DEYRKVVTSPFVAASRGYLDDIIRPQNTRWRICKALNFLRTKKVELLWKKHDNLPL"
FT   repeat_region   complement(443093..443159)
FT                   /note="RPE-7 Full"
FT   gene            443217..445214
FT                   /gene="accC"
FT                   /locus_tag="RF_0419"
FT                   /note="RF0419"
FT   CDS_pept        443217..445214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="RF_0419"
FT                   /product="Acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61270"
FT                   /db_xref="GOA:Q4UME2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UME2"
FT                   /protein_id="AAY61270.1"
FT                   /translation="MNKPLFDKILIANRSEIAVRIIRTLKKMGIKSVAVYSEADTNSMY
FT                   VQHADEAYYIGDSPATESYLSIKNIISAIRESGASAVHPGYGFLSENPIFANILKREGV
FT                   VLIGPSAGTIKKMGDKIEAKKIAIEAGVSTVPGYMGTINDVKQAVDIAKEIGFPVIVKA
FT                   AAGGGGRGMRVVNNPAEMANAFESAKLEAANSFSDDRLFIEKLIQTPRHIEIQLIADQY
FT                   GNSVCLGERECSIQRHHQKVIEEAPSSFITEDIRQEMYRQVISLSQKVGYYSAGTVEFI
FT                   VDSNKNFYFLEMNTRLQVEHPVTELITGIDIVEEMIKIAAGEKLSFTQDDIKLKGWAFE
FT                   SRICAENPSRGFLPSSGRIIAYSEPAKSPNIRIDTGIGLGGEVSMFYDSMIAKLCTYGE
FT                   TREQAIEVMRSALSSYIINGIAHNISFLEAVMLHPRFVSGNISTAFIQEEYPDGFSGAS
FT                   LTSEVTTVFLATAIFIYISEQRRASLISGNINNQANKIGTRWVVTIDDKLFPVLITPVE
FT                   NGYNIRHESDRIYIRSNWNLGNELFTAIINGKKTNVKIENIRTGYLLSHAGISVKAFVR
FT                   SPRISELEALMVSKVVVEESSELQAPLSGQIAAIKVKEGQEVTAGQEIMILTAMKMENL
FT                   ILAERDGKIAKIFVNEKDNVVRGQILLEFA"
FT   repeat_region   complement(445325..445441)
FT                   /note="RPE-6 Full"
FT   gene            complement(445328..445453)
FT                   /locus_tag="RF_0420"
FT                   /note="RF0420"
FT   CDS_pept        complement(445328..445453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0420"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61271"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UME1"
FT                   /protein_id="AAY61271.1"
FT                   /translation="MASFMSFLRKQESKKKHKYSKFLKLKARFISLYDGFLLSQE"
FT   gene            complement(445577..446104)
FT                   /locus_tag="RF_0421"
FT                   /note="RF0421"
FT   CDS_pept        complement(445577..446104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0421"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61272"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UME0"
FT                   /protein_id="AAY61272.1"
FT                   /translation="MANPNLTKGNNYFRNEKYKEAIKAYSKIDKSSTSYPYALFNIGEC
FT                   YFQQGKFIEAIKYYSQISDNHFSLYQSALFNCGSSFYNLDKYAEAIEMYSKIRKNSNYY
FT                   QKAQYYLRECQFEALEMADKTDKSMISYIEKNFNLMEYILEEETSFNILCLEKDTNFSI
FT                   LGENFVLMDIPE"
FT   repeat_region   complement(446224..446325)
FT                   /note="RPE-4 Full"
FT   repeat_region   complement(446391..446421)
FT                   /note="RPE-6 Partial"
FT   repeat_region   446506..446603
FT                   /note="RPE-7 Full"
FT   gene            complement(446652..447890)
FT                   /locus_tag="RF_0422"
FT                   /note="RF0422"
FT   CDS_pept        complement(446652..447890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0422"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61273"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMD9"
FT                   /protein_id="AAY61273.1"
FT                   /translation="MHKSLSYKALRDYFKTEKQILKEKFKEETKEKIKELIKTNQINEI
FT                   DPIHGTALNRAIKIKDKKIILKLLDNNADTIKSLVFLIEKNKDIKEIKQFVYTFYSDNL
FT                   LCFSIKFLIEKHRSIQDIKQLIDSSLSKTIIDFTVLQAVKNHKSLEDIRELIGSSKVSH
FT                   DGLYEAVVQGRLDLVKYFIEEKRFDVNTTIDDPVHGGSILSIAIMNDRTDVMDYLLTKE
FT                   AIASQGVISAIIKGNVKILEKLFKYGATAHDHSEDPVALVVSDAIAAYEPNYKALGSKP
FT                   EHEPFTYIAMLRVLLEHGGNPNAVMLERGKVVLLALNSLIDKPENPTYKDICRLLIKHK
FT                   ADISIFNPDNDKHKKYITIIDLLKAEIIQEAETGSRLAAKSKFFSLEDLNKLDEETSLG
FT                   GDTTELFNSKFEG"
FT   gene            complement(447974..451258)
FT                   /gene="ileS"
FT                   /locus_tag="RF_0423"
FT                   /note="RF0423"
FT   CDS_pept        complement(447974..451258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="RF_0423"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61274"
FT                   /db_xref="GOA:Q4UMD8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMD8"
FT                   /protein_id="AAY61274.1"
FT                   /translation="MTNTKYYPEVSSNADFAAIEREILKFWQDNNIFQKSIDDRNGESE
FT                   FIFYDGPPFANGLPHYGHLLTGFIKDVYARYQTVKGKKVERRFGWDCHGLPAEMQSEKE
FT                   LGISGRLAITNFGIEKFNSHCRASVMKYASDWEEYVTRQARWVDFKNSYKTMDKNFMES
FT                   VIWAFKELYNKGLLYESMRVMPYSWACETPLSNFETRLDNSYRERADKAVTVSFVLNEI
FT                   PAINGMTSRESGTTSSGDYKEYRILAWTTTPWTLPSNLALAVGSDIDYASIPKEDICYI
FT                   IAASSVSKYAKELGLSGEENFEIIKGSALQGLSYKPLFDYFANHPNSFKIFAGDFVVEG
FT                   DGTGIVHMAPGFGEDDQILCESKGISLVCPVDNSGKFTKEIPDLEGVQVFDANDKIIIK
FT                   LKEQGNWLKTEQYIHNYPHCWRTDTPLIYKAVPSWYVKVTQFKDRMVELNQQINWIPFH
FT                   VKDNLFGKWLENARDWSISRNRFWGTPLPVWKSDDPKYPRIDVYGSIEELEKDFGVKVT
FT                   DLHRPFIDELARPNPNDPTGKSTMRRIEDVFDCWFESGSMPYGQAHYPFENKKWFEDHF
FT                   PADFIVEYSAQTRGWFYTLMVLSTALFDRPPFLNCICHGVILDATGQKLSKRLNNYADP
FT                   LELFDKYGSDALRVTMLSSNVVKGQELLIDKDGKMVFDTLRLFIKPIWNAYHFFTMYAN
FT                   ADSLKGELNFASQNVLDIYILSKLKIAVNKIEESLDNFDTQTAYHAVSEFFEVLNNWYI
FT                   RRSRARFWKSEKDADKQNAYNTLYSCLETMAIAMSALVPMISEAIYLGLCHKRPDVIAR
FT                   KDLSLDEAISGNSHEIATALSVPRNDGSISVHLCNYPNLSSFEINHELVATMDNVLDIC
FT                   SNSLFIRSTENIRVRQPLATITIISKHNDKLKSFEDLIKDEINVKSVIYRDDLENYASK
FT                   KLSINFPMLGKRLPAKMKEIIAASKKGEWEAIGGGLAICDETLNSDEYKLVLEPHVHIK
FT                   GAASFENNSSLLILDLELTAELIEEGYARDIVRFIQQARKDADFSITDRILIEIISEFD
FT                   LSKIIDNYGDFIKEQTLGEFSKNFTPDYVSKVELENHQIQLKVKRS"
FT   repeat_region   448769..448834
FT                   /note="RPE-7 Full"
FT   repeat_region   451422..451541
FT                   /note="RPE-6 Full"
FT   gene            451474..451746
FT                   /locus_tag="RF_0424"
FT                   /note="RF0424"
FT   CDS_pept        451474..451746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0424"
FT                   /product="Excinuclease ABC, C subunit, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61275"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMD7"
FT                   /protein_id="AAY61275.1"
FT                   /translation="MYWVYILCSNKHGTLYIGITNNIIRRAYEHKQKIIKGFTSKYNII
FT                   KLVYTEEFTDIKEALTREKNLKKWKRNWKIELIEKANPEWKDLIE"
FT   repeat_region   complement(451738..451779)
FT                   /note="RPE-6 Partial"
FT   gene            complement(452057..452686)
FT                   /locus_tag="RF_0425"
FT                   /note="RF0425"
FT   CDS_pept        complement(452057..452686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0425"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61276"
FT                   /db_xref="GOA:Q4UMD6"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMD6"
FT                   /protein_id="AAY61276.1"
FT                   /translation="MSRLKNMSIKEEHHIKKISFVQSLLELLPFNEWNNKLLEEAEEKC
FT                   GFAKGYALIVFPEGLSEIIEFFESYLDNIMLESLKTIEEPAKIRDKISLAVKIRIKTVL
FT                   PIIHSKNAAYFALNPMQGTEVAFRSCDAIWRYTGDKSLDFNYYTKRGLLLSVYVSSILF
FT                   YIQDESENYIETDKFIETAVENIVKTFSQMKKLLDPSNIPIVRMFT"
FT   gene            452748..452948
FT                   /gene="rpsU"
FT                   /locus_tag="RF_0426"
FT                   /note="RF0426"
FT   CDS_pept        452748..452948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="RF_0426"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61277"
FT                   /db_xref="GOA:Q4UMD5"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMD5"
FT                   /protein_id="AAY61277.1"
FT                   /translation="MILVNVHAGNCDNTLKNFKKRLQRELYFRKMKEQRYYETPSAKRV
FT                   RKAQEAARRQRKFARKKMFDE"
FT   repeat_region   complement(453037..453104)
FT                   /note="RPE-7 Full"
FT   gene            453241..455040
FT                   /gene="ntrY"
FT                   /locus_tag="RF_0427"
FT                   /note="RF0427"
FT   CDS_pept        453241..455040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrY"
FT                   /locus_tag="RF_0427"
FT                   /product="Nitrogen regulation protein NtrY"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61278"
FT                   /db_xref="GOA:Q4UMD4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMD4"
FT                   /protein_id="AAY61278.1"
FT                   /translation="MLSYLKKNLRSYFSSRVLIFTLAIAAIIFACATFYVISLESKNFS
FT                   TIIGFLLVDLAIFLILGVLLTQKFFTQNSNNDSSKLQNRIVIAFSLVAAIPTIIVSVFS
FT                   VYFFNLSVQAWFDKKISTVLDQSVIVAESYIAEHKLQLKETALAVAEDLSDMYYDLIHN
FT                   PALFTKTLNTEAEMRSLDEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGEPV
FT                   EVKSDPTKIRMLIKLKEYNDVYLLVGRLVDNKIIDHIDATNGAAAEYNSLKNEIDNIQI
FT                   KFSIMFIFIALLLLFVAISFGVIFTAKIVKPIKKLVTATDKVKDGDLTVQVPENEVDKD
FT                   EIGTLYAAFNRMIKQLSRQQRDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLK
FT                   KFSPEIKEKEEFENYLKMIIRHTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHIVEA
FT                   RKLLNDNILYKFESNVDQFDFMCDATQINQVMINLLKNAEESIEGRESGKIEVTIDAKD
FT                   DFISVIVIDSGKGFPPELIGKATESYVTTSSKGMGVGLAIVKRIVEEHCGILDIANREE
FT                   EGAIIDIKFDLKKLDLKVGRSGG"
FT   gene            455163..456038
FT                   /locus_tag="RF_0428"
FT                   /note="RF0428"
FT   CDS_pept        455163..456038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0428"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Aminoglycoside phosphotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61279"
FT                   /db_xref="GOA:Q4UMD3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMD3"
FT                   /protein_id="AAY61279.1"
FT                   /translation="MDIEITELLAKELIAEQFPNWANLSIKSVEFSGHDNRTFHLGDEM
FT                   LIRLPSAEKYVDAVSKEQKWLPVLAPNLSFHIPKPLALGKPSKNYPWNWSIYKWIKGES
FT                   ANSFDASSLNLSLIASDLAKFLNELHKIDITDGPIPGTHNFWRGGNLAVYNLETKSAIK
FT                   SLKNLVDADKALSVWEKALNSQWNKKPVWIHGDFASGNIIIKNGKLDAVIDFGGIAVGD
FT                   PACDLVIIWTFLQNEARKVFKEKLPLDDDTWDRARGWALWKALIAPLDGLYAVKNLQII
FT                   HDILYEHEKL"
FT   gene            456383..457890
FT                   /locus_tag="RF_RNA14"
FT                   /note="RFRNA14"
FT   rRNA            456383..457890
FT                   /locus_tag="RF_RNA14"
FT                   /product="16S ribosomal RNA"
FT   gene            458171..458587
FT                   /locus_tag="RF_0429"
FT                   /note="RF0429"
FT   CDS_pept        458171..458587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0429"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61280"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMD2"
FT                   /protein_id="AAY61280.1"
FT                   /translation="MKLYKLVTILMSTIILSGCATIFSGTTQDIHVKVIDNKNNATLEN
FT                   VICTVTDGTRGSYVLQNNPGIVKVRRTSGSVLVDCKKEGYKQLNIAVGDNFNSVTLINV
FT                   LFWPGFIVDALSGSYKKYPSHYLVAMENIAPCAK"
FT   repeat_region   complement(458716..458740)
FT                   /note="RPE-6 Partial"
FT   gene            458899..459291
FT                   /locus_tag="RF_0430"
FT                   /note="RF0430"
FT   CDS_pept        458899..459291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0430"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61281"
FT                   /db_xref="GOA:Q4UMD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMD1"
FT                   /protein_id="AAY61281.1"
FT                   /translation="MKIAKSQAKILFSALDEWNNTGLLDDNTTILLKNDIEILNFDWKK
FT                   LARYSFWISLICIVIAINAILSDRYLRELLEYIFNAPYLLKFITLSTLSGIIYFVGFKR
FT                   QQQKPEKIFSNGAILFLGVLTTACAI"
FT   gene            459340..459939
FT                   /locus_tag="RF_0431"
FT                   /note="RF0431"
FT   CDS_pept        459340..459939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0431"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61282"
FT                   /db_xref="GOA:Q4UMD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMD0"
FT                   /protein_id="AAY61282.1"
FT                   /translation="MLLSFIVYAILGYFSKSNLIWCFALISLGSWMGAETGYMSGWGAY
FT                   YLGMNYPLRFILFGGILTFSALALEENKKFNHFTQVTLVIGLLYSFIAMWLLSIFGNYD
FT                   PEDYSTWRLVKPIELFHWSLLFALMSGAAIYHGLKQDNSITKGFGVTFLFINLYTRFFE
FT                   YFWNTTHKAVFFTILGISFWWLGSKAEKIWNLTAKK"
FT   repeat_region   complement(459976..460104)
FT                   /note="RPE-5 Full"
FT   gene            460218..460367
FT                   /locus_tag="RF_0432"
FT                   /note="RF0432"
FT   CDS_pept        460218..460367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0432"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61283"
FT                   /db_xref="GOA:Q4UMC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC9"
FT                   /protein_id="AAY61283.1"
FT                   /translation="MNYLGYGGISLGTILAIVISFNVNKSILWAIIHGFFGWFYIVYYL
FT                   LFRK"
FT   repeat_region   complement(460366..460418)
FT                   /note="RPE-1 Partial"
FT   repeat_region   complement(460440..460536)
FT                   /note="RPE-7 Full"
FT   repeat_region   complement(460586..460688)
FT                   /note="RPE-4 Full"
FT   repeat_region   460689..460713
FT                   /note="RR-2 Full"
FT   repeat_region   complement(460735..460849)
FT                   /note="RPE-1 Full"
FT   gene            460940..461899
FT                   /gene="corA"
FT                   /locus_tag="RF_0433"
FT                   /note="RF0433"
FT   CDS_pept        460940..461899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="RF_0433"
FT                   /product="Magnesium and cobalt transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61284"
FT                   /db_xref="GOA:Q4UMC8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC8"
FT                   /protein_id="AAY61284.1"
FT                   /translation="MITTYLKENNSIVKNEEYIINESTLWIDLFNITDEEKVIVKNTLN
FT                   IEIPTLKDISQIEISERLYVENEALYLTITELVNKEQEFPETHSIVFILHKGCLITVRY
FT                   VELIPFNDCINKFAKQLNNKYNAENILFMLLRNMVTRLSNIVQSISMDIDDYGRLILDN
FT                   NINDLRIDHTNVLKKIGRKGDLLSKSRECLFSLTMAIQYILKSPQITQNKASKDLLDTL
FT                   LRDVDSIINFSQFISSEIARTLDAALGMIAIEQNNIIKIFSLVTIFFLPPTLIASIYGM
FT                   NFTVMPELKSPYGYPIALSLMLLSTIITYKYLKKRKWL"
FT   repeat_region   complement(461956..462036)
FT                   /note="RPE-2 Full"
FT   gene            462082..462639
FT                   /locus_tag="RF_0434"
FT                   /note="RF0434"
FT   CDS_pept        462082..462639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0434"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61285"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC7"
FT                   /protein_id="AAY61285.1"
FT                   /translation="MSELDFEVEKTSFVVSVIDAIEEYIKAEFLFDYEKQKENFQYIYN
FT                   NLKYLNQSMPIENAEVMKEFFRLKSEFRKYIKDKDKNVDKEFLKVIYIESSKFIKEKIV
FT                   EVENKIERIKNGQAENEEEKEAYNWSKSNELKQKEIEDAYKKKQDEESIDNYKQLSVEV
FT                   QASRPKASSDVSNGSKMIQSNG"
FT   gene            462691..463302
FT                   /locus_tag="RF_0435"
FT                   /note="RF0435"
FT   CDS_pept        462691..463302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0435"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61286"
FT                   /db_xref="GOA:Q4UMC6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC6"
FT                   /protein_id="AAY61286.1"
FT                   /translation="MIILEQIMEIKILNKHGKSLRSIAREVGVSVNTVRKYLKYDGSPK
FT                   YKDRSELVTKLAPYKDYLSERIKSAHPVSLPGTVLFQEIKELGYTGGITQLRDYLRSIK
FT                   PVAKQEDIIRFETASGKQMQVDWIEFRKGKDPLSAFVATLGFSRASYVEFVNNEKLITL
FT                   IECHKRAFDYFGGVPEEVLYDNMKTVILDRDTYGPWDTPF"
FT   gene            463277..463720
FT                   /locus_tag="RF_0436"
FT                   /note="RF0436"
FT   CDS_pept        463277..463720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0436"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61287"
FT                   /db_xref="GOA:Q4UMQ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ0"
FT                   /protein_id="AAY61287.1"
FT                   /translation="MVLGIHRFNKGMLDFAKHYSFRLKVCRPYRAQTKGKVERFNRYIR
FT                   ESFYNPLVTKLKTSELVLDVDTANSEVLKWLRDTANLRVHRTTGAIPAERLKLERNHLQ
FT                   PLPLDYSGSHPTVLEIMRDKGERFSTVSLQHSLCIYQSILEAL"
FT   gene            463717..464517
FT                   /locus_tag="RF_0437"
FT                   /note="RF0437"
FT   CDS_pept        463717..464517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0437"
FT                   /product="Transposition helper protein, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61288"
FT                   /db_xref="GOA:Q4UMQ1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMQ1"
FT                   /protein_id="AAY61288.1"
FT                   /translation="MNLQHQRIEELCHSLNLMQIAENYLDIAQSSSKEDSSYTDFLESI
FT                   LKTELLARQHRSKSILTKMAGFPAIKTLDDFDYDFATGIKHKVLEGLRSLSFVERQENI
FT                   ILLGPSGVGKTHIAIALGYAATQCGIKTKFTTAADLMLILNAGLNQGNLDSIFKRVILP
FT                   YKLLIIDEFGYLPLKPEQANLLFQVIAKRYEKGSIILTSNLPFGQWHNSLAQDSALTAA
FT                   ILDRLLHHSTILNIKGDSFRLKDKKKTGLVPIEIINKQEDNFMT"
FT   gene            465405..466136
FT                   /gene="spoT7"
FT                   /locus_tag="RF_0438"
FT                   /note="RF0438"
FT   CDS_pept        465405..466136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT7"
FT                   /locus_tag="RF_0438"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61289"
FT                   /db_xref="GOA:Q4UJL3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJL3"
FT                   /protein_id="AAY61289.1"
FT                   /translation="MKDLSSWKEKFEVCVYAKKLLDKLEYLNTKVKNPVDIEEVKKGIY
FT                   YARKYHGSQMRQSGDPYYSHPIEVAYMFVQFVAEEAPKLYNAIMLQAALLHDTIEDTEL
FT                   TEEVITTIFGLEVAKHVEGLTRVKPYGKITAKESLNLLIKQKRYNIALIKLFDRIHNVQ
FT                   TLGAKSLEKAQKIIEETITDFLVVAARLEIHSIEEKLFNICNEFIKGNKTKTIIKFDAH
FT                   CSFLNSQSDAARNNSLLLPVS"
FT   gene            complement(466054..467361)
FT                   /locus_tag="RF_0439"
FT                   /note="RF0439"
FT   CDS_pept        complement(466054..467361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0439"
FT                   /product="MFS type sugar transporter"
FT                   /note="PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61290"
FT                   /db_xref="GOA:Q4UJL1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJL1"
FT                   /protein_id="AAY61290.1"
FT                   /translation="MLGYAKEQRSLTRNQKEAIGLLSIGTFLEYFDLMLYVHMSVLLNK
FT                   IFFSPDNTYSVKILTAFAYCSTFIFNPFGSLLFGWIGDNIGRKPTIIITTMLMACTCIG
FT                   MAILPSYDEIGFTAAVLVTLFRAIQGISSATEVTGAALYITEMVKPPLQYPAVASFSVS
FT                   STLGTIAALAVATLVTSTNLNWRYAFLFGAFVAITGTMARTTLKETPDFIDAKRRIKLA
FT                   IEKTGLDPKKIENNDIVKEKTNLKTILCYFLIQCAYPVWNYFGYFYCGNILTEDFGYNP
FT                   AEVINHNFYIAIGDILGCIFLTYLSYKIYPLKILRATFYVLVTFLCFFPFIMQNLTIPY
FT                   IMLIQLFFLLFAPTAFPASAIFYKHFPIFKRFMHTSLIYAISRAIMLLITSFGLAYLTE
FT                   HFNYWGILMIMIPVTIGYYFGLRHFENLEKNSEHQI"
FT   gene            467626..468342
FT                   /gene="spoT8"
FT                   /locus_tag="RF_0440"
FT                   /note="RF0440"
FT   CDS_pept        467626..468342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT8"
FT                   /locus_tag="RF_0440"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61291"
FT                   /db_xref="GOA:Q4UJL0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJL0"
FT                   /protein_id="AAY61291.1"
FT                   /translation="MKDLSSWKEKFEVCVYAKKLLDKLEYLNTKVKNPVDIEEVKKGIY
FT                   YARKYHGSQMRQSGDPYYSHPIEVAYLLAHYAALKLSNFFRTDLLIAALLHDTLEDTSL
FT                   KKEEIEVIFNKNVAHYVESLTRVKIDTKISAAETVILLHKQKNDGVLLIKLCDRLHNMQ
FT                   TINAKNPEKIKKIKEETINYFILLAGYLGIPQIEYELLELCSITQKRFKNSERRGAIKD
FT                   NYQPLFQAFQNDLYSI"
FT   gene            complement(468284..469591)
FT                   /locus_tag="RF_0441"
FT                   /note="RF0441"
FT   CDS_pept        complement(468284..469591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0441"
FT                   /product="MFS type sugar transporter"
FT                   /note="PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61292"
FT                   /db_xref="GOA:Q4UMC5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC5"
FT                   /protein_id="AAY61292.1"
FT                   /translation="MLGHEKEQKSLTRKQKEAIGLLSIGTFLEYFDLMLYVHMAVLLNN
FT                   LFFPKADPDTAALYSAIAFCSTFVVRPVGALIFGWIGDNIGRKPTVVLTTIMMAFSCFI
FT                   MANLQTHAEIGITATVVVTICRILQGLSSMGEVIGAELYVTEITKPPVQYPSVALIPTA
FT                   STLGGMAALGVAAIVTGFGFNWRLAFWFGVIIALVGGIARTALRETPVFVDAKRRIKLN
FT                   VEEAGYNSRFVDNNSIVKDKVNKKTIIALFCVGCTWPVCFYFVYIYCPNILKNILHLTS
FT                   EQVINQNFIVSIVHLISYLILTFLSYYVYPLKILRVKLVIFTVFILICPYLLNNIHNSF
FT                   DVLLIQLFVVLFGFTGVPARPLYYKHFPVFKRFTYPSFIYALSRAITHVISSFGMIYVI
FT                   KYFENWGLLLLIPTAICFKWSIDHFEKLEIEAGNYP"
FT   repeat_region   complement(469767..469860)
FT                   /note="RPE-7 Full"
FT   repeat_region   470059..470178
FT                   /note="RPE-6 Full"
FT   gene            complement(470276..470950)
FT                   /locus_tag="RF_0442"
FT                   /note="RF0442"
FT   CDS_pept        complement(470276..470950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0442"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61293"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC4"
FT                   /protein_id="AAY61293.1"
FT                   /translation="MSKSDASRYLDENKTILCTANNLYKRALEGFNDTNILKEQQGLTH
FT                   LVMSGYTVARSQLTKALLFGKIDACAGLALFNQQGIGGPVSPYNQKLFLTIGSKFGHPA
FT                   CIQALKNLQNNNCDVEKEANIWVNHINTYKIDLNKEITIKDIQLVDLTLGNALLKNDIR
FT                   LDTYNAHIHITKTKEEITEAFVPPPAPKPANYYDPHYNKNTTTTTTTNTYVPPTGATKA
FT                   IR"
FT   gene            complement(471342..472313)
FT                   /locus_tag="RF_0443"
FT                   /note="RF0443"
FT   CDS_pept        complement(471342..472313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0443"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61294"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC3"
FT                   /protein_id="AAY61294.1"
FT                   /translation="MADDKEDIQNNKDDAQVKNELGAIKAQLTATANPAELARLASAAA
FT                   GLAASTNNPELLEQIKGVQAAISKKEETAEQNISSKIAAENLEAPQQQHDPEIVREQEL
FT                   HERHESFKAQHAKLMQDASEYIEQKKQENNNLQDLLNDLREGKEITPERLQSFIKTPEQ
FT                   IREDSEKEKAIKEAQQRANQHYQEMQAEKERLQKQRAESAKQAEEQRKTNEKLVGKELE
FT                   QGQQKLAALDNKTQQTDVKLAAIHPKMEEAKKMKDEADKNAKEWEKEKNINEEIKKEIE
FT                   KHKEKNPQLYNSAFDDFSTLLLNQTEAVKTGEIKDLELRNKF"
FT   repeat_region   complement(472355..472499)
FT                   /note="RPE-1 Full"
FT   gene            complement(472670..473719)
FT                   /locus_tag="RF_0444"
FT                   /note="RF0444"
FT   CDS_pept        complement(472670..473719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0444"
FT                   /product="TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61295"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC2"
FT                   /protein_id="AAY61295.1"
FT                   /translation="MQVDKESHNSEYWYLLGKSQIYMEPEKALESFNKAIKLKRDDALF
FT                   YFNKGIALGLLNENEEAIKAYNKAIKLNPDNPDYIYIKGATLLIIINKLIEKQQFEKAT
FT                   GILRDKIFNKIHDNYTKETLFTLTGICLFHRKKYQKALIKLNQALTLNPESSSAINFKL
FT                   RCLKELGFANNQLPRNINNIEMLLDKALSLLNEKKIEESERFFRRIQRLGIKNKELQIC
FT                   YLFIKAIHLSDQNKYYEALASINEALEFKIEYEKLNLYRHKAVLLNLIRKYKEAMDCCN
FT                   YDLKHGAGQISERNRGIILAAKAFSYASLGDIEEAKELVKILPPELNPLYGKEEIEEKG
FT                   KLLYFPSIR"
FT   repeat_region   complement(473758..473901)
FT                   /note="RPE-1 Full"
FT   gene            474106..474516
FT                   /locus_tag="RF_0445"
FT                   /note="RF0445"
FT   CDS_pept        474106..474516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0445"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61296"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC1"
FT                   /protein_id="AAY61296.1"
FT                   /translation="MYKKLSRKYYIPYFTHSELACKQTGKIVLAEGFAEKLIELRNIFG
FT                   KSMPVVSGCRTREYNTKIKGAKNSFHIYDYPHHSGKGCCAVDIATTDSNYRGNLTALAW
FT                   SLGWSVGIHKNFLHIDRRIDYTTSNQIMFLYD"
FT   gene            474604..475086
FT                   /locus_tag="RF_0446"
FT                   /note="RF0446"
FT   CDS_pept        474604..475086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0446"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61297"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMC0"
FT                   /protein_id="AAY61297.1"
FT                   /translation="MTINNNVYINQLKPTAKAAMLIRKPIDQVFEAFINPNITSKFWFT
FT                   KSSDRLEVKKQITWTWEMYSFSAQINVQEIEKNKKILIEWDTYKIPTLVEWQFTSISSE
FT                   ETFVTITNTGFIGDGDEVIEQAISSTEGFTLVLAGAKAFLEHNIILNLISDRFPKK"
FT   gene            475188..477050
FT                   /locus_tag="RF_0447"
FT                   /note="RF0447"
FT   CDS_pept        475188..477050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0447"
FT                   /product="NACHT domain"
FT                   /note="This NTPase domain is found in apoptosis proteins as
FT                   well as those involved in MHC transcription activation"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61298"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMB9"
FT                   /protein_id="AAY61298.1"
FT                   /translation="MQTSVLNPLITRLKTLYSSHNTLPKLIEDEKIKAQSLEEYYVKLQ
FT                   ILLNEDDEAGKAALRDKVAGDKKLVEPENIFKAIDTKEKIRGLLKKELPNKEYQIDNIV
FT                   ELLNEEKNEKKKFGILRRNLPNKSESEIKNIAESISRIQADIGKVLLLGSAGIGKTTLM
FT                   HYLSYKWGKEELWNDKINYVFGIKLKELLSNWTVRYGTNIDEDILSCFIHYCLDSKDIK
FT                   LEEISNITNKDKVLLLLDGYDEVAFLSQNDRDYRDIMDSVFQYKNVIMTSRPNAVVEEM
FT                   SNRFERKVENTGWDSEGIEQYVNKNFEYDKELGVQLRSFLDTHSQIKEICEVPINTALI
FT                   CLVWSDKDIRDKFQKNSDEDFNISQLYHEVVSWLNNRHLEKTQNKYKNKTEANNHLKNK
FT                   MSFLEQIAYESLVVTGKLVERKLVEDKKDTLDIDEVIEQGLLKREGINYQFIHLTFQEF
FT                   LAALRLKNQLLDNHTKSKTASFIGEHRNDPKYLMTLKFLAGIVNNENNQELIEIFWEAV
FT                   TCNVDSILELGIERKIILLMHLLAQSKINGKFDNRIPNLTQIQNLIDDIVLKDIPIWEQ
FT                   HIIDSGYLSEVIVKTVNEKLQNKEAVFQEFKTATEIITGLANSK"
FT   gene            477280..478701
FT                   /locus_tag="RF_0448"
FT                   /note="RF0448"
FT   CDS_pept        477280..478701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0448"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61299"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMB8"
FT                   /protein_id="AAY61299.1"
FT                   /translation="MGEEVLNQVYKLNNKFLNETLITSSLVKILIVMPTQKAITISKKL
FT                   LIKPNYELKFAAASGLFWAVKTIPTQEAIIILKELLVNPNSAVKHVIANNLPKIIKLTP
FT                   SLAREAFIFLREEIMNPNAGNNLKSVATEGIVEIVETSPNLASEAFTFLKGVITNSKID
FT                   PYTQSIAAQNISKIVIMMPSLVPEAFNFLKELFTNPKANSDVKFETTRSIAEIAKVMPT
FT                   QGAFTFLKIVIINPKTNQYIKPKVTRSIIEIVRKTSSLAEEAFVFLKLVITNPYTGYNI
FT                   RSEFIRNIAWVVKGAPSLAQQVFTFLREIITTHNTYNVEYEATRSIAKVVKIKSNLTQK
FT                   AFAFIKNRIIAHKDDINYAAAISLIEVANVIPLNKASYKPINELLTIIDLTKTKDHYKG
FT                   LYLEAQTTLHKITHHLTQEYEKGKNPEVIEWFTESFNKLPNISETRIFLKEICQSILKS
FT                   GVINELESKFRRVCN"
FT   gene            478898..479896
FT                   /locus_tag="RF_0449"
FT                   /note="RF0449"
FT   CDS_pept        478898..479896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0449"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61300"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMB7"
FT                   /protein_id="AAY61300.1"
FT                   /translation="MLLERRSIFGEHLIYKFGEDNLKKIATIYPAEINKELRGQLFNEL
FT                   ESKEQFDCFIKNEKLKPEEEKRIFKCSNKLKFATEIIQDAKIRLETSNFKLLDAGANKR
FT                   LDAHEIKIDSHNKILKDSRTIQKAEIFREVEKLKHENILFYNYYYTFYCTTRNIILDFQ
FT                   IAEAKMFKNNTIEEEAIIKLFAKSLDLTIQSLLDGVCSILAARRKRKEENIVTSINDII
FT                   RNTIGIEDLDDNLKKIAIIKTQERKNEIINPQKMQEIHITNSYSWKFRAYVQKTFNKVK
FT                   EFVSPKALKRHDMDNLAVQLALKDSTLFIESLYTNRDDILNKKNDLFFRKK"
FT   gene            480073..480774
FT                   /gene="spoT1"
FT                   /locus_tag="RF_0450"
FT                   /note="RF0450"
FT   CDS_pept        480073..480774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT1"
FT                   /locus_tag="RF_0450"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61301"
FT                   /db_xref="GOA:Q4UMB6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMB6"
FT                   /protein_id="AAY61301.1"
FT                   /translation="MTFMEDLSSWKEKFETCVYAKKLLDKIEYLNTKVKNPVDIEKIKK
FT                   GIYYARKYHGLQMRQSGDPYYSHPIEVTIMLAEFVAEEAPKLYNAIMLQAALLHDTIED
FT                   TELTEEMITAIFGLEVAKHVEGLTRVKPYGKISAEESLNLLVRQKRYDTVLIKFFDRMH
