(data stored in ACNUC7421 zone)

EMBL: CP000058

ID   CP000058; SV 1; circular; genomic DNA; STD; PRO; 5928787 BP.
XX
AC   CP000058; AAEZ01000000-AAEZ01000028; AY922993;
XX
PR   Project:PRJNA12416;
XX
DT   02-AUG-2005 (Rel. 84, Created)
DT   12-JUN-2019 (Rel. 141, Last updated, Version 21)
XX
DE   Pseudomonas savastanoi pv. phaseolicola 1448A chromosome, complete genome.
XX
KW   .
XX
OS   Pseudomonas savastanoi pv. phaseolicola 1448A
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-5928787
RX   DOI; 10.1128/JB.187.18.6488-6498.2005.
RX   PUBMED; 16159782.
RA   Joardar V., Lindeberg M., Jackson R.W., Selengut J., Dodson R.,
RA   Brinkac L.M., Daugherty S.C., Deboy R., Durkin A.S., Giglio M.G.,
RA   Madupu R., Nelson W.C., Rosovitz M.J., Sullivan S., Crabtree J., Creasy T.,
RA   Davidsen T., Haft D.H., Zafar N., Zhou L., Halpin R., Holley T., Khouri H.,
RA   Feldblyum T., White O., Fraser C.M., Chatterjee A.K., Cartinhour S.,
RA   Schneider D.J., Mansfield J., Collmer A., Buell C.R.;
RT   "Whole-genome sequence analysis of Pseudomonas syringae pv. phaseolicola
RT   1448A reveals divergence among pathovars in genes involved in virulence and
RT   transposition";
RL   J. Bacteriol. 187(18):6488-6498(2005).
XX
RN   [2]
RP   1-5928787
RA   Vencato M., Schneider D.J., Collmer A.R.;
RT   ;
RL   Submitted (04-FEB-2005) to the INSDC.
RL   Plant Pathology, Cornell University, Plant Science Bldg. Rm 334, Ithaca, NY
RL   14853, USA
XX
RN   [3]
RP   1-5928787
RA   Joardar V., Lindeberg M., Jackson R., Selengut J., Dodson R., Brinkac L.M.,
RA   Daugherty S.C., DeBoy R.T., Durkin A.S., Giglio M.G., Madupu R.,
RA   Nelson W.C., Rosovitz M.J., Sullivan S.A., Crabtree J., Creasy T.,
RA   Davidsen T.M., Haft D.H., Zafar N., Zhou L., Halpin R., Holley T.,
RA   Khouri H.M., Feldblyum T.V., White O., Fraser C.M., Chatterjee A.K.,
RA   Cartinhour S., Schneider D., Mansfield J., Collmer A., Buell R.;
RT   ;
RL   Submitted (31-MAR-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [4]
RC   Amino acid sequence updated by submitter
RP   1-5928787
RA   Joardar V., Lindeberg M., Jackson R., Selengut J., Dodson R., Brinkac L.M.,
RA   Daugherty S.C., DeBoy R.T., Durkin A.S., Giglio M.G., Madupu R.,
RA   Nelson W.C., Rosovitz M.J., Sullivan S.A., Crabtree J., Creasy T.,
RA   Davidsen T.M., Haft D.H., Zafar N., Zhou L., Halpin R., Holley T.,
RA   Khouri H.M., Feldblyum T.V., White O., Fraser C.M., Chatterjee A.K.,
RA   Cartinhour S., Schneider D., Mansfield J., Collmer A., Buell R.;
RT   ;
RL   Submitted (12-DEC-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [5]
RC   Protein update by submitter
RP   1-5928787
RA   Lindeberg M.;
RT   ;
RL   Submitted (19-DEC-2008) to the INSDC.
RL   Dept. of Plant Pathology, Cornell University, Plant Science Building,
RL   Ithica, NY 14853, USA
XX
DR   MD5; 35aa96e75263234826635737141ca05c.
DR   BioSample; SAMN02603162.
DR   EnsemblGenomes-Gn; EBG00001253732.
DR   EnsemblGenomes-Gn; EBG00001253733.
DR   EnsemblGenomes-Gn; EBG00001253734.
DR   EnsemblGenomes-Gn; EBG00001253735.
DR   EnsemblGenomes-Gn; EBG00001253736.
DR   EnsemblGenomes-Gn; EBG00001253737.
DR   EnsemblGenomes-Gn; EBG00001253738.
DR   EnsemblGenomes-Gn; EBG00001253739.
DR   EnsemblGenomes-Gn; EBG00001253740.
DR   EnsemblGenomes-Gn; EBG00001253741.
DR   EnsemblGenomes-Gn; EBG00001253742.
DR   EnsemblGenomes-Gn; EBG00001253743.
DR   EnsemblGenomes-Gn; EBG00001253744.
DR   EnsemblGenomes-Gn; EBG00001253745.
DR   EnsemblGenomes-Gn; EBG00001253746.
DR   EnsemblGenomes-Gn; EBG00001253747.
DR   EnsemblGenomes-Gn; EBG00001253748.
DR   EnsemblGenomes-Gn; EBG00001253749.
DR   EnsemblGenomes-Gn; EBG00001253750.
DR   EnsemblGenomes-Gn; EBG00001253751.
DR   EnsemblGenomes-Gn; EBG00001253752.
DR   EnsemblGenomes-Gn; EBG00001253753.
DR   EnsemblGenomes-Gn; EBG00001253754.
DR   EnsemblGenomes-Gn; EBG00001253755.
DR   EnsemblGenomes-Gn; EBG00001253756.
DR   EnsemblGenomes-Gn; EBG00001253757.
DR   EnsemblGenomes-Gn; EBG00001253758.
DR   EnsemblGenomes-Gn; EBG00001253759.
DR   EnsemblGenomes-Gn; EBG00001253760.
DR   EnsemblGenomes-Gn; EBG00001253761.
DR   EnsemblGenomes-Gn; EBG00001253762.
DR   EnsemblGenomes-Gn; EBG00001253763.
DR   EnsemblGenomes-Gn; EBG00001253764.
DR   EnsemblGenomes-Gn; EBG00001253765.
DR   EnsemblGenomes-Gn; EBG00001253766.
DR   EnsemblGenomes-Gn; EBG00001253767.
DR   EnsemblGenomes-Gn; EBG00001253768.
DR   EnsemblGenomes-Gn; EBG00001253769.
DR   EnsemblGenomes-Gn; EBG00001253770.
DR   EnsemblGenomes-Gn; EBG00001253771.
DR   EnsemblGenomes-Gn; EBG00001253772.
DR   EnsemblGenomes-Gn; EBG00001253773.
DR   EnsemblGenomes-Gn; EBG00001253774.
DR   EnsemblGenomes-Gn; EBG00001253775.
DR   EnsemblGenomes-Gn; EBG00001253776.
DR   EnsemblGenomes-Gn; EBG00001253777.
DR   EnsemblGenomes-Gn; EBG00001253778.
DR   EnsemblGenomes-Gn; EBG00001253779.
DR   EnsemblGenomes-Gn; EBG00001253780.
DR   EnsemblGenomes-Gn; EBG00001253781.
DR   EnsemblGenomes-Gn; EBG00001253782.
DR   EnsemblGenomes-Gn; EBG00001253783.
DR   EnsemblGenomes-Gn; EBG00001253784.
DR   EnsemblGenomes-Gn; EBG00001253785.
DR   EnsemblGenomes-Gn; EBG00001253786.
DR   EnsemblGenomes-Gn; EBG00001253787.
DR   EnsemblGenomes-Gn; EBG00001253788.
DR   EnsemblGenomes-Gn; EBG00001253789.
DR   EnsemblGenomes-Gn; EBG00001253790.
DR   EnsemblGenomes-Gn; EBG00001253791.
DR   EnsemblGenomes-Gn; EBG00001253792.
DR   EnsemblGenomes-Gn; EBG00001253793.
DR   EnsemblGenomes-Gn; EBG00001253794.
DR   EnsemblGenomes-Gn; EBG00001253795.
DR   EnsemblGenomes-Gn; EBG00001253796.
DR   EnsemblGenomes-Gn; EBG00001253797.
DR   EnsemblGenomes-Gn; EBG00001253798.
DR   EnsemblGenomes-Gn; EBG00001253799.
DR   EnsemblGenomes-Gn; EBG00001253800.
DR   EnsemblGenomes-Gn; EBG00001253801.
DR   EnsemblGenomes-Gn; EBG00001253802.
DR   EnsemblGenomes-Gn; EBG00001253803.
DR   EnsemblGenomes-Gn; EBG00001253804.
DR   EnsemblGenomes-Gn; EBG00001253805.
DR   EnsemblGenomes-Gn; EBG00001253806.
DR   EnsemblGenomes-Gn; EBG00001253807.
DR   EnsemblGenomes-Gn; EBG00001253808.
DR   EnsemblGenomes-Gn; EBG00001253809.
DR   EnsemblGenomes-Gn; EBG00001253810.
DR   EnsemblGenomes-Gn; EBG00001253811.
DR   EnsemblGenomes-Gn; EBG00001253812.
DR   EnsemblGenomes-Gn; EBG00001253813.
DR   EnsemblGenomes-Gn; EBG00001253814.
DR   EnsemblGenomes-Gn; EBG00001253815.
DR   EnsemblGenomes-Gn; EBG00001253816.
DR   EnsemblGenomes-Gn; EBG00001253817.
DR   EnsemblGenomes-Gn; EBG00001253818.
DR   EnsemblGenomes-Gn; EBG00001253819.
DR   EnsemblGenomes-Gn; EBG00001253820.
DR   EnsemblGenomes-Gn; EBG00001253821.
DR   EnsemblGenomes-Gn; EBG00001253822.
DR   EnsemblGenomes-Gn; EBG00001253823.
DR   EnsemblGenomes-Gn; EBG00001253824.
DR   EnsemblGenomes-Gn; EBG00001253825.
DR   EnsemblGenomes-Gn; EBG00001253826.
DR   EnsemblGenomes-Gn; EBG00001253827.
DR   EnsemblGenomes-Gn; EBG00001253828.
DR   EnsemblGenomes-Gn; EBG00001253829.
DR   EnsemblGenomes-Gn; EBG00001253830.
DR   EnsemblGenomes-Gn; EBG00001253831.
DR   EnsemblGenomes-Gn; EBG00001253832.
DR   EnsemblGenomes-Gn; EBG00001253833.
DR   EnsemblGenomes-Gn; EBG00001253834.
DR   EnsemblGenomes-Gn; EBG00001253835.
DR   EnsemblGenomes-Gn; EBG00001253836.
DR   EnsemblGenomes-Gn; EBG00001253837.
DR   EnsemblGenomes-Gn; EBG00001253838.
DR   EnsemblGenomes-Gn; EBG00001253839.
DR   EnsemblGenomes-Gn; EBG00001253840.
DR   EnsemblGenomes-Gn; EBG00001253841.
DR   EnsemblGenomes-Gn; EBG00001253842.
DR   EnsemblGenomes-Gn; EBG00001253843.
DR   EnsemblGenomes-Gn; EBG00001253844.
DR   EnsemblGenomes-Gn; EBG00001253845.
DR   EnsemblGenomes-Gn; EBG00001253846.
DR   EnsemblGenomes-Gn; EBG00001253847.
DR   EnsemblGenomes-Gn; EBG00001253848.
DR   EnsemblGenomes-Gn; EBG00001253849.
DR   EnsemblGenomes-Gn; EBG00001253850.
DR   EnsemblGenomes-Gn; EBG00001253851.
DR   EnsemblGenomes-Gn; EBG00001253852.
DR   EnsemblGenomes-Gn; EBG00001253853.
DR   EnsemblGenomes-Gn; EBG00001253854.
DR   EnsemblGenomes-Gn; EBG00001253855.
DR   EnsemblGenomes-Gn; EBG00001253856.
DR   EnsemblGenomes-Gn; EBG00001253857.
DR   EnsemblGenomes-Gn; EBG00001253858.
DR   EnsemblGenomes-Gn; PSPPH_0098.
DR   EnsemblGenomes-Gn; PSPPH_0572.
DR   EnsemblGenomes-Gn; PSPPH_0573.
DR   EnsemblGenomes-Gn; PSPPH_0689.
DR   EnsemblGenomes-Gn; PSPPH_0690.
DR   EnsemblGenomes-Gn; PSPPH_0691.
DR   EnsemblGenomes-Gn; PSPPH_0692.
DR   EnsemblGenomes-Gn; PSPPH_0693.
DR   EnsemblGenomes-Gn; PSPPH_0743.
DR   EnsemblGenomes-Gn; PSPPH_0744.
DR   EnsemblGenomes-Gn; PSPPH_0745.
DR   EnsemblGenomes-Gn; PSPPH_0746.
DR   EnsemblGenomes-Gn; PSPPH_0878.
DR   EnsemblGenomes-Gn; PSPPH_0879.
DR   EnsemblGenomes-Gn; PSPPH_0880.
DR   EnsemblGenomes-Gn; PSPPH_0881.
DR   EnsemblGenomes-Gn; PSPPH_0882.
DR   EnsemblGenomes-Gn; PSPPH_0948.
DR   EnsemblGenomes-Gn; PSPPH_0992.
DR   EnsemblGenomes-Gn; PSPPH_1298.
DR   EnsemblGenomes-Gn; PSPPH_1541.
DR   EnsemblGenomes-Gn; PSPPH_1572.
DR   EnsemblGenomes-Gn; PSPPH_1573.
DR   EnsemblGenomes-Gn; PSPPH_1665.
DR   EnsemblGenomes-Gn; PSPPH_1666.
DR   EnsemblGenomes-Gn; PSPPH_1667.
DR   EnsemblGenomes-Gn; PSPPH_1688.
DR   EnsemblGenomes-Gn; PSPPH_1689.
DR   EnsemblGenomes-Gn; PSPPH_1690.
DR   EnsemblGenomes-Gn; PSPPH_1846.
DR   EnsemblGenomes-Gn; PSPPH_1943.
DR   EnsemblGenomes-Gn; PSPPH_1944.
DR   EnsemblGenomes-Gn; PSPPH_1945.
DR   EnsemblGenomes-Gn; PSPPH_1946.
DR   EnsemblGenomes-Gn; PSPPH_2143.
DR   EnsemblGenomes-Gn; PSPPH_2331.
DR   EnsemblGenomes-Gn; PSPPH_2382.
DR   EnsemblGenomes-Gn; PSPPH_2401.
DR   EnsemblGenomes-Gn; PSPPH_2586.
DR   EnsemblGenomes-Gn; PSPPH_2985.
DR   EnsemblGenomes-Gn; PSPPH_3078.
DR   EnsemblGenomes-Gn; PSPPH_3131.
DR   EnsemblGenomes-Gn; PSPPH_3132.
DR   EnsemblGenomes-Gn; PSPPH_3133.
DR   EnsemblGenomes-Gn; PSPPH_3134.
DR   EnsemblGenomes-Gn; PSPPH_3135.
DR   EnsemblGenomes-Gn; PSPPH_3501.
DR   EnsemblGenomes-Gn; PSPPH_3507.
DR   EnsemblGenomes-Gn; PSPPH_3508.
DR   EnsemblGenomes-Gn; PSPPH_3509.
DR   EnsemblGenomes-Gn; PSPPH_3621.
DR   EnsemblGenomes-Gn; PSPPH_3622.
DR   EnsemblGenomes-Gn; PSPPH_3623.
DR   EnsemblGenomes-Gn; PSPPH_3624.
DR   EnsemblGenomes-Gn; PSPPH_3761.
DR   EnsemblGenomes-Gn; PSPPH_3762.
DR   EnsemblGenomes-Gn; PSPPH_3786.
DR   EnsemblGenomes-Gn; PSPPH_3787.
DR   EnsemblGenomes-Gn; PSPPH_3982.
DR   EnsemblGenomes-Gn; PSPPH_4192.
DR   EnsemblGenomes-Gn; PSPPH_4193.
DR   EnsemblGenomes-Gn; PSPPH_4606.
DR   EnsemblGenomes-Gn; PSPPH_4607.
DR   EnsemblGenomes-Gn; PSPPH_4608.
DR   EnsemblGenomes-Gn; PSPPH_4609.
DR   EnsemblGenomes-Gn; PSPPH_4613.
DR   EnsemblGenomes-Gn; PSPPH_4614.
DR   EnsemblGenomes-Gn; PSPPH_4615.
DR   EnsemblGenomes-Gn; PSPPH_4616.
DR   EnsemblGenomes-Gn; PSPPH_4617.
DR   EnsemblGenomes-Gn; PSPPH_4687.
DR   EnsemblGenomes-Gn; PSPPH_4688.
DR   EnsemblGenomes-Gn; PSPPH_4932.
DR   EnsemblGenomes-Gn; PSPPH_4945.
DR   EnsemblGenomes-Gn; PSPPH_5092.
DR   EnsemblGenomes-Gn; PSPPH_5093.
DR   EnsemblGenomes-Gn; PSPPH_5094.
DR   EnsemblGenomes-Gn; PSPPH_5095.
DR   EnsemblGenomes-Gn; PSPPH_5096.
DR   EnsemblGenomes-Tr; EBT00001599233.
DR   EnsemblGenomes-Tr; EBT00001599234.
DR   EnsemblGenomes-Tr; EBT00001599235.
DR   EnsemblGenomes-Tr; EBT00001599236.
DR   EnsemblGenomes-Tr; EBT00001599237.
DR   EnsemblGenomes-Tr; EBT00001599238.
DR   EnsemblGenomes-Tr; EBT00001599239.
DR   EnsemblGenomes-Tr; EBT00001599240.
DR   EnsemblGenomes-Tr; EBT00001599241.
DR   EnsemblGenomes-Tr; EBT00001599242.
DR   EnsemblGenomes-Tr; EBT00001599243.
DR   EnsemblGenomes-Tr; EBT00001599244.
DR   EnsemblGenomes-Tr; EBT00001599245.
DR   EnsemblGenomes-Tr; EBT00001599246.
DR   EnsemblGenomes-Tr; EBT00001599247.
DR   EnsemblGenomes-Tr; EBT00001599248.
DR   EnsemblGenomes-Tr; EBT00001599249.
DR   EnsemblGenomes-Tr; EBT00001599250.
DR   EnsemblGenomes-Tr; EBT00001599251.
DR   EnsemblGenomes-Tr; EBT00001599252.
DR   EnsemblGenomes-Tr; EBT00001599253.
DR   EnsemblGenomes-Tr; EBT00001599254.
DR   EnsemblGenomes-Tr; EBT00001599255.
DR   EnsemblGenomes-Tr; EBT00001599256.
DR   EnsemblGenomes-Tr; EBT00001599257.
DR   EnsemblGenomes-Tr; EBT00001599258.
DR   EnsemblGenomes-Tr; EBT00001599259.
DR   EnsemblGenomes-Tr; EBT00001599260.
DR   EnsemblGenomes-Tr; EBT00001599261.
DR   EnsemblGenomes-Tr; EBT00001599262.
DR   EnsemblGenomes-Tr; EBT00001599263.
DR   EnsemblGenomes-Tr; EBT00001599264.
DR   EnsemblGenomes-Tr; EBT00001599265.
DR   EnsemblGenomes-Tr; EBT00001599266.
DR   EnsemblGenomes-Tr; EBT00001599267.
DR   EnsemblGenomes-Tr; EBT00001599268.
DR   EnsemblGenomes-Tr; EBT00001599269.
DR   EnsemblGenomes-Tr; EBT00001599270.
DR   EnsemblGenomes-Tr; EBT00001599271.
DR   EnsemblGenomes-Tr; EBT00001599272.
DR   EnsemblGenomes-Tr; EBT00001599273.
DR   EnsemblGenomes-Tr; EBT00001599274.
DR   EnsemblGenomes-Tr; EBT00001599275.
DR   EnsemblGenomes-Tr; EBT00001599276.
DR   EnsemblGenomes-Tr; EBT00001599277.
DR   EnsemblGenomes-Tr; EBT00001599278.
DR   EnsemblGenomes-Tr; EBT00001599279.
DR   EnsemblGenomes-Tr; EBT00001599280.
DR   EnsemblGenomes-Tr; EBT00001599281.
DR   EnsemblGenomes-Tr; EBT00001599282.
DR   EnsemblGenomes-Tr; EBT00001599283.
DR   EnsemblGenomes-Tr; EBT00001599284.
DR   EnsemblGenomes-Tr; EBT00001599285.
DR   EnsemblGenomes-Tr; EBT00001599286.
DR   EnsemblGenomes-Tr; EBT00001599287.
DR   EnsemblGenomes-Tr; EBT00001599288.
DR   EnsemblGenomes-Tr; EBT00001599289.
DR   EnsemblGenomes-Tr; EBT00001599290.
DR   EnsemblGenomes-Tr; EBT00001599291.
DR   EnsemblGenomes-Tr; EBT00001599292.
DR   EnsemblGenomes-Tr; EBT00001599293.
DR   EnsemblGenomes-Tr; EBT00001599294.
DR   EnsemblGenomes-Tr; EBT00001599295.
DR   EnsemblGenomes-Tr; EBT00001599296.
DR   EnsemblGenomes-Tr; EBT00001599297.
DR   EnsemblGenomes-Tr; EBT00001599298.
DR   EnsemblGenomes-Tr; EBT00001599299.
DR   EnsemblGenomes-Tr; EBT00001599300.
DR   EnsemblGenomes-Tr; EBT00001599301.
DR   EnsemblGenomes-Tr; EBT00001599302.
DR   EnsemblGenomes-Tr; EBT00001599303.
DR   EnsemblGenomes-Tr; EBT00001599304.
DR   EnsemblGenomes-Tr; EBT00001599305.
DR   EnsemblGenomes-Tr; EBT00001599306.
DR   EnsemblGenomes-Tr; EBT00001599307.
DR   EnsemblGenomes-Tr; EBT00001599308.
DR   EnsemblGenomes-Tr; EBT00001599309.
DR   EnsemblGenomes-Tr; EBT00001599310.
DR   EnsemblGenomes-Tr; EBT00001599311.
DR   EnsemblGenomes-Tr; EBT00001599312.
DR   EnsemblGenomes-Tr; EBT00001599313.
DR   EnsemblGenomes-Tr; EBT00001599314.
DR   EnsemblGenomes-Tr; EBT00001599315.
DR   EnsemblGenomes-Tr; EBT00001599316.
DR   EnsemblGenomes-Tr; EBT00001599317.
DR   EnsemblGenomes-Tr; EBT00001599318.
DR   EnsemblGenomes-Tr; EBT00001599319.
DR   EnsemblGenomes-Tr; EBT00001599320.
DR   EnsemblGenomes-Tr; EBT00001599321.
DR   EnsemblGenomes-Tr; EBT00001599322.
DR   EnsemblGenomes-Tr; EBT00001599323.
DR   EnsemblGenomes-Tr; EBT00001599324.
DR   EnsemblGenomes-Tr; EBT00001599325.
DR   EnsemblGenomes-Tr; EBT00001599326.
DR   EnsemblGenomes-Tr; EBT00001599327.
DR   EnsemblGenomes-Tr; EBT00001599328.
DR   EnsemblGenomes-Tr; EBT00001599329.
DR   EnsemblGenomes-Tr; EBT00001599330.
DR   EnsemblGenomes-Tr; EBT00001599331.
DR   EnsemblGenomes-Tr; EBT00001599332.
DR   EnsemblGenomes-Tr; EBT00001599333.
DR   EnsemblGenomes-Tr; EBT00001599334.
DR   EnsemblGenomes-Tr; EBT00001599335.
DR   EnsemblGenomes-Tr; EBT00001599336.
DR   EnsemblGenomes-Tr; EBT00001599337.
DR   EnsemblGenomes-Tr; EBT00001599338.
DR   EnsemblGenomes-Tr; EBT00001599339.
DR   EnsemblGenomes-Tr; EBT00001599340.
DR   EnsemblGenomes-Tr; EBT00001599341.
DR   EnsemblGenomes-Tr; EBT00001599342.
DR   EnsemblGenomes-Tr; EBT00001599343.
DR   EnsemblGenomes-Tr; EBT00001599344.
DR   EnsemblGenomes-Tr; EBT00001599345.
DR   EnsemblGenomes-Tr; EBT00001599346.
DR   EnsemblGenomes-Tr; EBT00001599347.
DR   EnsemblGenomes-Tr; EBT00001599348.
DR   EnsemblGenomes-Tr; EBT00001599349.
DR   EnsemblGenomes-Tr; EBT00001599350.
DR   EnsemblGenomes-Tr; EBT00001599351.
DR   EnsemblGenomes-Tr; EBT00001599352.
DR   EnsemblGenomes-Tr; EBT00001599353.
DR   EnsemblGenomes-Tr; EBT00001599354.