FT                   NLQTLGAKSPEKMRKVIEESLISFVKIAMYIEVHEIKQQLIKLCYKNLGMDFNKPQIAF
FT                   QDNFQLLSPIF"
FT   gene            complement(480716..481147)
FT                   /locus_tag="RF_0451"
FT                   /note="RF0451"
FT   CDS_pept        complement(480716..481147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0451"
FT                   /product="MFS type sugar transporter"
FT                   /note="PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61302"
FT                   /db_xref="GOA:Q4UMB5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMB5"
FT                   /protein_id="AAY61302.1"
FT                   /translation="MLVYLSCKIYPLKIIKIKLIIFGIFILICPYLLYNLTSPLQVFFI
FT                   QGFIMLFGCFMSPAFPIFCKYLPVLRRFTYASFSFALSRAAVFTITTFGSILLIIYLDH
FT                   WGVMVILVPVTLGFWYGVNYFKKLEKEAGNYPEKLFEVY"
FT   gene            complement(481300..482022)
FT                   /locus_tag="RF_0452"
FT                   /note="RF0452"
FT   CDS_pept        complement(481300..482022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0452"
FT                   /product="MFS type sugar transporter"
FT                   /note="PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61303"
FT                   /db_xref="GOA:Q4UMB4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMB4"
FT                   /protein_id="AAY61303.1"
FT                   /translation="MLGYEKTQTSLNRKQKQALGILSIGTFLEYFDLYLYVHMAVLLNE
FT                   LFFPKADPQTALIYEAAALCSTYVFRPIGALIFGWLGDNIGRKSTIIITTLLMAIACFI
FT                   MTNLSTYDEIGIVATWVMIACRMAQGMSSMGEVIGADVYLTEFIKPPVQYPAVATLDSF
FT                   CILGGFGALCLASLVTSFGFSWRIAFLIGAGIAIVGVIGRTSLRETPEFVDAKRYLRKT
FT                   LEQANIDPKKIKVILKLL"
FT   gene            complement(482156..483328)
FT                   /gene="rodA"
FT                   /locus_tag="RF_0453"
FT                   /note="RF0453"
FT   CDS_pept        complement(482156..483328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="RF_0453"
FT                   /product="Rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61304"
FT                   /db_xref="GOA:Q4UMB3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMB3"
FT                   /protein_id="AAY61304.1"
FT                   /translation="MTISYPHKQCRPPPRYDRINIKNHMHKNYLEQLQKLPITLILLIS
FT                   LICCIGFIVLYSAANSNLQPWAYKQIINFCIFLPLAIVVALIDLRIIFRLSYIFYFCVL
FT                   TLLVAVELLGSTAMGGKRWIDIGIVKLQPSEPIKIAVVLMLARYFHSLTIDDLTKFYKV
FT                   IIPIIGVLIPAFLIIREPDLGTGMIVLIVSAIIFFATGFRIKYFIILGLAALISLPIAW
FT                   NMMYDYQKKRVMVFLDPEHDPLGASYNIIQSKIAIGSGSLFGRGLNQGSQSHLDFLPEH
FT                   QTDFIFATFAEEFGFIGGMFLLILYFALITISLLIAANCREIFSKLMVIGITSILFSHV
FT                   FINIAMVMGLLPVVGVPLPFISYGGTMIASMLIGFGLVMNAQVHGHTTLN"
FT   repeat_region   483350..483424
FT                   /note="RPE-7 Full"
FT   gene            complement(483444..485522)
FT                   /gene="ptrB"
FT                   /locus_tag="RF_0454"
FT                   /note="RF0454"
FT   CDS_pept        complement(483444..485522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="RF_0454"
FT                   /product="Protease II"
FT                   /EC_number="3.4.21.83"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61305"
FT                   /db_xref="GOA:Q4UMB2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMB2"
FT                   /protein_id="AAY61305.1"
FT                   /translation="MTYTKVDNMKPPIANKQNYSFEAHGQTINDDYQWLRDPKWPNVED
FT                   SKILDYLKAENKYTENFFADLQKDKEKIFEELKGRIKLDDESVYVKKKDYYYYHRVESD
FT                   KNYPIYCRKHNSMEAHEEIILDVNFLTPNGSFTDVAKVTMSPNQNLMAYSVNFTGNEQY
FT                   NIKIYNLKEQKYLPDNVTDIAPTVIWHEKLNGFFYITINENQRWDKVMFHRLGEDVTQD
FT                   KLIFEVKNPLHFISCEKSASSEYIFINSGDYNENEIYVISMQDDNFTPKLVRAAENKIF
FT                   YDVEHNGDYFYIKTNYKAKNFHIVKLPVNNFENANWDDIYIKEEQDKYLKSFEVTNNYL
FT                   ILNYRDQGLPLIKIKRFKDLQEKTIHFPDESFQASSFSTNFEEDDIRVNYSSLARPNTT
FT                   YNYDFDSDKLAILKTQEIPSGFNPEEYQVKRIFADNGYVKVPITLFYKKSLFKKDGSNP
FT                   LYLMGYGAYGISMPVNFRNTVVTLADRGFIYAVAHIRGGDDLGHGWYEAAKFLTKKRTF
FT                   EDFIACSKALINEQYTSNNNIVIMGGSAGGMLIGYVLNEKPELYKLAVAHVPFVDVLNT
FT                   ILDESLPLTLLEYNEWGNPKEKEYFEYIKSYSPYDNVKAQNYPALFITCGISDPRVGYW
FT                   EPAKWVAKLRELKTDNNPLLLKTNMDTGHKGSAGRFDYLKEMADELVFIFKVFDVGV"
FT   repeat_region   complement(485516..485606)
FT                   /note="RPE-4 Full"
FT   gene            complement(485589..487121)
FT                   /gene="nuoL3"
FT                   /locus_tag="RF_0455"
FT                   /note="RF0455"
FT   CDS_pept        complement(485589..487121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL3"
FT                   /locus_tag="RF_0455"
FT                   /product="NADH dehydrogenase I chain N"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61306"
FT                   /db_xref="GOA:Q4UMB1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMB1"
FT                   /protein_id="AAY61306.1"
FT                   /translation="MFIQNSKFIFPLTNFELMFDFNLQNQLIALAFLIVTAILSLYTIS
FT                   QNRKLETLIGSLYCLSSIICVIAADFISMIISLEFMTIFVCIIVFCDQLKIKPARQYFL
FT                   THLFSSGLILIGMTLLIQATGNTAFISLTESVYNFELPAIFILAGCLINLGTIFVNGWV
FT                   VNCYPAASGSGIVYLTSFTTKVTLIIILKLFSGLEILKFFGISMIIYGLIFSLIEKNLK
FT                   RLICYLTVSQLGFILAAISINSPNIAYLITSFIFIHILYNGLFALYFTYIEDEYSIKNY
FT                   QDLQNTQVNLILLGGFVVSILIYTSILPINSSYIKDGIANLLDANNIIIFSKIATCTVL
FT                   FGLLIESLPSLRATKRSVAISSNILRLRAYKTTFFLAMTLRNLTYLSLCIITLCVCLFY
FT                   PIQISHNANFKLVILAISVLLTLIFRKIPRISTENINLDLYQYIEKFIYFIIDKYKERT
FT                   DSTEDTEEYLNFKVIWDNILGKISAWHNQQTAIFIILFLLISLILTLCHTVA"
FT   repeat_region   complement(485986..486051)
FT                   /note="RPE-7 Full"
FT   gene            complement(487123..487527)
FT                   /gene="vapC1"
FT                   /locus_tag="RF_0456"
FT                   /note="RF0456"
FT   CDS_pept        complement(487123..487527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapC1"
FT                   /locus_tag="RF_0456"
FT                   /product="Toxin of toxin-antitoxin system VapC"
FT                   /note="Containing PIN domain for nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61307"
FT                   /db_xref="GOA:Q4UMB0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMB0"
FT                   /protein_id="AAY61307.1"
FT                   /translation="MGLIIDTSIIIALERGKVSTKQWSHYGQAYISPIVLTELLIGVDR
FT                   VNNENKRIKCLAFIEYVKSLFTILPFGIEEVYTYARIINDLYKQRITIGTHDMLIAATA
FT                   ITHGYSLLTLNVKDFKRIQGLEVLTVSSKD"
FT   gene            complement(487518..487829)
FT                   /gene="vapB1"
FT                   /locus_tag="RF_0457"
FT                   /note="RF0457"
FT   CDS_pept        complement(487518..487829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapB1"
FT                   /locus_tag="RF_0457"
FT                   /product="Antitoxin of toxin-antitoxin system VapB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61308"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UMA9"
FT                   /protein_id="AAY61308.1"
FT                   /translation="MQLFLRINMAQIIRATEFVRSFSDIMNRVYYKGESFDVQKGNHIV
FT                   ARITPAETKPSIAVRDLEEAFKNGPHLDPEDADQFMKDIEEIRRSTRQDIKKLVERWD"
FT   gene            complement(487874..489337)
FT                   /gene="nuoL2"
FT                   /locus_tag="RF_0458"
FT                   /note="RF0458"
FT   CDS_pept        complement(487874..489337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL2"
FT                   /locus_tag="RF_0458"
FT                   /product="NADH dehydrogenase I chain L"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61309"
FT                   /db_xref="GOA:Q4UMA8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMA8"
FT                   /protein_id="AAY61309.1"
FT                   /translation="MITQFTTPSLLILSTLLVGALNLTSPYATKKDSFIRNFLLIIISI
FT                   FFFGNILIIDWLFLKGIRAGFEFNILGNYSIGFHLEPLGLIFLSLIGFLWICALLYTPK
FT                   YLAINNIEHSSRFLFFFNLTILIGVLIALSSNLFTMFICYELLTISTAFLIGHTKNNIV
FT                   LSGLYKYLKILMISATILFLPAVIIIYAKTGNGDFASGSLVENYFSQSQSIILLLMFIF
FT                   GIAKTAIFPVHSWLPAAMVAHYPVSSLLHAVIVVKTGLFCIYKILLYIFGLSYLQIIFA
FT                   ELNWLIFIPIVSIFYSSIKALGTDNIKKILAYSTMNQLSLALLSAFMLTPKALGAATLH
FT                   LVSHSFTKICLFYSMGSIYSLKKADQVQDLHGTSKEFPLISFIISISSLSLIGIPIFSG
FT                   FISKFSILLAASEQNQIIVMIVVIASSIFSSLYLLKILSSIYKPSLVESSVTKSSPYSM
FT                   EISIIICALAITLFYFIQILIREFLAYIT"
FT   repeat_region   complement(489434..489550)
FT                   /note="RPE-6 Full"
FT   gene            complement(489437..489559)
FT                   /locus_tag="RF_0459"
FT                   /note="RF0459"
FT   CDS_pept        complement(489437..489559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0459"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61310"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMA7"
FT                   /protein_id="AAY61310.1"
FT                   /translation="MLFMSFPRKRESRKKYKYRKFLKLKARFISLYAGFLLSQE"
FT   gene            complement(489624..490910)
FT                   /gene="nuoN2"
FT                   /locus_tag="RF_0460"
FT                   /note="RF0460"
FT   CDS_pept        complement(489624..490910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN2"
FT                   /locus_tag="RF_0460"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 2 (chain
FT                   N)"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61311"
FT                   /db_xref="GOA:Q4UMA6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMA6"
FT                   /protein_id="AAY61311.1"
FT                   /translation="MILANHFPIIQILFPLFGALLSIISFRFITFARVITTICILSSLL
FT                   VSVYGYSIIQNTELSYTMGGWSSKIGIEYRLNSLNQAIIIYLNLVLLFFLVFCHKITNR
FT                   TILKYINNNRKSLFYGILLFAHTGYLGMIATNDFFNLYVFIEISALSSYVLIASGNNPK
FT                   SLIGAFDYLIMGSIGATLILIAIGFLLSITGSLNMYDVASYLQEHTNSRIITIAIGFFL
FT                   TGAILKTAFFPMHFWMMRAYNNTASVILVYLAGISTIIGIYIIYKFTYIIIGYETIKIS
FT                   ITNFIRPIALATLIIAPYFAYRAEDFKNIIIYSCFTQIGYVFLLYVTEGGIIILPSLLL
FT                   ADSINKIALFLIDAYNESYKKNSNKVLTIIIIICSCGLPISPLFFIKINILELLFRQKL
FT                   LLDFVIILLSSVGSLFYHYKMVKVTFWKN"
FT   repeat_region   490953..491018
FT                   /note="RPE-7 Full"
FT   gene            complement(491050..491412)
FT                   /gene="mnhC"
FT                   /locus_tag="RF_0461"
FT                   /note="RF0461"
FT   CDS_pept        complement(491050..491412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnhC"
FT                   /locus_tag="RF_0461"
FT                   /product="Multisubunit Na+/H+ antiporter, MnhC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61312"
FT                   /db_xref="GOA:Q4UMA5"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMA5"
FT                   /protein_id="AAY61312.1"
FT                   /translation="MARPRYDNVMSHLIYFLTLILLTSGLFIMLTSRNYIHKIIGLGIF
FT                   QSSVLVFYLSIGKIKTGGVPILQDGLTTYTSPLPHVLMLTAIVVGFATLSVALSLIYQI
FT                   YKHFGTISENEINFDK"
FT   repeat_region   complement(491390..491471)
FT                   /note="RPE-4 Full"
FT   gene            complement(491473..492225)
FT                   /gene="virB9_1"
FT                   /locus_tag="RF_0462"
FT                   /note="RF0462"
FT   CDS_pept        complement(491473..492225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9_1"
FT                   /locus_tag="RF_0462"
FT                   /product="VirB9 protein"
FT                   /note="Probable conjugal transfer protein trbG precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61313"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMA4"
FT                   /protein_id="AAY61313.1"
FT                   /translation="MKQLIIFCTFIILTLDVFALTISRPLGRDPRLRVMTYNPDDVFKF
FT                   TGYYGYQASIELARDEEIVSISMGDTTSWQIVPAGHRIFIKPMEPDATTNMTLITNKRT
FT                   YFFELYAAETLDMRDPEMVFNVKFLYPDDENDNMSGHMQTFSASLASPDLTHPEKYNFN
FT                   YYISGSEEIAPIKIFDDGEFTYLQFRDKNAEISGIFAVDDSLRESLVNYRLAQDNPNMV
FT                   ILEQVFPKLAIRKGKKVTCVFNQSFKAY"
FT   gene            complement(492227..492925)
FT                   /gene="virB8_1"
FT                   /locus_tag="RF_0463"
FT                   /note="RF0463"
FT   CDS_pept        complement(492227..492925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB8_1"
FT                   /locus_tag="RF_0463"
FT                   /product="VirB8 protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61314"
FT                   /db_xref="GOA:Q4UMA3"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMA3"
FT                   /protein_id="AAY61314.1"
FT                   /translation="MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLLLICTI
FT                   FTLLLTLVCININILLPINEKVSYLIKDDAEKQATVTNTKHSTLANPYISVANIMLQNY
FT                   VKQREEYNYDILKEQFTFIKNASTSIVYMQFANFMNIDNPLSPVIRYQKLYRRSINILS
FT                   INNINDNEAVVTFESLAQNSTGEILENMVWEARIGFIMDSISTSTSPDMPFNFTVTSYK
FT                   LKLLRNKNQK"
FT   repeat_region   complement(493133..493231)
FT                   /note="RPE-5 Full"
FT   gene            493387..493566
FT                   /locus_tag="RF_0464"
FT                   /note="RF0464"
FT   CDS_pept        493387..493566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0464"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61315"
FT                   /db_xref="InterPro:IPR024444"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMA2"
FT                   /protein_id="AAY61315.1"
FT                   /translation="MLKSLKFLLVLIMLAQLLSCTPSAPYEIKSPCVSADIDDGSSLSV
FT                   NPCIRRPVNSVNIA"
FT   gene            493616..494347
FT                   /gene="virB8_2"
FT                   /locus_tag="RF_0465"
FT                   /note="RF0465"
FT   CDS_pept        493616..494347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB8_2"
FT                   /locus_tag="RF_0465"
FT                   /product="VirB8 protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61316"
FT                   /db_xref="GOA:Q4UMA1"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMA1"
FT                   /protein_id="AAY61316.1"
FT                   /translation="MNNIFGFFKSSNNSKSGSGDTQNQESIKSANPLKITQNWYEERSD
FT                   KLIVQRNLLIILIILLTIFMVISTLVIAFVVKSKQFDPFVIQLNSNTGRASVVEPISSP
FT                   VLTADESLTRYFIKKYITARETYNPVDFAIIARTTIRLFSTSGVYNNYLGYIRNKDFDP
FT                   TIKYKEDNTTFLVIKSWSKIAADKYIVRFSVNETSGSQLVYNKIAVVSYAYVPMQLTDS
FT                   ELDINPVGFQVNGYRVDDDNS"
FT   gene            494334..494810
FT                   /gene="virB9_2"
FT                   /locus_tag="RF_0466"
FT                   /note="RF0466"
FT   CDS_pept        494334..494810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9_2"
FT                   /locus_tag="RF_0466"
FT                   /product="VirB9 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61317"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMA0"
FT                   /protein_id="AAY61317.1"
FT                   /translation="MTIVRFYFLVFILLSGFTVQRECPLVDDPCNNSSNNYVDDLSITK
FT                   DNRIKTYIYNPNEVYLLVLHFGFQSHIEFAKNEEIQNIILGDAYAWKITPLANRLFLKP
FT                   LEKDIRTNMTIITNKRTYEFDIASTELMMGNERDLVYVIKFYYPKKNGNYMARF"
FT   gene            494905..496350
FT                   /gene="virB10"
FT                   /locus_tag="RF_0467"
FT                   /note="RF0467"
FT   CDS_pept        494905..496350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="RF_0467"
FT                   /product="VirB10 protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61318"
FT                   /db_xref="GOA:Q4UM99"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM99"
FT                   /protein_id="AAY61318.1"
FT                   /translation="MAEEQNNNDTGSLSGADAPEVQRELSKVSVSFNKSIAIVVVICGI
FT                   FIYIFYTLFFANKKEEISETQVPTNIVKPVTDVDDNIPEIPKLPDPPKLETPTAPPPPP
FT                   PPVVEVPPVLPPTTPVEENKDKTLPLPPVSLPSTSGTLVESDAEKQRREAKRKSAIVLV
FT                   GGVEPKKTQEQITTEATFKDRGDMSLVLGRGKLIDAVLETAINSDLGGEIRAIISRDVF
FT                   SEKDKVILIPKGSKIFGKYATSTDSSSYGRVSIIWDRIDLTNGYTIEFDSPAVDNLGRP
FT                   GLQGRVDNKYKEQFANAVLQSGFNIGLAKVLDKLVPPPIDSQAAATNSATATQLLNTAQ
FT                   TIAANTAMDANTRIVTICTNILAAITDKTSTAYTTMTQACTTAQTASSANTAEQRLQTL
FT                   VQAVNTAASSLLTTTSIASTPTQAQQASTQAFTDVTNVVQNMITQQPFKPTTTVNQGTP
FT                   VRIYVNKDYKFPKAVLLKSKVMK"
FT   gene            496347..497351
FT                   /gene="virB11"
FT                   /locus_tag="RF_0468"
FT                   /note="RF0468"
FT   CDS_pept        496347..497351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="RF_0468"
FT                   /product="VirB11 protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61319"
FT                   /db_xref="GOA:Q4UM98"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM98"
FT                   /protein_id="AAY61319.1"
FT                   /translation="MNEEFAALETFLLPFKNLFAEDGINEIMVNKPGEAWVEKKGDIYS
FT                   KQIPELDSEHLLSLGRLVAQSTEQMISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYS
FT                   IRKPSGMNLTLDEYAKMGAFDDTATESLVDEDAVILNNFLAEKKIKEFIRHAVVSKKNI
FT                   IISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSSHPNRVHLLASKGGQGRANV
FT                   TTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLKL
FT                   MVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV"
FT   repeat_region   complement(497355..497478)
FT                   /note="RPE-5 Full"
FT   repeat_region   complement(497510..497609)
FT                   /note="RPE-6 Full"
FT   gene            497672..499447
FT                   /gene="virD4"
FT                   /locus_tag="RF_0469"
FT                   /note="RF0469"
FT   CDS_pept        497672..499447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virD4"
FT                   /locus_tag="RF_0469"
FT                   /product="VirD4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61320"
FT                   /db_xref="GOA:Q4UM97"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM97"
FT                   /protein_id="AAY61320.1"
FT                   /translation="MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGAFVAIFTNEVGAL
FT                   GVDINAINIAYKWAYWLINVWGQLKIADYNYLKLKLLASLLGPAIVVIIFYIKNFERIK
FT                   SLQFFEQPEKVYGDASWANPSDIEAAGLRSKKGMLIGVDAGGYFVADGFQHALLFAPTG
FT                   SGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWEPSNPDGITHCYN
FT                   PIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEVV
FT                   RTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANP
FT                   LIDSATASSDFNVQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKE
FT                   EPHGVMFLLDEFPTLGKMDTFKAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLS
FT                   NATYRITFAANNYETANLISQLVGNKTVEQRSFSKPLFFDLNISTRTQNVSQVQRALLL
FT                   PQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPTFVPTQVPFDPRANNNE
FT                   AQEETETTTAPENNE"
FT   gene            499457..500869
FT                   /gene="gppA"
FT                   /locus_tag="RF_0470"
FT                   /note="RF0470"
FT   CDS_pept        499457..500869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="RF_0470"
FT                   /product="Guanosine pentaphosphate phosphohydrolase"
FT                   /EC_number="3.6.1.11"
FT                   /EC_number="3.6.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61321"
FT                   /db_xref="GOA:Q4UM96"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM96"
FT                   /protein_id="AAY61321.1"
FT                   /translation="MRSAIIDIGSNALRAVVYESDELGAPEIFNYKFRNYLTNLLNLDN
FT                   LDVKHQTYLSLQYLIHIFTKLSVTNIRCVATAILRGHPKADEFKAIIKKRFNIDIEIIS
FT                   GEREAYLTAAGLISGISDAFGIVADLGGGSLELAQIGNKKVGKLKSLPLGTKIIASSNF
FT                   GDVGLITKMLEEEFGAAHHPNLYLIGGALRLMSRIYMESINYPLKNLHNFEINRVEFEL
FT                   YLEKLSQIDKLKLSYYEQKAINYNAVLVIKAMIKVFSPEKIIISNYGLKEGVRFDSLPS
FT                   HETEKDIIYERVKRLVKFDRNICKIEKYIEAVQYLLINSDATTLIIIELAIMLAQYNKN
FT                   IDKTLRANFVSEFILSSDIPFSHRQRLMLGIALTVTYTAKTDMQINKIAKKMISKSDYY
FT                   NSHIIGYYIKIAREIDGPEFQEPSFSIKLKDDKFLQINASNILPKQVFEKVCERLKDIS
FT                   SARKNISYNFSD"
FT   repeat_region   500929..501065
FT                   /note="RPE-6 Full"
FT   repeat_region   501143..501167
FT                   /note="RPE-6 Partial"
FT   gene            501268..502425
FT                   /locus_tag="RF_0471"
FT                   /note="RF0471"
FT   CDS_pept        501268..502425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0471"
FT                   /product="Phage portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61322"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM95"
FT                   /protein_id="AAY61322.1"
FT                   /translation="MIKNYWKKFWKNSTTKSQNFIELNDIAYGNLKRVKVGIEAYRENV
FT                   IVYRCINLIAQSAGHVPWKVLKSRTGEVISELPVHYLLKRPNPEKAGVDFFSELIASKL
FT                   LFGNSYILSTLDSYPKEIYLLPALATELVIEHDNLVAYRYKSSKGDRIYKIDHIAKMSR
FT                   VLHLKNYHPLDQHYGLSCLEAASLPIDLHQQSFYWNHSLLQNGARPSGALIVKDSNGYL
FT                   SDEQFERLQAQLSEKFSGNSNAGKPLLLEEGLGWQEMSINPKDMDFIESKNSAAREIAL
FT                   AFGVPPQLLGINGDNTYSNMQEARLALWEETLIPLLDKIADSVSNWFSYLFKEDIIIDF
FT                   DRDSISALTEKRENLWAKISNANFMTLNEKRAFVGLPPIINGDRL"
FT   gene            502422..502709
FT                   /locus_tag="RF_0472"
FT                   /note="RF0472"
FT   CDS_pept        502422..502709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0472"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61323"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM94"
FT                   /protein_id="AAY61323.1"
FT                   /translation="MTKDISDTLNNLYDLIARLIILLEDELVRITLHKNENNIIDTKNV
FT                   TETLNKLVNLIVQLNKLSNSRISSENSKIDEKDKMIIDNFLENYNLKNLF"
FT   gene            502901..503401
FT                   /locus_tag="RF_0473"
FT                   /note="RF0473"
FT   CDS_pept        502901..503401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0473"
FT                   /product="Cell surface antigen-like protein Sca7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61324"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM93"
FT                   /protein_id="AAY61324.1"
FT                   /translation="MRKKSRILKSFLATASILGLSLIILVNEIYAAAVSQMVGDVNLNN
FT                   PNTNFNPPFVDGNTIEVINSGNITVSNSGTYNIGAIRADQEVTTISVGSGSTDLAINFT
FT                   IGSMSGVVKSLNITRFNNATNINITLNGSAGGGNIHPVNDYSALQQVSFTQMGGGIVQI
FT                   VLI"
FT   gene            503398..506040
FT                   /locus_tag="RF_0474"
FT                   /note="RF0474"
FT   CDS_pept        503398..506040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0474"
FT                   /product="Cell surface antigen-like protein Sca7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61325"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM92"
FT                   /protein_id="AAY61325.1"
FT                   /translation="MNINAPVTLNSTFYTSASSETINVNDDVIITQPTKASGAGNMNFN
FT                   IAGDKSLTLSAPNSIQDGTGAGRVRFNFTGANSVLNIDGTNTTIRGAITNGANGTLNVN
FT                   AGVTTATDSTVTTIQKTNIADNTTFNIDSVNSNMNLLNNGTSIAFKGASSELDLINTGN
FT                   TDKQFTLYSNLNPSDAEDEYGIVRVEATTNNLTIANNGGPYTIGKDNTHRLKEFEVKGA
FT                   GNIVIDNTVFTKLLSMNSTGQVTLNQRIDLGAGGNIAFGADGTLVVNNGITGDVDFNDG
FT                   AGTLVMSINFETGSKFSNAANATVQIFNSLISLRDSSAGNIGNIIIGNDNSSATLYANS
FT                   GISFTGNMIFGSQGGKLWVHNDQVSFSGKIINGIKAELYLENNFTALDPSIGSVNTVNI
FT                   VDNKTYTIDAKNGNVDLLNNGAKIIFEGADSEVDLVNTGNANKQFMLYSNLNPSDAEDE
FT                   YGIVRVEATTNNLTIANNGGPYTIGKDNTHRLKEFEVKGAGNVIVANQVFTKRFNMNST
FT                   GQVTLNQVLDLGVDGEVIYNQPGTLNVSGDNPIIGKVNFQNVDDTLKVSIGSNQVFAAN
FT                   IDNINNVDNNGSVIISQGGNNIAQPSIINSVIGMSNPIKELIINNANEYSLNIVLNGEV
FT                   KASKIQVNRTSGSNPNMRMTINNDVTADIEGVSNGSNNFVLTINQGKTVTGAINSINTA
FT                   STTINLRGSVTGPITNATTINFDGTGDTKLGSTANTTDFIVANAKANVTADGRMTGNLS
FT                   YNAAGTVAANKGITGDINFKGNDGVFNLGDGSTIVGAVTSTDSVAGSLYFIGDGEVTGG
FT                   VEAKKVVFNGIDNIEGAANAEIFTVANVNTKADITGKMVGNIEYTAAGALIANGGLTGN
FT                   VNFNNRGGS"
FT   gene            506009..507535
FT                   /locus_tag="RF_0475"
FT                   /note="RF0475"
FT   CDS_pept        506009..507535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0475"
FT                   /product="Cell surface antigen-like protein Sca7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61326"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM91"
FT                   /protein_id="AAY61326.1"
FT                   /translation="MLTLIIEEGAKIIGSVTSTGGVAGTLVFIGDGEVTGDIGTDDENK
FT                   PDIIEISGDNTKQVTLRGNVLVNDLVFVQGVDSSGKANIENGLVARRVVFNNENADGGT
FT                   LVINAPSAVNAIVNPNNGMIVLNADFTISDPSAGDIREIKIADNIKYTIDAKSGNVDLL
FT                   NNGAKIIFEGAGSELNLINTGNTDKQFTLYSNLNPSDAEDEYGIVRVEATTNNLTIANN
FT                   GGPYTIGQDNTHRLKEFEVKGAGNIVIDNTIFTKQFNMNNTGQVTLNQVLDLGVGGGVL
FT                   FAADGKLTANNGISGSVTTATNDTGTLTIGTGNVTGAIGTNGGSKLKEVNFNGVSNVTS
FT                   IDATIVKISNAAANVTAAGQISGAVSYTADGKLTANNGISGSVTTATNDTGTLTIGAGN
FT                   VTGAIGTSGDNKLKEVNFNGASNVTSIDATIVKINNVTAAGQISGAVSYTADGKLTANN
FT                   GINGAVTTNDTGTLTIGAGNVTGAIGTNGGNKLKEVNFNGVSNVTSIDAT"
FT   gene            507532..509940
FT                   /locus_tag="RF_0476"
FT                   /note="RF0476"
FT   CDS_pept        507532..509940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0476"
FT                   /product="Cell surface antigen-like protein Sca7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61327"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM90"
FT                   /protein_id="AAY61327.1"
FT                   /translation="MKISNAAANVTAAGQISGVVSYTADGKLTANNGISGSVTTATNDT
FT                   GTLTIGAGNVTGTIGTNGKSLKLVNIGANPITFSSNVFAPVALTDQNSQLTLADGIVVT
FT                   GSVTTKNNTRGVLSLGVGSSITNGIGANNFSLERVELRAGASSLGGNIYAGAVKLMADT
FT                   SVVTLEDNAKVYGSVTTKTDTKGVLVLGRNSSVAGIGANGFALERVEIGAGASSLRGNI
FT                   FTGTVKLMADDSALTLEDNATIHGSVTTKTNEKGILIFSRNGSVTDNIGENGAALEKVI
FT                   FKGVDTIEGAAYAQTFTIANANANVTVKGLMTGDVNYEADGTLASESIIGDIDFKGTNG
FT                   IFSINDGRAIDGAVLSTGGVGGILNFKGNANVTQNVGADEENSSATINIQGDDTTNVSL
FT                   ANDVFVGGVNFTNSGKLQLSKSFSAKNVDFGAKGGTLEFNGNDKYIFNAVIANGQTGIL
FT                   NVLTKLAATDASVGTLKTINIGNANAGQSFLIAVNNANLALLTSPNSSINFSNANSQLT
FT                   LTAPVDQTVTLANNLKGGGIVTLNGNGHNLVVSGKNGAMLGTAGNELAELNIKGDVTIT
FT                   NNLDIHNINKLNIQKGAYFTDQSLTSAKVAEINIGQLIDKTSYAATYALDAVNGDFELN
FT                   TGGMKFIHEDSALDLKNSSNANDHTINLQTEIYVENIVLDIHAITLNRVNANIRFEDDT
FT                   IYTATGNIESDIIDFQGKAGVINIADNVKIDSRVTSTADTSGILNFEGAGEVTKLITNI
FT                   KMLKTGNGNVALTAGGDYSIGEIQGNGNNNLTFGPNSRLTTTYINKTGG"
FT   gene            510075..512240
FT                   /locus_tag="RF_0477"
FT                   /note="RF0477"
FT   CDS_pept        510075..512240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0477"
FT                   /product="Cell surface antigen-like protein Sca7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61328"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM89"
FT                   /protein_id="AAY61328.1"
FT                   /translation="MSNGAEIEVNDNIIATDIAGENENDGTLKLNNKAPINITGTIGNN
FT                   NSLGIVEVAGKDVTITGELKAQAINFSNAGQEAILTLQAAGGVTNITTAGNNLHTLAIT
FT                   DFDTGNGAIGAEDHRLKAIELTENGLVTINTKNFYSDVTTANNGQGNVKLNIEGGTTYN
FT                   LGSKNNSLASVQVSKNSTIKGDVYSKEINIDAGKNIDFERGNNRNAKNIIIQDVLVDRD
FT                   LLPRSLQLFTYLTDIKVDKLNFADAAASIHFKDAVLVNAEIDGGGAIKFDENVWLKEEI
FT                   KNVERLEFGPEKFAILEKNIKAANLVANKANIVLLDNLGIDADSQFTDSALDLATYELK
FT                   HTGNVTYNGTLEIITYFDVTAKSGGHILVGNGANVNMSALDSLVIKVKSRSDITKITPD
FT                   TKHEVILKEAGGNFTPVAQNKVTVDTGGELNRLIRWVRWVSDENGVVLLNNNDNGGGNP
FT                   ENPDPGGGDPENPGDGDNGGGNPGDGESGVIVPIFDPKPIRDEVTGPIAPGLVEQLIGI
FT                   GIGNESDAGKVLNDLGSTKNVSETLNRLGGRMDIREVSEGLGEFNIEEIQDILTDISVN
FT                   MDSVVSSGINARLGEVNNKDEGTFKLNGLNKPNASESLNNQAAVAAGDEDNIGTGIWGV
FT                   PFYGKATQKSRNDGASGYKSKSQGGIIGFDYALSDSVIVGAAYTRADSKLRHQNYKVGD
FT                   KTKAISDIYILSMDFIIVGQVISLLRL"
FT   gene            512396..512707
FT                   /locus_tag="RF_0478"
FT                   /note="RF0478"
FT   CDS_pept        512396..512707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0478"
FT                   /product="Cell surface antigen-like protein Sca7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61329"
FT                   /db_xref="GOA:Q4UM88"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM88"
FT                   /protein_id="AAY61329.1"
FT                   /translation="MIGTRYATFKNNSYKETGTTFQNLSVRKKSYDRFEGIAGLKGVTN
FT                   FFVRDVRIKPELHGFVSYDFKGKLPNIDARLDGIDEPLTTVKFKPTKLNYNLGGSLSV"
FT   gene            complement(512704..513810)
FT                   /locus_tag="RF_0479"
FT                   /note="RF0479"
FT   CDS_pept        complement(512704..513810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0479"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM87"
FT                   /protein_id="AAY61330.1"
FT                   /translation="MVNMFGSFFSSLGSGIGNTFGGGIFSSVGRFAGKMLGEYLDQLNH
FT                   EPIEYDNIKNFKESFKYITANYGEAIPLIFGTARVNGKIIWADTIKEIANSTRHKEYFP