DR   EnsemblGenomes-Tr; EBT00001599355.
DR   EnsemblGenomes-Tr; EBT00001599356.
DR   EnsemblGenomes-Tr; EBT00001599357.
DR   EnsemblGenomes-Tr; EBT00001599358.
DR   EnsemblGenomes-Tr; EBT00001599359.
DR   EnsemblGenomes-Tr; PSPPH_0098-1.
DR   EnsemblGenomes-Tr; PSPPH_0572-1.
DR   EnsemblGenomes-Tr; PSPPH_0573-1.
DR   EnsemblGenomes-Tr; PSPPH_0689-1.
DR   EnsemblGenomes-Tr; PSPPH_0690-1.
DR   EnsemblGenomes-Tr; PSPPH_0691-1.
DR   EnsemblGenomes-Tr; PSPPH_0692-1.
DR   EnsemblGenomes-Tr; PSPPH_0693-1.
DR   EnsemblGenomes-Tr; PSPPH_0743-1.
DR   EnsemblGenomes-Tr; PSPPH_0744-1.
DR   EnsemblGenomes-Tr; PSPPH_0745-1.
DR   EnsemblGenomes-Tr; PSPPH_0746-1.
DR   EnsemblGenomes-Tr; PSPPH_0878-1.
DR   EnsemblGenomes-Tr; PSPPH_0879-1.
DR   EnsemblGenomes-Tr; PSPPH_0880-1.
DR   EnsemblGenomes-Tr; PSPPH_0881-1.
DR   EnsemblGenomes-Tr; PSPPH_0882-1.
DR   EnsemblGenomes-Tr; PSPPH_0948-1.
DR   EnsemblGenomes-Tr; PSPPH_0992-1.
DR   EnsemblGenomes-Tr; PSPPH_1298-1.
DR   EnsemblGenomes-Tr; PSPPH_1541-1.
DR   EnsemblGenomes-Tr; PSPPH_1572-1.
DR   EnsemblGenomes-Tr; PSPPH_1573-1.
DR   EnsemblGenomes-Tr; PSPPH_1665-1.
DR   EnsemblGenomes-Tr; PSPPH_1666-1.
DR   EnsemblGenomes-Tr; PSPPH_1667-1.
DR   EnsemblGenomes-Tr; PSPPH_1688-1.
DR   EnsemblGenomes-Tr; PSPPH_1689-1.
DR   EnsemblGenomes-Tr; PSPPH_1690-1.
DR   EnsemblGenomes-Tr; PSPPH_1846-1.
DR   EnsemblGenomes-Tr; PSPPH_1943-1.
DR   EnsemblGenomes-Tr; PSPPH_1944-1.
DR   EnsemblGenomes-Tr; PSPPH_1945-1.
DR   EnsemblGenomes-Tr; PSPPH_1946-1.
DR   EnsemblGenomes-Tr; PSPPH_2143-1.
DR   EnsemblGenomes-Tr; PSPPH_2331-1.
DR   EnsemblGenomes-Tr; PSPPH_2382-1.
DR   EnsemblGenomes-Tr; PSPPH_2401-1.
DR   EnsemblGenomes-Tr; PSPPH_2586-1.
DR   EnsemblGenomes-Tr; PSPPH_2985-1.
DR   EnsemblGenomes-Tr; PSPPH_3078-1.
DR   EnsemblGenomes-Tr; PSPPH_3131-1.
DR   EnsemblGenomes-Tr; PSPPH_3132-1.
DR   EnsemblGenomes-Tr; PSPPH_3133-1.
DR   EnsemblGenomes-Tr; PSPPH_3134-1.
DR   EnsemblGenomes-Tr; PSPPH_3135-1.
DR   EnsemblGenomes-Tr; PSPPH_3501-1.
DR   EnsemblGenomes-Tr; PSPPH_3507-1.
DR   EnsemblGenomes-Tr; PSPPH_3508-1.
DR   EnsemblGenomes-Tr; PSPPH_3509-1.
DR   EnsemblGenomes-Tr; PSPPH_3621-1.
DR   EnsemblGenomes-Tr; PSPPH_3622-1.
DR   EnsemblGenomes-Tr; PSPPH_3623-1.
DR   EnsemblGenomes-Tr; PSPPH_3624-1.
DR   EnsemblGenomes-Tr; PSPPH_3761-1.
DR   EnsemblGenomes-Tr; PSPPH_3762-1.
DR   EnsemblGenomes-Tr; PSPPH_3786-1.
DR   EnsemblGenomes-Tr; PSPPH_3787-1.
DR   EnsemblGenomes-Tr; PSPPH_3982-1.
DR   EnsemblGenomes-Tr; PSPPH_4192-1.
DR   EnsemblGenomes-Tr; PSPPH_4193-1.
DR   EnsemblGenomes-Tr; PSPPH_4606-1.
DR   EnsemblGenomes-Tr; PSPPH_4607-1.
DR   EnsemblGenomes-Tr; PSPPH_4608-1.
DR   EnsemblGenomes-Tr; PSPPH_4609-1.
DR   EnsemblGenomes-Tr; PSPPH_4613-1.
DR   EnsemblGenomes-Tr; PSPPH_4614-1.
DR   EnsemblGenomes-Tr; PSPPH_4615-1.
DR   EnsemblGenomes-Tr; PSPPH_4616-1.
DR   EnsemblGenomes-Tr; PSPPH_4617-1.
DR   EnsemblGenomes-Tr; PSPPH_4687-1.
DR   EnsemblGenomes-Tr; PSPPH_4688-1.
DR   EnsemblGenomes-Tr; PSPPH_4932-1.
DR   EnsemblGenomes-Tr; PSPPH_4945-1.
DR   EnsemblGenomes-Tr; PSPPH_5092-1.
DR   EnsemblGenomes-Tr; PSPPH_5093-1.
DR   EnsemblGenomes-Tr; PSPPH_5094-1.
DR   EnsemblGenomes-Tr; PSPPH_5095-1.
DR   EnsemblGenomes-Tr; PSPPH_5096-1.
DR   EuropePMC; PMC1236638; 16159782.
DR   EuropePMC; PMC1855804; 17237165.
DR   EuropePMC; PMC2612379; 18971268.
DR   EuropePMC; PMC2798240; 19854904.
DR   EuropePMC; PMC2809737; 20107499.
DR   EuropePMC; PMC2851929; 20231437.
DR   EuropePMC; PMC3112066; 21542933.
DR   EuropePMC; PMC3189936; 22016774.
DR   EuropePMC; PMC3194850; 21856827.
DR   EuropePMC; PMC3639832; 23587016.
DR   EuropePMC; PMC3807495; 23995634.
DR   EuropePMC; PMC3879358; 24391493.
DR   EuropePMC; PMC4556710; 26325299.
DR   EuropePMC; PMC5424326; 28486968.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01744; livK.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02144; rsmX.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000058.
DR   SILVA-SSU; CP000058.
DR   StrainInfo; 493507; 0.
XX
CC   On Apr 20, 2011 this sequence version replaced AY922993.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5928787
FT                   /organism="Pseudomonas savastanoi pv. phaseolicola 1448A"
FT                   /strain="1448A; BAA-978"
FT                   /mol_type="genomic DNA"
FT                   /note="pathovar: phaseolicola"
FT                   /db_xref="taxon:264730"
FT   gene            238..1773
FT                   /gene="dnaA"
FT                   /locus_tag="PSPPH_0001"
FT                   /note="PSPPH0001"
FT   CDS_pept        238..1773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PSPPH_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P03004; match to
FT                   protein family HMM PF00308; match to protein family HMM
FT                   TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37173"
FT                   /db_xref="GOA:Q48QK0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QK0"
FT                   /protein_id="AAZ37173.1"
FT                   /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGEHGQGMAPALSLLIGSKRSSAPRAAPNAPLAAAASQALSA
FT                   NSVSSVSSSAPAMATPAAAVAVPAPVQNVAAHDEPSRDSFDPMAGASSQQAPARAEQRT
FT                   VQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGK
FT                   THLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDI
FT                   QFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEP
FT                   PELETRVAILMKKADQAKVDLPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDIT
FT                   IELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALS
FT                   KELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
FT   gene            1812..2915
FT                   /gene="dnaN"
FT                   /locus_tag="PSPPH_0002"
FT                   /note="PSPPH0002"
FT   CDS_pept        1812..2915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PSPPH_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P00583; match to
FT                   protein family HMM PF00712; match to protein family HMM
FT                   PF02767; match to protein family HMM PF02768; match to
FT                   protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36500"
FT                   /db_xref="GOA:Q48QJ9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QJ9"
FT                   /protein_id="AAZ36500.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLSNDALIDIKLDDSKLIVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   AGILRAVATDGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRG
FT                   IRLQLASGQLKIQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDSNSSALVQESDNDDSAYVVMPMRL"
FT   gene            2938..4041
FT                   /gene="recF"
FT                   /locus_tag="PSPPH_0003"
FT                   /note="PSPPH0003"
FT   CDS_pept        2938..4041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PSPPH_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35814"
FT                   /db_xref="GOA:Q48QJ8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QJ8"
FT                   /protein_id="AAZ35814.1"
FT                   /translation="MSLSRVSVTGVRNLHPVTLSPSPRINILYGANGSGKTSVLEAIHL
FT                   LGIARSFRSSRLLPVIQYVQPSCTVFGQVDLAQGGHSNLGVSRDRQGEFQIRIDGQNAR
FT                   SAAQLAEILPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFMVTWQRLQKALKQRN
FT                   SWLRHGTLDAASQAAWDRELCYASDEIDEFRRAYIKALKPVFEQTLSELVELEGLTLSY
FT                   YRGWDKEKELSTVLASSLHRDQQMGHTQAGPQRADLRLRLGAHNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQVRRGQCIYLVDDLPSELDDNHRRALCRLLEELRCQVFITCVDQEFLR
FT                   EGWQTETPVALFHVEQGRITQTHDHRE"
FT   gene            4046..6463
FT                   /gene="gyrB"
FT                   /locus_tag="PSPPH_0004"
FT                   /note="PSPPH0004"
FT   CDS_pept        4046..6463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PSPPH_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P06982; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34879"
FT                   /db_xref="GOA:Q48QJ7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QJ7"
FT                   /protein_id="AAZ34879.1"
FT                   /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDISIIIHPDESITVRDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSELLLLTVRRSGKIWEQTYVHGVPQEPMKIVGESD
FT                   TTGTQIHFKPSADTFKNIHFSWDILAKRIRELSFLNSGVGIVLKDERSGKEELFKYEGG
FT                   LRAFVEYLNTNKTPVNEVFHFNIQRDDGIGVEIALQWNDSFNENLLCFTNNIPQRDGGT
FT                   HLVGFRSALTRNLNNYIEQEGLAKKHKVATTGDDAREGLTAIISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQEMGKYFSDFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QLPELIERGYIYIAQPPLYKVKKGKQEQYIKDDEAMEEYMTQSALEDASLHLSESAPGI
FT                   SGTALEKLVNDFRMVMKTLKRLSRLYPQELTEHFVYLPPISLDQLSDHEGMQAWLALFD
FT                   ARLRTGEKSGLVYKASLREDRERNVWLPEVELISHGLSNYVTFNRDFFGSNDYKTVTAL
FT                   GLQISTLLEEGAYVQRGERKKPVTEFKEALAWLMAESTKRHTIQRYKGLGEMNPDQLWE
FT                   TTMDPSVRRMLKVTIEDAIGADQIFNTLMGDAVEPRRDFIESNALAVSNLDF"
FT   gene            6773..8098
FT                   /locus_tag="PSPPH_0005"
FT                   /note="PSPPH0005"
FT   CDS_pept        6773..8098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0005"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34480"
FT                   /db_xref="GOA:Q48QJ6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QJ6"
FT                   /protein_id="AAZ34480.1"
FT                   /translation="MPAPLIPVETSPKLPLEADVVVIGGGIIGSFTAYYLALRGMKVAL
FT                   VEKGRIGAEQSSRNWGWCRQQNRDARELPMATKSLDLWEQFAKQSGEQTGFTRCGLLYL
FT                   SNDEKELAGWARWGEFARTVGVQTYMLTAQQAAERGKATGKQWKGGVYAPTDGTADPSR
FT                   AAPAVARAIMALGGTVHQGCAARGLETEGGRLSAVVTENGTIRTRLAVLAGGAWASSFC
FT                   RQYGISFPQATIRQTVMSVSPPTGELVPALHTSNVSMTRRHDGSYTLAISGRGRVDPTP
FT                   QLFGFAAQFLPMFGRRWRNLAPGGLEGLRSGHEGRGRWRLDQPTPMEKMRILDPKVDTS
FT                   AVELTYKRAVAMVPALKQSSVNAAWAGYVDSTPDGVPGIGEIASLPGLVLAAGFSGHGF
FT                   GIGPGAGHLIAHIVSGVAPIVDPKPYHPDRFHGSAWGKVADF"
FT   gene            complement(8300..9532)
FT                   /pseudo
FT                   /locus_tag="PSPPH_0006"
FT                   /note="PSPPH0006; IS801, transposase, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:P24607"
FT   gene            complement(9812..11044)
FT                   /locus_tag="PSPPH_0007"
FT                   /note="PSPPH0007"
FT   CDS_pept        complement(9812..11044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0007"
FT                   /product="IS801, transposase"
FT                   /note="identified by similarity to SP:P24607; match to
FT                   protein family HMM PF04986"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37126"
FT                   /db_xref="GOA:Q48QJ5"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QJ5"
FT                   /protein_id="AAZ37126.1"
FT                   /translation="MKPAYPPLLLQMSPAYTPRPLKNLFTANQCWAHLLEEGGLRDIEV
FT                   ESVTKMLACGTSILGVKHYTCGNHSCPHVKYLCNTCHCRACPSCGKKATDQWIAVQNNR
FT                   LPDCPWQHLVFTLPDTLWPLFFYNRWLLDALFRLAADNLIYAAKRRGLRVGIFGALHTY
FT                   GRRLNWHPHVHLSVTAGGLDEQGVWKNLSFHKEALRRRWMWLVRDYLLGQPLSQLTMPP
FT                   PLAHILCESDWRRLILTAGGQHWHIHLSKKTKNGRKTVNYLGRYLKKPPISGSRLAHYT
FT                   NGATLSFTYLDHRTQTYQQETLSQADMLFRVVQHIPEKHFRMIRYFGFLANRVCRQYLP
FT                   KVYEALKMATPGPTPKLYFVQMAKAFLNVDPFRCVLCGARMVYTAAISGLTVQGLNLNA
FT                   QAIAQMRYVKP"
FT   gene            complement(11095..12453)
FT                   /locus_tag="PSPPH_0008"
FT                   /note="PSPPH0008"
FT   CDS_pept        complement(11095..12453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0008"
FT                   /product="oxidoreductase, alpha (molybdopterin) subunit,
FT                   fusion"
FT                   /note="identified by match to protein family HMM PF00384"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36437"
FT                   /db_xref="GOA:Q48QJ4"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QJ4"
FT                   /protein_id="AAZ36437.1"
FT                   /translation="MTPEFFARHTVSELATWSDHELEAKGRITEPMRYDAATDKYLPVT
FT                   WDEAFAEIGAELRGLSDPWKLELYTSGRTSNEAAFLYQLFGRLYGMANFPDCSNMCHET
FT                   TTAALPESIGVGKGTTTLEDFENADAIFIIGQNPGSNSPRMMSELHAAAKRGASIISFN
FT                   PLRERALVCFAAPQDPRDMLSLHGVEISSQYHQVRIGGDMIALQGVCKAVIEADDVAHR
FT                   ENLPRVLDVAFIEEHTHGFEQYADYCRQLPWDTIERHSGLTRQAIEEVAAVYKRSKGVI
FT                   CCWGMGITQHKRGGDAMQQIINLLLLRGNIGKLGAGACPVRGHSNVQGDRTMGIYEKAG
FT                   EPFLASMSKVFGFEASRKKGHAVAQTCEALLRGEVEALISMGGNLFRAIPDTDVICPTV
FT                   SRLKMTVLVNTKLNRSATVHGQKAFLLPCVARSERDLQNRAACGCKSPVLTIA"
FT   gene            complement(12962..13732)
FT                   /gene="plsC"
FT                   /locus_tag="PSPPH_0009"
FT                   /note="PSPPH0009"
FT   CDS_pept        complement(12962..13732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="PSPPH_0009"
FT                   /product="hdtS protein"
FT                   /EC_number="2.3.1.51"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35876"
FT                   /db_xref="GOA:Q48QJ3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QJ3"
FT                   /protein_id="AAZ35876.1"
FT                   /translation="MSIMQAIRTFFFYLLLGTSSLLWCTLSFFIAPFLPFKARYRFINV
FT                   YWCRCAIWLTKVFLNIQVEVTGAENVPTPPCVIISNHQSTWETFFLSAYFEPMSQVLKR
FT                   ELLYVPFFGWAMAMLRPIAIDRDNPKAALREIAKKGDELLKDGVWVLIFPEGTRVPYGQ
FT                   VGKFSRGGTALAVNADLPVLPVAHNAGKYWPRDGWAKKPGTIQVVIGEPMYAEGTGPRA
FT                   IAALNDRVQAWNEEAQRAMGSPVTPAASPEKVPA"
FT   gene            complement(13798..14343)
FT                   /locus_tag="PSPPH_0010"
FT                   /note="PSPPH0010"
FT   CDS_pept        complement(13798..14343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0010"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="identified by match to protein family HMM TIGR01656;
FT                   match to protein family HMM TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35192"
FT                   /db_xref="GOA:Q48QJ2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QJ2"
FT                   /protein_id="AAZ35192.1"
FT                   /translation="MVKLLILDRDGVINHDSDAYIKSVKEWVPIPGSIKAIADLSKAGW
FT                   TVAVATNQSGIARGYYDLATLDAMHERLRKLVAEQGGEVGLIVYCPHGPDDACSCRKPK
FT                   PGMLQAIVTHYAVDPKGLWFVGDSKGDLQAALAVDSQPVLVMTGKGRKTMEGGVPAGTL
FT                   IFDDLAAVAAELIHNSAH"
FT   gene            complement(14354..16408)
FT                   /gene="glyS"
FT                   /locus_tag="PSPPH_0011"
FT                   /note="PSPPH0011"
FT   CDS_pept        complement(14354..16408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PSPPH_0011"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36340"
FT                   /db_xref="GOA:Q48QJ1"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QJ1"
FT                   /protein_id="AAZ36340.1"
FT                   /translation="MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLSGAGLTYSAK
FT                   QVYAAPRRLAVLITALATQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLSE
FT                   IDQSGPKLRYSQTILGKPTTSLLPTIVEDSLNDLPIAKRMRWGARKEEFVRPTQWLVML
FT                   FGDQVVDCTILAQSAGRHSRGHRFHHPQDVRISSPAGYLSDLRAAHVLADFNERRQIIS
FT                   KRVDELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLEVPQEALITTMQDNQK
FT                   YFCLLDAEGKLLPRFITVANIESKDPAQIVAGNEKVVRPRLTDAEFFFKQDKKQKLETF
FT                   NDRLKNVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRAARAGLLSKCDLSSEMVGE
FT                   FPEMQGIAGYYYAKADGEPEDVALALNEQYMPRGAGAELPTTLTGAAVAIADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKFAVTQFGAKIKPAGLAE
FT                   QVLDFIFDRLRARYEDEGVDVAVYLSVRALQPASALDFDQRVQAVQAFRKLPQAAALAA
FT                   VNKRVSNLLSKAEGSIAQTVEPKYFDNANEFSLYSAIQQADHAVQPMAAERQYSESLAR
FT                   LAMLREPVDAFFEAVMVNAEDANVRANRYALLSRLRGLFLGVADISLLG"
FT   gene            complement(16405..17412)
FT                   /gene="glyQ"
FT                   /locus_tag="PSPPH_0012"
FT                   /note="PSPPH0012"
FT   CDS_pept        complement(16405..17412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PSPPH_0012"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35638"
FT                   /db_xref="GOA:Q48QJ0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QJ0"
FT                   /protein_id="AAZ35638.1"
FT                   /translation="MRPNRVYSRSLNRSPAQVKFVSQPTPAVRTFQDLILALQQYWAEQ
FT                   GCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQ
FT                   FQVILKPNPDNFQELYLGSLKHIGLDPLVHDVRFVEDNWESPTLGAWGLGWEIWLNGME
FT                   VSQFTYFQQVGGLECYPVTGEITYGLERLAMYQQGVDSVYDLVWADGPFGKVTYGDVFH
FT                   QNEVEQSTYNFEHANVDKLFELFDFYESEAARLIELELPLPGYEMVLKASHTFNLLDAR
FT                   RAISVTARQQYILRVRTLARSVAQAYLQARARLGFPMAPPDLRDEVLAKLEAAQ"
FT   gene            17433..17984
FT                   /gene="tag"
FT                   /locus_tag="PSPPH_0013"
FT                   /note="PSPPH0013"
FT   CDS_pept        17433..17984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="PSPPH_0013"
FT                   /product="DNA-3-methyladenine glycosidase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="identified by similarity to SP:P05100; match to
FT                   protein family HMM PF03352; match to protein family HMM
FT                   TIGR00624"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ32976"
FT                   /db_xref="GOA:Q48QI9"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QI9"
FT                   /protein_id="AAZ32976.1"
FT                   /translation="MTRCFWCNEDPLYIAYHDQEWGVPLRDAQKLFELLLLEGFQAGLS
FT                   WITILKRRARYREVLHGFDVVRLAQLSDAEIEALMLDPSIIRNRLKLKAVRTNARAWLA
FT                   LQDPAGLLWSFVGGEPKINHFKDRSEVPAITAEAEAMSKALKKAGFTFVGPTICYAYMQ
FT                   ASGMVMDHTVDCDRYAILSR"
FT   gene            18023..18910
FT                   /locus_tag="PSPPH_0014"
FT                   /note="PSPPH0014"
FT   CDS_pept        18023..18910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0014"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase,
FT                   putative"
FT                   /note="identified by similarity to SP:P24187; match to
FT                   protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37552"
FT                   /db_xref="GOA:Q48QI8"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QI8"
FT                   /protein_id="AAZ37552.1"
FT                   /translation="MDKFKGAVMVGALRLFALLPWRAVQWAGTAIGWLMWKLPNRSREV
FT                   ARINLSKCFPELSEPELEKLVGRSLMDIGKTLTESACAWIWPAQKSINLVREVEGLDVL
FT                   KDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDDLLRKQRVQLGNR
FT                   VAASTKEGILSVIKEVRKGGSVGIPADPEPAESAGIFVPFCGTQALTSKFVPNMLAGGK
FT                   AVGVFLHAMRLPDGSGYKVVLEAAPEAMYSTDTETSAAAMSKVVEKYVRAYPSQYMWTM
FT                   KRFKKRPAGEARWY"
FT   gene            18981..19598
FT                   /locus_tag="PSPPH_0015"
FT                   /note="PSPPH0015"
FT   CDS_pept        18981..19598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0015"
FT                   /product="Protein of unknown function (DUF1534) family"
FT                   /note="identified by match to protein family HMM PF07551"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34704"
FT                   /db_xref="InterPro:IPR011433"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QI7"
FT                   /protein_id="AAZ34704.1"
FT                   /translation="MRDAPRHRSAPRRAFKIGRRASRTACDAERRTIVRLSFRTLQRGN
FT                   AVSDAPRHRFAPRRAFKIGRRASRTACDAERRTIVRLSFRTLQRGNAVRDAPRHRSAPR
FT                   RAFKIGRGASRTACDAERRTIVRLSFRTLQRGNAVRDAPRHRSAPRRAFKIGRGAPHDS
FT                   VSLNWPPQSTRAVPVPLASPPNSSAPGSCIGISKCLCIRLTL"
FT   gene            complement(19733..20965)
FT                   /locus_tag="PSPPH_0016"
FT                   /note="PSPPH0016"
FT   CDS_pept        complement(19733..20965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0016"
FT                   /product="IS801, transposase"
FT                   /note="identified by similarity to SP:P24607; match to
FT                   protein family HMM PF04986"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34750"
FT                   /db_xref="GOA:Q48QJ5"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QJ5"
FT                   /protein_id="AAZ34750.1"
FT                   /translation="MKPAYPPLLLQMSPAYTPRPLKNLFTANQCWAHLLEEGGLRDIEV
FT                   ESVTKMLACGTSILGVKHYTCGNHSCPHVKYLCNTCHCRACPSCGKKATDQWIAVQNNR
FT                   LPDCPWQHLVFTLPDTLWPLFFYNRWLLDALFRLAADNLIYAAKRRGLRVGIFGALHTY
FT                   GRRLNWHPHVHLSVTAGGLDEQGVWKNLSFHKEALRRRWMWLVRDYLLGQPLSQLTMPP
FT                   PLAHILCESDWRRLILTAGGQHWHIHLSKKTKNGRKTVNYLGRYLKKPPISGSRLAHYT
FT                   NGATLSFTYLDHRTQTYQQETLSQADMLFRVVQHIPEKHFRMIRYFGFLANRVCRQYLP
FT                   KVYEALKMATPGPTPKLYFVQMAKAFLNVDPFRCVLCGARMVYTAAISGLTVQGLNLNA
FT                   QAIAQMRYVKP"
FT   gene            complement(21016..22644)
FT                   /locus_tag="PSPPH_0017"
FT                   /note="PSPPH0017"
FT   CDS_pept        complement(21016..22644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0017"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit,
FT                   fusion"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM TIGR01701"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33668"
FT                   /db_xref="GOA:Q48QI5"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QI5"
FT                   /protein_id="AAZ33668.1"
FT                   /translation="MSESENSPAPLQGSQTDGTPAGGWPALSAVNKHLLHQHVLIKGNR
FT                   TLLSMNKPGGFDCPSCSWPDPKKPHTFEYCENGAKALAWESTKKRVTPEFFARHTVSEL