FT                   YFHNLKSVTNFTEYSYFFSFAVSICEGEITEINKVWAGDKVINLGKYNFRLYKGSETQL
FT                   PDPLIENYLGSGKTPAFRSLSYIVFEELPLEDFSNIIPNFSFEVTRKPNIYLPNNYAKV
FT                   ENLISSINMIPGSGEFVYDTEVQYKTLESSYGGVISHEAINSHNHYNIADSVFSLNQLQ
FT                   NTCPNIKWIAPVVSWFGDSLDIGYCSIKPAIEFNDALTSYSCTWQVGRYNRANAKIISK
FT                   DEHDNPHYGGTVNDASLLYLIPNSIILY"
FT   repeat_region   complement(513875..513941)
FT                   /note="RPE-7 Full"
FT   gene            513992..514876
FT                   /locus_tag="RF_0480"
FT                   /note="RF0480"
FT   CDS_pept        513992..514876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0480"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61331"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UJN3"
FT                   /protein_id="AAY61331.1"
FT                   /translation="MFKRSLFILLLLAASLVKAEIIEVDSLNKIKQDFKENYNKNYVPQ
FT                   DLLVVTVLDEFLFKSLVPIGEQIDKDIYLTLTPLLRNINKNSKAIYIDQLILTNDSYKK
FT                   ELQESDFPNFVNEMSNSKIPIIAVNDGFTGNFNNIPKFEIWFADYLKKNFNIDFSNSFP
FT                   NNNYIIFNNLDSFANTYPVFYKGILTSNNISKAEMMLNFLIQVGFMPKAFIIISNNIEL
FT                   LKSMEFQLNSYSSNILFIGYHYNNKNTPENKDAAYYTKIINDLISQINKIKRNNPPLKT
FT                   NKIKDKNPYDKNQ"
FT   gene            514860..515705
FT                   /locus_tag="RF_0481"
FT                   /note="RF0481"
FT   CDS_pept        514860..515705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0481"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61332"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJN2"
FT                   /protein_id="AAY61332.1"
FT                   /translation="MIKINKVLLSLLCLVISCVSYGQIIPTYSVDSVTMKNLLPKIDAD
FT                   TLVLINIDNTIITPKSKLFRYRDNSYINFTKYLYSLAADNASVNKTIAKLIVQRQMMLV
FT                   ESKWVDLINKMKQQGATVLGLQEITAPCNLIENYEGWLYTLLYGLNINFTNKVNDKDVF
FT                   RFNPSDAGAPIFYLGIIFTGNINRVKTLIEFLKIIPKQPTKIVIFANNKKDLENMDSYL
FT                   SMVDIGYYGIEYLGWQMLPGSPDHQIAELQQSTFLNTGQWLEDDVASKMLNIPDSKLQK
FT                   "
FT   repeat_region   515784..515891
FT                   /note="RPE-6 Full"
FT   gene            515934..516710
FT                   /gene="cysQ"
FT                   /locus_tag="RF_0482"
FT                   /note="RF0482"
FT   CDS_pept        515934..516710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="RF_0482"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61333"
FT                   /db_xref="GOA:Q4UJN1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJN1"
FT                   /protein_id="AAY61333.1"
FT                   /translation="MNNNLIAALKDLIINTGRVALDIKKAGILTDIKSDGSVVTNADKE
FT                   ISKVIYQSLQVLTPKIAIVCEEQPLPILSSDTFWLIDPIDGTRSYVNGKSTYTVNIGLI
FT                   ENGLPTIGLIYHPETAKLYYTDVQGRLKIEQNSKEIFVNHEPKHEELNAVIGFYNSNKD
FT                   TKEFLSKYSFGQINAIGSSIKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNIL
FT                   DCDGQEITYGKENFANPNFFACSKYWLKREAVFRGY"
FT   repeat_region   516777..516848
FT                   /note="RPE-7 Full"
FT   gene            complement(516886..519546)
FT                   /gene="mutS"
FT                   /locus_tag="RF_0483"
FT                   /note="RF0483"
FT   CDS_pept        complement(516886..519546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="RF_0483"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61334"
FT                   /db_xref="GOA:Q4UM86"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM86"
FT                   /protein_id="AAY61334.1"
FT                   /translation="MNLQEFKQKYNYDVATKMMQQYLDIKFAHLDCLLLFRMGDFYEMF
FT                   YEDAILASNVLGIALTKRGKNGEEEIAMCGVPYHALENYLTKLIEENYKVAICDQLETP
FT                   EEAKNRGGYKAVVTRDVTRIITPGTIIEENLIASAEPNYLASLVITKNKETASLCYVDL
FT                   STSEIFVVNVPEAEILNELARLKPREILLSENLRSSNLADSIFKQLNFRITYQVDSFFA
FT                   INKCEKIILDFYKMKDIKGIGEISSSQICAIGSILEYLSLTQKQNIPHLPIPRIINFHS
FT                   YMTIDFATRRNLEIVTNSQGTLKGSLLNTLNHTVTKQGGRLLYNFLSSPLTNIAKINHR
FT                   LNITEFFYSNLEIVKRIRELLKKTSDIERCLTRITMNRSSGRDLLSIKYTLEAATIIKG
FT                   VFFDAYGFNLPDFIEKIIKPLSGDAELYNLIDESIREDAPNNLNDGGIIKHEYHPKVAQ
FT                   LHDLINNGKLHIEKLKDQYCKETGIDSLKISHNNVIGLFIDITAKNVNKILDPKFIHRQ
FT                   TTVNSVRYTTTELQKLESELANAKTLVISLEKELYADICNQVIEKASYLRMLASSLSGL
FT                   DVFCNFAYIADEYDYVKPEFTDDLSFDIVKGRHPVVEKALKRESKSFVYNDCHLSEFER
FT                   IWLITGPNMAGKSTFLRQNAIIAIIAQIGSFVPAKSAKIGVVDKIFSRIGAADDLIRGQ
FT                   STFMAEMLETSAILAQSTKNSLIILDEVGRGTSTYDGVSIAWSVLEYIHDKLKCRCLFA
FT                   THYHELTVMSNFLPALQNYTIAIEESGKDILFLHNIISGAADRSYGIHVAALAGLPASV
FT                   INRAEQILLKFEKTSTGKGKNILSTESNNLSLFNLEPNKTTISSKLDEQFRTIAPDKLS
FT                   PKEALELIYELKKLV"
FT   gene            complement(519606..519857)
FT                   /locus_tag="RF_0484"
FT                   /note="RF0484"
FT   CDS_pept        complement(519606..519857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0484"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61335"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM85"
FT                   /protein_id="AAY61335.1"
FT                   /translation="MEDKIRRYYRLVDFFLNVVKSQSTRALQIIKNDNIEYLLSAKQLM
FT                   MWNWINTKEINEFSRKDAVNALGFPERTVESIIKNYLI"
FT   gene            complement(519809..520630)
FT                   /locus_tag="RF_0485"
FT                   /note="RF0485"
FT   CDS_pept        complement(519809..520630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0485"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61336"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM84"
FT                   /protein_id="AAY61336.1"
FT                   /translation="MNLQDFRIHKRLNLNPSVIEEIYTKISEIEGIKNSWYITGQILPQ
FT                   TLDRLTRSVIITSTGSSNRIEGNKLTDEQVENLYKNLSVKKFKTRDEQEIVGYLKCLEF
FT                   IFNNYEEISITESFILKLHSDMLVHSEKDARHKGNYKFGSNRVEAKDHNGNVVGTIFDP
FT                   TPPYLVKKEMQELIDWYNWTVDSKTKHPLIIIANFIFEYLAIHPFQDRNGRTSRLLTNL
FT                   LLLKHGYLFVQIISHEHIIEANKIDYYMALNKTQATWKTKSEDITAWLIFF"
FT   gene            complement(520697..521134)
FT                   /gene="lacA"
FT                   /locus_tag="RF_0486"
FT                   /note="RF0486"
FT   CDS_pept        complement(520697..521134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="RF_0486"
FT                   /product="Ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61337"
FT                   /db_xref="GOA:Q4UM83"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM83"
FT                   /protein_id="AAY61337.1"
FT                   /translation="MKTYNIVIASDDHSGYELKSEIINYLEQKSLKVYDCGTNNTQTVD
FT                   YPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCHNMLTAENAKAHND
FT                   ANILILGAKTIDYKIVFDIIDKFLTTKFEGGRHNVRLLKIK"
FT   gene            521186..521854
FT                   /gene="nlpD1"
FT                   /locus_tag="RF_0487"
FT                   /note="RF0487"
FT   CDS_pept        521186..521854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD1"
FT                   /locus_tag="RF_0487"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /note="Outer membrane antigenic lipoprotein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61338"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM82"
FT                   /protein_id="AAY61338.1"
FT                   /translation="MFSNVNNSFVKYMKYSVALSIVICFCLVACVEQPPAPIEYKVGDV
FT                   TANNNSTELEHDEGLIVQRTMEDDSVSEKVSGRLEEPKAKIIEDDNDDIEIPISRNEDE
FT                   EEIEQSSFVKPLNGVIITEFKAGKSKGIDIAAKEYSEVKSIEAGTVIYSGFNKQFGNLV
FT                   IVKLDKDDLEVAYASLDDLLLKKGDKITKNSVIGHVEHKLYFAMRKNKIAVDPSKYIEF
FT                   "
FT   gene            521855..522544
FT                   /locus_tag="RF_0488"
FT                   /note="RF0488"
FT   CDS_pept        521855..522544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0488"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61339"
FT                   /db_xref="GOA:Q4UM81"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM81"
FT                   /protein_id="AAY61339.1"
FT                   /translation="MEDFITLTKYGEPQNVIVRRSGKAKNIAIRITPKGAELVLPLKAK
FT                   LEKGHNFLLSKEYWVRQKLRRNVTVIPKDKDKISILGKSYEIIHIDSSKNQIKLNDSTL
FT                   EVYCSTVLKKLSIEVFLKKTLLAEIKIIVENISKKHNLTYSNIRIMENVTRWGSCCSKG
FT                   NLAFNWRVVFAPFEVLKYLVAHEMAHLKEMNHSENFWELVEDIYPEYQPAKLWLKRNGK
FT                   NLYSYLS"
FT   gene            522563..522802
FT                   /locus_tag="RF_0489"
FT                   /note="RF0489"
FT   CDS_pept        522563..522802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0489"
FT                   /product="Probable antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61340"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM80"
FT                   /protein_id="AAY61340.1"
FT                   /translation="MNHLVTNEESKYINKLIDEVTLYHQPTLIKGKRNNAILISEEDWE
FT                   DIQETLLVSSNKKLSESLLKGRNTPYSECSTKLD"
FT   gene            522808..523074
FT                   /locus_tag="RF_0490"
FT                   /note="RF0490"
FT   CDS_pept        522808..523074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0490"
FT                   /product="Probable toxin of toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61341"
FT                   /db_xref="GOA:Q4UM79"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM79"
FT                   /protein_id="AAY61341.1"
FT                   /translation="MYTLYYTHDAKKDFKKIIKSNHKEICLQLLDLITQNPFQTPPPYK
FT                   KLLGEHVGMYSRRINIQHRLFYEVDEKNKRIKILRMWNHYYDN"
FT   gene            523092..523976
FT                   /gene="thyX"
FT                   /locus_tag="RF_0491"
FT                   /note="RF0491"
FT   CDS_pept        523092..523976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyX"
FT                   /locus_tag="RF_0491"
FT                   /product="Thymidylate synthase ThyX"
FT                   /EC_number="2.1.1.148"
FT                   /note="Flavin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61342"
FT                   /db_xref="GOA:Q4UM78"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM78"
FT                   /protein_id="AAY61342.1"
FT                   /translation="MHNTTKRVTVPALEEILYEPIKVLDHGFIRVIDYMGDDSAIVQAA
FT                   RVSYGKGTKQLNQDKGLINYLLRHYHTTPFEMCDIKFHIKLPIFIARQWIRHRTASVNE
FT                   YSARYSILGNEFYLPEPANIASQSAVNKQCREGDSLPKEGAEKVLAILEEDAKQCYGHY
FT                   KELMNADEDGNIIDENNTGIARELARMNLTLNYYTEWYWKINLHNLLHFLRLRADPHAQ
FT                   YEIRVYAEKMLEIVKAWVPFTYEAFEEYRLQGANISRKGLDVIKRMIKGEKVTHESSGM
FT                   TKREWEELMKIFG"
FT   repeat_region   524032..524101
FT                   /note="RPE-7 Full"
FT   gene            524171..525505
FT                   /gene="tolB"
FT                   /locus_tag="RF_0492"
FT                   /note="RF0492"
FT   CDS_pept        524171..525505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="RF_0492"
FT                   /product="TolB protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61343"
FT                   /db_xref="GOA:Q4UM77"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM77"
FT                   /protein_id="AAY61343.1"
FT                   /translation="MRNIIYFILSLLFSFKGYALETINIEHGRADPTPIAVNKFNADSS
FT                   ADDVVGHDVVKVISNDLKLSGLFRPISSASFIEEKTGIEYKPLFAAWRQINASLLVNGE
FT                   VKKLESGKLKISFILWDTLLEKQLAGEILEAPENLWRRAAHKIADKIYEKITGDAGYFD
FT                   TKIVYVSESTSLPKIKRIALMDYDGANNKYLTNGKSLVLTPRFARSADKIFYVSYATKR
FT                   RALVYEKDLKTGKESVVGDFSGISFAPRFSPDGRKAVMSIAKNGSTHIYEIDLATKRLH
FT                   KLTDGFGINTSPSYSPDGKKIVYNSDRNGVPQLYIMNSDGSDVQRISFGGGSYTAPSWS
FT                   PRGDYIAFTKITRGAEGKTFNIGIMKACPQDDENSERIITSGYLVESPCWSPNGRVIMF
FT                   AKGWPSRAKAPGKNKIFAIDLTGHNEREIITPADASDPEWSGVLN"
FT   repeat_region   525622..525718
FT                   /note="RPE-7 Full"
FT   repeat_region   525782..525853
FT                   /note="RPE-7 Full"
FT   gene            complement(525904..526785)
FT                   /gene="rpoH"
FT                   /locus_tag="RF_0493"
FT                   /note="RF0493"
FT   CDS_pept        complement(525904..526785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="RF_0493"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61344"
FT                   /db_xref="GOA:Q4UM76"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM76"
FT                   /protein_id="AAY61344.1"
FT                   /translation="MTNNINALAISSESGFYSYLQKINKIPSLTQEEEFLLAKSYLEEN
FT                   DLQAAHKLVTSHLKLVAKIASGYRTYGLPITELVSEGNIGLMQAVKKFNPELGFRLSTY
FT                   AMWWIKAAIQEYILKSWSLVKMGTTAAQKKLFFSLNKIKHKITNLYSRAITADDFIQIA
FT                   DELGVSVNEVSEMNTRISGPDLSLNNPINSDDAESGELIELLPETRPTPETIAINKQDS
FT                   TGKRKLLSNAMKILNDRELRIFTERKLTDTPKTLDILSNEYNISKERIRQIENTAFEKI
FT                   KKFILNHSGQVA"
FT   gene            526871..527434
FT                   /gene="cox11"
FT                   /locus_tag="RF_0494"
FT                   /note="RF0494"
FT   CDS_pept        526871..527434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cox11"
FT                   /locus_tag="RF_0494"
FT                   /product="Cytochrome c oxidase assembly protein cox11"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61345"
FT                   /db_xref="GOA:Q4UM75"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM75"
FT                   /protein_id="AAY61345.1"
FT                   /translation="MSKKSNKNLAFSLLGLIISMVLLSFASVPIYNLFCKVTGYGGTTA
FT                   KETVSVYSKVKGTKPIIIEFDANVDKDLPWRFIPRQQRVQIVPGQNTLVFYETENLSNN
FT                   DIIGTSVYNVTPNKAGKYFVKIHCFCFEEQLLKADEKVLMPVTFYIDKDFELDPEMQDI
FT                   KVLTLSYSFFKVREIASLRGNTKY"
FT   repeat_region   complement(527407..527479)
FT                   /note="RPE-7 Full"
FT   gene            complement(527459..528511)
FT                   /locus_tag="RF_0495"
FT                   /note="RF0495"
FT   CDS_pept        complement(527459..528511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0495"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61346"
FT                   /db_xref="GOA:Q4UM74"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM74"
FT                   /protein_id="AAY61346.1"
FT                   /translation="MLFKILYKTIITLALIYFVLIILEYARQGFINDLSLQKVDLSIQN
FT                   SIKEPIYLVSYADGPEYVYRNQNATTHYAINNGIDFIFNYKKKHINQAFIEKNQEIFNE
FT                   PAGAGLWLWKPYIILETMKNAPEGAIIIYLDSAFVIKKHISNLTNLLGDNDILLVHDRD
FT                   RKNGNFVKGETFALMDCLNEECRNNDHIWSAIIVVRNTELSRSFIEKWLRSCEDIRILS
FT                   GKDYNIHPNYDEYKWHHSDQSVLSLIYHKNPQSVKVIEYEETAPFLSWFHRKYSNSSPL
FT                   KPWYSIYGIEPIINFNTNGKVLPSTALINTPLIVRLRKWIISNINNEHCLRGYRAVIAS
FT                   SHRLRGNLMK"
FT   repeat_region   complement(528569..528596)
FT                   /note="RPE-4 Partial"
FT   gene            528722..529819
FT                   /gene="trmU"
FT                   /locus_tag="RF_0496"
FT                   /note="RF0496"
FT   CDS_pept        528722..529819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="RF_0496"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61347"
FT                   /db_xref="GOA:Q4UM73"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM73"
FT                   /protein_id="AAY61347.1"
FT                   /translation="MINLGDKQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDH
FT                   GMAVGKKNACCAGQDIYDAKMVANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLP
FT                   CVQCNKSVKFRDLIKTARELGAAQLATGHYVRKVNGDNGAELHTGLDPAKDQSYFLFTT
FT                   TKEQLEYLSFPLGGLTKDETRRLASKFGLEVADKPDSQDICFVPDGNYKSVINKIRPGA
FT                   SESGKIIHVNGFELGEHSGIINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESAL
FT                   HVQEFIIKNINWLADEIKDNEKLEVEVKIRSTRPPRLAEISKLDDDKMKVKFLSEEKAV
FT                   APGQACVIYAGERVLGGGWITRDIR"
FT   repeat_region   complement(529838..529907)
FT                   /note="RPE-7 Full"
FT   gene            529988..531385
FT                   /gene="atrC1"
FT                   /locus_tag="RF_0497"
FT                   /note="RF0497"
FT   CDS_pept        529988..531385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atrC1"
FT                   /locus_tag="RF_0497"
FT                   /product="Cationic amino acid transporter-1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61348"
FT                   /db_xref="GOA:Q4UM72"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM72"
FT                   /protein_id="AAY61348.1"
FT                   /translation="MSFLRKKSFESVKEIGSSSGLSKTLGAFDLILLGLGAMIGTGVFV
FT                   VTGIIAAKYSGPAVMVSYAIAGITCIFVALVYTELAAMLPTSGSIYTYSYVAFGEVFAW
FT                   MIGSVIILELGVAAGIVAAGWSGYVQGILAAGGIHLPMELTTVSTNGGIINLPAFLISV
FT                   FIGFILYLGTKDSKRLNAILVFIKMAAIFVFVLAAAPHFDATNWSNFMPFGFSNVLVGA
FT                   SILFLAFTGFGTIATAAEECKNPKRDIMIGIIGSLVLTTIVYVTMAGLVTGIAPFDQLN
FT                   NDQPLAYALTINNSKIGSAIVATGAVCGMMTVLMMNIYGTSRIFYAIARDGLLPKSFAK
FT                   LHPKYDSPYITIIIFASLAAILGGFCSTELLTQLTSMGALIDYITVTIIVVLFRIRLPE
FT                   AQRPFRCPLVFIIVPFILIACAYLLFIQIYDGEFNLLTAGRALIYWFITIFVLYIIRSF
FT                   FMKKEQN"
FT   repeat_region   complement(531388..531419)
FT                   /note="RPE-5 Partial"
FT   repeat_region   531499..531604
FT                   /note="RPE-6 Full"
FT   gene            531673..532920
FT                   /gene="hisS"
FT                   /locus_tag="RF_0498"
FT                   /note="RF0498"
FT   CDS_pept        531673..532920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="RF_0498"
FT                   /product="Histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61349"
FT                   /db_xref="GOA:Q4UM71"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM71"
FT                   /protein_id="AAY61349.1"
FT                   /translation="MTEKLQPLRGMKDLLPDDYKVHDYIINKARDVGVLYGYKQMSIPI
FT                   LEYTKVFNRSMGESSDVISKEIYSFLDKSNESVALRPEFTAGIIRSFISNGLQHKLPLK
FT                   FFSTGPVFRYDRPQAGRQRQFHQLNYEYIGAKGAITDAETLKLAVDILKALEIEQDTIL
FT                   ELNSLGCSESRSVYQQKLVEYLNDFKDQLSEESKIRLTKNPMRILDSKSEIDQKIIAAA
FT                   PILSEYYTDESKEYFEELIKYLDILGVKYVINPRLVRGLDYYCHTAFEFTTKKLGSQST
FT                   ILAGGRYDGLAKIMGNNDDVPAIGFAAGIERIALMREYNISEVKPVFVLPIGENNICYA
FT                   LEIVDKLRLQNISTIIDPVGKIAKRIQRVLNENAKFIIFIGDEEQANNSLKLKDLEKKE
FT                   EYIVDFAKVLELLKKY"
FT   gene            532984..533715
FT                   /locus_tag="RF_0499"
FT                   /note="RF0499"
FT   CDS_pept        532984..533715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0499"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61350"
FT                   /db_xref="GOA:Q4UM70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM70"
FT                   /protein_id="AAY61350.1"
FT                   /translation="MIIINDLAMSYGARILFTDVSLHIKNNKRYGLVGANGAGKTTFFK
FT                   VLTKEEEPAFGDIINIPKNSKVGCLKQDQFLYENTKIIDTVIAGNKELWKALQEKEEIL
FT                   NRQECSDEDGYKLGELEQIIYDNDGYTAEIFAASLLVGLGIAEKYHYEPLSALSRGYKL
FT                   RVLLAQSLFNNPDILLLDEPTNHLDIISIYWLENYLKNSFKGILIFISHDLAFLNNVAT
FT                   DILDIDYGEIKLYTDNYDNFV"
FT   gene            533782..534606
FT                   /locus_tag="RF_0500"
FT                   /note="RF0500"
FT   CDS_pept        533782..534606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0500"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61351"
FT                   /db_xref="GOA:Q4UM69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM69"
FT                   /protein_id="AAY61351.1"
FT                   /translation="MQAWVDKFRAGTRARQSTFREKQLEKIELPDIQKSSRISPLFRFK
FT                   QLRNSGKLVLKIDQITKDFENKQILNKVSFSVSRGEKIIIIGANGIGKSTLLKILMNKI
FT                   SADQGSHEWGYESQISYFAQDHHELLNENISIIDWLKKQSEKETENTIRNTLGQVLFRS
FT                   DEVIKNILSLSGGEGARLLLAKMMLEKSNILVLDEPTNHLDIESREALKKALIDFEGTV
FT                   ILVTHDRDFAKSIATRIIALSHRKNIVDFKGKYDDYIEKYGNDYLSSAIKLS"
FT   repeat_region   534685..534802
FT                   /note="RPE-6 Full"
FT   gene            complement(535407..536156)
FT                   /locus_tag="RF_0501"
FT                   /note="RF0501"
FT   CDS_pept        complement(535407..536156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0501"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61352"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM68"
FT                   /protein_id="AAY61352.1"
FT                   /translation="MSTKYYKLAFEKLPTQTEIAYSLWSNYRIQGEFEKAKNLIPKVQE
FT                   GCIKYFLEMLTNPYEVSYKSKQFVSIEKNILSPSYLSLYNACEYMAFYNKIPDKQKITI
FT                   KQQATLTKKLEDNSSNNALLAFSLALCSKQFKTASELLNKIPEHQINLYGKAIIKLRSY
FT                   IDPNYTLPQNNTLNPNEKVEVLNAVSTTLIADSKTKLTSEKSEKIFQNVENALQNDSCN
FT                   ENTLEIGVVSALLNNNQEKVQENMQVN"
FT   gene            complement(536300..537058)
FT                   /locus_tag="RF_0502"
FT                   /note="RF0502"
FT   CDS_pept        complement(536300..537058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0502"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61353"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM67"
FT                   /protein_id="AAY61353.1"
FT                   /translation="MKNTEPSIAFKLNIAEVNNTTNILSQNSIRNFRQTTLGLDVETID
FT                   KNFLCIPTVDAAIEVMHYILGHLDSEKAIVSSMKSKELKHSLMQRLIYNYSYESYKNHE
FT                   LLKKYEINKNAGFFEYKLDSEYMDGIPDKIIPITPDTLTKIQVMCSAFQCSILNRHDET
FT                   AKEIFKYIITETNLYFNNFAEETEQYIKCAEYILPVLKLIEPESQLKIIQALVPYIKFS
FT                   LDLSVKFYDLLIKINNFEGAKALLEELTPH"
FT   repeat_region   complement(537096..537241)
FT                   /note="RPE-1 Full"
FT   repeat_region   537405..537473
FT                   /note="RPE-7 Full"
FT   gene            complement(537798..538403)
FT                   /locus_tag="RF_0503"
FT                   /note="RF0503"
FT   CDS_pept        complement(537798..538403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0503"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61354"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM66"
FT                   /protein_id="AAY61354.1"
FT                   /translation="MQMKLTEYFKKLESIAFGPWLNKYKQLFTSKELSTQMFDIIIQAQ
FT                   KNKKHYNKELVILSNDIVEREIGADIKQSEVAIIFSSDHRENLYSIFTWLTNFQLEQYS
FT                   RFILNLPKDYKDYFLQEEQQGGYSKIIAFNNVQDKKWLARKYFNLSKHEPASNYSLFQE
FT                   NTVKLQKYLEYPYEYNTTIYKSEFLGSDSYSNYSCDNI"
FT   repeat_region   538513..538587
FT                   /note="RPE-7 Full"
FT   repeat_region   complement(538643..538767)
FT                   /note="RPE-5 Full"
FT   gene            538786..539514
FT                   /gene="tolQ"
FT                   /locus_tag="RF_0504"
FT                   /note="RF0504"
FT   CDS_pept        538786..539514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="RF_0504"
FT                   /product="TolQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61355"
FT                   /db_xref="GOA:Q4UM65"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM65"
FT                   /protein_id="AAY61355.1"
FT                   /translation="MSTDINNISDSLEIVTQDHLSIFSLISSSDIIGKSVMLMLLIASI
FT                   WSWAIILDKIFKLAQVQRRMKNFENVFWSGGVLEQLYESIKRSVNNPLALIFVSAMDEC
FT                   KSLNTKGLSDALKNNHKERITGAMYLAQNREVEKLEKNLSFLATVGSSAPFVGLFGTVW
FT                   GIMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLISRITLINNKI
FT                   EDFSSELNSILSKAIDQEKM"
FT   gene            539514..539945
FT                   /gene="tolR"
FT                   /locus_tag="RF_0505"
FT                   /note="RF0505"
FT   CDS_pept        539514..539945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="RF_0505"
FT                   /product="TolR protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61356"
FT                   /db_xref="GOA:Q4UM64"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM64"
FT                   /protein_id="AAY61356.1"
FT                   /translation="MAIKLAGSNRKSKRAVVSEISVTPLVDVMLVLLIIFMITSPMLVS
FT                   GVNVDLPETNSSPISGQDEPLVVTINNKGEIFLLETPIERTHLTDKLANITKEKKDARI
FT                   FVRGDRNVSYGQVVEIVAEIHAAGFSRIALISNIKNNEK"
FT   gene            539935..540918
FT                   /locus_tag="RF_0506"
FT                   /note="RF0506"
FT   CDS_pept        539935..540918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0506"
FT                   /product="Periplasmic protein TonB"
FT                   /note="Linking inner and outer membranes"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61357"
FT                   /db_xref="GOA:Q4UM63"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM63"
FT                   /protein_id="AAY61357.1"
FT                   /translation="MKSNQNRDNFTIFLSFSVVLHLLLLYFFLFGMPSLFEKLPEEQTI
FT                   TFEMLPVSDKPNIITQTKQKEAPIENEDAKKSEQSKPKEEEPQDSPKEEKTKELEAKTI
FT                   EEKPKIEEKKPIEEPKPEEAKEALPEKKEEVKEEKPKEEEKKQTEEKKKPEEKKEEVVV
FT                   KKPEEKQKEVKKKEPKTDELDSLLKNLEQSSEGNNVKSNKHQRSKKVDNAKEAKGVYTD
FT                   GLPLSDSETSLIKRQIERHWSNVPAGVRGNNKVKVIISITLDKAGNVEQAKVKERICPN
FT                   IPASVCEALSDNAIRAVWQASPIENLDPARFNHWKEINFSFDPSKL"
FT   repeat_region   complement(540966..540990)
FT                   /note="RR-2 Full"
FT   repeat_region   540991..541092
FT                   /note="RPE-4 Full"
FT   gene            complement(541448..542299)
FT                   /locus_tag="RF_0507"
FT                   /note="RF0507"
FT   CDS_pept        complement(541448..542299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0507"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61358"
FT                   /db_xref="GOA:Q4UM62"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM62"
FT                   /protein_id="AAY61358.1"
FT                   /translation="MSSLTITYIFLITTILISLFCRDKRPAYLGIGVTILAALYQGVIN
FT                   IIGVGALSIFAAITYTYFNLQLNKVLKTLLFISISVCFTAFAFHKVLGFFNLLAIDKIQ
FT                   LSELSIPFSMYLNFDKVMPALIIFSLSDLYILEKQESSDTIKYTLLSLLLCIAIIMVLS
FT                   LISGYVLFEPKIPSILPIWAINNFFLVCMAEEVFFRGFLQRTFQNLLPNRQILAVIIAS
FT                   LIFGVAHFQGGIIYIALSTICGFFYGYTYYKTNKILCSMIVHFGLNLCHLLLFTYPALK
FT                   TL"
FT   gene            542439..543158
FT                   /gene="spoT2"
FT                   /locus_tag="RF_0508"
FT                   /note="RF0508"
FT   CDS_pept        542439..543158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT2"
FT                   /locus_tag="RF_0508"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61359"
FT                   /db_xref="GOA:Q4UM61"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM61"
FT                   /protein_id="AAY61359.1"
FT                   /translation="MGDFMKDIEYWEKNFESCKYSNKLIERLLFFNTQVKQPVDIREVK
FT                   KGIYYARKYHGEQMRQSGDPYYSHPIAVTIMVAEFVAKEVPKLFTFRMLQAALLHDTIE
FT                   DTELTEEMISNIFDEEVARHVEGLTRIKPCGKISSEKSLILLIKQERYDTALIKLFDRI
FT                   HNLQTLEAKSPEKAHKIIKETLKSFLVLSEILEIPSVSELIYAECYKNNLKFNINSTFN
FT                   KIINFDSFPFSQNKLLP"
FT   gene            complement(543109..544425)
FT                   /gene="proP2"
FT                   /locus_tag="RF_0509"
FT                   /note="RF0509"
FT   CDS_pept        complement(543109..544425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP2"
FT                   /locus_tag="RF_0509"
FT                   /product="Proline/betaine transporter"
FT                   /note="MFS type sugar transporter PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61360"
FT                   /db_xref="GOA:Q4UM60"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM60"
FT                   /protein_id="AAY61360.1"
FT                   /translation="MLGYEKEQRSLNKEQKQAVGLLSIGTFLEYFDLMLYVHMGVLLNN
FT                   LFFPEYDPFTFSLLTAFSFCSTYLLRPIGALIFGYIGDHFGRKIVVVLTTLLMAITCVI
FT                   IGSMSTYAQIGITASWVLTICRIIQGMSATAEARGAELYLTENSSPPIQYPLVAIITVF
FT                   SAIGTTVALGIASIFTNQNIYQHESSWRIAFFVGATIAFVGTIARTSLKEADAFSNKKN
FT                   KLKLRLQENNITLEEIDKDILDQQVPNATSIWYFFIQCARPPCFYFVYIYCGDILKREC
FT                   GFTPNQIINQNFWISIIDLLGIIGLAFISYKIHPLKILKVKLYLFFTSLIFFPIVLNYN
FT                   PTPLYIFIFQCLAALFVFDHVPAAPIFYKYFPVFKRFTYTSMLSAIAKLFTYIITSFGL
FT                   VYITNYLGYWGLFLIFIPVGITFFMGVTYFERMEKNRNL"
FT   gene            complement(544565..546100)
FT                   /gene="aprE"
FT                   /locus_tag="RF_0510"
FT                   /note="RF0510"
FT   CDS_pept        complement(544565..546100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprE"
FT                   /locus_tag="RF_0510"
FT                   /product="Alkaline protease secretion protein AprE"
FT                   /note="Type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61361"
FT                   /db_xref="GOA:Q4UM59"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM59"
FT                   /protein_id="AAY61361.1"
FT                   /translation="MQDLKHNKPQITPEQLKQLLSLREDSLNLKGQSSKRKALINTTLK
FT                   KTSHVIEFLLVKLDRFVNFTTKKTDKDRNNVAQAARSPILFGIYVIIFLVLIGGLWAAL
FT                   APLDSGAVAVGIVMPSTNKKTIQHNEGGIINAIYVKQGDKVKEGDKLIELEETRIKSEH
FT                   ENILGQYRNFLATENRLIAERDNLEQIEFSDFLMQDINLPEVAKIIHTQENLFRSRKEV
FT                   YNSEKDALHQNIAQLEKKIEGLEAKKVAASKTAEVYQDRLKALRTLKEKGFVQKAALLD
FT                   QEAKVAASKSDVATTEAEIAGIRHAITETQIKIINQQNKYTERTLTELREAQVQTASLK
FT                   EKYNSLTDSLNRVIIRSPVDGIVNNLKYHTIGGVISHGQPIMEISPINDPLIIEAKVSQ
FT                   KNIDSVHEGLVAKIRFSAFKSRTTPTFTGKVVSISPDIVQDERQHPGQQQDNYYVARVE
FT                   IDMDEFNKVAKVKNLELHPGMQAEVQIVTGTRTLLRYLLDPVTDTAFKAFREK"
FT   repeat_region   complement(546131..546231)
FT                   /note="RPE-7 Full"
FT   gene            complement(546302..548056)