FT                   ATWSDHELEAKGRITEPMRYDAATDKYLPVTWDEAFAEIGAELRGLSDPWKLELYTSGR
FT                   TSNEAAFLYQLFGRLYGMANFPDCSNMCHETTTAALPESIGVGKGTTTLEDFENADAIF
FT                   IIGQNPGSNSPRMMSELHAAAKRGASIISFNPLRERALVCFAAPQDPRDMLSLHGVEIS
FT                   SQYHQVRIGGDMIALQGVCKAVIEADDVAHRENLPRVLDVAFIEEHTHGFEQYADYCRQ
FT                   LPWDTIERHSGLTRQAIEEVAAVYKRSKGVICCWGMGITQHKRGGDAMQQIINLLLLRG
FT                   NIGKLGAGACPVRGHSNVQGDRTMGIYEKAGEPFLASMSKVFGFEASRKKGHAVAQTCE
FT                   ALLRGEVEALISMGGNLFRAIPDTDVICPTVSRLKMTVLVNTKLNRSATVHGQKAFLLP
FT                   CVARSERDLQNRAACGCKSPVLTIA"
FT   gene            complement(22799..24172)
FT                   /gene="trkA"
FT                   /locus_tag="PSPPH_0018"
FT                   /note="PSPPH0018"
FT   CDS_pept        complement(22799..24172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PSPPH_0018"
FT                   /product="Trk system potassium uptake protein TrkA"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36417"
FT                   /db_xref="GOA:Q48QI4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QI4"
FT                   /protein_id="AAZ36417.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLAGEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKGSYPAVLRQAGADDADMLVAVTSSDEANMIACQVAHTLFHTPTKIARIREAAY
FT                   LTRAGLFDKNAIPVDVLISPEQVVTNYIKRLIEYPGALQVIDFAEGKAQLVAVKAYYGG
FT                   ALVGQQLRQLRAHMPNVDTRIAAIYRRDRAILPHGDTVIEADDEVFFIAAKADIRAVMG
FT                   ELRRLDENYKRIVIAGGGNIGERLAEAIESRYQVKIIEVNPARCRYLSEHLNSTVVLQG
FT                   SSSDRDLLMEENINNTDLFLALTNDDEANIMSSLLAKRLGARKVMTLINNPAYVDLVQG
FT                   GEIDVAVSPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEIVAHGDPKSSKVVGRAIK
FT                   DINLPTGTAIGAIIRDEQVLIAHDITVIESGDHVIMFLVDKKCIREVERLFQVGLSFF"
FT   gene            complement(24169..25515)
FT                   /gene="sun"
FT                   /locus_tag="PSPPH_0019"
FT                   /note="PSPPH0019"
FT   CDS_pept        complement(24169..25515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="PSPPH_0019"
FT                   /product="sun protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM PF01189; match to protein
FT                   family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35879"
FT                   /db_xref="GOA:Q48QI3"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QI3"
FT                   /protein_id="AAZ35879.1"
FT                   /translation="MNPRLAAAKALAAVLSGKASLNSSLPTQLDKVEVRDRGLTQDLAF
FT                   GTARWQPRLSALAAKLLQKPFKAADADVEALLLVGLYQLFYSRIPAHAAIGETVGCAHK
FT                   LKKPWAKGLLNAVLRNAQRDGEALLIELEHDPVVRTAHPRWLQKALKAAWPEQWEAICA
FT                   ANNAHPPMILRVNRRHNSRDQYLELLNTAGLQASACTFSQDGIVLAEPCDVRSLPGFAE
FT                   GWISVQDEAAQLAADLLELAPGQRVLDACCAPGGKTCHLLEVQPQLSGVVAVDLEAKRL
FT                   VRVRENLDRLGLDAELIAADARETAQWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQ
FT                   LDDIAALASLQGELLDALWPTLQVGGMLVYATCSTLPTENTDVIEAFLARTSGARELDI
FT                   AGQAGQPPAGIKQAHGRQLLAQQGGHDGFYYAKLIKIADQGRGGAGVSR"
FT   gene            complement(25512..26456)
FT                   /gene="fmt"
FT                   /locus_tag="PSPPH_0020"
FT                   /note="PSPPH0020"
FT   CDS_pept        complement(25512..26456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PSPPH_0020"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37003"
FT                   /db_xref="GOA:Q48QI2"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QI2"
FT                   /protein_id="AAZ37003.1"
FT                   /translation="MTEPLRIVFAGTPEFAAEHLKALLDSPYQIVAVYTQPDRPAGRGQ
FT                   KLMPSPVKQLALQHEIPVMQPPTLRAPEAQAELAALKPDLMVVVAYGLILPQVVLDIPR
FT                   LGCINSHASLLPRWRGAAPIQRAVQAGDAESGVTVMQMEAGLDTGPMLLKAVTPITAQD
FT                   TGGTLHDRLAELGPPAVLQAIAGLADGSLVGEVQDDSLANYAHKLNKDEARLDWTRPAD
FT                   ELERLIRAFNPWPICHSTLNEETLKVLAADLAEGQGVPGTVLSASKDGLIVACGQNALR
FT                   LTRLQLPGGKPLNFADLFNSRREKFAIGTVLGQ"
FT   gene            complement(26516..27022)
FT                   /gene="def1"
FT                   /locus_tag="PSPPH_0021"
FT                   /note="PSPPH0021"
FT   CDS_pept        complement(26516..27022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="PSPPH_0021"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37545"
FT                   /db_xref="GOA:Q48QI1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QI1"
FT                   /protein_id="AAZ37545.1"
FT                   /translation="MAILNILEFPDSRLRTIAKPVAMVDEGIRQLVDDMFETMYEAPGI
FT                   GLAATQVNVHKRVVVMDLSEDRSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDR
FT                   PQKVRVKALDRNGKPYELVAEGLLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEKQ
FT                   HKLNA"
FT   gene            27148..28173
FT                   /locus_tag="PSPPH_0022"
FT                   /note="PSPPH0022"
FT   CDS_pept        27148..28173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0022"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35866"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QI0"
FT                   /protein_id="AAZ35866.1"
FT                   /translation="MRKSLLALLLLTASGLAQAQVQLREGYPQSYTVVAGDTLWDISGK
FT                   FLREPWKWREIWRANPQVHDPDLIYPGDTLALTWVDGQPRVTLNRGESRGTIKLSPRVR
FT                   STPMVEAIPSIPLGAINAFLISNRIVDNAEQFEKAPYIVAGNAERVLSGSGDRAYARGT
FT                   LDPAHTVYGIFRQGKTYTDPQTKEVLGINADDIGSAEVVASEGDVSTLVLQRSTQEVRL
FT                   GDRLFSSEERAINSTFLPSAPQTPIEGLILDVPRGVTQVSVLDVVTLNKGKRDGLAEGN
FT                   VLAIYKTSETVRDRITGEQVKIPDERSGLLMVFRTYDKLSYALVLQANRSLAIMDKVRN
FT                   P"
FT   gene            28297..29415
FT                   /gene="smf"
FT                   /locus_tag="PSPPH_0023"
FT                   /note="PSPPH0023"
FT   CDS_pept        28297..29415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="PSPPH_0023"
FT                   /product="DNA processing protein DprA"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36448"
FT                   /db_xref="GOA:Q48QH9"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QH9"
FT                   /protein_id="AAZ36448.1"
FT                   /translation="MPLFENALSSPAELEARLRMHRLPEIGPKRFSRLIEAFGSASSAL
FT                   SAPASAWRALGIPGACAEARRAPSVRDGASAALAWLECPAQHLLMWDDPCYPALLAEIA
FT                   DPPPLIFIAGDPSILERPQLGMVGSRRASRPGLDTARAFARSLAGAGFVITSGLARGID
FT                   GAAHQGALDVGGHTIGVLGTRLEKLYPQQHRALAAQMAAQGGAVISEFPLDAEPQPSNF
FT                   PRRNRIISGLSLGVLVVEASVASGSLITARLAAEQGREVYAIPGSIHHPGAKGCHQLIR
FT                   DGATLVETVEHILEGLQHWKSVAPAAPPETPAKPVPCDHPLLALLHAAPHTSEGLSVSS
FT                   GWPLPKVLAGLTELELDGRISCEAGRWFARAP"
FT   gene            29454..30011
FT                   /locus_tag="PSPPH_0024"
FT                   /note="PSPPH0024"
FT   CDS_pept        29454..30011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0024"
FT                   /product="SUA5/yciO/yrdC family domain protein"
FT                   /note="identified by match to protein family HMM PF01300"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34812"
FT                   /db_xref="GOA:Q48QH8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QH8"
FT                   /protein_id="AAZ34812.1"
FT                   /translation="MVSSWRVQQAAQDIRAGAVIAYPTEAVWGLGCDPWDEEAVYRLLA
FT                   IKSRPVEKGLILIADNIRQFDFLFEDFPQLWLDRMASTWPGPNTWLVPHQNLLPEWITG
FT                   IHETVALRVTDHPTVRELCALVGPLISTSANPAGRPAARSRLRVEQYFRGQIDGVLGGS
FT                   LGGRRNPSVIRDIATGQVMRAG"
FT   gene            complement(30031..31008)
FT                   /gene="qor1"
FT                   /locus_tag="PSPPH_0025"
FT                   /note="PSPPH0025"
FT   CDS_pept        complement(30031..31008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor1"
FT                   /locus_tag="PSPPH_0025"
FT                   /product="quinone oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="identified by similarity to SP:P28304; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34314"
FT                   /db_xref="GOA:Q48QH7"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QH7"
FT                   /protein_id="AAZ34314.1"
FT                   /translation="MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDT
FT                   YYRSGLYPAPELPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEA
FT                   NLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKA
FT                   LGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVFDGVGQDTW
FT                   LTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKGSVYVTRPTLGTYANNAQNLQAMAD
FT                   ELFDMLASGKLKVDNIQQYALKDAAKAQTELSARRTTGSTILIP"
FT   gene            31180..32094
FT                   /gene="hemF"
FT                   /locus_tag="PSPPH_0026"
FT                   /note="PSPPH0026"
FT   CDS_pept        31180..32094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PSPPH_0026"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /note="identified by match to protein family HMM PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34851"
FT                   /db_xref="GOA:Q48QH6"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QH6"
FT                   /protein_id="AAZ34851.1"
FT                   /translation="MSTRTEAVKAYLLDLQDRICTALEQEDGNAHFVEDAWTRPAGGGG
FT                   RTRVIENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVP
FT                   TSHANVRFFIAEKEGEEPVWWFGGGFDLTPYYGVEEDCVHWHRVAERACAPFGDDVYPR
FT                   YKAWCDSYFHLKHRDEPRGIGGLFFDDVNQWDFDTSFAFIRAIGDAFINAYLPIVRRRK
FT                   AAAYTAQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKA
FT                   APGSEEARLTEYFLTDRDWLADN"
FT   gene            32094..32918
FT                   /gene="aroE"
FT                   /locus_tag="PSPPH_0027"
FT                   /note="PSPPH0027"
FT   CDS_pept        32094..32918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PSPPH_0027"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by match to protein family HMM PF01488;
FT                   match to protein family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33249"
FT                   /db_xref="GOA:Q48QH5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QH5"
FT                   /protein_id="AAZ33249.1"
FT                   /translation="MDRYVVFGNPIGHSKSPLIHRLFAEQTGQALDYQTSLAPLDDFTA
FT                   FAQAFFQTGRGANVTVPFKEEAYRLAHSLTERGQRAGAVNTLSKLDDGKLLGDNTDGAG
FT                   LVRDLTVNCGRSLRGQRILLLGAGGAVRGALEPLLAEQPAVLVIANRTVEKAERLAQEF
FT                   ADLGPVFASSFDWLEEPVDVIINATSASLAGELPPISPSLIQPGATFCYDMMYSKEPTA
FT                   FCRWATEHGAAQSVDGLGMLVEQAAEAFLLWRGVRPDSAPVLAELRRLLAAG"
FT   gene            complement(33015..34583)
FT                   /locus_tag="PSPPH_0028"
FT                   /note="PSPPH0028"
FT   CDS_pept        complement(33015..34583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0028"