FT                   /gene="aprD"
FT                   /locus_tag="RF_0511"
FT                   /note="RF0511"
FT   CDS_pept        complement(546302..548056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprD"
FT                   /locus_tag="RF_0511"
FT                   /product="Alkaline protease secretion ATP-binding protein
FT                   AprD"
FT                   /note="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61362"
FT                   /db_xref="GOA:Q4UM58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM58"
FT                   /protein_id="AAY61362.1"
FT                   /translation="MYNNNNNLNKKNPLVIALGECRTAFWIVFWFAFVINLLMLITPLY
FT                   SLQVLDRVLGSGNLQTLLFLSIIIAYIYFVYGLLQIARSFTLIKVGEWLDRTVAPVIFA
FT                   SSISAAATRANMGSSQLLRDFQAVKTFLTSTGINTLFDAPWSLIYIAVIFSIHPYIGLI
FT                   TVFGAVIIVSTAFFNAAATNKTLGEATEFSIKGMTQADIANRNAEAIEAMGMMKNVTKN
FT                   WHKFNILALDKQSVASYRNGVISNFSRFIRNIMQMAVTGVGAYIVVKSHSADMTPGNMI
FT                   MSSIIVGRALAPFDNAIDLWKSMSGAIKSYKNINNLFNTYSSRDEAMPIPNVDGHLTVE
FT                   NIYYAHPIPKHLPQPPVQKYILKGVSFAVQPGEVLAIIGPSATGKSTLAKIIVGVWKES
FT                   SGSVRLDSAEIYRWNREDFGRHVGYLPQGIELFSGSIKQNIARMEEDADPQKVIEAAKI
FT                   AGAHEMILRFPDGYDSDIGPAGSNLSGGQRQRIGLARAFYGNPKLIILDEPNANLDEAG
FT                   EVALASALKQAKLKGIAVVVISHRPSVLSVVDKILILQDGAVAVYGTEEEIQKHFKTLK
FT                   SGTIHINN"
FT   gene            complement(548067..549083)
FT                   /gene="asd"
FT                   /locus_tag="RF_0512"
FT                   /note="RF0512"
FT   CDS_pept        complement(548067..549083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="RF_0512"
FT                   /product="Aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61363"
FT                   /db_xref="GOA:Q4UM57"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM57"
FT                   /protein_id="AAY61363.1"
FT                   /translation="MTKKYNIAVIGATGNVGRETLNILAERNFPVNKIYAIASDNSIGR
FT                   EISYGEKILKISSLTNLNFDDIDIAFFCAGSEVSKEFVPKATASSCVVIDKSSLFRVDN
FT                   QVPLIVPEVNLSTLTEFNTKNIIANPNCIVIPLAVALKPLDNEIKIKRVVISTYQSVSG
FT                   AGKAGMDELYDQTKSKYVFGENDPKKFPKQITFNLFPHIGDLNKDGYTSEEAKIAFELN
FT                   KIMGNHFKASVTSVRVPVFIGHSISVNIEFNDKMDANIAEEILQDADGIVTISNNNDLA
FT                   YISPVEVVGEDAVYVSRIRNDVSKPNAINLWITCDNLRKGAALNSVQIAEELINNYL"
FT   gene            complement(549080..549439)
FT                   /gene="pkcI"
FT                   /locus_tag="RF_0513"
FT                   /note="RF0513"
FT   CDS_pept        complement(549080..549439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkcI"
FT                   /locus_tag="RF_0513"
FT                   /product="Protein kinase C inhibitor 1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61364"
FT                   /db_xref="GOA:Q4UM56"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM56"
FT                   /protein_id="AAY61364.1"
FT                   /translation="MMYNKENVFAKIIDKNLPAKIIYEDEQILAFKDIAPVAPVHIIVI
FT                   PKNEYIDYADFISKAQIDEIKHFFAKISDIANEAGLDKDGYRLITNKGEKSGQTIFHFH
FT                   FHIIGGEKLIGLINK"
FT   repeat_region   549500..549568
FT                   /note="RPE-7 Full"
FT   gene            complement(549574..549927)
FT                   /locus_tag="RF_0514"
FT                   /note="RF0514"
FT   CDS_pept        complement(549574..549927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0514"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61365"
FT                   /db_xref="GOA:Q4UM55"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM55"
FT                   /protein_id="AAY61365.1"
FT                   /translation="MNIYAIYINSTQKNNNFIVIEEGFSWIAALLSIFWALYHKMWLVV
FT                   AIVVIANIIVTAINIEELKFIFKIALILGFGFFASDIRENYLKRNNYRLEDIIIANSSI
FT                   EAELKFLARSMLI"
FT   repeat_region   complement(549990..550064)
FT                   /note="RPE-5 Partial"
FT   repeat_region   complement(550115..550241)
FT                   /note="RPE-5 Full"
FT   gene            550319..550867
FT                   /gene="hslV"
FT                   /locus_tag="RF_0515"
FT                   /note="RF0515"
FT   CDS_pept        550319..550867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="RF_0515"
FT                   /product="Heat shock protein HslV"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61366"
FT                   /db_xref="GOA:Q4UM54"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM54"
FT                   /protein_id="AAY61366.1"
FT                   /translation="MSDNLALHGTTILCLKKNEEIIIAADGQVSHGNTILKSTARKLRT
FT                   IANNKIIAGFAGSTADGLALFEKLEVKIEQHKHNLLRSAVELAKDWRSDKYLRRLEAMM
FT                   IVADRNHILILTGNGDVVEPENNVAAIGSGGLFALSAARALMSYENNLTAEEIALKSMN
FT                   IAADLCVFSNHNIIMEKVV"
FT   gene            550864..552216
FT                   /gene="hslU"
FT                   /locus_tag="RF_0516"
FT                   /note="RF0516"
FT   CDS_pept        550864..552216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="RF_0516"
FT                   /product="Heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61367"
FT                   /db_xref="GOA:Q4UM53"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM53"
FT                   /protein_id="AAY61367.1"
FT                   /translation="MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNR
FT                   CRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVG
FT                   RDVESIIRDLVEIAVNTKKTLAKMEVDINAREKAIERILDSLVGKTSSSETREKFKEKI
FT                   LNGKLDDTEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKML
FT                   VKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSGAKNAEISR
FT                   EGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELN
FT                   SLTKDDMIKILLEPETSLVKQYSALIGTEDVHLEFAASAIEKIADYAITVNLEVEDIGA
FT                   RRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL"
FT   repeat_region   552271..552338
FT                   /note="RPE-7 Full"
FT   gene            552379..552519
FT                   /locus_tag="RF_0517"
FT                   /note="RF0517"
FT   CDS_pept        552379..552519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0517"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61368"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM52"
FT                   /protein_id="AAY61368.1"
FT                   /translation="MKKNFMIIHIASLMFNGIDIINVDVQVQISPGIPAFTIVGLADKT
FT                   S"
FT   gene            552665..553915
FT                   /locus_tag="RF_0518"
FT                   /note="RF0518"
FT   CDS_pept        552665..553915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0518"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61369"
FT                   /db_xref="GOA:Q4UM51"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM51"
FT                   /protein_id="AAY61369.1"
FT                   /translation="MNILPELEIAEYLIIGELSLDGSILPVSGALPAAIGASARGKGLI
FT                   CSSKNSSEVAWSGNDNILVAGNLIELVNHFKGSQVLTPPEAKLQDEPINYPDFKDIKGQ
FT                   KIAKRALEIAASGGHNLLMFGPPGTGKSRLAACLPSILPKMSTKEILECSTITSIAGKF
FT                   SDGKLTKIRPFRTPHHSCSLAAMVGGGVGKKVKPGEITLAHNGVLFLDELPEFPHNVID
FT                   SLRQPIENGEILISRSSAHIKYPANFQLIAAMNPCKCGYLGDTYKECMKAPKCDSDYQM
FT                   KVSGPIMDRFDLHIEVSNINIYNYDFITDNSEEKSEDIAIRVENVRLIQEKRYEGYNIK
FT                   TNNRLDGQLLIDYAMPADEGRDLLNEAANKFRLSMRVYNRILRVARTIADLENVDKVLK
FT                   IHIAEALSYRKMEFNNM"
FT   repeat_region   complement(553950..554016)
FT                   /note="RPE-7 Full"
FT   gene            554105..555277
FT                   /gene="lpxB"
FT                   /locus_tag="RF_0519"
FT                   /note="RF0519"
FT   CDS_pept        554105..555277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="RF_0519"
FT                   /product="Lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61370"
FT                   /db_xref="GOA:Q4UJN0"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UJN0"
FT                   /protein_id="AAY61370.1"
FT                   /translation="MTKIYFIAGETSGDFIGGRIIQHLKDNIEIKCMGVGGKYMEEAGS
FT                   FKSLFSITSINLMGFVEILPHIFKLKKLIDKTVEDITNSRADLLITIDSPGFTYRVAKR
FT                   VRKLLPKLKMIHIVAPSVWAYKEDRAVKYAQIYDCLFALLPFEPPYFTRLGLDCRYIGH
FT                   PIMEQEFYSDKVALRKEFKIDENERVLCVTLGSRKGEILRHLPVFVSSIEEIFKSCNNL
FT                   KVIFTLANPAHEAIIKPFLEDVKFNYLFSSERLKTYAVADAALAKSGTNTLEIAASGTP
FT                   MIVAYKVNLISFFIIRLLIKIKYVTLINIIAGSEIIPEFIQFNCRASLISNKLQELLFN
FT                   SKKAYEQVIESQKILQKLGFESNRSPSYIAAEIIKQEFLKPKIKLLKEKD"
FT   gene            complement(555246..555545)
FT                   /locus_tag="RF_0520"
FT                   /note="RF0520"
FT   CDS_pept        complement(555246..555545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0520"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61371"
FT                   /db_xref="GOA:Q4UJM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJM9"
FT                   /protein_id="AAY61371.1"
FT                   /translation="MIQDHNTDLKHEEHTERLKALQNKLGNLSGFLTTMRSDNNEEYKK
FT                   ISNDLEILMKKINTIRKNMEIYFVIILILMFIIIQKMLWTTGSSTNLSLLTTLF"
FT   gene            555904..556923
FT                   /locus_tag="RF_0521"
FT                   /note="RF0521"
FT   CDS_pept        555904..556923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0521"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61372"
FT                   /db_xref="GOA:Q4UJM8"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJM8"
FT                   /protein_id="AAY61372.1"
FT                   /translation="MLKNLLKTKLFLVIVSLTIFITLLNFSIFYIFVPGNLTQNKTIII
FT                   EPKLSVNQIVTKLYSNEVIKYPRIFKVIAKIYSIKRPLKSGEYVFTRNISPLQTLRILA
FT                   SGKSIIHKIIVPGGTVVGEVIKKINEESRLLGEIKGIIPEGFLMPSTYFFSYGDQKEQI
FT                   IDQMRNLMSANLDKVMQNLSPDSPLKTRLEVLTLASIIEKEAGSNAEKPIIAAVFINRL
FT                   KKNMKLQADPTTIYALTEGKFKLARALTKKDLLQELPYNTYYIKGLPPGPISCPSLKSL
FT                   EAVVKPAKTDALFFVVDGKGGHNFSNNLNDHNRFVETYRKSLIRVPEPEIDPDKPSTR"
FT   repeat_region   complement(556913..557036)
FT                   /note="RPE-5 Full"
FT   gene            557063..557368
FT                   /gene="cyaY"
FT                   /locus_tag="RF_0522"
FT                   /note="RF0522"
FT   CDS_pept        557063..557368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="RF_0522"
FT                   /product="CyaY protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61373"
FT                   /db_xref="GOA:Q4UM50"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM50"
FT                   /protein_id="AAY61373.1"
FT                   /translation="MNNTEFSKIAETTIAYIADKIEEQDKEASIDVDLQGDILNLDTDK
FT                   GIYVINKQSAAKEIWLSSPVSGPYHFFYEQGKWKNKIGLELMAILTEELNIKFDNI"
FT   gene            557365..558114
FT                   /locus_tag="RF_0523"
FT                   /note="RF0523"
FT   CDS_pept        557365..558114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0523"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61374"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM49"
FT                   /protein_id="AAY61374.1"
FT                   /translation="MKDFETADSAEKVYNLIIENAPTDTSIFFDVDDTFLTPKSKTFRK
FT                   APYNQMIDRIKENKNNYDNYEEIVSNWRFQRKVILIDEEWAEVINKLKAKFPVYALTQM
FT                   NTGEFGNILSMQDWRYKELKSLGIEFSDNEELAACSSGQKDDAICYKGIFITGNHSKSG
FT                   TLSKFSDELNTSFIVFVDDREKHVEDVRDYCKKNKIGFLGILFDGLKHLMGEPDPKLAA
FT                   FQESYLIENAKWLEDEEAYELMAESNY"
FT   repeat_region   complement(558185..558278)
FT                   /note="RPE-4 Full"
FT   repeat_region   558279..558303
FT                   /note="RR-2 Full"
FT   gene            558373..559140
FT                   /locus_tag="RF_0524"
FT                   /note="RF0524"
FT   CDS_pept        558373..559140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0524"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61375"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM48"
FT                   /protein_id="AAY61375.1"
FT                   /translation="MDFLKNFLIIFIILIPNLVLANTYRQINYKITPLSNMPVSAIKVE
FT                   TEIIGDMSGEVILDLPYAWANATYYKQIKNVKLEYPIGKLQFRNQDSNEAILNTGKINI
FT                   IRLSYEIYQKTGNPCDVHEAIIRQNLIHSPGYGLFATPGDLNGNDIVEFNVEWNNIPEA
FT                   WQAISDYGLGKSVKFKATRIELYSAVYAAGDLRVYKIVDQKNPVYLSLHGQFDLKDEEI
FT                   ASYINKIIKGQRAFFHDNDFPYYVISLIEGDEP"
FT   gene            559127..560029
FT                   /locus_tag="RF_0525"
FT                   /note="RF0525"
FT   CDS_pept        559127..560029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0525"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61376"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM47"
FT                   /protein_id="AAY61376.1"
FT                   /translation="MMSHDHMGGTGLTNSFTAFIPQGLDKQDYITLLAHEHLHNWTGKK
FT                   IRNNLGGLNYWWSEGFTDYYSRVLALRSSVITLEEFVEEFNQFFENYYLSPVINEPNNL
FT                   IKTDYWKDYAIQRLPYYRGFVFALYLDNLIKENNRSKSLDNVMLVLFKTSKEQEFSSDY
FT                   FKKVIKDYVPKGIDKEINEYIEQGKTIDLADVAKVLPIEKIKMGAYDRGFDKDALINNY
FT                   TIKNIDENSNAYKSGLRNGDIVIKYDFPKWGSPDQIVTIKTTKGEFKFRPENANKKDIY
FT                   RFKPNLSKEDKLKIKKFFS"
FT   gene            560157..560741
FT                   /gene="bioY1"
FT                   /locus_tag="RF_0526"
FT                   /note="RF0526"
FT   CDS_pept        560157..560741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioY1"
FT                   /locus_tag="RF_0526"
FT                   /product="BioY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61377"
FT                   /db_xref="GOA:Q4UM46"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM46"
FT                   /protein_id="AAY61377.1"
FT                   /translation="MRYTMNSLLKVLYPNRVVEHLNTNSYALDIVKIIMGVVAIFASSQ
FT                   ISIPIKPVAITMHSVILCIIAFTYSPRLSFLTILTFIFIGVMGLPVFCKFSSGINYFLG
FT                   AAGGYYLGFLIGTPVMSALKDKLAENFMNVTIICIIGHTIFYLFGVSWLASMIGLKQAI
FT                   YSGFIIFIPSGLAKLFVFSSLFSYVKNLRQK"
FT   gene            560751..561680
FT                   /gene="bioB"
FT                   /locus_tag="RF_0527"
FT                   /note="RF0527"
FT   CDS_pept        560751..561680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="RF_0527"
FT                   /product="Biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61378"
FT                   /db_xref="GOA:Q4UM45"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM45"
FT                   /protein_id="AAY61378.1"
FT                   /translation="MKKWTFDEAKEIFSFSFMELVYQAQTIHRANFDPNKIQISSLLSI
FT                   KTGSCPENCKFCPQSSHYKTYVKKEPLMQIEDVITAAKRAKAAGSTRFCMGAAWRGPRD
FT                   EDLKLVCEMIKEVKKLGLETCVTLGLLKEHQAVTLKEAGLDFYNHNIDTSEEFYNKIIT
FT                   TRTFQDRLDTLRYVRASGMKVCCGGILGMGETNDDRINMILTLANLEEPAESVTINKLI
FT                   KIPGTPLENVQDIDPFDFVRVIALARIMIPKSYIRLSAGREQMSDELQALCIMAGVYSI
FT                   FYGEKILTSANPMPERDNDLFQKLGIIH"
FT   gene            561893..562288
FT                   /locus_tag="RF_0528"
FT                   /note="RF0528"
FT   CDS_pept        561893..562288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0528"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61379"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM44"
FT                   /protein_id="AAY61379.1"
FT                   /translation="MYATLATEHAINVIENGASAVCSIQGVISDVSTNYSFISTFAQAT
FT                   VASLATFAYYNPPVLIGACALGAIAISPYDSIKCAENTIKAGIAAGYVACETVEGLMAG
FT                   AAGIVSLIADNIYGDTVQNLLVLLILT"
FT   repeat_region   complement(562312..562455)
FT                   /note="RPE-1 Full"
FT   repeat_region   562516..562635
FT                   /note="RPE-6 Full"
FT   gene            complement(562734..564077)
FT                   /gene="gltX1"
FT                   /locus_tag="RF_0529"
FT                   /note="RF0529"
FT   CDS_pept        complement(562734..564077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX1"
FT                   /locus_tag="RF_0529"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61380"
FT                   /db_xref="GOA:Q4UM43"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM43"
FT                   /protein_id="AAY61380.1"
FT                   /translation="MTKIITRFAPSPTGMLHVGNIRAALLNWLYAKKHNGQFILRFDDT
FT                   DLERSKQEYKDAIEEDLKFLNLNWDQTFNQLSRLSRYDEIKNLLLDKKRLYACYETPEE
FT                   LELKRKFQLSKGLPPIYDRASLNLTEEQTQKYIEQGRKPHYRFLVNHEPISWHDMIKGE
FT                   VKYDGKALSEPIVIRADGSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQIQMFEALN
FT                   TTPPTFGHLSLIINKDEKISKRVGGFEITTLRKEIGLEAMAIASFFSLLGSSAQILPYK
FT                   SMEKLANQFEISSFSKSPTIYQPEDLERLNHKLLISLDFDEVKNHLKEIDAEYIDENFW
FT                   LSVRPNLQKLRDVKDWWEICHKTPNVKSLNLDKEYLKQAAEVLPQGKITKDSWSIWTKE
FT                   ITNITGKKGKELFLPLRLALTGRESGPEIASVLPLIDREEIIKRLTSA"
FT   repeat_region   564114..564234
FT                   /note="RPE-6 Full"
FT   gene            complement(564265..566595)
FT                   /gene="topA"
FT                   /locus_tag="RF_0530"
FT                   /note="RF0530"
FT   CDS_pept        complement(564265..566595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="RF_0530"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61381"
FT                   /db_xref="GOA:Q4UM42"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM42"
FT                   /protein_id="AAY61381.1"
FT                   /translation="MKLVIVESPAKAKTINKYLGDEFKVIASFGHIRDLPSKKGSVLPD
FT                   ENFAMKYDISDKAGKYVDAIVKDAKKADAVYLATDPDREGEAISWHVAEVIKEKNKVKS
FT                   DDFFKRVAFNEITKKAIIHAVENPRKLDANLVNAQQARRALDYLVGFTLSPLLWRKLPG
FT                   CKSAGRVQSVALRLICEREDEIERFKSEEYWDISLKMQNSNNELFTAKLTHVNDQKLEK
FT                   FSIINEKDAKDLTEKLKSQNFHVDKIEKKQQKRQPQPPFITSSLQQEAARKLGFSAKKT
FT                   MQIAQKLYEGVDIGKETIGLITYMRTDGVTLSNDAIADIRKLIDKNYGDKYLPNSPRIY
FT                   KSKVKNAQEAHEAIRPTNITYTPDSLKEKLEKDYYKLYELIWKRTIACQMENVIMDLVV
FT                   ASLASENKEYLAKANGSTIAFDGFYKVYRESVDDEAEEENKMLPPLKEQEPLKTKEIIP
FT                   NQHFTEPPPRYSEASLVKKLEELGIGRPSTYASILSVLQDRKYVSLEKKRFMPEELGRL
FT                   VTVFLVGFFKKYVEYDFTAGLENELDEIAAGKLEWKAALNNFWSGFNHNIESVNEQKIT
FT                   EIISYVQKALDYHLFSENKESKACPSCKTGELSLKLGKFGAFLACSNYPECTFRKSIVS
FT                   GNDNNENDGDLAATPNENKVLGTDKDGIEIYLKKGPYGPYVQLGEQEGKVKPKRSPVPA
FT                   SLNQNDITLEMALKLLSLPLKIGIHKDSGEEIMIGYGKFGPYIKYMGKFISIPKKYDFL
FT                   NLSLDDAMKLIEDNKAKLEKKQA"
FT   repeat_region   complement(566656..566788)
FT                   /note="RPE-6 Full"
FT   gene            complement(566795..567943)
FT                   /gene="dprA"
FT                   /locus_tag="RF_0531"
FT                   /note="RF0531"
FT   CDS_pept        complement(566795..567943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="RF_0531"
FT                   /product="Putatie DNA processing protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61382"
FT                   /db_xref="GOA:Q4UM41"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM41"
FT                   /protein_id="AAY61382.1"
FT                   /translation="MLKELFSAPKISYDIETINILRLIRSENIGPKTFFSLIKLFGDAA
FT                   TAIDNAPDFSLRGGKSKPIKIFSKSDAEKELELLEKDNAKIITYKSPEYSKLLLEIYDP
FT                   PPILSYKGNIELLNHNKCVAIVGARNASANGRSFAHKIANDLVKEGYITISGLARGIDS
FT                   SVHQAAISQTIGVIAGGIDHIYPPENKKLFENLAEEGLILAELPIGSTPLGKHFPQRNR
FT                   IISGLALGVVIVEASLKSGSLITAKFALEQNREIFAVPGFPLDPRCQGTNKLIREGAYL
FT                   VESVDDIVANLPQYEEFMKKDNGLFKDFVELGTVNTRYVKEPSQKERTAILELLSSVPI
FT                   DFEFLQKETELSLPIIYTVILELELAGKAIRHAGNKISLVYA"
FT   repeat_region   complement(567986..568057)
FT                   /note="RPE-7 Full"
FT   gene            complement(568114..568722)
FT                   /gene="tdpX1"
FT                   /locus_tag="RF_0532"
FT                   /note="RF0532"
FT   CDS_pept        complement(568114..568722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdpX1"
FT                   /locus_tag="RF_0532"
FT                   /product="Thioredoxin peroxidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61383"
FT                   /db_xref="GOA:Q4UM40"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM40"
FT                   /protein_id="AAY61383.1"
FT                   /translation="MNMSVFVGKTAPDFTAKAIMPNNNIDEKFKLSDYAAGDNIVLFFY
FT                   PLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFP
FT                   MVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVIDAL
FT                   THHQKHDEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL"
FT   gene            complement(568798..569733)
FT                   /gene="hflC1"
FT                   /locus_tag="RF_0533"
FT                   /note="RF0533"
FT   CDS_pept        complement(568798..569733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC1"
FT                   /locus_tag="RF_0533"
FT                   /product="Membrane protease subunits"
FT                   /note="Stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61384"
FT                   /db_xref="GOA:Q4UM39"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM39"
FT                   /protein_id="AAY61384.1"
FT                   /translation="MEYALLIFSIIAILVIIQMVKVVPQQQAWVVEKLGKFDKVLQPGL
FT                   NLLIPVIQKVAYKHTLKEEAIDVTAQTAISNDNVTLSIDGVLYVKIIDPIAASYGVNNP
FT                   YYAITQLAQTTMRSEIGKLPLDKTFEERETLNVAIVAAINQAAINWGIQCMRYEIKDIQ
FT                   PPQTILKAMELQVAAERQKRAQILESEGNRQAKINHAEGEKAQIVLNSEASYTDQINRA
FT                   KGEAEAIGLVATATANSIEIVAAAVQKTGGSDAVALKIAEQYISAFGNLAKDTNTVILP
FT                   TNLSEPSSFVTGALTIFNQLKASSEKKIDK"
FT   gene            complement(570104..571672)
FT                   /locus_tag="RF_0534"
FT                   /note="RF0534"
FT   CDS_pept        complement(570104..571672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0534"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61385"
FT                   /db_xref="GOA:Q4UM38"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM38"
FT                   /protein_id="AAY61385.1"
FT                   /translation="MLKIIQKHLDTKLIKLSAILAFIYCLLFNTAILIYKFDYYKATIF
FT                   RGILELSKDFCYIYIFSFIAFFGLSVHKLVLKIGVGFLFITSAIASYYIYFFKINPTKQ
FT                   VIGSFFSTDLNEVYELVSIKLIIWIIFCLFSCFYTLKSFAAENSKSFVTKLLSAACLLI
FT                   FVYNIITPSFKILKNYFPIQYLHNSYLNFAGNLTGKNYACIDISKQYNFIDKSDKDIIG
FT                   VLVIGESARFDHFGINGYERDTTPYLKTAQNLTSFKAKSSSNLTYLSVPSLLSRYPASQ
FT                   IENTRQENSFLSILTNLGFNTTWIGTQTLMRNFANFDLSNIYNDVNFTIVPGGSALFSL
FT                   NDHDEKILPFIKEIITNSEKQFLVVHTSGSHWNYNARYPKEFEHFTPTCPIKVKGDASD
FT                   CDKLALVNSYDNSILYTDFFLSNLIDLLKDKNAFLLYVSDHGESLGENGYYGHGGPLLV
FT                   EQITVPLIVWVSDDFREKYPESVDSIKNYANTEISHDYVFHSILDCLNIDSDIIDKDLS
FT                   ICKSS"
FT   gene            571708..572172
FT                   /locus_tag="RF_0535"
FT                   /note="RF0535"
FT   CDS_pept        571708..572172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0535"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to predicted endonuclease involved in
FT                   recombination"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61386"
FT                   /db_xref="GOA:Q4UM37"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM37"
FT                   /protein_id="AAY61386.1"
FT                   /translation="MIIKNLQEFYPLLIPNAPLIAIDYGSKKLGIALSNQERNIAMPLN
FT                   TIIEINKKIVITSLLSIIEKYKVCGVVIGLPIDMSGAVTEQTNIVMKFAEELAKSINLP
FT                   IYLQDERLTTKAANNFLKSFGVKRKDRNNNDDAVAASMILETVLDSMKKL"
FT   repeat_region   572220..572356
FT                   /note="RPE-6 Full"
FT   gene            572451..572612
FT                   /locus_tag="RF_0536"
FT                   /note="RF0536"
FT   CDS_pept        572451..572612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0536"
FT                   /product="Plasmid maintenance system antidote protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61387"
FT                   /db_xref="GOA:Q4UM36"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM36"
FT                   /protein_id="AAY61387.1"
FT                   /translation="MGISQSKLARDIDVPVTRINNIIKHHRSITADTALRLGKYFNVNP
FT                   RWWMNMQN"
FT   gene            572700..572939
FT                   /locus_tag="RF_0537"
FT                   /note="RF0537"
FT   CDS_pept        572700..572939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0537"
FT                   /product="Transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61388"
FT                   /db_xref="GOA:Q4UM35"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM35"
FT                   /protein_id="AAY61388.1"
FT                   /translation="MIVQKSYIDNNGRLVIPIKVRQKLKLKIGDKVTIKYNNSELIISS
FT                   FYSNIEKARNILDKYKDIDLYKELKLMRKEEDIN"
FT   gene            573036..573893
FT                   /locus_tag="RF_0538"
FT                   /note="RF0538"
FT   CDS_pept        573036..573893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0538"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61389"
FT                   /db_xref="GOA:Q4UM34"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM34"
FT                   /protein_id="AAY61389.1"
FT                   /translation="MKILILGVTGMLGNSMFRFLSQDSKFDVCATARNNFARSYFSKDL
FT                   SDKLITNVDVENHDSLVEVFINKTKPEIVINCIGLVKQLADANDPLKALPINSLLPHRL
FT                   ANLCKLANSRLIHISTDCVFSGKKGNYKESDFPDCYDLYGRSKFLGEVDYPHAITLRTS
FT                   IIGHELAGNRSLINWFLSAEGQVKGFEKAIYSGFPTVELARIIRDFVLPNKELHGLYHV
FT                   ASKPINKLELLKLVAAIYDKKIDIIPSDELVIDRSMDSTRFNEATGYNPPEWPELVKRM
FT                   CEFG"
FT   repeat_region   complement(573936..574003)
FT                   /note="RPE-7 Full"
FT   gene            574092..575117
FT                   /gene="capD"
FT                   /locus_tag="RF_0539"
FT                   /note="RF0539"
FT   CDS_pept        574092..575117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capD"
FT                   /locus_tag="RF_0539"
FT                   /product="CapD protein"
FT                   /note="Predicted nucleoside-diphosphate sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61390"
FT                   /db_xref="GOA:Q4UM33"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM33"
FT                   /protein_id="AAY61390.1"
FT                   /translation="MFVDKTLMITGGTGSFGNAVLSRFLKSDITNDIKEIRIFSRDEKK
FT                   QEDMRIALNNPKLKFYIGDVRNYKSIDEAMHGVDYVFHAAALKQVPTCEFYPMEAINTN
FT                   VLGAENVLSAAINNKVAKVIVLSTDKAVYPINAMGLSKALMEKLAVAKARMRSQGETVL
FT                   CVTRYGNVMASRGSVIPLFINQIKQDKDLTITEPSMTRFLMSLVDSVDLVLYAFEHGRQ
FT                   GDIFVQKSPASTIEVLAKALQEIFGSKNELRFIGTRHGEKHYESLVSSEEMAKADDLGG
FT                   YYRIPMDGRDLNYAKYFVEGEKKVALLEDYNSHNTKRLNLEEVKELLLNLDYVQEELKN
FT                   A"
FT   gene            575110..576243
FT                   /gene="rffE"
FT                   /locus_tag="RF_0540"
FT                   /note="RF0540"
FT   CDS_pept        575110..576243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffE"
FT                   /locus_tag="RF_0540"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61391"
FT                   /db_xref="GOA:Q4UM32"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM32"
FT                   /protein_id="AAY61391.1"
FT                   /translation="MLKVMTIVGTRPELIKLCCVISEFDKYTNHLLVHTGQNYAYELNQ
FT                   VFFDDMGIRKPDYFLEVAADNTAKSIGLIIEKVDEVLEKEKPDAVLFYGDTNSCLSAIA
FT                   AKRRKIPIFHMEAGNRCFDQRVPEEINRKIIDHISDVNITLTEHARRYLIAEGLPPELI
FT                   FKSGSHMPEVLDRFMPKILKSDILDKLSLKSKQYFLISSHREENVDVKNNLKELLSSLQ
FT                   TLIKEYNFPVIFSTHPRTKKRLEDLEGFKDLGDKIRFLPSFGFTDYVKLQMNAFCILSD
FT                   SGTITEEASVLNLPALNIREAHERPEGMDAGTLIMSGFKAERVLQSVKAITEEHENNKR
FT                   LQDIVSDYAEAGLVSKKILRIVLSYVDYVNRSVWFKK"
FT   gene            576203..576955
FT                   /locus_tag="RF_0541"
FT                   /note="RF0541"
FT   CDS_pept        576203..576955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0541"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61392"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM31"
FT                   /protein_id="AAY61392.1"
FT                   /translation="MWIMLIAAFGLRSNPIHYCHIKNMKFFKLIKPNTLFLSVFLLITL
FT                   ISSFCYSKENSYKKIVFLVSTEIFGGKGVYAMYNEMKKIGHDVKIVIVPHPHPNIQGGI
FT                   DTEFISKFDTQDVIYPCGKYASYSNVNTKCEISELKNYQPDSIFTQNPYENFQGYISEP
FT                   FTAANLYKSFRGTKTKIMYIVYGPHIFHQKNIDDDKLSSFIETVFVDSESTKDIFISNY
FT                   KFPKDRVIVSGYQPYYEVRNYNIGEKPN"
FT   gene            577562..578230
FT                   /locus_tag="RF_0542"
FT                   /note="RF0542"
FT   CDS_pept        577562..578230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0542"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61393"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM30"
FT                   /protein_id="AAY61393.1"
FT                   /translation="MYILEEIYNDGERLIPGETHDVLEVIRHKSSYKFFKKIIEADILN
FT                   SPLIINQKIKILDIGCGTGHGTFMLSDMLGVEITAIDISKESIIYAEQNYGASNIKYIK
FT                   SDLVSFIKKAEEYDYIVSRHALEHIEDGLNLALNLKCKKRLIVNVPFNEPEGNIYNLVN
FT                   WITEKDFTSYTNREFFYEGLDGVTNDTHSEENPPNSIICVSSNSDLKPIKQLFNYPISA
FT                   "
FT   repeat_region   complement(578496..578597)
FT                   /note="RPE-4 Full"
FT   gene            578677..580485
FT                   /locus_tag="RF_0543"
FT                   /note="RF0543"
FT   CDS_pept        578677..580485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0543"