FT                   /product="sulfate transporter family protein"
FT                   /note="identified by match to protein family HMM PF00916;
FT                   match to protein family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33794"
FT                   /db_xref="GOA:Q48QH4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QH4"
FT                   /protein_id="AAZ33794.1"
FT                   /translation="MRWLNRHKFLPFLAWLPQQNRASVGRDALVGLSGAILALPQSIAY
FT                   ALIAGLPPEYGLYAAIVPVLIACLWGSSWHLICGPTAAISIVLYASVSPLAVPASQDYI
FT                   MLILLLTFIAGVFQLLLGMMRFGALVNFVSHSVVLGFTLGAAIVIALGQMPNLLGIDLP
FT                   SQTTALRSLTAVLEHRGEVDLPSLTLGLLTLALGIGLKLLVPRWPTLLIALVSSSLLVW
FT                   LWPAMFGHVRVVRAFVGHLPPFSPLPLDLELILKLLPTAVAVGMLGLVNSLSIARSLSA
FT                   RSQQMLNANQEVRAQGLSNMVGSLFSGYLSAGSFTRAALSYEAGARSPLAGVFSALWVA
FT                   LFAVAGASLISHIPIPAMAASILLICWGLVDRRGIRALFRVSRAEFFVMALTCLATLLL
FT                   ELQTAIYAGVLASLFFYLKRTSQPCVQQWREGDEDVLRVGGSIFFGASHYLQTRLQRTE
FT                   GLRVVIDAQQINFIDYSGVEMLHQEARRLGQQGRVLVMRNARPQVIEELHKLEGPQNCP
FT                   ILFED"
FT   gene            complement(34760..35686)
FT                   /locus_tag="PSPPH_0029"
FT                   /note="PSPPH0029"
FT   CDS_pept        complement(34760..35686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0029"
FT                   /product="glycine/betaine family, ABC transporter,
FT                   substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37129"
FT                   /db_xref="GOA:Q48QH3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QH3"
FT                   /protein_id="AAZ37129.1"
FT                   /translation="MKKLSTAVAVAVMTFGSLAAQAEDASCSTVKMADPGWSDIGATNA
FT                   IASVVLEGLGYKAKVDTLAVPIAYGGLKDGKLDVFLGNWMPAQQGFYDKFVATGDVTQL
FT                   ARNLEGTEFTLAVPDYVWDAGVHDFADLNKFADKFDQKIYGIGSGAPANLSLQEIIKKN
FT                   EFDLGKWKLVESSETAMLAEVNRNVKKKAFVVFLGWTPHPMNVQIKGMHYLKGGEKYFG
FT                   DTGSVFTLTRKGYAQACPNVGKLLTNLSFTLDMENSIMAEVANKKVSNSAAAKAWIKAN
FT                   PAVLDTWLEGVKTFDGKDGLTAVKARL"
FT   gene            complement(35724..37229)
FT                   /gene="betC"
FT                   /locus_tag="PSPPH_0030"
FT                   /note="PSPPH0030"
FT   CDS_pept        complement(35724..37229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betC"
FT                   /locus_tag="PSPPH_0030"
FT                   /product="choline sulfatase"
FT                   /EC_number="3.1.6.6"
FT                   /note="identified by similarity to SP:O69787; match to
FT                   protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33914"
FT                   /db_xref="GOA:Q48QH2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QH2"
FT                   /protein_id="AAZ33914.1"
FT                   /translation="MKRKNILFIMADQMAAPMLPFYSRSPILMPNLSRLAADGVVFDSA
FT                   YCNSPLCAPSRFTLVSGQLPSKIGAYDNAADFPADIPTYAHYLRALGYKTALAGKMHFC
FT                   GPDQLHGYEERLTSDIYPADYGWSVNWDEPDVRPSWYHNMSSVLQAGPCIRTNQLDFDE
FT                   EVLFKSQQYLYDYVRQDGDAPFCLTVSMTHPHDPYTIPKPFWDLYADEEIPMPPPHANQ
FT                   AALDPHSQRLLKVYDLWDKPMPTDKIRDARRAYFGACSYIDLNVGKLMQTLDEVGLAED
FT                   TIVVFSGDHGDMLGEKGLWYKMHWFEMAARVPLVVYSPGQFKPGRVSASVSTADLLPTF
FT                   VEMANGKLDAGLPLDGRSLMPHLKRKGGHDEVFGEYMAEGTTSPLMMIRRGAYKFIYSE
FT                   QDPCLLFDVKKDPKEQKDLSQSPAHEKLFNDFLAEARAKWDIPAIHQQVLASQRRRRFV
FT                   AKSLATGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARFPQP"
FT   gene            37344..38294
FT                   /locus_tag="PSPPH_0031"
FT                   /note="PSPPH0031"
FT   CDS_pept        37344..38294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0031"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34781"
FT                   /db_xref="GOA:Q48QH1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QH1"
FT                   /protein_id="AAZ34781.1"
FT                   /translation="MFEAFGDMSLDLLRAFEVAARLRSFTAAAIELGTTQPAVSQQIKR
FT                   LEEQLATRLFDRIYRGIELTEAGEILFSHVQAGLQSIDSGLIAITEQHQHEVLQVATDF
FT                   AFAAYWLMPRLHRFHKVNPDVDVSLVTSERTHSMLRADIDVAVLFGDGRFKQGESHWLF
FT                   SEEVFPVCSPQLITGRQTPLPNEALRDFPLLHLRGESSNNWFDWAGVFRALDIPQAPTP
FT                   GQLRFDNYTLLIQAAIGGQGIAIGWKHLVDDLLDQGLLCRPIAGAAISGQGYYVVLPQR
FT                   KRRVQIVQQFMDWLASEQALSGVSLAGRPLPSIAV"
FT   gene            38331..38663
FT                   /locus_tag="PSPPH_0032"
FT                   /note="PSPPH0032"
FT   CDS_pept        38331..38663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0032"
FT                   /product="DOPA 4,5-dioxygenase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35324"
FT                   /db_xref="GOA:Q48QH0"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QH0"
FT                   /protein_id="AAZ35324.1"
FT                   /translation="MQDTHGYHAHIYFNAQTLDQARALCEAATEKFAVQMGRVHQKLVG
FT                   PHPDWSCQLAFGHEQLADVTLWLALNRDGLVVFLHPLTGDELRDHTDHAIWMGAVRPLN
FT                   LGALSG"
FT   gene            38877..39701
FT                   /locus_tag="PSPPH_0033"
FT                   /note="PSPPH0033"
FT   CDS_pept        38877..39701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0033"
FT                   /product="3-oxoadipate enol-lactonase, putative"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36319"
FT                   /db_xref="GOA:Q48QG9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QG9"
FT                   /protein_id="AAZ36319.1"
FT                   /translation="MPDLLIDGKTLHYADQGTGPVVLLGHSYLWDKAMWSAQIDTLASR
FT                   YRVIVPDLWGHGDSSGFPEGTRNLDDLARHALALLDHLNIERCSIVGLSVGGMWGAIAA
FT                   LLAPERITGLVLMDTYLGKESEAKKAYYFSLLDKLEQAGAFPEPLLDIVVPIFFRPGID
FT                   PQSPVYQAFRSALAGMNAEQLRQTVVPLGRMIFGRDDWLGLLEQLNADTTLVMCGDADI
FT                   PRPPEETREMASLIGCPYVLVPEAGHIANLENPDFVSGALMTFLARVNQQQG"
FT   gene            complement(39886..40416)
FT                   /locus_tag="PSPPH_0034"
FT                   /note="PSPPH0034"
FT   CDS_pept        complement(39886..40416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0034"
FT                   /product="CigR"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36703"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QG8"
FT                   /protein_id="AAZ36703.1"
FT                   /translation="MKLPNRFITGLGILMISASPLLQAAPPDQRGDGPDDNRGGQQQGP
FT                   QNNGGHNERGNDRGPGNDNGRGPDKGPASQPGRQAHQDNRGGNRPPQDFGPVRETFQQH
FT                   RDVIGRGQPLPPGVHIAKGRPLPPGYGKRLDSRSLQYLPHYDGYEWRRLGTDVVLIAVG
FT                   SGIVYAILDGVLN"
FT   gene            complement(40542..41354)
FT                   /gene="trpA"
FT                   /locus_tag="PSPPH_0035"
FT                   /note="PSPPH0035"
FT   CDS_pept        complement(40542..41354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="PSPPH_0035"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00290;
FT                   match to protein family HMM TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33480"
FT                   /db_xref="GOA:Q48QG7"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QG7"
FT                   /protein_id="AAZ33480.1"
FT                   /translation="MSRLEQRFAQLKTEGRAALVTFITAGDPGYDTSLQVLKGLPAAGA
FT                   DVIELGMPFTDPMADGVAIQLATLRALDAGQTLQKTLQMVSEFRVDDQTTPIVLMGYYN
FT                   PIHRFGVEAFVAQAKEAGVDGLIIVDLPPEHDAELATPAQASGIDFIRLTTPTTDDARL
FT                   PRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTSLPISVGFGIRTPEQAAA
FT                   IARLADGVVVGSAFVDKIATAESPEKAIDGVLTLCAALAEGVRNARIG"
FT   gene            complement(41351..42580)
FT                   /gene="trpB"
FT                   /locus_tag="PSPPH_0036"
FT                   /note="PSPPH0036"
FT   CDS_pept        complement(41351..42580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="PSPPH_0036"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00263"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34189"
FT                   /db_xref="GOA:Q48QG6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QG6"
FT                   /protein_id="AAZ34189.1"
FT                   /translation="MTQTNFRSGPDVNGLFGSFGGRYVAETLMPLVLDLNREYEAAKAD
FT                   PEFAKEMAYFQRDYVGRPNPLYFAERLTEFCDGAKIYFKREELNHTGAHKINNCIGQVL
FT                   LAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAE
FT                   IVPVTSGTGTLKDAMNEALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKE
FT                   QMQEKEGRLPDSLIACVGGGSNAMGLFHPFLDDASVEIIGVEAGGHGVDTDKHAASLNG
FT                   GVPGVLHGNRTYLLQDGDGQITDAHSISAGLDYPGIGPEHAFLHEVKRVEYVSITDDEA
FT                   LDAFHQCCLLEGIIPALETAHALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMA
FT                   AAEKTQEKLV"
FT   gene            42708..43616
FT                   /gene="trpI"
FT                   /locus_tag="PSPPH_0037"
FT                   /note="PSPPH0037"
FT   CDS_pept        42708..43616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpI"
FT                   /locus_tag="PSPPH_0037"
FT                   /product="transcriptional regulator TrpI"
FT                   /note="identified by similarity to SP:P34818; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34618"
FT                   /db_xref="GOA:Q48QG5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QG5"
FT                   /protein_id="AAZ34618.1"
FT                   /translation="MSRDLPPLNALRAFESTARLGSVSQAAEQLNVTHGAVSRQLKVLE
FT                   EHLGVSLFSKDGRGLKLTDAGIRLRDVSGEAFDRLRGVCVELSKGSADAPFVLGCSGSL
FT                   LARWFIPRLSRLNAELPDLRLHLSAGEGDLDPRRPGLDALLIFAEPPWPADMQVFELAS
FT                   ERIGPVLSPRFARFERLCDAPAETLLEESLLQTTSRPQAWPSWAQQNGIDPQSLRYGQG
FT                   FEHLYYLLEAAVAGLGIAIAPEPLVIDDLKAGRLAAPWGFSETPAQLALWVPRRAADGR
FT                   AQQLAQWLKNELKRSGEPIKN"
FT   gene            complement(43617..43943)
FT                   /locus_tag="PSPPH_0038"
FT                   /note="PSPPH0038"
FT   CDS_pept        complement(43617..43943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05957"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35657"
FT                   /db_xref="GOA:Q48QG4"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QG4"
FT                   /protein_id="AAZ35657.1"
FT                   /translation="MATTSLRKASLQSMEAEIESLLKSLEGLKADATDESRKTLKNLKA
FT                   NAESALSHSRSLLSDVYEDVKEKTRENALATRDYAQEHPWTTAGVAVGAIGLIAAYMLF
FT                   KRGN"
FT   gene            44110..44325
FT                   /locus_tag="PSPPH_0039"
FT                   /note="PSPPH0039"
FT   CDS_pept        44110..44325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0039"
FT                   /product="Protein of unknown function (DUF1458)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF07311"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33431"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QG3"
FT                   /protein_id="AAZ33431.1"
FT                   /translation="MTDHHTYKKVEIVGSSTTTIEDAINNALAEASKSLDLMEWFEVTE
FT                   TRGHIENGKVAHFQVTLKVGFRITNS"
FT   gene            44402..44698
FT                   /locus_tag="PSPPH_0040"
FT                   /note="PSPPH0040"
FT   CDS_pept        44402..44698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0040"
FT                   /product="Protein of unknown function (DUF1161) family"
FT                   /note="identified by match to protein family HMM PF06649"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35263"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QG2"
FT                   /protein_id="AAZ35263.1"
FT                   /translation="MGVGVFNGRLFRWRLHLAGREGLPMKKFLLAVGLLSIAGTALAAG
FT                   KPCEELKSEIDARLQAKGVTSYTLEVVEKGSASDKQVVGTCEGGTKEVVYQRG"
FT   gene            complement(44837..45838)
FT                   /locus_tag="PSPPH_0041"
FT                   /note="PSPPH0041"
FT   CDS_pept        complement(44837..45838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0041"
FT                   /product="bacterial luciferase family protein"
FT                   /EC_number="1.14.14.3"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34532"
FT                   /db_xref="GOA:Q48QG1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QG1"
FT                   /protein_id="AAZ34532.1"
FT                   /translation="MKRLADVKISTLDLVPVRHDKGPADSLRNSLNLAQHVEKLGYNRF
FT                   WVAEHHNMDGIASSATSVLLAYLAGGTSTIRVGAGGIMLPNHAPLVVAEQFGTLASLYP
FT                   GRIDLGLGRAPGSDQMTARALRRERSGSAEDFPDDVTELMEYLGPRTPDQKVIAVPGSD
FT                   TNVPIWLLGSSLFSAQLAGMRGLPYAFASHFAPRYMHEAIRVYRNHFQPSAVLDKPYVM
FT                   LGVPLSAADTDEHAEYLATSVYQRILALMRGHSLMQRPPVESMDGLWLPHEREAVASFL
FT                   GLAMVGGPDKIRAKLDVLLEQTDADELIFTCDMYEHEDRLRSYEILAQVAQG"
FT   gene            46051..46482
FT                   /gene="osmC"
FT                   /locus_tag="PSPPH_0042"
FT                   /note="PSPPH0042"
FT   CDS_pept        46051..46482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PSPPH_0042"
FT                   /product="hydroperoxide resistance protein OsmC"
FT                   /EC_number="1.11.1.-"
FT                   /note="identified by similarity to PDB:1QWI_A.0; match to
FT                   protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36219"
FT                   /db_xref="GOA:Q48QG0"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QG0"
FT                   /protein_id="AAZ36219.1"
FT                   /translation="MSIVKKASAHWEGDLKNGIGSISTETGVLKEAPYGFKARFEGGKG
FT                   TNPEELIGAAHAGCFSMALSMILGGAGLTAESIDTQADVTLNQIEGGFEISAVHLTLKA
FT                   KVPGATQEKFDELTKQAKEGCPVSKVLNAKITLDATLLS"
FT   gene            46601..46834
FT                   /locus_tag="PSPPH_0043"
FT                   /note="PSPPH0043"
FT   CDS_pept        46601..46834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0043"
FT                   /product="Protein of unknown function (DUF1161)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06649"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37730"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF9"
FT                   /protein_id="AAZ37730.1"
FT                   /translation="MKRFILAVTCTLLATSALAAPKSCEELKDEIEAKIQANNVTSYTL
FT                   EIVSNEEASDPSMIVGSCDNGTKKIIYQLNGR"
FT   gene            complement(46835..47269)
FT                   /locus_tag="PSPPH_0044"
FT                   /note="PSPPH0044"
FT   CDS_pept        complement(46835..47269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0044"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37471"
FT                   /db_xref="GOA:Q48QF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF8"
FT                   /protein_id="AAZ37471.1"
FT                   /translation="MPNRLLILITALTLATLAGCAGPLPTVNPDMAWVEMRTVTGQLIM
FT                   GDKLDGENTYDGRYFQVTPGSHELQVRYDYEYRSGGMGMIGDEYTEITCYVSVRYDHFA
FT                   AGQRYVLEVRSLANSVDAWLYDAERKMVAEEEEEGGVHCI"
FT   gene            complement(47286..47579)
FT                   /pseudo
FT                   /locus_tag="PSPPH_0045"
FT                   /note="PSPPH0045; Protein of unknown function (DUF1526)
FT                   family, interruption-C; this region contains one or more
FT                   premature stops and/or frameshifts which are not the result
FT                   of sequencing error; identified by match to protein family
FT                   HMM PF07512"
FT   gene            47647..48906
FT                   /locus_tag="PSPPH_0046"
FT                   /note="PSPPH0046"
FT   CDS_pept        47647..48906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0046"
FT                   /product="ISPsy18, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34994"
FT                   /db_xref="GOA:Q48QF7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF7"
FT                   /protein_id="AAZ34994.1"
FT                   /translation="MPTKKKSANATARELPSIPQERIEQFVKGPMSAEAIQDASMAFKK
FT                   ALIERALGAELGHHLGYPQGAERPKESTNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFA
FT                   PILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEV
FT                   GAWQQRPLEPMYPVIFFDALRVKIRDEGLVCNKAIYLALGVLPDGTRDILGIWIESTEG
FT                   AKFWMKVFNDLKTRGVEDVLIAVTDGLKGIPEALGAVFPATTLQTCIVHLIRNSLDYAA
FT                   WDKRRALAKALKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVF
FT                   PAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDW
FT                   KVAMNQFAILYGDRFTRPSW"
FT   gene            complement(48887..49336)
FT                   /pseudo
FT                   /locus_tag="PSPPH_0047"
FT                   /note="PSPPH0047; Protein of unknown function (DUF1526)
FT                   family, interruption-N; this region contains one or more
FT                   premature stops and/or frameshifts which are not the result
FT                   of sequencing error; identified by similarity to
FT                   GB:BAA87659.1; match to protein family HMM PF07512"
FT   gene            49624..50679
FT                   /locus_tag="PSPPH_0048"
FT                   /note="PSPPH0048"
FT   CDS_pept        49624..50679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34643"
FT                   /db_xref="GOA:Q48QF6"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF6"
FT                   /protein_id="AAZ34643.1"
FT                   /translation="MATFSLPRLRHLPALTVVTLLAGCSSVSYYGQLAQGQWQLLQARE
FT                   PVEKIVADPTRDAGLRQHLARSQLARTFASEHLHLPDNKSYRLYADLGRPYVVWNVFAT
FT                   DEFSLEPVTHCFPIAGCVAYRGYYSPGGARGEAALQRQAGKDVYLSGVEAYSTLGWFND
FT                   PILSSMMGWGDERLATLIFHELAHQRFYVKDDTEFNESYASFVEQEGTRQWRAARGLPP
FT                   ESVSQSARRDQFIRLVLDTRERLKALYRQPLSAEVMRARKAEEFERLRSDYRTLRDEQW
FT                   AGDKRFDAWINSPMNNAKLLPFGLYDQWVPAFAALFRQVNGDWVAFFNAVEKLGGLPVE
FT                   ARKAALQRLMP"
FT   gene            complement(50864..52123)
FT                   /locus_tag="PSPPH_0049"
FT                   /note="PSPPH0049"
FT   CDS_pept        complement(50864..52123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0049"
FT                   /product="ISPsy18, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33223"
FT                   /db_xref="GOA:Q48QF5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF5"
FT                   /protein_id="AAZ33223.1"
FT                   /translation="MPTKKKSANATARELPSIPQELIEQFVKGPMSAEAIQDASMAFKK
FT                   ALIERALGAELGHHLGYPQGAERPKESTNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFA
FT                   SILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEV
FT                   GAWQQRPLEPMYPVIFFDALRVKIRDEGLVCNKAIYLALGVLPDGTRDILGIWIESTEG
FT                   AKFWMKVFNDLKTRGVEDVLIAVTDGLKGIPEALGAVFPATTLQTCIVHLIRNSLDYAA
FT                   WDKRRALAKALKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVF
FT                   PAGIRKVVYMTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDW
FT                   KVAMNQFAILYGDRFTRPSW"
FT   gene            complement(52202..52747)
FT                   /locus_tag="PSPPH_0050"
FT                   /note="PSPPH0050"
FT   CDS_pept        complement(52202..52747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0050"
FT                   /product="bacterial transferase hexapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33259"
FT                   /db_xref="GOA:Q48QF4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF4"
FT                   /protein_id="AAZ33259.1"
FT                   /translation="MAIRKFQDHTPALGERAFVDHSAVVIGDVEIGADSSVWPLTVVRG
FT                   DMHRIRIGARTSVQDGSVLHITNAGPFNPDGFPLLIGDEVTIGHKAMLHGCTIGNRILV
FT                   GMGTTIMDGAVVEDEVIIGAGSLVPPGKVLESGFLYVGRPVKQVRALTDKEIAFFPYSA
FT                   TNYVKLKDQHLAEGFDKA"
FT   gene            52824..54911
FT                   /gene="prlC"
FT                   /locus_tag="PSPPH_0051"
FT                   /note="PSPPH0051"
FT   CDS_pept        52824..54911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PSPPH_0051"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.21.63"
FT                   /note="identified by match to protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37720"
FT                   /db_xref="GOA:Q48QF3"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF3"
FT                   /protein_id="AAZ37720.1"
FT                   /translation="MVGCFFQPRCKTVSANNPLLQSYDLPPFSAIRAEHVKPAVEKILA
FT                   DNRAAIADILAKQGSTPTWAGLVLTMDELNDRLGAAWSPVSHLNAVCNSAELREAYESC
FT                   LPALSAYSTEMGQNRALFQAYEALANGPEAATFDVGQKTILEQSLRDFRLSGIDLPPEQ
FT                   QKRYAEVQSKLSELGSQFSNQLLDATQAWTKLVADESALAGLTDSAKQQMAAAAKAKDL
FT                   EGYLITLEFPSYYAVMTYAEDRALREEVYAAYCTRASDQGPNAGKNDNTPVMEQILDLR
FT                   QELAQLLGYANFAELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLEQLKAYAAEQGC
FT                   PDLQSWDSGFYGEKLREQRYSVSQEILRAYFPIDKVLGGLFAIVQRLYGIEIAEQKGFD
FT                   TWHPDVRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAEGTLQSPVANLV
FT                   CNFTPAVAGKPALLTHDEVTTLFHEFGHGLHHLLTRIDHAGVSGINGVAWDAVELPSQF
FT                   MENWCWEPEGLALISGHYETGEPLPQDLLEKMLAAKNFQSGLMMVRQLEFSLFDFELHA
FT                   THGDGRSVLEVLEGIRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADA
FT                   FSKFEEDGVLNAETGRAFREAILARGGSQAPMVLFVDFRGREPSIDALLRHSGLSEDAA
FT                   A"
FT   gene            54908..55195
FT                   /locus_tag="PSPPH_0052"
FT                   /note="PSPPH0052"
FT   CDS_pept        54908..55195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02443"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37183"
FT                   /db_xref="GOA:Q48QF2"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF2"
FT                   /protein_id="AAZ37183.1"
FT                   /translation="MTDTPVIITKKRFIAGAVCPACSEPDKLMMWSENDVPHRECVGCC