FT                   /product="Two-domain glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61394"
FT                   /db_xref="GOA:Q4UM29"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM29"
FT                   /protein_id="AAY61394.1"
FT                   /translation="MITKKDKPLNIYCPLVSIIIPVYNGANYMREAIDSALAQTYENIE
FT                   IVVVNDGSKDNGETENVALSYGDKIRYFHKENGGCGSALNYGIKNMKGEYFSWLSHDDI
FT                   YYPNKIEHQVNILNKLDNKDTIIYGGYELIDEKGSSLRYIKPDSVLPINKLNISLLPLL
FT                   RGLIHGCSLLIPAKYFHEIGIFNEALPTTQDYDLWFKILRVAPIHFDESILIKSRFHSE
FT                   QGSKKISNHNEECNVLWSSFLHELTEEEMIKMEDSPYLFLTRTATFLSNNTPYKKACDL
FT                   ANTMAKQVLHDTKVSVIIPVYNRINWAIEAIESVLIQTHKNFEILIIDDGSTDDISELT
FT                   SICKKDKRIRYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLKFMEEN
FT                   NFIFSHTSYQKINEKGKYIESVHSGFFSGNVFPQIIQTCPIAMPTVMGTLTLFQENLFP
FT                   ENIRSGEDCCLWISIASKNSIGGIDKELSKVRISGGTNTFMDPNKYSVGLINITSYVLN
FT                   DPYLSKFSPFTINLLLAAVTQLRLLENKDYKKSNISFFNNNYVIQKIQTYCFVTKILIL
FT                   LTITSIRQEGIRATISRIQRWLRKHI"
FT   gene            complement(580490..581485)
FT                   /locus_tag="RF_0544"
FT                   /note="RF0544"
FT   CDS_pept        complement(580490..581485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0544"
FT                   /product="Efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61395"
FT                   /db_xref="GOA:Q4UM28"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM28"
FT                   /protein_id="AAY61395.1"
FT                   /translation="MPAKLIVLFTLLISLSTMASKKEEEKITGVKATKVQIAELYDIFN
FT                   IVGQCQNDNSRDYYANAIGVVEKVSAHQGEIVKKGDILLVIDKNIAETTKSRAAALLNT
FT                   KQEDYNRKEALFAKKFVSNEEYKRSKSELEDAKFNYSKALKTYNDMIITAPYSGKIGVI
FT                   KSMVGDEVKIGDYLFSITGTENSQSIFIELPESLSGKVGVDTEVLIAGKFKSTIEAVSH
FT                   YLSDNGTLTAKIILPIGTKILHNSFVDVTLIINPHKNLTVPESCIQRNNQGNFIYKIDG
FT                   DTVKQLYVKIGTRTEGLIEITSKDIKEGDLVVTEGMTKIGDGSKVKILEE"
FT   repeat_region   complement(581613..581761)
FT                   /note="RPE-6 Full"
FT   repeat_region   581782..581884
FT                   /note="RPE-4 Full"
FT   gene            complement(581921..582688)
FT                   /locus_tag="RF_0545"
FT                   /note="RF0545"
FT   CDS_pept        complement(581921..582688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0545"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61396"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM27"
FT                   /protein_id="AAY61396.1"
FT                   /translation="MYSKINKVHDFKEVIEAVKQADNTSLVLFDVDEVIVMDSDESRLT
FT                   HDYRKELMNNIEKRLTRKECELLLSVILKEKKARFVNSDILKIFALLKEKNIPAMGLTK
FT                   LPTGKFGVIEDMIEWRIRELTELKVNFQEFSPLEDKITIEDFNIGYGKPTLKDGIIYTA
FT                   EYDKGSVLEYVLRKTDYYPQSIIFIDDIEENLLSLQEICKKLKINYQGFEFMGSAIVPE
FT                   PDLDEQLEKIRFEILEKEYKWLTDEELKKHTLS"
FT   gene            complement(582698..583456)
FT                   /locus_tag="RF_0546"
FT                   /note="RF0546"
FT   CDS_pept        complement(582698..583456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0546"
FT                   /product="Predicted hydrolases or acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61397"
FT                   /db_xref="GOA:Q4UM26"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM26"
FT                   /protein_id="AAY61397.1"
FT                   /translation="MHKLYNKTQDKFIVYDNYRIINTNIPSVIFLHGLMSSMQSTKAIY
FT                   LIDYCKKNNYNFIVFDNFGHGNASGRFEEQTISDWLEGVSLILDKLIDTKAILVGSSMG
FT                   GWLALLAALKFPDKIKGLVCLAPASDFTEDIWQNISLDDQNKMQKEGILEVRGKNCEHK
FT                   YPISYKLIEDAKKHLLLTKKQIDINIPVHLIHGMLDEDVPYNVSVKLLEKIISKQIVMK
FT                   LIKDGHHNLSREEDLKVMTNSLEEMISNIK"
FT   gene            583489..584661
FT                   /locus_tag="RF_0547"
FT                   /note="RF0547"
FT   CDS_pept        583489..584661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0547"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61398"
FT                   /db_xref="GOA:Q4UM25"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM25"
FT                   /protein_id="AAY61398.1"
FT                   /translation="MPSLKSSKRYNKYTILQVVPALVSGGVERGTIEVAKYLKILGHTP
FT                   IIISAGGTLVKELDKEDILHIEMNSSSKNPFVILNNAKLIAEIIKKYNVDIVHTRSRAP
FT                   AWSSYLATKWTNAKFLTTFHGVYNIPNSFKKYYNSIMLKGEKVIAVSNFVKQHLLENYK
FT                   IDEDKIVVIERGVNCDYFDPANLTPEKLKKCRDKYDAPSNVPIILMPSRMTSWKGHLVL
FT                   VEALSKLKHRDFYCLMVGDISRHPNFTNRVKELIATLKLQNKIQIFGNDSDIINLYGIS
FT                   DIIVSASIEPEAFGRTIIEGQAMEKLVIATNIGGAVETINNNITGFHVEPNNAEALAEK
FT                   IDYCFSILGTDTAKKIQEAARHTVINNFSLDLMLRKNLEVYKEILKNSHN"
FT   gene            complement(584707..585495)
FT                   /locus_tag="RF_0548"
FT                   /note="RF0548"
FT   CDS_pept        complement(584707..585495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0548"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61399"
FT                   /db_xref="GOA:Q4UM24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM24"
FT                   /protein_id="AAY61399.1"
FT                   /translation="MVITNVLDLIEACINSSFINYTGNDGNTLIALTLLIQDPNAAIGP
FT                   LISQGAKISILWCGKNIISTLFQSYKTSLIQNTQDLIEQKALELLLNEEYKSKILGLKD
FT                   IEAITNNLFIDQNSYIPAQSTLFEVITSGPDQSIIKSNKQSLEEKINTLFIKLDLGTLI
FT                   THLSDKNYDVINAPSGGQKKKIGIIKAIISNPKILILDEVFANLDKISIENAQQALKEF
FT                   LPETLMLVVHHDGKSHDYNNFYDQYINLEDLYAEIKLLGE"
FT   repeat_region   586263..586411
FT                   /note="RPE-6 Full"
FT   repeat_region   586464..586488
FT                   /note="RR-2 Full"
FT   gene            complement(586704..587369)
FT                   /gene="rpsD"
FT                   /locus_tag="RF_0549"
FT                   /note="RF0549"
FT   CDS_pept        complement(586704..587369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="RF_0549"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61400"
FT                   /db_xref="GOA:Q4UM23"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM23"
FT                   /protein_id="AAY61400.1"
FT                   /translation="MYIFSCNSNIKLRILSVTKIVRSKYKASRRLGVSLWGDSKDAFNT
FT                   RNYRPGQHGQNTMIKTSDYGLHLKAKQRLKCHYGRVTEKQFRNIFALAQKMKGNTGENF
FT                   IGLLESRLDTVVYRMNIAPTIFAARQLVSHGHIKLNGKKADIASIRLKEGDVIEVKESV
FT                   KQIPLIQESVSKQAQTTPGYLSFDVPSLTGKYLRVPALSDVPYPFEAEVHLVIELYSR"
FT   gene            587439..588356
FT                   /gene="cyoB"
FT                   /locus_tag="RF_0550"
FT                   /note="RF0550"
FT   CDS_pept        587439..588356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="RF_0550"
FT                   /product="Protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61401"
FT                   /db_xref="GOA:Q4UM22"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM22"
FT                   /protein_id="AAY61401.1"
FT                   /translation="MSSLVTPINLDKINHSQSTVKDYILLMKPRVMSLVIFTGFVGIWL
FT                   APYSVHPFIAGIAVVCIALGAGSAGAINMWYDRDIDSLMKRTQKRPIVRGAIEPDEALS
FT                   FGLITGFFAVFFMALCVNLLASFLLLFTIFYYICIYTIWLKRRSIQNIVIGGVSGALPP
FT                   VIGYAAVSNTISLESIILFLIIFIWTPPHSWALALFCNDDYKNCKVPMMPAVKGNLYTK
FT                   KQILIYSILLFIVSLMPFFIGMNNFIYLITSGILGLVFLYYSGSLFYDTPDNKQAKRFF
FT                   AYSIFYLFFIFLLLSSTSTISLIS"
FT   gene            complement(588483..589358)
FT                   /locus_tag="RF_0551"
FT                   /note="RF0551"
FT   CDS_pept        complement(588483..589358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0551"
FT                   /product="Putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61402"
FT                   /db_xref="GOA:Q4UM21"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM21"
FT                   /protein_id="AAY61402.1"
FT                   /translation="MVKKIVQNTKTLHVRSNGRSADYITPNFIYGCAGGCRNSYCYVMR
FT                   HNYETLYINENIDQILDVLDKHIESLPIKVSNQTDSKYWTYDIGCSTDVSLHWKHTNWL
FT                   KIFNFFKEHPHAKATFATKYVNPKLLNFNPEGKIRIRFSLMPARISEILEPKTSPIIER
FT                   IKAVNIFIKAGYEVHLNFSPIIAYEGWLTEYAKLFEDLDQYINNQYKPFIKAECIFLTH
FT                   NDKQHERNIASNSLESEALIWQPNIQENKVSKYGGKAVRYKAGIKSNFIKRWSVLHDRL
FT                   LPWNQIRYIF"
FT   gene            589474..589953
FT                   /locus_tag="RF_0552"
FT                   /note="RF0552"
FT   CDS_pept        589474..589953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0552"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61403"
FT                   /db_xref="InterPro:IPR025494"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM20"
FT                   /protein_id="AAY61403.1"
FT                   /translation="MEKPSYLNFDNKNYKWKNDIDYRKCPESYRVGKGEQGVLICQPYK
FT                   NEILPYWKFKIPEIAKESSEKIYEIFLKYLEDNDFVGADMARKYLQMGFTRSRRYANYK
FT                   GGKKYDKEHDYKKLERGGGDPKKVKSADIFFKKWQEAEDNKKYKKMKIEWKKQYG"
FT   repeat_region   590668..590744
FT                   /note="RPE-4 Full"
FT   repeat_region   590752..590782
FT                   /note="RPE-6 Partial"
FT   gene            complement(590865..593390)
FT                   /gene="asmA"
FT                   /locus_tag="RF_0553"
FT                   /note="RF0553"
FT   CDS_pept        complement(590865..593390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asmA"
FT                   /locus_tag="RF_0553"
FT                   /product="Outer membrane assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61404"
FT                   /db_xref="GOA:Q4UM19"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM19"
FT                   /protein_id="AAY61404.1"
FT                   /translation="MYINRRLNSMPKTLKYSLIIFISIILLLIIIPFFIPLNNYKGVII
FT                   DKVKEATNKDLTINGDIKLSLLPNPAVSLSEIKLSSIDGTKEPHLISVENAKASLKLFP
FT                   LFRGAIEVASIELQKPIINLEVLNNGQKNWQFATPTSNNNPKINNVSSAESTNANSELE
FT                   FPILISHFKIIDGKVIYIEKNSEKIFNDINLDTKIKSLKGPIDFTLALKALEQQINIDG
FT                   NIEKIGKIIPLSANINLASEKIKIEGKFDSENNSFIGNANIKGNTKALGVPADLQNDYE
FT                   LTTAITADNKNITIKDARLNYPNIELLANANYDIERNNLKSNIIVNPGNIITEISSNLD
FT                   KTNIMLQADSLKPILDALKLKTDKLPPIINQKLNLTSNVISNSQTIKLQNINLSAANSN
FT                   LTGDIEFKNLAQDITISHNLKINNFESFISLMGVSNLSKIGVLQLNGEVQKIKDTYHIN
FT                   NKISAFNTNISIKGDINLAAQKPNFNLNLYSPLVNLDKILASNSPTTVPSKTSSPATQN
FT                   IPTAKNNSPWSNNTINLGFLNEIEGQLSANIDKLTNDSLIINNLKAKLNITGGTLNITS
FT                   VNASIYGGELSITGYVSSGKDQNATIKIDLKNAYLKSLTPQSGKIKITDGRLSFKTDLT
FT                   SRGNSVYTYVNNLNGQFNVNSDNGKISGFDLNRIADAVHNAKNTEGVLRLINSSFSGGS
FT                   TSFKNLIAGGNITQGKLNLNECSLDATPAKANASGQINLPQYMMDISASVTIGELPPIA
FT                   VKLYGFINNPQHKLDIQAFQTYLVKNVFNSVIKDLKSGEKKPENIIKDALGLRKKKDTN
FT                   TEEQSSPSPENQQADPVNKLLQKGLKKLF"
FT   repeat_region   593440..593573
FT                   /note="RPE-8 Full"
FT   gene            593667..594611
FT                   /locus_tag="RF_0554"
FT                   /note="RF0554"
FT   CDS_pept        593667..594611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0554"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61405"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM18"
FT                   /protein_id="AAY61405.1"
FT                   /translation="MSKKLKHDKIIRSAFENPFVGREFFEMHLPSHIKDSLIFETLKME
FT                   KDSFIESSLKESILDILFSAKFNGEDGYLFLLLEHQSKPDYYTAFRLFRYMLNIAEHHR
FT                   KVLKNKKFPFIYPLVFYNGTQKYNTPRNLWKLFENSELVKATWTNDYQLINVHEIPDEQ
FT                   LKETAWSGILQFFMKHIHERDLLKRWQEIAELLPKFAEVNIGIDYIELILYYTLTKISQ
FT                   NDIIRIEKILKSHLNPIKGEEIMGSIVDHWLQQGIEKGRQEGINIGEMKLAEMAKRMLR
FT                   KNKPLDEIIEFTGFTKKGIEELQKQLKSQRLKN"
FT   gene            complement(594617..595114)
FT                   /gene="rimM"
FT                   /locus_tag="RF_0555"
FT                   /note="RF0555"
FT   CDS_pept        complement(594617..595114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="RF_0555"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61406"
FT                   /db_xref="GOA:Q4UM17"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM17"
FT                   /protein_id="AAY61406.1"
FT                   /translation="MNSLENLILVGVIKSCHGIKGHVILKSFTEPATKILERNLVNESG
FT                   EDIHIKLISQNTKGELICTFNDIATRNEAENLKGYKLFCLRASLPKLEEDEFYIADLNH
FT                   LPVLNQDHKEIGKIKNILNFGAGDIIEIEFLDQTTELLPFNKEFIPLITKDYVVLNYQR
FT                   EI"
FT   gene            595177..597810
FT                   /locus_tag="RF_0556"
FT                   /note="RF0556"
FT   CDS_pept        595177..597810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0556"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61407"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM16"
FT                   /protein_id="AAY61407.1"
FT                   /translation="MIKKIAAGIIICFSLLLFIIFGALSFVNYNSVTNNLTSHLGIAKE
FT                   NIGKIKMNKFPLPYLIIETIKEGGELDLEQIKIHFSLWSLIKFNPKINKIDILDAKFYS
FT                   NSNVLNIYNHEELIKNFFKYKLQNINLNVTNLSIINKQDYSILNFNNCILKKENALSSN
FT                   YIFKTTSNYIGKISGSINKRDDIVDFSLDIDNNDYGFKLSQIYKDFKLTSGSGEYQIKN
FT                   LASVMYNILPDLNHLFNKFNQNEAVNVKFNISNNEDEIELKDIVIASSFITGNGFVNIA
FT                   KNDNITTNVKLDFPKIDLSSLISPNAEVTFNTFSSNIRFIFADKLLKADIAINEIILSS
FT                   NEALEKIVFSSNLSKGTLKINELSGNIKSGGEFKLTGNVTQNAVRSMFDGQLYLKHNDI
FT                   NLLLNILGFNDVTIKEAIPFSLSSDLKLTLIDLFFKNLLLKTDNLNLSGNFSSKFIAQT
FT                   PRLDATLNISSLDLSGRTYPIISPLIEFTKNLTKDMKTLDYPSKFIPIRTIGYLANLDI
FT                   LIDSVKYNDHVFDKMNLLAKIVPANIKISNLDFKTAGSYLSTSWNLDASSVLPSLTIEI
FT                   KDGNLTTDLLSPAGMLNLRNKLINDYSLDKAILQFYGTLSTLSQNNLILKNVKFYVANN
FT                   NNLLQFNNIEAELLGGKLQGSGNILLEPYSINFVYALNTIDLDKVSALMPKIFTASSGK
FT                   VSISGSLGTNGNSLQSQLYNLTTKSQFAINNIDVNNFGIDSFIEKINTADYKVQNLDKD
FT                   INTAITTGQENIRGISGDIELQKGIALLKKVKFATQYSSGAASFAVNIYNFDMDASSIL
FT                   SFYVPARLVKLNPSNTSSDKDSLVHLNIKMQGSIFAPKKTFDSSELKKLLIPQTKTEEA
FT                   ADSVNH"
FT   gene            597824..598066
FT                   /gene="xseB"
FT                   /locus_tag="RF_0557"
FT                   /note="RF0557"
FT   CDS_pept        597824..598066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="RF_0557"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61408"
FT                   /db_xref="GOA:Q4UM15"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM15"
FT                   /protein_id="AAY61408.1"
FT                   /translation="MTNTKTLEENISFEEALKELEEIVKKIDNGQESLETAVNSFERGI
FT                   LLKNHCEKKLKEARLKIEKITKLADSTGVLEETEV"
FT   gene            598139..598486
FT                   /locus_tag="RF_0558"
FT                   /note="RF0558"
FT   CDS_pept        598139..598486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0558"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61409"
FT                   /db_xref="GOA:Q4UM14"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM14"
FT                   /protein_id="AAY61409.1"
FT                   /translation="MLMVNHIIDFIYTVPNIVLFIIINIVLMSFCAGCLYLTKYIIPNN
FT                   FQKEELGSLGGFLSGVVGSMYAVSTGFVLIYLLGNFNKAQEGVAAESIVLMRLADSVGW
FT                   LPHKMRDLQFI"
FT   gene            598513..598947
FT                   /locus_tag="RF_0559"
FT                   /note="RF0559"
FT   CDS_pept        598513..598947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0559"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61410"
FT                   /db_xref="GOA:Q4UM13"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM13"
FT                   /protein_id="AAY61410.1"
FT                   /translation="MQREWQLMKDGKKIGHEALIFLQDINKRLQAYKASEQMQLFTKQE
FT                   IIEEIKELYTVRYNRIKMSYFSLNIQYWIVVCIMTAINLIFVCMLGTKLYLHKISVGLV
FT                   CITPSSMLFLLFILDKPFRGPFAVNQYDLIKAVHYIERLN"
FT   repeat_region   complement(598947..599090)
FT                   /note="RPE-1 Full"
FT   gene            complement(599076..599609)
FT                   /gene="mpg"
FT                   /locus_tag="RF_0560"
FT                   /note="RF0560"
FT   CDS_pept        complement(599076..599609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpg"
FT                   /locus_tag="RF_0560"
FT                   /product="DNA-3-methyladenine glycosidase"
FT                   /EC_number="3.2.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61411"
FT                   /db_xref="GOA:Q4UM12"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM12"
FT                   /protein_id="AAY61411.1"
FT                   /translation="MNKLILLPREFFARDTNLVSTELIGKVLYFQGKTAIITETESYIG
FT                   QDDPACHAARGRTKRTDIMFGPAGFSYVYLIYGMYYCLNFVTETEGFPAATLIRGVHVI
FT                   SPENLYLNGPGKLCKYLGINISHNKCDLINNNEFFVSDIGLKLPYSTTTRIGITKGTDK
FT                   LWRYVVTDIIRLPA"
FT   gene            complement(599602..599904)
FT                   /locus_tag="RF_0561"
FT                   /note="RF0561"
FT   CDS_pept        complement(599602..599904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0561"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61412"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM11"
FT                   /protein_id="AAY61412.1"
FT                   /translation="MFIVNLKYTLGLDLSSIEKFITEHRKFLDKYYDKGYFILSGPIHP
FT                   RIGGIILANIEKLNQLKDILKEDPFYINDIAEYEITEFTPTKWHKNLNIFIKKYE"
FT   gene            complement(599908..600156)
FT                   /locus_tag="RF_0562"
FT                   /note="RF0562"
FT   CDS_pept        complement(599908..600156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0562"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61413"
FT                   /db_xref="GOA:Q4UM10"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM10"
FT                   /protein_id="AAY61413.1"
FT                   /translation="MTRILLLLLRFYQYFISPLLGNNCRFHPTCSEYAKEAITTHGTLK
FT                   GLWLTFKRIIKCQPFCNGGYDAVPLSIKNSKLFNKKI"
FT   gene            complement(600265..600768)
FT                   /gene="nuoE"
FT                   /locus_tag="RF_0563"
FT                   /note="RF0563"
FT   CDS_pept        complement(600265..600768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="RF_0563"
FT                   /product="NADH dehydrogenase I chain E"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61414"
FT                   /db_xref="GOA:Q4UM09"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM09"
FT                   /protein_id="AAY61414.1"
FT                   /translation="MSTNFTFDKKNLNLAEDIIKKYPPHGKRSAILPLLDLAQRQNGGW
FT                   LPVPAIEYVANMLEMPYMRAYEVATFYSMFNLKRVGKYHIQVCTTTPCWLHGSDDIMKI
FT                   CEKKLGIKLKETTEDQKFTLSEIECLGACVNAPVVQINDDYYEDLTEEKMEKLIDEYSN
FT                   DFKN"
FT   repeat_region   complement(600807..600876)
FT                   /note="RPE-7 Full"
FT   gene            complement(600944..602119)
FT                   /gene="nuoD"
FT                   /locus_tag="RF_0564"
FT                   /note="RF0564"
FT   CDS_pept        complement(600944..602119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="RF_0564"
FT                   /product="NADH dehydrogenase I chain D"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61415"
FT                   /db_xref="GOA:Q4UM08"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM08"
FT                   /protein_id="AAY61415.1"
FT                   /translation="MTNNTKTITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLH
FT                   RGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHAFALAVESLLECEVPRRAQFIRVLFSE
FT                   LTRILNHTLNIGSQALDIGATTPLLWLFEEREKIMEFYERVSGSRMHSNYFRPGGVAED
FT                   LPDGLLEDIDKFIEQFPPKLHDIESLLNENRLWKQRLVDIGVVSQKEAMDWGFSGPMLR
FT                   GSGIAWDLRKSNPYDVYDEIDFKVPIGKNGDCYDRYFVRMLEMYESIKIIKQCIEKMPK
FT                   GAVKTDDPKLTPPTRAKMKESMEAMIHHFKLYTEGYDVPAGETYKAVEAPKGEFGVYLY
FT                   SQGGNRPYRCRIKAPGFAHLQGLDFISKGHLMADVITIIATLDIVFGEIDR"
FT   repeat_region   complement(602146..602217)
FT                   /note="RPE-7 Full"
FT   gene            complement(602257..602880)
FT                   /gene="nuoC"
FT                   /locus_tag="RF_0565"
FT                   /note="RF0565"
FT   CDS_pept        complement(602257..602880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="RF_0565"
FT                   /product="NADH dehydrogenase I chain C"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61416"
FT                   /db_xref="GOA:Q4UM07"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM07"
FT                   /protein_id="AAY61416.1"
FT                   /translation="MTLDKLIEKLAAKSSILITPIIVKDYLAYQVEPNFLLPFLKALKE
FT                   SEELRFTVLTDLFGTDFPERDKRFEVIYNLLSLKLNKRLIIKVYISEKETIPSAMNIFN
FT                   ASCWYEREVYDMYGVNFDGNDDKRRILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVA
FT                   YEPVDLDIEYREFDFSSHWHSPSYVLPGDEKATDVIPAKAGIQK"
FT   repeat_region   complement(602258..602291)
FT                   /note="RPE-6 Partial"
FT   gene            complement(602858..603382)
FT                   /gene="nuoB"
FT                   /locus_tag="RF_0566"
FT                   /note="RF0566"
FT   CDS_pept        complement(602858..603382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="RF_0566"
FT                   /product="NADH dehydrogenase I chain B"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61417"
FT                   /db_xref="GOA:Q4UM06"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM06"
FT                   /protein_id="AAY61417.1"
FT                   /translation="MKHSFYQEDELLNNELSNRGFLLTKVDDVIGWARANSLWPMTFGL
FT                   ACCAVEMMQAAASRYDMDRFGMLFRPSPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPK
FT                   WVLSMGSCANGGGYYHFSYSVVRGCDRIVPVDVYVPGCPPTAEALIYGLMQLQKKIKRT
FT                   TGFKYDARQTH"
FT   gene            complement(603387..603758)
FT                   /gene="nuoA"
FT                   /locus_tag="RF_0567"
FT                   /note="RF0567"
FT   CDS_pept        complement(603387..603758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="RF_0567"
FT                   /product="NADH dehydrogenase I chain A"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61418"
FT                   /db_xref="GOA:Q4UM05"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM05"
FT                   /protein_id="AAY61418.1"
FT                   /translation="MLQNSELLQEYLPIAIFFGIALLVSGLIMILPNLLSTKKYNKDKL
FT                   EPYECGFEPFSDARSKFDIRFYLVAILFIIFDLEIAFLVPWAISLNMIGKIGFFSMIFF
FT                   LFVLTIGFIYEWKKGALDW"
FT   repeat_region   complement(603777..603844)
FT                   /note="RPE-7 Full"
FT   gene            complement(603910..605133)
FT                   /locus_tag="RF_0568"
FT                   /note="RF0568"
FT   CDS_pept        complement(603910..605133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0568"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61419"
FT                   /db_xref="GOA:Q4UM04"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM04"
FT                   /protein_id="AAY61419.1"
FT                   /translation="MQYLISSLIFLIPSLGMVAGLSVAATVTIFLLMLFLRGINRHCER
FT                   LKGAWQSHKAGLLRLLRQNLQFFLAMTIKTELLFTAWCFISCLFAIRPINSLATFIQVF
FT                   ILLFLGFTVSNCVPFGNRVQLKNSLILGILTAILLFFIEYSSHGFLTRTFKASFGLYML
FT                   DRGCALLSITSWVAIIILLSSGKRRHALMLYILVLYLLSISDSLASFLGFSIGGVIFIL
FT                   ARLIKPIFFKLIAISLITGSLLFPVIAKQIEPRDLSEKYLATQPSAAHRLFIWHFVANK
FT                   ITLKPILGYGFASSKYIKVNNSEMINYNGEKWHPLPLHPHNNILQITLELGIIGLILFL
FT                   CLVYKYLKQINNIKSSNFRAASYSCFINYYIIGMISYNIWQIWWISSGIWVLVLMKLLV
FT                   KPDIVVDN"
FT   repeat_region   complement(604919..604988)
FT                   /note="RPE-7 Full"
FT   gene            complement(605134..605607)
FT                   /locus_tag="RF_0569"
FT                   /note="RF0569"
FT   CDS_pept        complement(605134..605607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0569"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61420"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM03"
FT                   /protein_id="AAY61420.1"
FT                   /translation="MKLLRIVFITIICTYSSIFAENLESVTTTEDIENDVFIPLDENHP
FT                   VLNSNDNINDSSEFKSYTNGKIIALNKITATSEEINFKVGEEKYFGNIKIKLHKCIKNL
FT                   DPYNEDNYLLMTITEYKIDEDPNLLFQGWMISSSISLSTFEHPIYEIFAKDCF"
FT   repeat_region   complement(605684..605751)
FT                   /note="RPE-7 Full"
FT   gene            605932..607191
FT                   /locus_tag="RF_0570"
FT                   /note="RF0570"
FT   CDS_pept        605932..607191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0570"
FT                   /product="Phage uncharacterized protein"
FT                   /note="Terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61421"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM02"
FT                   /protein_id="AAY61421.1"
FT                   /translation="MQSGDINRLIINIPPRSLKSICVSVAWPAYLLGTSPTKRIMAASY
FT                   SQILSIKHSLDCRFILNSDWYKELFPNTILSKTHNQKSKFLTTANGFRFATSVGGSATG
FT                   EGGDILIIDDPHNPTQIHSYKIRKKVIDWFEQTFVSRLNNRNKGAIVLVMQRLHSDDLS
FT                   GYLLNSSNSWHHLKIPAISIQDYSFKLMNKEYQYLSGEILDSYKEPPDCLAKLEQEIGS
FT                   YNYNAQYLQEPIARGSSLLNMEDISFYETLPEKFDYFVQSWDTAIKISEDSDYSVCTIW
FT                   GILEQKYYLVLLVRKKINYPELKNLTEKLAREYQPKFILIEDKASGQQLIQDIGFLGDN
FT                   IRVIGIKPKLDKVTRFASVVPLFQSASVLIPKQSSIVLKELLNFPHIKNDDIVDSVSQF
FT                   LNFMKDKSLKQPARIRSILV"
FT   repeat_region   complement(607180..607301)
FT                   /note="RPE-5 Full"
FT   repeat_region   complement(607378..607450)
FT                   /note="RPE-7 Full"
FT   gene            607499..607573
FT                   /locus_tag="RF_RNA15"
FT                   /note="RFRNA15"
FT   tRNA            607499..607573
FT                   /locus_tag="RF_RNA15"
FT                   /product="tRNA-Cys"
FT   gene            607594..608514
FT                   /gene="xerD"
FT                   /locus_tag="RF_0571"
FT                   /note="RF0571"
FT   CDS_pept        607594..608514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="RF_0571"
FT                   /product="Tyrosine recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61422"
FT                   /db_xref="GOA:Q4UM01"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UM01"
FT                   /protein_id="AAY61422.1"
FT                   /translation="MEFISQFLEMLLAERALSKNSILSYKRDLFDFQNYLAKQRLSELN
FT                   ITTENVRDWIEYLASNDLQARSINRKISTIKSYYEFLISENHTAFNPVLNVDLPKYQNK
FT                   LPEILSIDQIKSLLEYCSQDNSPEGIRLNAMIHLLYASGLRVSELVSLKLTDILTNKTS
FT                   KGEVRKIFSVLGKGNKERVIVINEQAVISIAKYLAIRDVFVNKAKPKNLIYLFPSSALA
FT                   GYMTRQNFAILLKSAALYANLNPEHISPHILRHSFASHLLEGGADLRVIQGLLGHADIS
FT                   TTQIYTHLQTNHLKKALLHHPLNKN"
FT   gene            608597..609667
FT                   /locus_tag="RF_0572"
FT                   /note="RF0572"
FT   CDS_pept        608597..609667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0572"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61423"
FT                   /db_xref="InterPro:IPR020168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UM00"
FT                   /protein_id="AAY61423.1"
FT                   /translation="MKLKEIMLSCIKAREIEEKYPRLAQKKESGFNVYSGLGQRNLERE
FT                   ELCDEASHNLANLVIQEIDNENFDFGILQKMQQAFSIASKQKQRKAFISFLDKELNKEQ
FT                   LHKLSQAIMENADKLMPDDDPNFVCRTTNNKVFQEILLLQAERNNFAVEVDKKGALKIN
FT                   FPSKILELYKLLVDNFYLKNFEKEELQKKLYQELFHDCQIPFEELIEKEELQKKLYQEL
FT                   FHDCQIPFEELIEEVSFFENFIECLKEFYIKNSLAQSIMFLLVSKYIEEHDVAKELFKS
FT                   ERFKKVSELEKFKPYYDINKGDEVDSYVFNSILNDVKGVYISNLASSNILELVNHSQPD
FT                   GEIVSIEILGNSESPV"
FT   gene            609779..609943
FT                   /locus_tag="RF_0573"
FT                   /note="RF0573"
FT   CDS_pept        609779..609943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0573"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61424"
FT                   /db_xref="InterPro:IPR020168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULZ9"
FT                   /protein_id="AAY61424.1"
FT                   /translation="MATKNKKETVNTETKNLANLVIKEIGNENFDFDVLQKMQQAFSTA
FT                   SKQKQREAF"
FT   gene            610000..610821
FT                   /locus_tag="RF_0574"
FT                   /note="RF0574"
FT   CDS_pept        610000..610821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0574"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61425"
FT                   /db_xref="InterPro:IPR020168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULZ8"
FT                   /protein_id="AAY61425.1"
FT                   /translation="MENANELMSDNDPNFVCRTPNNKIFQGILLLEAKRSGMKAKFNDK
FT                   GELQSLDVKDITQEILDHYRILQEKFYPKRNSKDLVDSRIAQSINFLLYAPLFRESEIY
FT                   EKIYKKSPEEALKIEGGIAAPNGKYVKQLVDAKIGTNIHFNTKENLENKANEGKEIKIS
FT                   SIIEKAITTLEKDKKVSIEDKRREEIKRHLSKSLEGASDYILTFKKNDLVDIIHQELDK
FT                   RQTWWSKIVNYISIKSYSISKENLEKIGKIINSEIKNSHTPLKVEVQEQFK"
FT   repeat_region   610953..611074
FT                   /note="RPE-6 Full"
FT   repeat_region   complement(611096..611191)
FT                   /note="RPE-7 Full"
FT   gene            complement(611288..612070)
FT                   /gene="fabI"
FT                   /locus_tag="RF_0575"
FT                   /note="RF0575"
FT   CDS_pept        complement(611288..612070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="RF_0575"
FT                   /product="Enoyl-[acyl carrier protein] reductase"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61426"
FT                   /db_xref="GOA:Q4ULZ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULZ7"
FT                   /protein_id="AAY61426.1"
FT                   /translation="MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEV
FT                   LEKRVKPLAEEIGCNFVSELDVTNPKSISNLFDDIKEKWGSFDFLLHGMAFADKNELKG
FT                   RYVDTSLENFHNSLHISCYSLLELSRSAEALMHDGGSIVTLTYYGAEKVIPNYNVMGIS
FT                   KAALEASVKYLATDLGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTT
FT                   QEDVGGAAVYLFSNLSKGVTGEIHYVDCGYNIMGSNKL"
FT   gene            612146..613636
FT                   /gene="cutE"
FT                   /locus_tag="RF_0576"
FT                   /note="RF0576"
FT   CDS_pept        612146..613636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /locus_tag="RF_0576"
FT                   /product="Apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61427"
FT                   /db_xref="GOA:Q4ULZ6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULZ6"
FT                   /protein_id="AAY61427.1"
FT                   /translation="MYKPKIICLLLGMLSGLVFAPTFFIPALLTLSYLCYIVQKSENWQ
FT                   EAAKFGYLFGFGHFLSGIYWISIGVSVYIADFWWAIPFALFGLPIVLAFFISASCTLSF
FT                   FAKNNKYYQFIFCICWVLFEWVRSWIFTGLPWNLIGYAFSFSDILIQTLSIIGIYGLSF
FT                   IVIYISTSAYPLFRKQFTQLKILLASSVLILSVIVIYGAVRLSNNPTNFTDIKVRLVQP
FT                   SIPQTEKWNEEEFWHNLMLHINLSENSEPTDLIIWSEAALIVPDDIPQVKSELLQMLNS
FT                   TNAILITGGISDNKKQGDEFELYSAMYALDKNDHKLFEYHKSHLVPFGEYMPLKKILPF
FT                   KKLTHGLIDYKEGDGGLVYLEKYNLKIKPLICYESIFPDFVRTNNEIVDVIINITNDAW
FT                   YGKSSGPYQHFHISRSRAVENGLPMIRVANNGISAIVDPFGRTIEKLNLNEINYTQGLI
FT                   PKKLNSPTIFSQFGNFTILLLIVFILLINYLLALILDN"
FT   gene            613769..614260
FT                   /locus_tag="RF_0577"
FT                   /note="RF0577"
FT   CDS_pept        613769..614260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0577"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61428"
FT                   /db_xref="GOA:Q4ULZ5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULZ5"
FT                   /protein_id="AAY61428.1"
FT                   /translation="MNDSIKHPDKLASERLKERRLAVGISQKELGQALDISALQVKKYE
FT                   EGLSNIPISRLYVFAKVLNTPLKYFFNSSEEEKLKTDDENTSNNKIEYLFKEIESDFLN
FT                   NIAEEEGQYENDVSFDYKELSRTMERELLSLTRAFTRVQNPNIRKIIIELVRSVSISCE
FT                   "
FT   repeat_region   614517..614611
FT                   /note="RPE-7 Full"
FT   repeat_region   614665..614768
FT                   /note="RPE-4 Full"
FT   repeat_region   complement(615003..615136)
FT                   /note="RPE-8 Full"
FT   gene            615504..616301
FT                   /locus_tag="RF_0578"
FT                   /note="RF0578"
FT   CDS_pept        615504..616301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0578"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61429"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULZ4"
FT                   /protein_id="AAY61429.1"
FT                   /translation="MTEIILGIKESLKDIDTEIIVKNAHADFNILLAIVKQIKDQDIDV
FT                   IIPIGTTTSQTVISHITNKPIVCAAAMINSKNLPLVTGVNDEIKITDTISKLPFLQNIT
FT                   LIYSSSEKVIPEVEMLKLYTGKNNISLHTVMIQNLNDMPVAVKNAPENTQSFVILKDHL
FT                   VVSGINILKQEAFKRRIPIIASDEGSVISGATIAVGVQEKQIGVEAGLMAKKILQGTEP
FT                   KDIPFGDMQDLTLFINLQSLSKQVILTKENLSVLPFTKKELTE"
FT   gene            616306..617139
FT                   /locus_tag="RF_0579"
FT                   /note="RF0579"
FT   CDS_pept        616306..617139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0579"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61430"
FT                   /db_xref="GOA:Q4ULZ3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULZ3"
FT                   /protein_id="AAY61430.1"
FT                   /translation="MNILVTALEQSLIMLPLILGIYISYRILKITDLTVDGTYVLGAAV
FT                   FARTISLGLFPALIFAVISGGIIGSIVSFMQKNNRINGLIAGILASFMLYSVNLQIMQR
FT                   PNISVLGMPTLLSILDLENWLVPLIIINCLIIFAVIILLKGKLGLFLRAFGFNKDLLIN
FT                   LGKPAELYRTLGLSISNCLAALTGTLSAQINGFADINMGFGVALVGIGAIVIGRHILIH
FT                   ANNFNAFKEIFSCFIGILFYFIALSVLLRIGIDPINLKLILGIVLFISLSTVGKK"
FT   repeat_region   617185..617258
FT                   /note="RPE-7 Full"
FT   gene            complement(617306..618223)
FT                   /locus_tag="RF_0580"
FT                   /note="RF0580"
FT   CDS_pept        complement(617306..618223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0580"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61431"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULZ2"
FT                   /protein_id="AAY61431.1"
FT                   /translation="MMSNYNKNNLFAKLAYGDLSEVQALLKSGVNIDEHKNERGETALY
FT                   NTLFTGYMDRAAFLLKHKASPNIPDNSGQTILYLLVMNNSIDKMKFLFENTTNIDLEIK
FT                   SFCGHSPLHAATFNENIEAMELLLKKGADINSKDSFGASALHGTIYNNKLKAAELLLNH
FT                   GADVNAKDNYEDTILHNIIGTNNIEAAKFLLQNGADVNIENNNNFTPLDRAILGQHKEL
FT                   AELFLKSGATIKIGNTMDFKILSEKLLDMNIDKELVFKSLLISNIDDQTKFQLLSDFNF
FT                   KADIHHKIGLLLSLTLNCIFSAYK"
FT   gene            complement(618383..618925)
FT                   /gene="dsbB"
FT                   /locus_tag="RF_0581"
FT                   /note="RF0581"
FT   CDS_pept        complement(618383..618925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="RF_0581"
FT                   /product="Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61432"
FT                   /db_xref="GOA:Q4ULZ1"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULZ1"
FT                   /protein_id="AAY61432.1"
FT                   /translation="MTFLKKIKPMPFTTIINYIRKDSYKVLHLGLIAISIIALATAYIA
FT                   EYIFHYTPCPLCVYERFPYLTLIKICLTALIIRQLSKYTLIFILLTILSSCILSTYHSF
FT                   VERGIVQPSALCSSMSRIPKGLSIQHIKQMFYSQPITSCTKPAIKIFDISMTEYNLLLN
FT                   ITLLICLLLVWFYPKSI"
FT   repeat_region   complement(618921..618981)
FT                   /note="RPE-7 Full"
FT   gene            619107..620684
FT                   /gene="lysS"
FT                   /locus_tag="RF_0582"
FT                   /note="RF0582"
FT   CDS_pept        619107..620684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="RF_0582"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61433"
FT                   /db_xref="GOA:Q4ULZ0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULZ0"
FT                   /protein_id="AAY61433.1"
FT                   /translation="MSEIWEDAIKSNAWPFVEAKKILDSLNGKVPEKNYVLFETGYGPS
FT                   GLPHIGTFGENARMVMVQKAFEQLSDISTKLICFSDDMDGLRKVPSNIPNPEMVAGYMD
FT                   MPLTSIPDPFGECESYGHYMNAKLRSFLDKFGFEYEFYSSTNCYKAGMFDEMLIRVLEK
FT                   YDEIMELMLPTFREERKATYSPFMPICPKTGKVLQVPIEKWDAKAGTVRYKDEAGNYVE
FT                   VPVTGGHCKLQWKPDFGMRWAALKVDYEMYGKDHLANARLYSEICRILGGKPPVQLCYE
FT                   LFLDENGEKISKSKGNSISVDDWLKYAPVESMALFMYQNPTRAKRLFFDVIPKNVDEYI
FT                   TFNQKYHLEEDRAKRFANPVYHIHHGNVPKIETFGITYALLLNLTSVCNPSDKSVLWGF
FT                   ISKYEPKATPKTSPYLDHLAEFAIRYYNDFIKAYKSYLAPSEKHKVILQDILDMLSSIS
FT                   DQTEAEAIQKAIYDIGMKAGYENLRDYFKDLYQILLGQSEGPRLGTFIKLYGIKETMKL
FT                   VEGKLYTR"
FT   repeat_region   complement(620674..620798)
FT                   /note="RPE-5 Full"
FT   repeat_region   620866..620938
FT                   /note="RPE-7 Full"
FT   gene            620962..621894
FT                   /locus_tag="RF_0583"
FT                   /note="RF0583"
FT   CDS_pept        620962..621894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0583"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61434"
FT                   /db_xref="GOA:Q4ULY9"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULY9"
FT                   /protein_id="AAY61434.1"
FT                   /translation="MNEIFCSTLPIFLITLLGSIIKNKWLTSEEFWRGIEKLSYFVLFP
FT                   AMLFNYVSTADLSVASIIKLVVALIISTILVSIGLIIYQKKYNIDKIQFTSIFQGSIRY
FT                   NSYIFFGVSSPLLGPSGLSIVAVISSYMIIFTNILSVMIFAYYIPNKSVTNTIRTSFVL
FT                   MMKLIVRNPLIIASLVGFVFNYSNLELHLGLKKTLDSLSNAALAIGMLNVGAGLNFTIR
FT                   REVLHNVMFTSFIKLVAFPLVSVIVLWLMSIEGIDRSVGILYSCLPCASTAYVLSRQLD
FT                   GDPDSMASIITFTTFFSVVTISIIMYVMG"
FT   repeat_region   complement(621904..621971)
FT                   /note="RPE-7 Full"
FT   gene            622072..624375
FT                   /gene="tme"
FT                   /locus_tag="RF_0584"
FT                   /note="RF0584"
FT   CDS_pept        622072..624375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tme"
FT                   /locus_tag="RF_0584"
FT                   /product="Malate oxidoreductase and phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.38"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61435"
FT                   /db_xref="GOA:Q4ULY8"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULY8"
FT                   /protein_id="AAY61435.1"
FT                   /translation="MDEMNKINYAEALEYHEKDKPGKIAISATKSLVTQQDLSLAYSPG
FT                   VAAPCLEIAKNLEDVYKYTARGNLVAVISNGTAVLGLGNLGAAASKPVMEGKAVLFKKF
FT                   ADIDAIDLEVNTEDPEEFINAVKYLSYSFGGINLEDIKAPECFIIEEKLKSLMNIPVFH
FT                   DDQHGTAIITAAGLINAAYLTNRKLEDLKIVVNGAGAAAIACIDLLIALGVDKSKIILC
FT                   DTKGVVYKGRLEGMNKWKKLYASDTKVRTLAESLNNADVFIGLSVKGAVTKEIVKGMAN
FT                   NPIIFAMANPDPEITPEDIKFVRDDAIIATGRSDYNNQINNVMGFPYIFRGALDVRART
FT                   INTEMKIAAAKAIADLARRPVPEEVYKAYSGRKMVFGKEYIIPVPFDPRLITVVAAAVA
FT                   VAAIESGVARVKDFSIGKYRKELGSRLNPTANYMNFLAEKIHNAPLKRIVFAEGEEEEV
FT                   ISAALMMRDEKYGHPIIIGRVERIEATLKKIGQDISLDGIQIMNAALTDSLEKYIDYLY
FT                   KRLQRKGYLYRDCAKLVKTDKNIFAACMVACGDGDALLTGVTKSYIDSLEDIMKVISPK
FT                   PNRRILGYSIMIAKDNNIIISDNCITEYPNSLELAQIATQTAEIAKNMGITPRVALLSF
FT                   SSFGNASKEKTARIREAVNILDNFSKDKEELSGMKVDFEYDGEMSVKVALDGDLRKLYK
FT                   FCRLSGSANVLIMPGLNSAAISTELLQEFSSNSFIGPITNGFEKPVQILQATATANEIL
FT                   KIATFACVEAIKEV"
FT   repeat_region   624405..624537
FT                   /note="RPE-8 Full"
FT   gene            624596..626545
FT                   /locus_tag="RF_0585"
FT                   /note="RF0585"
FT   CDS_pept        624596..626545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0585"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61436"
FT                   /db_xref="GOA:Q4ULY7"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="InterPro:IPR038075"
FT                   /db_xref="InterPro:IPR040917"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULY7"
FT                   /protein_id="AAY61436.1"
FT                   /translation="MRDKMDSLVKNEVIKLFNDKPKSGITRIKKWCADNNKDFTEETAK
FT                   FFYEEKTNLNLEFVGDYLGTDGGDNKKVLESFTKQFDFKEKDYLESLRGFLQSFKLPGE
FT                   AQKIDRLVESFGTNYYEQNINGEIKSKDAAYILAYQTIMLNTDLHNSSIAEPKKMTFEQ
FT                   LKNNLKGTNESQNFNDNFLKKIYDGIKAKPFVLNFVDSSPGYEIDNISSQNDQTFKKLS
FT                   KFLEEKRNIQDVFPKLQNNNLTAEFKNPKTLLNKFTGYEGSVIVKDEKGGKAEIQVYKP
FT                   SVFSRWFSGEKSKIIIQPLSEEGKQPSEQSLKLAAQITANFETKVTSIKATYDYLKEDL
FT                   KSWYENIRNPKKELERASSIAELHKNIKEITEIVQQTNQQIPEKPLASKESFEDLTQAE
FT                   IGIKPIEILIKSSSQPVEKPKFNSFIEELAWKNAQRRQNIDTPISQNKESKIQTDNHAK
FT                   ILEELKQKQKELEDKKKGLEEKKANSNITREERWKIVAELESINNQFKAIEKERSNINS
FT                   ASDREKKFDNKNNPSSPTKGEPTAADLQQQGALAAIKRMKEEKIKQQQAEATNQPSKNT
FT                   STMPSGTIPVPPPMPGSGLSVPPPPPPTSIPNIVKEEAKDIGKQIPQERDKNKEGLAKA
FT                   MEAQRKKIDTGRGM"
FT   repeat_region   626566..626681
FT                   /note="RPE-6 Full"
FT   gene            626797..628017
FT                   /gene="proP3"
FT                   /locus_tag="RF_0586"
FT                   /note="RF0586"
FT   CDS_pept        626797..628017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP3"
FT                   /locus_tag="RF_0586"
FT                   /product="Proline/betaine transporter"
FT                   /note="MFS type sugar transporter PFAM00083"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61437"
FT                   /db_xref="GOA:Q4ULY6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULY6"
FT                   /protein_id="AAY61437.1"
FT                   /translation="MSNSAFLVAFFTTIIRYYDYALFGLSASILAQNFLPNIEQDKQLL
FT                   GFFAILSAAVIVRPLGSLIFGFIGDKYGRTKSIKISMFMSSISTGLIAITPSFEMIGIF
FT                   ATVILTLCRMVFLASLAGEVDGIKIYVAEKTGDNRKNLNIGIVSCCSQIGALLAAIAYY
FT                   YTSNSDIQYLWRFNFFIGAIFGLFAILMRNFFKESSEFLRKSSKSTIKQIIKDNKTSFI
FT                   IALLINGAIGGVYHFLVIFLGVFLTKIAFVNHPEIRFMNIALTTTYGISAVFAGLLADK
FT                   INPLRQITWTVFASIIVALGMQIMLYKQIFNILCPIILIGLAAFYAVPLQIIVQSLFKT
FT                   NVKMRLYSLSHSFGGIILSSTTPFFSMLLWQNFKSLSLTLSFFIFLLIILMSTVLVLRK
FT                   MLSLHGY"
FT   repeat_region   628083..628170
FT                   /note="RPE-6 Partial"
FT   repeat_region   complement(628196..628235)
FT                   /note="RPE-7 Partial"
FT   gene            complement(628286..628528)
FT                   /locus_tag="RF_0587"
FT                   /note="RF0587"
FT   CDS_pept        complement(628286..628528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0587"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61438"
FT                   /db_xref="GOA:Q4UMG4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UMG4"
FT                   /protein_id="AAY61438.1"
FT                   /translation="MIFLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNAVFK
FT                   SLYLAIDYMTKKWSMSIPNWNKAMAHFLIKFDERI"
FT   gene            complement(628603..629556)
FT                   /locus_tag="RF_0588"
FT                   /note="RF0588"
FT   CDS_pept        complement(628603..629556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0588"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61439"
FT                   /db_xref="GOA:Q4ULY4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULY4"
FT                   /protein_id="AAY61439.1"
FT                   /translation="MCKFLKGCIKENITKREITMTQKQNAAMEQAIDLLINNDTDVSIL
FT                   FREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSDAQNSRNGYNTKNLITKNGAVEIE
FT                   VPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLIS
FT                   QITDDIIEDVKLWQSRPLDPVYAIVFFDCLIVKVRQDKRIINKSVYVALGIDLEGRKDI
FT                   LGLWISENEGAKFWLGNFTEMKNRGIQDILIACSDNLNGMSEAIGAVFPKTEHQLCIVH
FT                   QIRNSLRYVSYKDRKELAGDLKPIYTLAQKKKHFPL"
FT   repeat_region   complement(629544..629625)
FT                   /note="RPE-7 Partial"
FT   gene            complement(629738..632983)
FT                   /locus_tag="RF_0589"
FT                   /note="RF0589"
FT   CDS_pept        complement(629738..632983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0589"
FT                   /product="unknown"
FT                   /note="Similar to Mycoplasma hominis variable membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61440"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULY3"
FT                   /protein_id="AAY61440.1"
FT                   /translation="MKHKNESDRLTRNLYLIKNTNLNNILEADKLVITRTTNFIEALIN
FT                   KIDPRKPGPYVSQQQANFKVANKVATDKNIQGASKEIYLKNLPISIGKVEGFKEDGKGR
FT                   KTKAQLDVLISPSDFSELLRLSNSLPITNEQGLEIKSNINLLQLMEEVVQKVGKSSLNI
FT                   QQDKKILTSQKNAQAITHGQQKVELSLKEEIIKLREAVQETIKNPTNNEEFNKTSKEIL
FT                   DLINNINSHQPSRLQAARNKILSSGGSPNAKNTKIEEFFLEQHEWDKFQELRERLQKIK
FT                   EPREKLDEMKNFYDVINSLDKNIILRAMQEKQKVQQASNQKAQEIIRSKFLYLDNAGDF
FT                   SDGLQNLFEELKNKEEKGQKELIEASKNILSKSISVNKNYFRNTNNSSELDLQYKMLLI
FT                   DHADNISQNIKEALVLYAGSNNNNQIDILSEELANKFKNISNLIRQNESVLQKETGKYS
FT                   PSLETIPEDSIPKLSPAIVHSSTELFAKLENSFNELEQFTDKILIDAGKSYVQQANINP
FT                   KSNNVSRSSSIDSGIGSSQEELSTTFGKSSSTNLIKALDLAQAKILSNSNTTKDKLTAT
FT                   KELQKSIQQKEVSNERLTQEEIDNIYKTLGIFEEIKEYEKSENSRDPRLLNKNYYKLTD
FT                   PREERRSDNIALEWDDTGMLPPSQNSAVLDKLKEAVDDYISELQNEKLSIDTSPKQVNI
FT                   DNVLPKIRTLFNDELAKDTSPMQEAIPAPPPLSWNTHPIFGDTIKFLKRFKEEIDKFPQ
FT                   DYTKASTIPLYLSNVNRNLGRNEFLASMVSTSQKDERINDILDKLQKISTNCSKISNSD
FT                   DKFNNEIKESFVEINTTLKNIIEYKGPEIEYLNSNIEKVQKNLSRLESFTYELSKNTSP
FT                   KHTKQSTQEQPKISTGAVTGIKDRIAKFEADSDSKIEKYWTEEKKQTVEKQHENTQSDY
FT                   ITPKKNFEFENRGKEIKENSTKNLINKFEKGFDSKITRYWTSPEEWDKWEEEKQKGIGK
FT                   ENELIRPRTKFLIEHSKHAQSKDNAPKRQTKSYIEASEDTHIKEGNTKSLKDKFENLAK
FT                   EAKQIGTQAQQSPKSSSSPSIKPTGRSKDGRVI"
FT   gene            complement(633116..634060)
FT                   /gene="mdh"
FT                   /locus_tag="RF_0590"
FT                   /note="RF0590"
FT   CDS_pept        complement(633116..634060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="RF_0590"
FT                   /product="Malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61441"
FT                   /db_xref="GOA:Q4ULY2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULY2"
FT                   /protein_id="AAY61441.1"
FT                   /translation="MKKNPKISLIGSGNIGGTLAHLISLRNLGDIVLFDVAEGVPQGKA
FT                   LDLMQAGTIAGSDIKIKGTNDYKDIEGSDAIIITAGLPRKPGISRDDLISINTGIMKNV
FT                   AENVKKYAPDAFVIVITNPLDVMVYVMLKESGLPHNKVIGMAGVLDSSRFNLFLAEEFK
FT                   VSVSNVNSTVLGGHGDAMVPLARYSTISGVPIPDLIKMGLSSNKNIEKIIDRTRNGGGE
FT                   IVALLKTGSAYYAPAASAIEMLEAYLKDKRQILTCAAYLQGEYGVNDLYVGVPIIIGKE
FT                   GVIKVVELQLTKEEKALFDKSVEGVKKLLDTIK"
FT   gene            634352..635077
FT                   /locus_tag="RF_0591"
FT                   /note="RF0591"
FT   CDS_pept        634352..635077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0591"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61442"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULY1"
FT                   /protein_id="AAY61442.1"
FT                   /translation="MFHDLRISINNSLNSKDVSFDTVDSPENKSTLHHVTDLVELKELL
FT                   QKNIDPNIQDENGYTALEVTGNFEKAKMLLEYGATVNDYKQMGEVLYYCGRNSVENKII
FT                   LSLLMHSNANTNFTKANLVRQCKEPHEEAERLIKRIEKIKGLIYQSKEVETLRVYVDRL
FT                   QNLKNKYEEANQDVSKIILDYIENQESDSLKAKLVTTCQNLGLIEDYSEVAQENALYKC
FT                   LDEAFDLLDQGLIGEDAQI"
FT   repeat_region   complement(635202..635296)
FT                   /note="RPE-7 Full"
FT   gene            complement(635368..636891)
FT                   /gene="tlc2"
FT                   /locus_tag="RF_0592"
FT                   /note="RF0592"
FT   CDS_pept        complement(635368..636891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlc2"
FT                   /locus_tag="RF_0592"
FT                   /product="ADP,ATP carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61443"
FT                   /db_xref="GOA:Q4ULY0"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULY0"
FT                   /protein_id="AAY61443.1"
FT                   /translation="MDAVDSNFTIWNKARNSKFRHIVWPIRSYELTKFIPMVLLMFFIL
FT                   LNQNLVRSIKDSFVVTLISSEVLSFIKLWGEMPMGILFVILYSKLCNIMTTEQVFRIIT
FT                   GTFLFFFAIFGFILFPYREFFHPDPELIKHYITVLPHLKWFLIIWGQWSLVLFYIMGEL
FT                   WPVIVFTLLYWQLANKITKVEEAPRFYSFFTLFGQTNLLISGTVIIYFAKSEHFLLPLF
FT                   SHLNDTNEILLKSFITVILISGLICLALHKLIDKSVVEADKNIKFKNQRTDILKLSLVE
FT                   SAKVILTSRYLGFICLLVMSYSMSISLIEGLWMSKVKQLYPATKDFISYHGEVFFWTGV
FT                   LTLVSAFLGSSLIRICGWFWGAIITPIMMFGAGVMFFSFTVFENHLENIVNTLGYSLPL
FT                   VVIVFIGGLWHVLSKSVKYSLFDATKEMVYIPLDSEMKTKGKAAVDVMGTKIGKSIGAI
FT                   IQFISFSIFPNAVHNDIAGLLMFSFVIVCLLWLYGVKVLSEQYNKMIKR"
FT   repeat_region   complement(636941..637011)
FT                   /note="RPE-7 Full"
FT   repeat_region   complement(637198..637321)
FT                   /note="RPE-5 Full"
FT   gene            complement(637330..638943)
FT                   /gene="pyrG"
FT                   /locus_tag="RF_0593"
FT                   /note="RF0593"
FT   CDS_pept        complement(637330..638943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="RF_0593"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61444"
FT                   /db_xref="GOA:Q4ULX9"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULX9"
FT                   /protein_id="AAY61444.1"
FT                   /translation="MVRFIFVTGGVVSSLGKGLTAASLAMLLQAKGFKVCVRKLDPYLN
FT                   VDPGTMNPHEHGEVYVTDDGAETDLDLGHYERFTGVSSCKFDSITTGAIYSKLLKDERL
FT                   GNYTGVTVQIIPHVTNIIKDFILSNTKGFDFIICEIGGTVGDIEGLPFFEAIRQIGNKL
FT                   KNENCLFIHLTLLPYVKTARELKTKPTQHSVKELRAIGITPNILVCRAERNISKSEIDK
FT                   IALFCNIESEYVIPAIDQKNIYLVPIAYHNSGLDNKVLKFFNINVVPSKLDKWYDIIGR
FT                   LKDSSSKVRIAIIAKYHKLKDAYKSVIEALDHAGIYYKYKIDLVWINAENLTEENINKK
FT                   LLNIDGILVPGGFGERATKGKITAITYARTNNIPFFGICFGMQLATIEIAQNLIGIKDA
FT                   VTEEFKVDGTKIIEKINKNCEGSKITIENVKKTMRLGSYPCSLVANTIAANAYKSLEIN
FT                   ERHRHRYKFNNEFQNIFEKNGVVFSGFSKDEEIVEIIELPELRWFVGVQFHPEFKSKPF
FT                   EAHPLFIQFIKAAIEYTLRK"
FT   gene            complement(638950..639690)
FT                   /gene="kdsB"
FT                   /locus_tag="RF_0594"
FT                   /note="RF0594"
FT   CDS_pept        complement(638950..639690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="RF_0594"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61445"
FT                   /db_xref="GOA:Q4ULX8"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULX8"
FT                   /protein_id="AAY61445.1"
FT                   /translation="MQHQDVAIIIPSRLSSTRLKQKPLQLIGSTTLIERVFKQVNQANL
FT                   EHTYVATDSEEIANIIKKVGGKVIFTDSAIPTGTDRTYEAFKLIPNNQNINYIVNVQGD
FT                   MPFIEPSSILKIIEYLKNSEYDIVTPVVKVDRESVEASSNVTVAVDSAGKALYFSRSLI
FT                   PNGAEKFLYHVGMYGFRKNALEKFVSLKPTFLEKTERLEQLRVLENGMTIGTCLVENVP
FT                   ISVDTEDDLKKAVKFYENISKLGL"
FT   repeat_region   complement(639788..639887)
FT                   /note="RPE-4 Full"
FT   gene            639914..639989
FT                   /locus_tag="RF_RNA16"
FT                   /note="RFRNA16"
FT   tRNA            639914..639989
FT                   /locus_tag="RF_RNA16"
FT                   /product="tRNA-Lys"
FT   gene            640003..640079
FT                   /locus_tag="RF_RNA17"
FT                   /note="RFRNA17"
FT   tRNA            640003..640079
FT                   /locus_tag="RF_RNA17"
FT                   /product="tRNA-Ile"
FT   gene            complement(640135..640560)
FT                   /gene="mutT"
FT                   /locus_tag="RF_0595"
FT                   /note="RF0595"
FT   CDS_pept        complement(640135..640560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="RF_0595"
FT                   /product="ADP-ribose pyrophosphatase MutT"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61446"
FT                   /db_xref="GOA:Q4ULX7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="PDB:4KYX"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULX7"
FT                   /protein_id="AAY61446.1"
FT                   /translation="MINHPRIGIGILIFNNRNEILLGKRISSHGESSYAPAGGHLEFGE
FT                   TFEECAIREVLEETNLIIENPQFIAVTNDIFEKEQKHYVSIFLKAHCLNEHELQNLEPH
FT                   KVENWQWFALDNLPSNLFLPLKRLIEKKCYLYKEIID"
FT   gene            640761..641504
FT                   /locus_tag="RF_0596"
FT                   /note="RF0596"
FT   CDS_pept        640761..641504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0596"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61447"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULX6"
FT                   /protein_id="AAY61447.1"
FT                   /translation="MINKEDFDCAFKILELQTNILNLKLQQVKLGYYRRSTTLKVLDSK
FT                   LLTLLKSITKYNFIPRINLGNSLLVGEGNLSFSVSLMKKLQQLPRCITSTYEDYDDLSE
FT                   TAQLNTYKLRKFGINVLHNIDATKLHKNFNHNSFDTIIFQFPHSGSREEINGLNPNYIL
FT                   VRDFIVSASYVLKKHGLILITIVDSDFYNSIFQFEKLSQELKISTPIKYKFDPKDYPEY
FT                   VHTMTNQDESAIENYSKFATWEFKL"
FT   gene            641501..642067
FT                   /locus_tag="RF_0597"
FT                   /note="RF0597"
FT   CDS_pept        641501..642067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0597"
FT                   /product="Alkylated DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61448"
FT                   /db_xref="GOA:Q4ULX5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULX5"
FT                   /protein_id="AAY61448.1"
FT                   /translation="MSQLSLFNDQIIISGLKYIEEYITAEQEDRLIKLIDSSPWITDLK
FT                   RRVQHYGYKYDYKSRSIEQSYYLGLLPKWLQIVADEFYKKNIFNEIPNQVIVNEYMPGQ
FT                   GIASHIDCIPCFSDTICSLSLGGSCIMELTNDKTKHAILLKPRSLLVFKNEARYKWQHG
FT                   IAARKSDNKIIRNRRISLTFRKAIL"
FT   gene            642132..643712
FT                   /locus_tag="RF_0598"
FT                   /note="RF0598"
FT   CDS_pept        642132..643712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0598"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61449"
FT                   /db_xref="GOA:Q4ULX4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULX4"
FT                   /protein_id="AAY61449.1"
FT                   /translation="MNSTNHLQNNSLTISWLKLGILSLGFAGLYSVILVVLRTPQLSSF
FT                   FPNPHIFKSALIIHVNLSVLIWLLSIMASVWGCETSLRGEAKPRRGNLRNFALLHEIAT
FT                   LSTFARNDVFRLYPKLAFLATLLIAISPIAGHNPVMNNYIPMLENIIFILGLSLFGVTL
FT                   LLYAINILYFFDWMNLNSLVNFTILLTIIMFILSFICFGWSYNGLQRVIQIIPIEIEFY
FT                   YELLFWSGGHLLQFIYTQILIFIWVVLFQKLIGRELKFQKFYLFLLYLNFIFGVLIVCG
FT                   HISYDIIDGSFKEFYTNHMKYLGGIAPVLCLVGMGVEWVFRCTVIAGDYKERGNLRMFT
FT                   EIASSIAMQFPRNDDVIKTTLLCSITLFLLGGLIAMNITGINVVIPAHYHGSIVGISIA
FT                   CMGYSYLGIERRQRHCERLKGVQQSHEAIQKFPRLPRRHFVPTRNDNIINFTFYLLTFG
FT                   QILHILGLALAGGYGVMRKDPNSVMPMSAKLLMGMMGGGGLIAIVGGLMFVYICGKTMF
FT                   LKSIKLEHE"
FT   repeat_region   complement(642371..642443)
FT                   /note="RPE-7 Full"
FT   repeat_region   643128..643193
FT                   /note="RPE-7 Full"
FT   repeat_region   643393..643466
FT                   /note="RPE-7 Full"
FT   gene            643705..644277
FT                   /gene="folE"
FT                   /locus_tag="RF_0599"
FT                   /note="RF0599"
FT   CDS_pept        643705..644277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="RF_0599"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61450"
FT                   /db_xref="GOA:Q4ULX3"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULX3"
FT                   /protein_id="AAY61450.1"
FT                   /translation="MSKPTREEAKEAVRTLLKFIGEDPTREGLLKTPDRVVNSYTEIFS
FT                   GYGKDVAEILNTKFYDTCNFQDFILLKDIKFTSFCEHHMLPFIGTVDIAYIPDNCIVGI
FT                   SKLARIVNAFSKRLQIQEKMTVQIAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSV
FT                   MNTMHYTGIFAEQQKYRYDFLNLTAKR"
FT   repeat_region   644315..644381
FT                   /note="RPE-7 Full"
FT   gene            644449..645732
FT                   /gene="proS"
FT                   /locus_tag="RF_0600"
FT                   /note="RF0600"
FT   CDS_pept        644449..645732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="RF_0600"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61451"
FT                   /db_xref="GOA:Q4ULX2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023716"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULX2"
FT                   /protein_id="AAY61451.1"
FT                   /translation="MLLSKYFLPVLKEEPSEAQVTSHKLMLRSGMIRQQAAGIYTWLPL
FT                   GLKVLKNIENIVRSNMNKAGALEVLMPCIQPAHLWMESGRFDNYGKEMLKFQDRHDNTL
FT                   LFGPTNEDMITDIFRHNIKSYKDLPKNLYHIQWKFRDEIRPRFGVMRGREFLMKDAYSF
FT                   DINEENAVKTYNQMYQAYINTFRDLGVFAIPVIADNGPIGGNLSHEFHIIAETGESTIY
FT                   YNKRFKTLKDNPNIDVEEIKSWYAAAEEKHDVNKLPISEQEITSSKGIEVGHIFYIGSK
FT                   YSVNMNALINDEHGKLTPVEMSSYGIGISRLVAAIIEANCNEKGIIWPSNVAPFKVSLI
FT                   NLNIHDSKCVELAAKVYKELSAQNIEVLYDDTEARAGSKFATHDLIGSPYQIIIGPKKA
FT                   ADDIVELKNRKIGVIEDIEVENLIHYIK"
FT   gene            645796..646023
FT                   /locus_tag="RF_0601"
FT                   /note="RF0601"
FT   CDS_pept        645796..646023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0601"
FT                   /product="Antitoxin of toxin-antitoxin system StbD"
FT                   /note="COG2161"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61452"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULX1"
FT                   /protein_id="AAY61452.1"
FT                   /translation="MNISATELNKNPGKIIDQALREPIVINKQGRPTVVLVDYEYFTKL
FT                   EDDYWGKAATNITKQPEWLSAKESEKFLKG"
FT   gene            646166..646294
FT                   /locus_tag="RF_0602"
FT                   /note="RF0602"
FT   CDS_pept        646166..646294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0602"
FT                   /product="Cytotoxic translational repressor of
FT                   toxin-antitoxin system RelE"
FT                   /note="COG2026"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61453"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULX0"
FT                   /protein_id="AAY61453.1"
FT                   /translation="MISIGAIGEYRIIYRFNETTIYVILVGKRNDSEVYKLLKNIF"
FT   gene            646319..646558
FT                   /locus_tag="RF_0603"
FT                   /note="RF0603"
FT   CDS_pept        646319..646558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0603"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61454"
FT                   /db_xref="GOA:Q4ULW9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULW9"
FT                   /protein_id="AAY61454.1"
FT                   /translation="MYDTVDSQEINMKNFIKYLFFTVLYIVVTIIVAYMVLAQTIPNDG
FT                   QCHMMDRPLVIHYILAAIITALPALILIYSRKKK"
FT   repeat_region   complement(646561..646687)
FT                   /note="RPE-5 Full"
FT   gene            646715..647326
FT                   /gene="ruvA"
FT                   /locus_tag="RF_0604"
FT                   /note="RF0604"
FT   CDS_pept        646715..647326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="RF_0604"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61455"
FT                   /db_xref="GOA:Q4ULW8"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULW8"
FT                   /protein_id="AAY61455.1"
FT                   /translation="MIGKLSGKIDSQGDDYIIIDVNGVGYLVYASGKTLGKLAEGEFYK
FT                   LFIETHVREEHIHLYGFLTLEEKNFFNLLQSVNGIGTRMALSILSSLTPSDIQIAINNE
FT                   DKNIFKAISGVGAKLAERIVLELKGKVAKISSGSVIIKDSLNIKNITPVASNEVIKALV
FT                   NLGFSRFEAQNAVQGIIIQNPEISIDELIKTALKNRNAGL"
FT   gene            647425..648297
FT                   /locus_tag="RF_0605"
FT                   /note="RF0605"
FT   CDS_pept        647425..648297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0605"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61456"
FT                   /db_xref="GOA:Q4ULW7"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULW7"
FT                   /protein_id="AAY61456.1"
FT                   /translation="MSKLKTFLASINVNKLIEELKKDPATLNINDEVLPNHLEDLLETL
FT                   KGDDTVKTLKIESSVWNSASLLSHNGITEESKIELLKAIPKMNLNALGLTGLTLNNSNI
FT                   DIFCEAIKHSKINELEFFLGREISDESKAKLFTSIKNNKALLNCLVTGPNDMSSQEKQE
FT                   KKAWTSQINERTDKNQSILEEVAQVLKDWSETPNDLHKGTIHSYLKLYQKLNKDSVIEE
FT                   LEKLKVTDANFILENADKHINEHFFEMVGIAKEVYADGLFVPTDIISYIASCIGDLSNI
FT                   INKSSDIES"
FT   gene            648360..649388
FT                   /gene="ruvB"
FT                   /locus_tag="RF_0606"
FT                   /note="RF0606"
FT   CDS_pept        648360..649388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="RF_0606"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61457"
FT                   /db_xref="GOA:Q4ULW6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULW6"
FT                   /protein_id="AAY61457.1"
FT                   /translation="MTNILSPEKIENDQELPIRPSYLQEFVGQQQIKENLSVFIKAAKS
FT                   RNEHLDHTLFYGPPGLGKTTLAKIISNEIGGNFKSTSGPAILKAADLAAILTNLEKNDV
FT                   LFIDEIHRLNTAVEEVLYPAMEDFELDIIIGEGPAARSVKITLPKFTLIGATTRLGLLS
FT                   NPLRDRFGIPMRLNFYNTEELKKVLNRASKLFDIDLTDSGSEEIAKRSRGTPRIALRLL
FT                   RRIRDFAAVDGKSRVDKEISDFGLNRLEVDHIGLDSNDYRYLKFIADNYNGGPVGIETI
FT                   AAALSEQRDALEETIEPYLIQIGLLQRTPRGRVITIAAFEHLKMPIPNQSHHQFNIFNE
FT                   NE"
FT   gene            649381..651144
FT                   /gene="msbA1"
FT                   /locus_tag="RF_0607"
FT                   /note="RF0607"
FT   CDS_pept        649381..651144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA1"
FT                   /locus_tag="RF_0607"
FT                   /product="Multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61458"
FT                   /db_xref="GOA:Q4ULW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULW5"
FT                   /protein_id="AAY61458.1"
FT                   /translation="MSNNNLNDSYTAADVIKRLIKDHVKPYANKIYFSIFCMVIAALCT
FT                   AVIVHAVRPIIDKIFLTHDKKMLIIMPIVLTVTFFIKGISEYYQNYLIKFVGQRVLNDL
FT                   QIKMYEHLLLADISFIQNQSSGRLISRFTNDISLMRGAVSNLLVGCAKHFLTVVCLIIT
FT                   MFHLEPLLSCVVFLVFPLAVYPVQRMGRKIRKIFSQSQEELGHYTSRLDETFQSIKIIK
FT                   SFVGEKIESNRASLIINNILEFYKKTSKLDAMVSPIMEGLSGLAVGGMVWYGGNLVLEG
FT                   KTTPGALFAFLAAFAAAYRPFKSLVSLNINLQEGIAAAKRVFSILDTEPLIKDHEDAKE
FT                   VDLYNPQITFEKLALSFESKIVIKYIDLKLEPHKMIAFVGRSGSGKTSLSNLLVRFYDP
FT                   NEGRILINNHDIKDIKLTMLRGQISLVTQDTHLFDTSVAENIAYGQENATREEIIEAAK
FT                   YADAHEFIIHLPNGYDTQIGVQGTTLSGGQRQRLAIARAFLKDVPILIWDEATSSLDQA
FT                   SEQKILESLKKLRQGKTTLIITHRLSSITDLDNIIVMKNGEICEQGTHTQLLKNKDEYY
FT                   RLYNKELRENG"
FT   repeat_region   651232..651300
FT                   /note="RPE-7 Full"
FT   gene            651320..652564
FT                   /gene="ampG4"
FT                   /locus_tag="RF_0608"
FT                   /note="RF0608"
FT   CDS_pept        651320..652564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG4"
FT                   /locus_tag="RF_0608"
FT                   /product="AmpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61459"
FT                   /db_xref="GOA:Q4ULW4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULW4"
FT                   /protein_id="AAY61459.1"
FT                   /translation="MLITKIFKDYRLFEIFILGIVSGMPLVIIFSTLSVWLKESGIDIA
FT                   VITTFAVARLSYSLKVFWSPLVDNFKIPFLSRWGHRKSWLILCSSLMVLVLIAMSKENP
FT                   EVSLTSLYFLTIALGFLSSTFDIAVDALRIDKFDQETQTIASATAVFGYRIGMLITGAG
FT                   ALYLAEITGNNWQLTFVIIAIIFAVATIFIITVNEKELVREKVNITSIISWIYAVINPF
FT                   KDFFKREFAVTILLAVIFFKLGDAMLGAVASPFYIELGYTKGEIAIIAKLYGLIATLVG
FT                   GFAGGIVMYKVGNFKGLIITGIAQSLTHFAFIWLNHQPPSFEALLIAITIENFAAAMGA
FT                   TALVGYIGNLCNKKYSATQYALLSSSSSLCNNTVTIYAGKLVNMMGWDGFFIFTIILAL
FT                   PALFILMYLNKKVNV"
FT   repeat_region   complement(652582..652659)
FT                   /note="RPE-7 Full"
FT   gene            652755..653675
FT                   /gene="dacF"
FT                   /locus_tag="RF_0609"
FT                   /note="RF0609"
FT   CDS_pept        652755..653675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacF"
FT                   /locus_tag="RF_0609"
FT                   /product="Penicillin-binding protein DacF precursor"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61460"
FT                   /db_xref="GOA:Q4ULW3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULW3"
FT                   /protein_id="AAY61460.1"
FT                   /translation="MFSKFLLPYIFIATFFFAPISEAKKAVKNTSKPPVQTSLVIDAKS
FT                   GKVLQAHNSQIRIYPASLTKLMTLYLMFEAIEAGKLPLDKKLLVSAKASKMPPCKLGLK
FT                   AGETITVREAINGLIIKSANDAAVTVAEGMKGSEKAFAHLMNVKAKQLGMKNTYFKNAS
FT                   GWHDPLQQTTARDMAKLAMALKRDYPKYYPLFAKTSFVFRGNIVNGHNRVTKNYQGAEG
FT                   MKTGFHTPAGYNLITTASRNGKSLIAVVTGGKSAASRDQKMMGLLDQHFNIKPIVPKSS
FT                   IKLASNNKSTTKAKSKIIKKKNIRS"
FT   repeat_region   complement(653720..653749)
FT                   /note="RPE-6 Partial"
FT   repeat_region   complement(653862..653978)
FT                   /note="RPE-6 Full"
FT   gene            complement(653865..653990)
FT                   /locus_tag="RF_0610"
FT                   /note="RF0610"
FT   CDS_pept        complement(653865..653990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0610"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61461"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULW2"
FT                   /protein_id="AAY61461.1"
FT                   /translation="MVRFMSFLRKQESKKNYKYSKFLKLKARFILLYDGFLLSQE"
FT   gene            complement(654029..654721)
FT                   /gene="rlpA"
FT                   /locus_tag="RF_0611"
FT                   /note="RF0611"
FT   CDS_pept        complement(654029..654721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="RF_0611"
FT                   /product="Rare lipoprotein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61462"
FT                   /db_xref="GOA:Q4ULW1"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULW1"
FT                   /protein_id="AAY61462.1"
FT                   /translation="MMMIQRHKLIVLIFLLIFCLSGCNTSKRLPYSHKYSYKELSKDDP
FT                   HNLTYKGHYKVGKNYKIKGKTYKPHSTKSFTETGYASWYGGRKDGFHGKKTANGDRFNR
FT                   NLLTAAHKTLPLPCLVKVTNKANNKSVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQG
FT                   ITKVKIEYLPNETEKFLKNINLKKPQSKTLAKNSKKSSSTKVTKNAKCSVNCHIKLVNL
FT                   KYKLAVNP"
FT   gene            complement(654699..655313)
FT                   /locus_tag="RF_0612"
FT                   /note="RF0612"
FT   CDS_pept        complement(654699..655313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0612"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61463"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULW0"
FT                   /protein_id="AAY61463.1"
FT                   /translation="MMLRVLIFIALSFSLSACLPAIFTAATTTGIVASKDQPMSKTLND
FT                   SRISAGIKADLVKNNFRDLGAKIKVEVSQGRVLLTGNIQKESDALKAVEIAWNQKGVKE
FT                   VINELKVNKNSNHFDLAQYTKDSMITTQIKAKNLVRKDIKFANYTILTIDNIVYLFGVA
FT                   RSEEELEKLASIASKIKGVEKVVCYAKIMDNFNKHDDDTTP"
FT   repeat_region   655461..655565
FT                   /note="RPE-4 Full"
FT   gene            complement(655632..656174)
FT                   /gene="ispZ"
FT                   /locus_tag="RF_0613"
FT                   /note="RF0613"
FT   CDS_pept        complement(655632..656174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispZ"
FT                   /locus_tag="RF_0613"
FT                   /product="Intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61464"
FT                   /db_xref="GOA:Q4ULV9"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULV9"
FT                   /protein_id="AAY61464.1"
FT                   /translation="MLKLLSEIGPVIAFFAGFFYGGGIQNATLYMLITSVICITLCYVI
FT                   DKKVSKLSIISTTVLLVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKY
FT                   ALESIVRLKEESWIILSYRTAAFFFFMAVVNEIVWRNFSDETWVKFKVFGVIPVTFIFI
FT                   LLQLPLLLKNKLPDSKI"
FT   gene            complement(656204..657052)
FT                   /locus_tag="RF_0614"
FT                   /note="RF0614"
FT   CDS_pept        complement(656204..657052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0614"
FT                   /product="FTR1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61465"
FT                   /db_xref="GOA:Q4ULV8"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULV8"
FT                   /protein_id="AAY61465.1"
FT                   /translation="MFKIALVVFRECLEISLLLGVILAVTKQIEKSRLYIIAGVMLGVV
FT                   FASIFAFFTRKLSLSFGGIGDELFDSGIMILITILISWTIIWMQGYGIKVKQHINDLSV
FT                   KIHEGNASYFMLVFLVATTILREGAEIIILVYSISSVETISSSIYLQGVIIGATSGFLL
FT                   GLVIYFGLIKIANQKYIFKISTVLLMLIAGGFAASAAGILTSSGLVMFLSDQLWDSSWL
FT                   VADRSMIGKILHIVTGYIARPNGLQVLAYFTTILLINIFIQIKLRYSKNNLISVQKNES
FT                   N"
FT   gene            complement(657062..657442)
FT                   /locus_tag="RF_0615"
FT                   /note="RF0615"
FT   CDS_pept        complement(657062..657442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0615"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61466"
FT                   /db_xref="GOA:Q4ULV7"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULV7"
FT                   /protein_id="AAY61466.1"
FT                   /translation="MEIIKKNKNIIVLVGLIFLAVIIYISTNKSSDNKTNDNILEVKIT
FT                   IKDHKFVPNIIEVPKSTKIRLIVHNEDDTVEEFESHDLHREKIVMPNESINIILAPLKP
FT                   GKYEIFGDFHQDTAQGIIIVND"
FT   gene            complement(657653..658648)
FT                   /locus_tag="RF_0616"
FT                   /note="RF0616"
FT   CDS_pept        complement(657653..658648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0616"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61467"
FT                   /db_xref="GOA:Q4ULV6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULV6"
FT                   /protein_id="AAY61467.1"
FT                   /translation="MQKFLSLIIVILILYNIVKLKISPDNNNPTTIEQTASNNSSTDEN
FT                   QTSINNEPHISLNGNLFERTVSKIVINALKTEEGKAFFENILQPLNGPINPNDYTIEVR
FT                   KDLVKTLFKINTLGSGNIGPASCGHVVTVFYQISDMNNTLISEDTKTFTLGSAPVMLGL
FT                   DNVIIGMMVGEAREAIIPAKYAVNNSKNIIFDDAYNYKVNVILKSILPQNFVKNNEVKI
FT                   YDDEIAYRVPLLCGEKVSFNAKITRLSNGKILYDSKAKGQQIDMKIGDITYPLIFSYAL
FT                   QGKVTVGTRSVIAEGKTFKALGSNINKIISHESLPINEYLLLELGDFKQN"
FT   repeat_region   complement(658686..658808)
FT                   /note="RPE-3 Full"
FT   gene            658847..659473
FT                   /locus_tag="RF_0617"
FT                   /note="RF0617"
FT   CDS_pept        658847..659473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0617"
FT                   /product="Protocatechuate-3,4-dioxygenase, beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61468"
FT                   /db_xref="GOA:Q4ULV5"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULV5"
FT                   /protein_id="AAY61468.1"
FT                   /translation="MKKFIFCFLCLWTLNIFAASKTYPNKLNRCKITRNIFNDYEPKVF
FT                   ETTNNLLRKTGRLSKFYGERILIKGKILDQNCVPVADAKVYLWQVGSGGKYPYEPLKTR
FT                   VDKRRFTSKSDSSFTGSGIATTNNKGEYYFISMLPYKSSRYLRSANIRIEHPSLTTLET
FT                   RLDLSDKNMCDNECGEVNPILIEPQENMPSYCFDLVLQGTTLKRY"
FT   repeat_region   659507..659571
FT                   /note="RPE-7 Full"
FT   gene            659679..660326
FT                   /gene="tlpA"
FT                   /locus_tag="RF_0618"
FT                   /note="RF0618"
FT   CDS_pept        659679..660326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpA"
FT                   /locus_tag="RF_0618"
FT                   /product="Thiol:disulfide interchange protein TlpA"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61469"
FT                   /db_xref="GOA:Q4ULV4"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULV4"
FT                   /protein_id="AAY61469.1"
FT                   /translation="MTLRNYNKYLIYIIVFLLSIIIFIPKIYAKHQDKLEFLRGSSVPD
FT                   NIIFFDEEKNQYSLDQFEGKTILLVFWATWSAPCVKEMPDLDMLQKDFRKLPFSVIPIS
FT                   EDYQDIKIVKEYFKSYQIRYLPIYHDYRNELFKALGVVSLPTSILIDPNGKIITSFVGN
FT                   TNWYDEKVRDTILSAIPGNYPEPKNSYNEQSLNKPAKPLPPVKKDAIVTPNK"
FT   repeat_region   660324..660448
FT                   /note="RPE-5 Full"
FT   gene            660474..661388
FT                   /gene="sppA1"
FT                   /locus_tag="RF_0619"
FT                   /note="RF0619"
FT   CDS_pept        660474..661388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA1"
FT                   /locus_tag="RF_0619"
FT                   /product="Signal peptide peptidase SppA"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61470"
FT                   /db_xref="GOA:Q4ULV3"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULV3"
FT                   /protein_id="AAY61470.1"
FT                   /translation="MNEVNKSTMANAEFDQIITKRQISKLDQLFASVFGDSKEVIAVLR
FT                   LSGVIGKVSTMQSGLTLESLNELIEKAFKIKKLKALCLIINSPGGSPVQSELIAKRIRD
FT                   LAKENKIKIYSFIEDMAASGGYWLACSGDWIYASYSSVIGSIGVVSSGFGFHEAINKLG
FT                   IERRVYTEGKNKAILDPFKPINKEDLKIIKNLQQQVYEHFVDYVKTRRAGKLTQQDEIL
FT                   FNGEFWAGQTALDYGLIDGIGDMYSIMKEKFGDNIKFQYLCAKQPWLKKKLGMGSKILT
FT                   DNFANSLIDAVENKIVNDKFDIR"
FT   gene            661390..661836
FT                   /gene="dut"
FT                   /locus_tag="RF_0620"
FT                   /note="RF0620"
FT   CDS_pept        661390..661836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="RF_0620"
FT                   /product="Deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61471"
FT                   /db_xref="GOA:Q4ULV2"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULV2"
FT                   /protein_id="AAY61471.1"
FT                   /translation="MTITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAGE
FT                   IQLIPTGIAIALPDSFEAQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGKE
FT                   DFVIEKGMRIAQMIIAKYERILWEESSSLTETMRGSGGFGSTGV"
FT   repeat_region   661902..661997
FT                   /note="RPE-7 Full"
FT   gene            661993..664068
FT                   /gene="mltE1"
FT                   /locus_tag="RF_0621"
FT                   /note="RF0621"
FT   CDS_pept        661993..664068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltE1"
FT                   /locus_tag="RF_0621"
FT                   /product="Soluble lytic murein transglycosylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61472"
FT                   /db_xref="GOA:Q4ULV1"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULV1"
FT                   /protein_id="AAY61472.1"
FT                   /translation="MTENRSTQQDLLAMTVLVSTQQIIKLMKITIKLLTSIFLLALNWI
FT                   PWSSYGMTTAVNSDSVDKVKQVFTYIDQKNWSQAEDLALEVNNKVLTKIVLSQKYLDNK
FT                   YSDNSFEHVIRFLRNNPDWPQNKLLEERAEEYLNNNTNKKVIFDWFSKHSPLTGKGYKF
FT                   YAAAASSLIKDQKILLPIIKESWVYANFTPEEENTYYNKWHKYLTANDHLERIEEHLWK
FT                   NDIRSAEQSLKYVDQGYRNSFKAQIAIIGKLPNAEKLFKSVPEKYYSSGLLYRYLDFKK
FT                   MQKPTKEVITLFKKAKNNRKHFAKWCRIQSYYAREFIDYKDFANSYRMATLPFATCPET
FT                   IREQEWLAGWLSLSFLKKPDQALVHFNKFIKVVKTPISLARGFYWLGRTYEAKGDKQTA
FT                   RKFYEQAAKYSFTFYGQVANVELNRTKLVLPPIPVITSEERKTIENKEIIKAIRLLVKY
FT                   NKNNLAMIYSKAAIKNTKNPAEIQIIANIIKANNNTNHMVEVAKIAAQNNAFIPDCAFP
FT                   TPYNLGGLPIPSHLTYGIIRQESVFDHRAVSYANAMGLMQLIKGTACDTAKSINMKCNV
FT                   ADLTRNPVYNIKLGSHHFKKLLDDHKGSYILSIASYNAGSHNVVKWIDRFGDPRDIKDT
FT                   RKVIDWIELIPFRETRDYVQRVLENVQIYRVILNKNSNLYFKRDLHACNIVKVNFY"
FT   repeat_region   complement(662081..662151)
FT                   /note="RPE-4 Partial"
FT   gene            664144..664869
FT                   /locus_tag="RF_0622"
FT                   /note="RF0622"
FT   CDS_pept        664144..664869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0622"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61473"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULV0"
FT                   /protein_id="AAY61473.1"
FT                   /translation="MKKLEQHFKKQRNDTDTQVKKYKKDLDVIDIRYDHKSAHVEVPNH
FT                   ATGGFEYFKWDWMTSTTSSHSEIVQIFKKIVRTLKEAKNNPAQYENLVSKLDASTKNAL
FT                   DVNIKKHNITVPTQDTNKVISEILSGMQTWLDTKSHIPLELKQKFLELGSNNLEEFIES
FT                   AFNKFNNKWIVKEFIDNAFVPPREESNKYLADSGCDSAEQLWTKMENLRISDDSNKATT
FT                   SQASSESINSSDFKGNHVR"
FT   repeat_region   complement(665235..665314)
FT                   /note="RPE-4 Full"
FT   gene            665371..666324
FT                   /gene="mccF"
FT                   /locus_tag="RF_0623"
FT                   /note="RF0623"
FT   CDS_pept        665371..666324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mccF"
FT                   /locus_tag="RF_0623"
FT                   /product="Microcin C7 self-immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61474"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULU9"
FT                   /protein_id="AAY61474.1"
FT                   /translation="MILKNLSLLIILFFSISAFSSATNLKNIPITVVAPATGADNKTLS
FT                   DLKNINGLNLQILSKCFAKGKLPFLASSDEVRFNCLRDALFDESDNVVWSLRGGYGSAR
FT                   IIPGLLKLSKPNKEKFFIGYSDITALHLFLSQEWGWKTIHGSNIADLLKTDKDQSNFTK
FT                   LAEILKGKVKQVTIDNLSPLNDIAKSSDLVNGKLTGGNLTMVQTSIGTSWQIKTKGKIL
FT                   FLEDVNVAPFRLDRELLHLKQAGLLEDVKAIIFGSFGKDLDATMLVLRNFADNLNIPVF
FT                   KTNRFGHEKINDPIIYNTDSKIIMGKNKGFKLVMRL"
FT   repeat_region   666362..666428
FT                   /note="RPE-7 Full"
FT   gene            complement(666446..669016)
FT                   /locus_tag="RF_0624"
FT                   /note="RF0624"
FT   CDS_pept        complement(666446..669016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0624"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61475"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR022436"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULU8"
FT                   /protein_id="AAY61475.1"
FT                   /translation="MTADYSFLKSFAEYIIDKLEKGTEVQIILPNNFSCLELKKILTDK
FT                   YKIKLPIIIPFNSLISKKTDSDYVSKIEELLIISKIITEYKDLQFNKNESLKAAEILRK
FT                   LINDLIINNIDIKLIEVYNNSNYWQKIYKFLEYCFLRWQEEISLTQKQTKAIHKLKLLQ
FT                   EEIIRIKNKQIILVGMFKPNVFLKRFEEDLKDYIVYYNQTSKQISDGISYYEPNDIYEE
FT                   AVAIAYICSRNKDKRIAIITNNNKLKRVYCNFLDRYEDLLGNDLRLTNIGELLTSIIKI
FT                   LCNNFDLKLLFLLLKNPLINCSATQKLEVMLSNKNRFISSPKYLLQLQFDNEDTKEYCR
FT                   NLIDILFTDNPHNILDILTLTKEIAEKLLPTIWEKEGGAELVEFLTNLTAYSKYINSMD
FT                   KKDFPKIFSFLLSNIKYYKNTDSANIIIAPPEDLALCTFDLIILPHFNNENWTPTAKSH
FT                   PWLSKKALQILNIDYNETASTLYSDYFNLFLQNKQVIILNAKKYDGKLSVPSNLFLKLQ
FT                   DVIPAVHYVIPAEAGIHLDMDSRRCWNDIRKDDIGDESTAHSHSFPSVLSVTDIETLIR
FT                   NPYGFYAKKILGLRKKDNIWEEPKISDFGNFIHKVLEEYSKNYDKQFINLNLLDKQNAL
FT                   INIGNHILYGTILPNYTKKTWQIKLTAFSKAFILFDIERRKNCKEIYFETKGELRLNIA
FT                   GQDIKIIGIADRIEISKSNHITILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFNI
FT                   KNENTIVNSVGLGYKARGATPIIIGETTSNDVGKPKSIDYTIAYVKITSTEPYVQTTEI
FT                   ALSIETLNKHKAGLIKLLEYYVTNKSFSYDLNLSKYNDYLHLSR"
FT   repeat_region   complement(666638..666741)
FT                   /note="RPE-2 Full"
FT   repeat_region   667380..667407
FT                   /note="RPE-6 Partial"
FT   repeat_region   667416..667443
FT                   /note="RPE-6 Partial"
FT   gene            669168..669434
FT                   /locus_tag="RF_0625"
FT                   /note="RF0625"
FT   CDS_pept        669168..669434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0625"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61476"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULU7"
FT                   /protein_id="AAY61476.1"
FT                   /translation="MKIFIILFTIIVSITSRAYANNLNSHIAYCDNIQVEQQEDLIIQK
FT                   LVKLFAAEMNCIIGGCLQQWDVQDNRVKYSIAWQEQCGPVIYG"
FT   gene            complement(669573..670451)
FT                   /locus_tag="RF_0626"
FT                   /note="RF0626"
FT   CDS_pept        complement(669573..670451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0626"
FT                   /product="Predicted glutamine amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61477"
FT                   /db_xref="GOA:Q4ULU6"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULU6"
FT                   /protein_id="AAY61477.1"
FT                   /translation="MKKKPIIGVTPDLAQNCEKYTYAAFPWYALRRNYTDAIIAAGGVP
FT                   LLLPYQTDTINQLIELVDGVVIPGGDEDIHPKFYEPEYAEDVVISNEERDNFEILVLKK
FT                   VLERDIPVLGICRGMQLLNVIFKGTLIKHIPDYIRHLSELAYREEFEGNTEVLATAAYK
FT                   SVREDASTGLTYKLPLEVEFRKVSIGTVINHTQPPPKNIVSHAINIEANTKLSKIANNQ
FT                   LQTMVNSTHHQAAKQLGNDLIVSAKAEDGIIEAIESTKHKFVIGVQWHPEYLNDNGVDL
FT                   ELFKELVKVSK"
FT   repeat_region   complement(669891..670037)
FT                   /note="RPE-1 Full"
FT   repeat_region   670531..670606
FT                   /note="RPE-7 Full"
FT   gene            complement(670636..672234)
FT                   /gene="coxA"
FT                   /locus_tag="RF_0627"
FT                   /note="RF0627"
FT   CDS_pept        complement(670636..672234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="RF_0627"
FT                   /product="Cytochrome c oxidase polypeptide I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61478"
FT                   /db_xref="GOA:Q4ULU5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULU5"
FT                   /protein_id="AAY61478.1"
FT                   /translation="MDITTTEIYHDDHHTPHGWKRWLFSTNHKDIGIMYIIFAVFAGIV
FT                   GGLFSLLFRLELAMPGGTFLNHDFQLYNVLITAHAVIMVFFMIMPALFGGFGNYFVPLL
FT                   IGAPDMAFPRLNNISFWLLVTAFILLMGSAFVDGGPGTGWTLYPPLSNLSGHPGAAVDM
FT                   AIFSLHLTGLSSILGSINLIVTIFNMRAPGMGLFKMPLFVWSILVTAFLIILAMPVLGG
FT                   AITMLLTDRNFGTNFFKPDGGGDPVLFQHLFWFFGHPEVYIVILPGFGIVSQVISTFSR
FT                   KPIFGYQGMVGAMVIIGFVGFIVWAHHMFTVGLSYNALIYFTAGTMIIAVPTGIKIFSW
FT                   IATMWGGSITFPTPMLFSIGFIILFTIGGVTGIILSNSALDRVLHDTYYVVAHFHYTMS
FT                   LGALFTAFAGFYYWFGKISGKQYPEILGKIHFWITFIGVNLTFFPQHFLGLAGMPRRIP
FT                   DYPEAFAGWNMVSSIGAGISMAAALYFVFIVFYTLKYGKDCPNNPWGDGADTLEWTLTS
FT                   PPPFHTFETPPHIEG"
FT   repeat_region   complement(672289..672461)
FT                   /note="RPE-6 Full"
FT   gene            complement(672484..673203)
FT                   /locus_tag="RF_0628"
FT                   /note="RF0628"
FT   CDS_pept        complement(672484..673203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0628"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61479"
FT                   /db_xref="GOA:Q4ULU4"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULU4"
FT                   /protein_id="AAY61479.1"
FT                   /translation="MSGFRYLVRRFYNIKENLILPLLFENLKSNNKRIYGETVQVLGEI
FT                   THFVPRLKRKIYLAYFENGIDFFTETRLKKFTDKNLIYSLNNEEEKIEFILSFCQNSLN
FT                   YQEALEVCLYFLKKNENEEINIAAFQGLSYIVFRFRKIDFKAVLPFIKRFSKYSITGCE
FT                   NIYAESLLEDIAIVIPKLRKKVISLLKKSPVFFLVLWFVNYIIAKNKPKDQIKLEKILK
FT                   LHLNNLKRKKLKYNFDF"
FT   repeat_region   complement(673480..673598)
FT                   /note="RPE-6 Full"
FT   gene            complement(673654..674601)
FT                   /gene="coxB"
FT                   /locus_tag="RF_0629"
FT                   /note="RF0629"
FT   CDS_pept        complement(673654..674601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="RF_0629"
FT                   /product="Cytochrome c oxidase polypeptide II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61480"
FT                   /db_xref="GOA:Q4ULU3"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULU3"
FT                   /protein_id="AAY61480.1"
FT                   /translation="MKNIIRHLSKPAYREEFKGDTSPRTAAYISNRADASLGSTYKLPL
FT                   EAKFWKMSIALICFLIVSSNCFASEPLPWQVTFQPPASPIMEELHHFHNFLLYISTAIV
FT                   LFVAGLLGFVCIRFNAKNNPVPAKFSHNVLIEIIWTVIPIIILVIIAVPSFRILRHAEK
FT                   IPETDLTIKVVGYQWYWHYIYPDHDNLEFDSVMISDENLKPDQKRLLDVDNRIVIPENA
FT                   TVRFLITAGDVIHSFAVPSLGFKIDAVPGRINETWTRVAKKGVYYGQCSELCGINHGFM
FT                   PIAIEVVSKEDFDNWIASKNKTAMNGKNPKLAAN"
FT   repeat_region   complement(674443..674586)
FT                   /note="RPE-1 Full"
FT   gene            complement(674685..675239)
FT                   /gene="tagD"
FT                   /locus_tag="RF_0630"
FT                   /note="RF0630"
FT   CDS_pept        complement(674685..675239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /locus_tag="RF_0630"
FT                   /product="Glycerol-3-phosphate cytidyltransferase TagD"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61481"
FT                   /db_xref="GOA:Q4ULU2"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULU2"
FT                   /protein_id="AAY61481.1"
FT                   /translation="MPRLFLFLLIFINLMSCLSNHNAVKLPKIEYYENISLNKNCPINS
FT                   EIVLVGGCFDLLHYGHIEFLRKAKKQGKYLIVALEPDETIIKYKKRQPIHNQLQRAKIL
FT                   SSFTFVDKVLILPKLKDFNDYARLVQNICPAVIAVTKHDPQLINKQIQAKLINAKVIEV
FT                   IDLLQHPNIGTLSSSNIIKNM"
FT   gene            675424..676788
FT                   /gene="nlpD2"
FT                   /locus_tag="RF_0631"
FT                   /note="RF0631"
FT   CDS_pept        675424..676788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD2"
FT                   /locus_tag="RF_0631"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61482"
FT                   /db_xref="GOA:Q4ULU1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULU1"
FT                   /protein_id="AAY61482.1"
FT                   /translation="MNDTALSYDFNDILPSSFISARLRKILTSSSLLLFIALVVFVSFA
FT                   VNNYVNDTLSITLVQPDSNEEETISFKEVVVKKGDTIKSILIEQHIPKNEIEKIVSLIK
FT                   EGKLSSALKIGQQITFEYETKITENKDEDLTSEVTFLNKIVIIIDKLKTIEVIREGDNF
FT                   KVAEIIVPLTKKVAKSSVSIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKSGD
FT                   TATVITEKYVTEDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNKANNQVFFSEDGKSVK
FT                   RSLLKTPLKVIKVSSHYGNRKHPILGYTKMHKGVDFAAPTGTPIYSAGNGVITEIGWKS
FT                   GYGKFIQVKHSGTLSTAYAHASNFAKNLKVGSIVKQGQVIAYVGSTGRATGPHLHYEVK
FT                   IDGKHVNPMSVKTTPGVELNGKNLEKFKQFKKEIKTLNVKLDKELQVEKAAEVSL"
FT   gene            676817..677533
FT                   /gene="lspA"
FT                   /locus_tag="RF_0632"
FT                   /note="RF0632"
FT   CDS_pept        676817..677533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="RF_0632"
FT                   /product="Lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61483"
FT                   /db_xref="GOA:Q4ULU0"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULU0"
FT                   /protein_id="AAY61483.1"
FT                   /translation="MLQSRAKVLRLLRRNLQFLLAMTIKPIHAKNNIRAIIHKTSMFLL
FT                   LKKLYITFARSSRIIITLVIIDQLSKWWFIDDLRWKPGLMLKVTSFLNMVYTWNYGISF
FT                   GLMREYYQYSNAIFLITNTLIVCYLYYLMIRSKTIGSFAGYSFVIGGAVGNLIDRFFRG
FT                   AVFDFIHFHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQIEAM
FT                   AEKIRNAGHNGDDIVN"
FT   repeat_region   676818..676884
FT                   /note="RPE-7 Full"
FT   repeat_region   677521..677637
FT                   /note="RPE-3 Full"
FT   gene            677676..677924
FT                   /locus_tag="RF_0633"
FT                   /note="RF0633"
FT   CDS_pept        677676..677924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0633"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61484"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULT9"
FT                   /protein_id="AAY61484.1"
FT                   /translation="MKKIFLLVTVLLITSACSKKLKETVGISTAGPNEYQVQRAKALEV
FT                   PPHYYLPDPGNSKSTYNNIKGQGEFNEGEQALMQEIN"
FT   repeat_region   complement(677941..678014)
FT                   /note="RPE-7 Full"
FT   gene            678060..679409
FT                   /gene="murD"
FT                   /locus_tag="RF_0634"
FT                   /note="RF0634"
FT   CDS_pept        678060..679409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="RF_0634"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61485"
FT                   /db_xref="GOA:Q4ULT8"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULT8"
FT                   /protein_id="AAY61485.1"
FT                   /translation="MNSHTKQKIGVFGLGKTGISVYEELQGKCDVIVYDDLKANRDIFE
FT                   ELYTNNSIAALSDSRWQNLDKIVLSPGIPLTHKIAGIAKNFNIPIISDIDLLFEKSKNL
FT                   NFIAVTGTNGKSTTTALISHILNSNGLDYPVAGNIGVPALQAKASKDGYILELSSFQLD
FT                   LVKTFTAKIAVLLNITPDHLDRHQDMTGYIAAKSKIFDRMDKDSYAAINIDNYYCREIF
FT                   MLLQQEQRIKLIPFSVTKILKNGISVVGDKINDNDISYKLPFNKNLQGTHNCENIAASY
FT                   AVAKIIGVESKKILESISSFQSLPHRMQYIGSINNIGFYNDSKATNAISAVQSIKALDN
FT                   IYWLAGGIPKEGGIEEIKPYFSKIKKAYFYGQAKEIFAKTAKNIVDFVICDNLEQAFDL
FT                   AYKDAVGDNAEVKNILLAPSCSSYDQFKNFEERGELFMKLSKRHCEEITK"
FT   repeat_region   complement(679384..679449)
FT                   /note="RPE-7 Full"
FT   gene            679469..680623
FT                   /gene="ftsW"
FT                   /locus_tag="RF_0635"
FT                   /note="RF0635"
FT   CDS_pept        679469..680623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="RF_0635"
FT                   /product="Cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61486"
FT                   /db_xref="GOA:Q4ULT7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULT7"
FT                   /protein_id="AAY61486.1"
FT                   /translation="MTKRAYNMNNEISNNFIKLWWRSTDRQIIISLIILFAFSLMLVTT
FT                   SGSAVASRIGLEESYFASRQIFYLAAASGLILLFSCLNKKWLRRFAIVGFIASIVLLIA
FT                   VKFFGYEVKGAVRWINILGLSIQPSEFIKPFFAVVTGWILSLKFNDDFPSFTICVILYS
FT                   IVAILLIIQPDFGMLVMITAVFGIQLFIAGMPIFWIVLAGFLGMIGVTIAYFWLPHVTQ
FT                   RINSFLDPDSSENYQVSKSLKAFEHGGLYGRGPGEGAVKQVLPDSHTDFIFAVAGEEFG
FT                   AIICLIVIGIFAFIVLRSLIKLLNETDKFVQFAASGIIAQLGLQAIINMGVTLHLLPTK
FT                   GMTLPFISYGGSSTLAIAIATGMLLGFTRHRTPLNSYKIRNIEI"
FT   gene            680620..681702
FT                   /gene="murG"
FT                   /locus_tag="RF_0636"
FT                   /note="RF0636"
FT   CDS_pept        680620..681702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="RF_0636"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61487"
FT                   /db_xref="GOA:Q4ULT6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULT6"
FT                   /protein_id="AAY61487.1"
FT                   /translation="MKKIILVAGGTGGHFFPAVALGEELIKRGYEVHFITDLRCQKYIN
FT                   QNMGLIFHILDLKRSDNIFLFLPNLSIAILKAIKLLYNIRSSVIIGFGGYPVIAPMFAA
FT                   IFLRVPIIIYEQNSYLGKVNKFFASFAKKIAISYEDVKNLPEFVKSKIVVTGGIVRENI
FT                   RNVCHSRESGNDIKRSKDNIFTVFIFGGSQGAKLFSELIPASIQILMQKQPNLKLNIIQ
FT                   QAALDDQVKIKDIYSKLNINYEFAEFFDNMALKYKEADLVISRAGASTIEELTYIGLPA
FT                   IFIPLPSAADNHQYYNAKLLADKKAGWCLEQNSISAEELADKILDLINNPKILEDTSQN
FT                   LLKRRKEGHVLLSDLIERVI"
FT   repeat_region   681117..681141
FT                   /note="RPE-6 Partial"
FT   repeat_region   complement(681715..681781)
FT                   /note="RPE-7 Full"
FT   gene            681951..682607
FT                   /locus_tag="RF_0637"
FT                   /note="RF0637"
FT   CDS_pept        681951..682607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0637"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61488"
FT                   /db_xref="GOA:Q4ULT5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULT5"
FT                   /protein_id="AAY61488.1"
FT                   /translation="MLKKIIILFLGMFLLSACTDNFRSYFQRSANNRLVDSKGAKGGKR
FT                   KPVYNNKYITLAKKNIVEDNLDDDNDDDDDYDSDSPLRGERIDPVKRNRDMYLKMIKRD
FT                   IARQKAESGFAESDDDMTLNRANKKVRKDDSDKEKRMQEELNQIKAMLRETKRDISKYT
FT                   CPNATVNQNYAPPVTNYEPVNYPPVKNSKPYNNNSKVKQKFIREDDDNGSNACSI"
FT   repeat_region   682659..682755
FT                   /note="RPE-7 Full"
FT   gene            683055..683519
FT                   /locus_tag="RF_0638"
FT                   /note="RF0638"
FT   CDS_pept        683055..683519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0638"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61489"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULT4"
FT                   /protein_id="AAY61489.1"
FT                   /translation="MASDDVSIQATREQILYALKAVESAKQHLTDKTQEFCNKLNDYGI
FT                   CVAYSFANYKRSGKDILEFVSPYLLKNASDMEYIKAYIPEAYIKESNKNDAMELFGKRE
FT                   VRDYLDQKSSELVSKSPVPSTPSTTDTFNYDSDEITVAGEEKTTPNTEQA"
FT   repeat_region   683526..683627
FT                   /note="RPE-4 Full"
FT   gene            complement(683658..685118)
FT                   /locus_tag="RF_0639"
FT                   /note="RF0639"
FT   CDS_pept        complement(683658..685118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0639"
FT                   /product="RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61490"
FT                   /db_xref="GOA:Q4ULT3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULT3"
FT                   /protein_id="AAY61490.1"
FT                   /translation="MLDSDTGQILVFTEAAQTISFDAMVKEQQQVSDVLLKNPNIDSFF
FT                   SAVGVSGRNSAVNQGTIFISLKPRNQRIGADEVIDQLRSKLNHLVGLRVYIQNVPTITI
FT                   GGQATKSQYQYTMQGLDQDELFSFTPKLKDKLARLPGFTDVTSDLQIAQPQTLVQIDRY
FT                   KAAKLGISVEQIQNILYAAYGAEQISTLYTPTAQYDVILELDPKYQTDSSMLSLVNINS
FT                   ANGNLVPLTTLAKIVNNVGPLSISHFGQLPSVTVSFNLQDGYSISDAVPKVNQAIKGLQ
FT                   MPATITGSFQGTAQAFQSSFSDLGLLLGLAVIVIYIILGMLYESFVHPITILSGLPTAI
FT                   FGALLTLLIFNSELDMYGFVGLIMLIGIVKKNAIMIIDFALELERTDNKSSHEAIYEAC
FT                   IIRFRPIMMTTLAALMGAMPIALGVGTTGAERRSLGLAVVGGLLTSQLLTLYITPIIFL
FT                   YLEAAKRWLKNSNYKAEIRSYLELNWKD"
FT   gene            complement(685088..685813)
FT                   /locus_tag="RF_0640"
FT                   /note="RF0640"
FT   CDS_pept        complement(685088..685813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0640"
FT                   /product="RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61491"
FT                   /db_xref="GOA:Q4ULT2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULT2"
FT                   /protein_id="AAY61491.1"
FT                   /translation="MLLALILVVIAIFLFLHNLRSVIIPTIALPLSIVGTFAFMYLFGF
FT                   SIDNMSLMALTLAMGFVVDDAIVVLENITRHMEKGEGKIAACINGTKEIGFTIVSMTLS
FT                   LMAVFIPILFMSGILGKLLHELAVVITTAILLSGVISITVTPMLCNVFLKDRHCEERSD
FT                   EAISGHQTEIATASLTPRNDESLLTEKAFEYVKQKYSSSLKTVVEHSKTTMLILLSQRL
FT                   IYLGKSVKVLCLIPIRDKS"
FT   repeat_region   685289..685347
FT                   /note="RPE-7 Full"
FT   gene            complement(685831..686826)
FT                   /locus_tag="RF_0641"
FT                   /note="RF0641"
FT   CDS_pept        complement(685831..686826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0641"
FT                   /product="RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61492"
FT                   /db_xref="GOA:Q4ULT1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULT1"
FT                   /protein_id="AAY61492.1"
FT                   /translation="MGISEIFIKRPVLATLFMATILLFGAFGYKLLPVSVLPDIDFPTI
FT                   QVSVSLPGADPTTMASSVALPLEKQFSTISDIDSMSSVNSNGTTQITLQFNLDRDIDAA
FT                   AQDVQAAISSAAKQLPNDLPTPPSYRKVNPADAPIFYLSLTSDTLPLYTVDYYAETIMA
FT                   ERLSMLPGVAQVQVYGSQQYAVRVQVDPVKMAANNIGLDQVSNIISSANINLPTGALYG
FT                   KDLYSSIRVPGQLQNAKEYNDLILTYKNGNPLFLKNIGKAIDSVANNKIAAWYRDKPGV
FT                   ILAIQKQPDTNTIEIVDSIKEVLPLLRRQIPKGVNINIMFDRSISLSENR"
FT   repeat_region   complement(686840..686941)
FT                   /note="RPE-4 Full"
FT   gene            complement(686973..688232)
FT                   /gene="mfp"
FT                   /locus_tag="RF_0642"
FT                   /note="RF0642"
FT   CDS_pept        complement(686973..688232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfp"
FT                   /locus_tag="RF_0642"
FT                   /product="Membrane-fusion protein component of the RND
FT                   family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61493"
FT                   /db_xref="GOA:Q4ULT0"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULT0"
FT                   /protein_id="AAY61493.1"
FT                   /translation="MLKTIIDFLHNAANKEEFVGDTERSTAAYTLVREDASTGSTHKLP
FT                   LEASYARRLMRNLILITLLVLAVILVVWVIKHHHKSNKQIIIAAPVEVTKVIKKDVPYV
FT                   IELAGAAETYQSADIRPQVTGQILSVNFDDGQEVKAGDLLYEIDSRPFQNQLQQAQANL
FT                   LSDTYNLENAIKEEARYRALYQEKAVLEEQYLQMLTNMNMLKASVERDKAIIADANLQI
FT                   EYSKIVAPFDGKLSESNVDIGDLVSPDFASLVTINTISPIYVSFSVPEEYLDRINKSQK
FT                   SNDLALTVRTVNDQEIKDGEIVFVDNAIDPNSGTIKVKATLLNNDEILWPGQFVRVSLT
FT                   IYIEKAALIVPSKAMQTNDQGPYVFVVNKDNKAVVKNIDIVFSNDDFIVIKSGIDEGET
FT                   VITNGQLRLSNGTEVSVREE"
FT   repeat_region   complement(688072..688215)
FT                   /note="RPE-1 Full"
FT   repeat_region   688301..688378
FT                   /note="RPE-7 Full"
FT   gene            complement(688389..689780)
FT                   /locus_tag="RF_0643"
FT                   /note="RF0643"
FT   CDS_pept        complement(688389..689780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0643"
FT                   /product="RND efflux system, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61494"
FT                   /db_xref="GOA:Q4ULS9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULS9"
FT                   /protein_id="AAY61494.1"
FT                   /translation="MNLLDNRHCEERSDVAISFNILRLLRQLLCNFLVMTDKLIHAIIT
FT                   SRNGINILIISISSFLLCSCSTKQNNTIPNLSLPTTWNNYSLAQKDNMPQQWWLQFNDP
FT                   VLNQLIEESLTGNSDIELAMSNVLAAKAQLNLVNSYRFPQINLQGGANRTKNSKETVRL
FT                   SVISNVTMSYFNLLALDKQIYLTEKLIEAQTEIYKLNQKLYNLGVGDLISVSEAASELA
FT                   LTNLSLPPLKQQRHEQETALKILVGRTPENIVNGLIYRDKPIDYFPALPVLPKILPSEL
FT                   LEQRPDIKAAEQNLLAADANLKAIKATYFPQLSLTGLLGFGSNKLNTLFNSSAQTWQIG
FT                   GNIAGPIFDFGKTRANVQIAESVKEQYIAQYKSVVRTAFGEVMDALSLEQTSNSNFHIW
FT                   QQNEAALTSIFKLAAQRYKRGNIDYLTVLTAKQNVLQNEIDGVAIKLSQLSSMVNIFHA
FT                   LGGKW"
FT   repeat_region   complement(689674..689739)
FT                   /note="RPE-7 Full"
FT   repeat_region   689893..690009
FT                   /note="RPE-3 Full"
FT   gene            complement(689991..691007)
FT                   /locus_tag="RF_0644"
FT                   /note="RF0644"
FT   CDS_pept        complement(689991..691007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0644"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61495"
FT                   /db_xref="GOA:Q4ULS8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULS8"
FT                   /protein_id="AAY61495.1"
FT                   /translation="MKVLNIMLSRDLGGIQQAFLDYNAALEMQKIEVINITSYKAKINS
FT                   FLRKTSFKLPNLVPIDPLSVLILKYIIYKIKPDIIIAHGNRAINFSKFAKSQNIKLIGI
FT                   AHNYSLKGLRKCNFIIALTHHMKEFLLKNNFAESWICTLPNMINISKDFTPNKTYKKPI
FT                   VIGILARFVAKKGVDVFINAIKILKEKKYDIQAVIGGSGEEKDNLIALARKLNLQDQIS
FT                   FTGWVNDRDNFFKQIDIFCLPSLHEPFGIIVLEAMEAGLPIVSTDTEGPAEILSDMQDG
FT                   LICKAASSEDLAEKIVYLIDNPIKAKEFSKNAYLTLKQNYDIKVVSKKLQHILESLI"
FT   gene            691091..691903
FT                   /gene="dapF"
FT                   /locus_tag="RF_0645"
FT                   /note="RF0645"
FT   CDS_pept        691091..691903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="RF_0645"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61496"
FT                   /db_xref="GOA:Q4ULS7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULS7"
FT                   /protein_id="AAY61496.1"
FT                   /translation="MISKINFVKMHGLGNDFVVVNKRDLSSSYDLSQLAKNMADRHTGI
FT                   GCDQFIIYEEHDDFYEMIIYNIDGSSAKLCGNATRCLAKLIYLDTGKKDITVMVGNKKL
FT                   LCNVEDENNISVNVGKVSFNEVWMPSRDKIWELAERYMIDLKETICVDIGNPHLVIFSK
FT                   LEPQDQKIVGEKLQAKELFADGVNVNFAEVKDNKIYLSVWERGAGLTLACGSGACGSFA
FT                   AGLKLGFIHSPSTVVFKYGSLTMKEENGNIIMQGAATLVARGEYYCEQ"
FT   gene            691878..693143
FT                   /locus_tag="RF_0646"
FT                   /note="RF0646"
FT   CDS_pept        691878..693143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0646"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61497"
FT                   /db_xref="GOA:Q4ULS6"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULS6"
FT                   /protein_id="AAY61497.1"
FT                   /translation="MGNIIVSNNLRQEVVTFGCRLNIYESEIIRKNLELSGIDNVAIFN
FT                   TCAVTKAAEKQARQAIRKAKKNNPDLKIIVTGCSAQTSPQMYGNMPEVDKVIGNEEKLL
FT                   PSYYQITDEKIAVNDIMSVKETAGHLVSSFDGKSRAFIQVQNGCDHFCTFCIIPYGRGK
FT                   SRSVPIGAIVSQVKHLVLNGFKEVVFTGVDVTAYGSDLPGSPTFAQMIKRVLNLVPELK
FT                   RLRLSSIDVAEIDDELFELIAYSERIMPHFHISLQAGDDMILKRMKRRHNRANVIEFCR
FT                   KLRAIRPEVSFGADIIAGFPTETPEMFENTRKLISEAELQYLHVFPYSEREGTPAARMP
FT                   QVPKAIRKERAEILRQEGQNQLSEFFKKHIGQKVELLVENNNIAHTENFIPVKLDKPLE
FT                   IGQIFKAKLVGIEGNNMKCELV"
FT   repeat_region   complement(693151..693214)
FT                   /note="RPE-7 Full"
FT   repeat_region   complement(693235..693343)
FT                   /note="RPE-4 Full"
FT   gene            693322..694422
FT                   /gene="pheS"
FT                   /locus_tag="RF_0647"
FT                   /note="RF0647"
FT   CDS_pept        693322..694422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="RF_0647"
FT                   /product="Phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61498"
FT                   /db_xref="GOA:Q4ULS5"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULS5"
FT                   /protein_id="AAY61498.1"
FT                   /translation="MDKPRDDSVNIKQTKNIMENIETILRLAEEKILLVQNLKELQEYK
FT                   VEFLGKNGIVTGELKKLGSLNEQERKEFGLKINKLKDKIQNIIKAKEEILEEQELNLKL
FT                   AADKIDLTIPARRYKQGSIHPITQCSEELIQVFSQFGFTIENGPNIENDFHNFTSLNFE
FT                   DDHPARQMHDTFYLKGQENNKPLLLRTHTSTVQIRAMKNGKPPFRFIAPGRTYRSDSDM
FT                   THTPMFHQIEGLVIDKNINMGHLKYVITEFIKSFFENSNIELRFRPSFFPFTEPSAEVD
FT                   IRMNKNDKWLEVLGCGMVHPNVLKNVGIDSSEYQGFAFGLGVERFAMLKYNIKDLRQFF
FT                   EGDMRWLKHYNFGSFDIPNLAGGLTK"
FT   gene            694419..696875
FT                   /gene="pheT"
FT                   /locus_tag="RF_0648"
FT                   /note="RF0648"
FT   CDS_pept        694419..696875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="RF_0648"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61499"
FT                   /db_xref="GOA:Q4ULS4"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULS4"
FT                   /protein_id="AAY61499.1"
FT                   /translation="MKFTLSWLKQFLETSSTVIEIAEALTAIGLEVEEVIDKAAELQKF
FT                   EVAYIASTKPHPSADKLKLCDVETKSGMRQIVCGASNARAGIKVVLANIGIEIPNGKFK
FT                   IKESIIRGEKSCGMLCSEEELLLASESEGIIELYEDAVVGENFTKYYGLDDPIFVINVT
FT                   PNRGDALGVYGIARDLAAKGIGILKELEIPEIKSTFTSKMKLNVQDKEACPLFTFREIR
FT                   NLKNKPSPDWLRKLLKNVGVKTISSLVDVTNYISYSFGQPMHAYDADRIKGGISVARHC
FT                   EKCSDEAISGQQKEIAAAALQPRNDVAKFHALNGKEYLLTENDLAIKDESGIQGLAGVI
FT                   GGAKSSCTDSTTNIILEAACFNAKMVAASGRRFQIDTDARYRNERNIDRNFTEKALDIA
FT                   TNLILSICGNGEVSEVVKFGEKEPQKKPLDFSAYYLEKITGIKLSIKEIEAILNELGFI
FT                   TDVKGEIIKVIAPSWRHDITILEDIAEEITRIYGYDKIESIKLPELDQDNNKLREYKRI
FT                   SSFKRILASKGYDEVVTNSFMSSEDAKLFAELKEELFLLNPISIGDNYMRPTILPNLLS
FT                   IVSKNLARSIKDMAFFEVGPSFIDLNTEATYLTAIISGSYNNKNPHSLGRGYDIFDLKG
FT                   DLELVVDYAGLSIDKCIATNGTALPQYYHPTRAVNIGLGKNLLGHFGQIHPKILKYYDI
FT                   NQEIFAFELNITNLPLIKAKFGKREEFAVSDFQANFRDYAFIVDQDHRVGEIISYINNF
FT                   NKKLVKSVILFDIYSGDKLPESKKSIAIKIELQADDRTLTEADLNLFSQDLIAAIEQKF
FT                   QGTLRE"
FT   repeat_region   complement(695254..695312)
FT                   /note="RPE-7 Full"
FT   gene            696880..698019
FT                   /gene="dnaN"
FT                   /locus_tag="RF_0649"
FT                   /note="RF0649"
FT   CDS_pept        696880..698019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="RF_0649"
FT                   /product="DNA polymerase III beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61500"
FT                   /db_xref="GOA:Q4ULS3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULS3"
FT                   /protein_id="AAY61500.1"
FT                   /translation="MLKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAKDGNLEL
FT                   SSTNMDLYLSQKIAVQVVSEGELTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNC
FT                   KFNLFTLPVSSFPPMDSINPEASFKISCTDFAKIIESTKFSISLDETRYNLNGVYLHIK
FT                   DKEFCSASTDGHRLSISWVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINEDIEILLS
FT                   SNKIKFICNENTIMLSKLIDGTFPDYSAFIPESSSSKLVINRKIFADSIERIAIITVEK
FT                   FRAVKLSLSRETLEISAVGEARGNAKEVINSSQDKESFYEYNSDESLAIGFNPQYLEDV
FT                   LKAVKSDLVELYFSDVSAPVLIKFPENPKDIFVVMPVKV"
FT   repeat_region   698059..698128
FT                   /note="RPE-7 Full"
FT   gene            698212..698718
FT                   /locus_tag="RF_0650"
FT                   /note="RF0650"
FT   CDS_pept        698212..698718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0650"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61501"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULS2"
FT                   /protein_id="AAY61501.1"
FT                   /translation="MKKIIGLFFVIILSAISTSILADDDYPKTEREQKWDEVGSIAGEE
FT                   GLVFRPGRVKNESTKAVGGSVNKYLWQAALETISFAPLASADSNGGVIITEWYSPRSNP
FT                   NFRFKINIFIKDDVITPDSIEVKVFEEMLKNKQWVLNENTSNLAITLEDKILRKARDIY
FT                   INSAR"
FT   repeat_region   698776..698848
FT                   /note="RPE-7 Full"
FT   gene            698909..701416
FT                   /gene="leuS"
FT                   /locus_tag="RF_0651"
FT                   /note="RF0651"
FT   CDS_pept        698909..701416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="RF_0651"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61502"
FT                   /db_xref="GOA:Q4ULS1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULS1"
FT                   /protein_id="AAY61502.1"
FT                   /translation="MNQIEQKWQQIWYDEKAFEVSNESSKPKYYVLEMLPYPSGKIHVG
FT                   HVRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAIKNNSHPKDWTYSNIENMKK
FT                   QLKSMGFSYDWSREINSCDPQYYKHEQKFFLELYERNLAYQKESLVNWDPVDNTVLANE
FT                   QVVDGRGWRSGAIVEKRYLKQWFLKITDYAEELLNEIQNLKEWPEAVRSMQEKWIGKSI
FT                   GANFHFKIKDNEDNTIEVFSTKPETIFGAGFIGIAFNHPIIEKLISKTPEILSFITKCS
FT                   HITGSSELEKTEKEGVFTGLYVIHPFDSNIVLPVIITNFVLMDYGTGAVFGCPAHDERD
FT                   HELAVKMNLPIKQVIETDIDVQKTAYTEDGILVNSDFLNGLTSNEAKQKVIDEFEKLGI
FT                   GKRSVYYRLKDWGISRQRFWGCPIPMIHCEACGIVPVPCSDLPVTLPDDVSFDGHGNPL
FT                   DHHPSWKHVNCPKCDKSAIRETDTFDTFFESSWYFTRYCNSNATEMTDKKACDYWLPVD
FT                   KYIGGIEHAVMHLLYARFFTKVMNEQNYVSVREPFKGLFTQGMVLHATYKDEHNNWLYP
FT                   EEVVKKGNEFFHKESNNRVVQGRIEKMSKSKKNLIDLVTMQEQYGADAIRLFVLSDSPP
FT                   EKDLEWSASGIEGCSRFINKLEHMFEAIASLIDDVNSEINKELNRLVHFTIKHVADDIK
FT                   HFVLNRAIARMRELSNAISAELNKEVVDVKTVRYGFNVIVQLLNPFIPHITEEIWQKLG
FT                   NKERLYNSAFPAFDESMLELDTYVMAVQVNGKLRDTYEFKTSASEDEIKQITVNLPKVQ
FT                   KFLEGKEPKKIILVPRKIVNIIV"
FT   repeat_region   complement(701428..701502)
FT                   /note="RPE-7 Full"
FT   gene            complement(701601..702119)
FT                   /locus_tag="RF_0652"
FT                   /note="RF0652"
FT   CDS_pept        complement(701601..702119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0652"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61503"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULS0"
FT                   /protein_id="AAY61503.1"
FT                   /translation="MTDKITTLLDSNEALNLSLEGGYLSDITREKNNLGDADFITSEEK
FT                   YALDPDTILSMTLSGIFGEIRSQPETNIVNSSLEPTSKEKNTLNVDNNVNALSINVVVA
FT                   FCWWAVNYIIASVANICNYRESPSQQQQEEPFDIAKLWLNDPVYFEHMQMGGDTGMVAI
FT                   GAMGTIEAH"
FT   gene            complement(702277..702888)
FT                   /gene="rnd2"
FT                   /locus_tag="RF_0653"
FT                   /note="RF0653"
FT   CDS_pept        complement(702277..702888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnd2"
FT                   /locus_tag="RF_0653"
FT                   /product="Ribonuclease D"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61504"
FT                   /db_xref="GOA:Q4ULR9"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULR9"
FT                   /protein_id="AAY61504.1"
FT                   /translation="MNIKIYQDDLPNNFELEGDIAIDTETMGLNLHRDKLCLLQFSNGN
FT                   GEAHLVHFVNQDYSAPNLKALLLDKTRCKIFHFARFDLAAIKKYLSIDLENIFCTKISS
FT                   KLVRTYTDSHGLKDLCRELLSINISKQQQSSYWGTDNLSSEQKEYAAKDVLYLHQLKDI
FT                   LQKMLLRENRLELAQDIFRFLPTRANLDLIGWNEIDIFMH"
FT   repeat_region   complement(702930..703050)
FT                   /note="RPE-6 Full"
FT   gene            complement(703095..703418)
FT                   /locus_tag="RF_0654"
FT                   /note="RF0654"
FT   CDS_pept        complement(703095..703418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RF_0654"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61505"
FT                   /db_xref="GOA:Q4ULR8"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULR8"
FT                   /protein_id="AAY61505.1"
FT                   /translation="MIIHLNNHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQ
FT                   LEKAYDELKGLRAERVELEHNVKLLRTESLNKDMLEEQAKKVLGVADPKEQVFTIKDTP
FT                   SQR"
FT   repeat_region   complement(703443..703500)
FT                   /note="RPE-7 Full"
FT   gene            complement(703527..704210)
FT                   /gene="cdsA"
FT                   /locus_tag="RF_0655"
FT                   /note="RF0655"
FT   CDS_pept        complement(703527..704210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="RF_0655"
FT                   /product="Phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61506"
FT                   /db_xref="GOA:Q4ULR7"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULR7"
FT                   /protein_id="AAY61506.1"
FT                   /translation="MITQKGKEHLAKDKQNIYLRILSGIVLVPLFVIAILWFKPLFYIL
FT                   MILVGMGMLSEWYNMTYSSIPYLLIGLIIIPIPISLLTFLSMEDTNRWLIMLYFCIIWS
FT                   VDSFAMIGGKTFKGAKLAPKISPKKTWSGLVTGVLSAGLVAVLASFIPNFHIENYYFSN
FT                   KIYLFIISCILALIAQSSDLFISYLKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVLF
FT                   FISIL"
FT   gene            complement(704170..704877)
FT                   /gene="uppS"
FT                   /locus_tag="RF_0656"
FT                   /note="RF0656"
FT   CDS_pept        complement(704170..704877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="RF_0656"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61507"
FT                   /db_xref="GOA:Q4ULR6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULR6"
FT                   /protein_id="AAY61507.1"
FT                   /translation="MQQHLKYKIMTNIKHLAIIMDGNARWADQHNLTKSEGHKAGADKI
FT                   RELLPEFINLNIPYITLYTFSSENWQRSSTEVDFLIKLLSIYFKNELNSLHKNGVKIKV
FT                   IGRLNLLSSSLQKQINNAIELTKNNNKITLCIAFSYGSRQEIVDACTKIIASGKKEISE
FT                   SDIGHALYDPEMPDVDLLIRPGGVYRISNFLLWQAAYAELYFSPKYWPAFNKDDIIEAI
FT                   NDYSKRKRTFGKR"
FT   repeat_region   704916..704983
FT                   /note="RPE-7 Full"
FT   gene            complement(704991..706304)
FT                   /gene="envZ"
FT                   /locus_tag="RF_0657"
FT                   /note="RF0657"
FT   CDS_pept        complement(704991..706304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="RF_0657"
FT                   /product="Osmolarity sensor protein EnvZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61508"
FT                   /db_xref="GOA:Q4ULR5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULR5"
FT                   /protein_id="AAY61508.1"
FT                   /translation="MRAMHFISKLLPRTLFVRFMFIIIIPILIGQIVAIFLFYDRHWYN
FT                   VSYYTSTIIINEIESLIKEHRNNSREIIHLSENYLNLSYQFQLNKKLSIKQPKLSEPLT
FT                   IFKNILATKIHEKNIVKLNKENKIEVFLELKDGILYITFPAKLLLNPTVYIFVLWIISL
FT                   TVILLSISIIFSKNQIKSIITLADSMDKFGRGVLKGKNFKPSGALEIRKAGLAFLKMKA
FT                   RIEKQITKRTTMLAMISHDLRTPLTRMKLQLELMEGSEEIKGLKQDILTMQQMINSYLD
FT                   FAKGESTEEFEEILLLPWIEHFLNKWSHVDIEFIKLNNIDNSKVRIKPNSFERALSNLI
FT                   GNAIKYGNKIKISLTDNSSTVTIIIEDNGPGIDDTEKHLVFKPFYRSDKARQLDNASNV
FT                   GLGLAITKEIINDHKSSIYLEDSKDLGGLSVRIEIPKI"
FT   gene            complement(706279..706959)
FT                   /gene="ompR"
FT                   /locus_tag="RF_0658"
FT                   /note="RF0658"
FT   CDS_pept        complement(706279..706959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="RF_0658"
FT                   /product="PetR protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61509"
FT                   /db_xref="GOA:Q4ULR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULR4"
FT                   /protein_id="AAY61509.1"
FT                   /translation="MQPHKAHILIVDDDSRILALLKQFLNKNEFLVSTASSVIEAKNLL
FT                   KTSNYDLIILDVMLPEITGLDFATTIRDAGNNIPIVMLTALSEADDRVKGLEAGASDYI
FT                   TKPFEPRELLLRINNLINNYNNFKKETNIIKFGNNFYNFDTKEFTKNDQIISLSSTEQK
FT                   LLEILIKNSGKSTSRFELSKIMGGLSMRSIDVQITRIRSKLEDNPKEPKYLKTVRNEGY
FT                   ALYI"
FT   repeat_region   complement(706962..706996)
FT                   /note="RPE-5 Partial"
FT   repeat_region   707037..707113
FT                   /note="RPE-7 Full"
FT   gene            707170..708042
FT                   /gene="ilvE"
FT                   /locus_tag="RF_0659"
FT                   /note="RF0659"
FT   CDS_pept        707170..708042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="RF_0659"
FT                   /product="Branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61510"
FT                   /db_xref="GOA:Q4ULR3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULR3"
FT                   /protein_id="AAY61510.1"
FT                   /translation="MTMIKLEQIFWHVWINGDLVPYQFARIHVLTHSLHYSGSVFEGER
FT                   AYNGKVFKLKEHTERLIKSAEALGLKVPYSVDEIIKAHELVIKQNNIKDAYIRPLIWCG
FT                   DESLNITNPDLSTNLLIAGIPSMPRSFEKGINLHVGRWRKAIPDSTPVQSKSAAQYNMA
FT                   ITSKKEAKALGYDDALLLDYEGYIAECTTTNIFFVKDKTLYTPIADRFLNGITRQTIIE
FT                   IAKDLGLEVKEERLKLEQIENFTGCFVTGTAIEVQNIDSIDLGNKKITFDDHQIADRLK
FT                   KEYGRIVRE"
FT   repeat_region   complement(708069..708136)
FT                   /note="RPE-7 Full"
FT   gene            708190..709074
FT                   /gene="dapA"
FT                   /locus_tag="RF_0660"
FT                   /note="RF0660"
FT   CDS_pept        708190..709074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="RF_0660"
FT                   /product="Dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61511"
FT                   /db_xref="GOA:Q4ULR2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULR2"
FT                   /protein_id="AAY61511.1"
FT                   /translation="MNNIFKGLITAAITPFKDNKLDLYALERILKHQIKYEVDAILIAG
FT                   STGEGSSLSFEEYKLLLQTSVEIVNNRIPIISGCSSNNTAYARELAAESTKIKVDGFMA
FT                   SPPSYVKPTQYGIYKHFEALHEACNLPIMLYSAPTRSGVDFSDETILRLSKLPRILALK
FT                   DCGVDLERPLRIRAVVKKDFNILTGNDEVVLAFNAQGGVGWTSVASNIAPDMCKELLEK
FT                   WNKNDTKGALEIHQKLLPLYKALFVESNPIPIKYAAYYLGLCENEIRLPLTEASDSAKK
FT                   QIENIITSLSIKL"
FT   gene            709071..709529
FT                   /gene="smpB"
FT                   /locus_tag="RF_0661"
FT                   /note="RF0661"
FT   CDS_pept        709071..709529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="RF_0661"
FT                   /product="tmRNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61512"
FT                   /db_xref="GOA:Q4ULR1"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ULR1"
FT                   /protein_id="AAY61512.1"
FT                   /translation="MTEYKKVIAQNKKALFNYFIEERLEAGIVLKGSEVQSLRQGKASI
FT                   EESHAADTGHEVFLYNCHIAEYEKANRFNHSTRRPRKLLLHTKEIKKIIGRIRIKGYTL
FT                   VALSMYFNKKNKVKVELGIAKGKKLHDKRESIKEKDWKRDQSRLIRQK"
FT   repeat_region   complement(709546..709614)
FT                   /note="RPE-7 Full"
FT   gene            709684..710478
FT                   /gene="dsbA"
FT                   /locus_tag="RF_0662"
FT                   /note="RF0662"
FT   CDS_pept        709684..710478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="RF_0662"
FT                   /product="Thiol:disulfide interchange protein DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:RF_0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAY61513"
FT                   /db_xref="GOA:Q4ULR0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ULR0"
FT                   /protein_id="AAY61513.1"
FT                   /translation="MQHIIGKILVIFVVVIGVLFVFKTMKTYSTNPVSVEVKQSEDARK
FT                   CEEERVQEIIKDYLLKTPEIIIESIEGLQKRKVQENETKVNNYLKDNKLGIEDSTSFPI
FT                   IGNKDGDVTIIAFYDYNCSYCKKGDVSINELLQNDSKVKVILRPLPILGDASEYLARIV
FT                   LAVYKVNPSKFKAVHDELIKIRDVSKESIKELLTENGLNATEIEETADSNEIKDLITQN
FT                   MKIARSLRIQGVPAYIIDSKLIPGLIDFPQLLNIVKEIRDAR"
FT   repeat_region   complement(710511..710606)
FT                   /note="RPE-7 Full"
FT   gene            complement(710644..711078)
FT                   /locus_tag="RF_0663"
FT                   /note="RF0663"
FT   CDS_pept        complement(710644..711078)
FT                   /codon_start=1
FT                   /transl_table=11