FT                   YSDTLNEQGISIPKELGTRVNKVVVKPADPKVQGVQFFPNPKLKKPVDPE"
FT   gene            complement(55283..55510)
FT                   /locus_tag="PSPPH_0053"
FT                   /note="PSPPH0053"
FT   CDS_pept        complement(55283..55510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36646"
FT                   /db_xref="GOA:Q48QF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF1"
FT                   /protein_id="AAZ36646.1"
FT                   /translation="MAKYEIRLWAEDIEQHNHPVIAIQFYEDDDLQEQAWVRLHPHGNH
FT                   KIFGELGRDEEVLTVLALAFRKKVAELADW"
FT   gene            complement(55725..57623)
FT                   /locus_tag="PSPPH_0054"
FT                   /note="PSPPH0054"
FT   CDS_pept        complement(55725..57623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0054"
FT                   /product="lead uptake protein, putative"
FT                   /note="identified by match to protein family HMM PF00034;
FT                   match to protein family HMM PF03239"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35762"
FT                   /db_xref="GOA:Q48QF0"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QF0"
FT                   /protein_id="AAZ35762.1"
FT                   /translation="MPLRFRFLAWLLIPLLALCSGVTLADPVEGAAQALHLLDYLGADY
FT                   PATVADGKVVNSAEYQQQVDNLAALQSLVVALPQRAERADLERAVTQLKSAVAGRQDGA
FT                   QVARQARQLSAKLALAYEVSQAPAITPDPARGAPLYAQHCSVCHGDSGAGDGPAGIGLE
FT                   PPPSNLRDTARLDRLSLYDLYNATGLGIAGTDMPAFADQLDDRQRWDIATYIASFSAQP
FT                   VANPAKTFNIADLARQTPAEVQAAEGADASAIFRVQRAQPPQVQRGPAQLLDYTSVTLD
FT                   KSLAAYKAGDREQAYDLSVAAYLEGFELVESSLDNVDANVRKDTEKSLMAYRQSLQDSM
FT                   PLPQVAQKLEAAKGKLKESADLLGSDGLSLSLSYVSGLLILLREGLEAILVLAAILAFL
FT                   RNTGQQSAVRSVNIGWGLALLAGLGTWALAAYVIDVSGAQRELLEGATALFASVMVLWL
FT                   GVWMHDRRHAAAWQDYVKSSLVGGGGRFGFAVLAFFSVYRELFEVILFYETLWLQAGPA
FT                   GHDAVLAGGATALVLLVGLAWVILRGSAKLPLSLFFGINAALLCALSVVFAGHGVKALQ
FT                   EAGIFGTRPVPFFEFDWLGIHADLYSLSAQAIALIAIAVLYGRSRLAEKRRLQAAG"
FT   gene            complement(57785..58417)
FT                   /locus_tag="PSPPH_0055"
FT                   /note="PSPPH0055"
FT   CDS_pept        complement(57785..58417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0055"
FT                   /product="homoserine/homoserine lactone efflux protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34921"
FT                   /db_xref="GOA:Q48QE9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QE9"
FT                   /protein_id="AAZ34921.1"
FT                   /translation="MALETWLGFFAACWIISLSPGAGAIASMSCGLQYGFLRGYWNALG
FT                   LQIALVAQIAIVAAGLGAVLAASEMAFTLIKWFGVAYLVYLCIKQWRALPADLGDESAV
FT                   RPVGKPMTLVIRGFLVNISNPKALIFMLAILPQFIEPAAPLLIQYVIIAATMVVVDLIV
FT                   MAGYTGLASKVLRMLKTPRQQRRLNRTFASLFVGAAGFLATLHRGTA"
FT   gene            complement(58485..59078)
FT                   /locus_tag="PSPPH_0056"
FT                   /note="PSPPH0056"
FT   CDS_pept        complement(58485..59078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35296"
FT                   /db_xref="GOA:Q48QE8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QE8"
FT                   /protein_id="AAZ35296.1"
FT                   /translation="MDMLGLPVSAYWLEPLLVGAQILLILLAGYVLQRIVGGFLTGLGE
FT                   RYPLPPELLVPVRGGLRWLIMGSAFVLVLGRLGVSATVLWTALSGFVAVAAVAFFAMWS
FT                   VLSNLLCAILIFTIGPFRIGDMVELVDTLDKPGVKGRVVAINLMFTTLIETPEAGGALV
FT                   QVPNSQFFQKSVRRWRGSDLFPQMVVAKQPDEQD"
FT   gene            complement(59095..61050)
FT                   /locus_tag="PSPPH_0057"
FT                   /note="PSPPH0057"
FT   CDS_pept        complement(59095..61050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0057"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33801"
FT                   /db_xref="GOA:Q48QE7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QE7"
FT                   /protein_id="AAZ33801.1"
FT                   /translation="MIHLFRTKLVDSAAIMIRLQSLTLQRGPQRLLEDAELTLHAGHKA
FT                   GLIGANGAGKSSLFALLRGELTPDAGDCLLPADWRIAHMRQEVDTLERLGVDYVLDGDE
FT                   RLREVQRLLAEAEAAQDGAAQARLHSELDSADGYTADARARKLLAGLGFTNEQMERQVG
FT                   SFSGGWRMRLNLAQALMCPSDLLLLDEPTNHLDLDAILWLEDWLKSYPGTLLLISHDRD
FT                   FLDAVVDHIAHVEQRKITLYRGGYSAFERARAERLAQQQQAYEKQQAQRAHMEKYIARF
FT                   KAQATKARQAQSRIKALERMEELSAAHVDSPFNFVFRESDKISSPLLDLSDARLGYGDK
FT                   TILEKVKLQLTPGARIGLLGPNGAGKSTLIKNLAGELEPQSGRLVRGENLTVGYFAQHQ
FT                   LDSLDAKATPLLHLQRLAPTEREQTLRDFLGGFDFRGARLDEPVLNFSGGEKARLALAL
FT                   IAWEKPNLLLLDEPTNHLDLEMRLALTMALQEFGGAVLVVSHDRHLLKSTTDDFLLVAD
FT                   GRVQEFDGDLDDYTRWLADYRLRNAPVSATPVNADKTDKKAQRQQAAALRQQLAPHKRE
FT                   ADKLERDLGLVNEKLAKVEEALADSTNYEAANKDKLRDLLAEQAKLKVRESELEDAWMQ
FT                   ALELLESMQAELEALS"
FT   gene            61052..61528
FT                   /locus_tag="PSPPH_0058"
FT                   /note="PSPPH0058"
FT   CDS_pept        61052..61528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02444"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34085"
FT                   /db_xref="GOA:Q48QE6"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QE6"
FT                   /protein_id="AAZ34085.1"
FT                   /translation="MPSALWSFTLDFYARPGVEQACLTLQANGANVCMVLCGVWLGTRE
FT                   VECNAQRLTQIRQLATPWHDEVVRPLRDLRNQWRNAALEDAVLMTLRMKVKALELEAEQ
FT                   SLMLKLEALAGDWPAGEARSAEEWLIELADGEAEKNRDALQVLRIAVDLAVDQT"
FT   gene            complement(61525..62550)
FT                   /gene="algR3"
FT                   /locus_tag="PSPPH_0059"
FT                   /note="PSPPH0059"
FT   CDS_pept        complement(61525..62550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algR3"
FT                   /locus_tag="PSPPH_0059"
FT                   /product="alginate regulatory protein AlgR3"
FT                   /note="identified by similarity to SP:P15276"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37107"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QE5"
FT                   /protein_id="AAZ37107.1"
FT                   /translation="MSAKKKPVNTPLHLLQQLSGSLLEHLEDACSQALADAEKLLAKLE
FT                   KQRGKAQEKLHNSRIKLQDAATAGKSKAQAKAKDAVSELEELLDALKDRQTETRTYILH
FT                   LKRDAQESLKLAQGIGRVKEAVGKILTTRNAKPAAPKAAAKAGTAATAKAPAKTAVKAA
FT                   AAKPVAKTAAKPSSVAKPAAKPAATKAPVKAAAKPATRAAAAAKPAAAKTAAAKPVTAK
FT                   PAATRPAAKAAAAKAPVAKTTASSAAKPAAAKTPVAKPAAKAPVKAPAKAATKAPVKAP
FT                   VKAAAKPVAKPAAKPAAKPTAAKPATPAPAAAAKPTTPAPAAPSAAPATPANGATPTSA
FT                   S"
FT   gene            62767..63447
FT                   /locus_tag="PSPPH_0060"
FT                   /note="PSPPH0060"
FT   CDS_pept        62767..63447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0060"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF01346"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37936"
FT                   /db_xref="GOA:Q48QE4"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QE4"
FT                   /protein_id="AAZ37936.1"
FT                   /translation="MSRYLLTSLFLLLPLAQAAEAPPAAADDGHDLAYSLGASLGERLH
FT                   QEVPDLDLKALVDGLKQAYQGKPLALKQERIDQVLREHDAAIAQAETAGTDAPTEAALK
FT                   AERTFMDSEKAKPGVKVLADGILMTELTPGTGPKPDANGRVEVRYVGRLPDGTIFDQST
FT                   QPQWFRLDSVISGWTSALQTMPTGAKWRLVIPSDQAYGAEGAGDLIDPFTPLVFEIELI
FT                   AVSQ"
FT   gene            complement(63528..64001)
FT                   /gene="algQ"
FT                   /locus_tag="PSPPH_0061"
FT                   /note="PSPPH0061"
FT   CDS_pept        complement(63528..64001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algQ"
FT                   /locus_tag="PSPPH_0061"
FT                   /product="alginate regulator AlgQ"
FT                   /note="identified by similarity to SP:P15275; match to
FT                   protein family HMM PF04353"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35996"
FT                   /db_xref="GOA:Q48QE3"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QE3"
FT                   /protein_id="AAZ35996.1"
FT                   /translation="MLESCQNAQERWGGVNKLIDRWLQSRLELVEAYDALGDTPQALAA
FT                   DREGLQNFCGVLVDYVSAGHFEVYEQLGDEARAFNDERGLELADTIYPRLDVITKFALT
FT                   FNDRCDKGDCSDATVVAKEFNQLGQLLHERFELEDCLIEVLHNSHKEEIAAQV"
FT   gene            complement(64019..64171)
FT                   /locus_tag="PSPPH_0062"
FT                   /note="PSPPH0062"
FT   CDS_pept        complement(64019..64171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35514"
FT                   /db_xref="GOA:Q48QE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QE2"
FT                   /protein_id="AAZ35514.1"
FT                   /translation="MYELYLLRTLKALSSGHNLARTRHWKYAVLAHLSGQVQANRQDRP
FT                   RTACP"
FT   gene            complement(64176..64763)
FT                   /locus_tag="PSPPH_0063"
FT                   /note="PSPPH0063"
FT   CDS_pept        complement(64176..64763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0063"
FT                   /product="DsbB family protein"
FT                   /note="identified by match to protein family HMM PF02600"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34398"
FT                   /db_xref="GOA:Q48QE1"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QE1"
FT                   /protein_id="AAZ34398.1"
FT                   /translation="MNAPYPFLYRNRLVLCYGFAMYLARTRFLFFLASLACASIIGTAF
FT                   YLQQTFGLDPCFLCLIQRAAIIACGVLALCAACHAPGPTGMRRYSLGFLLIALTGLVTA
FT                   GAQVWLQTASADQLIPFITKLEHLLSLLSLDMCIDRLRSDAMFCAEITWTLFGISLPEW
FT                   SLLAFTGLALLPLYPLFSEFSHWLATKDRARY"
FT   gene            complement(64920..66164)
FT                   /locus_tag="PSPPH_0064"
FT                   /note="PSPPH0064"
FT   CDS_pept        complement(64920..66164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0064"
FT                   /product="hemY protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07219; match to protein
FT                   family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ32972"
FT                   /db_xref="GOA:Q48QE0"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QE0"
FT                   /protein_id="AAZ32972.1"
FT                   /translation="MKRFYVLLFIAIAAAALIGVAIAEHSGYVLIAYQNFRYESSLWAT
FT                   LALLVAVLLVIALLRLVITLLTTSGRVVNPWSRRNRRRRVQLAIEHGQMDLAEGRWASA
FT                   QRHLQRAAEADAHPLLYYIGAARAANEQGRYEDCDALLERALERQPQAELAIALNHAQL
FT                   QQDRGDTEGALTTLLAMKERHPHNPQVLRQLQRLYQQRGDWSDVVRLMPELRKDKVLPA
FT                   KELAELERRAWGENLTLAAYRDGIEGSPTGLPSLESAWQGLGSAQRQEPQLVLAYADQL
FT                   RRLGAEAQAEEVLRSALKREYNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLLL
FT                   SLGRICLQGRLWGKARDYLESSLRLERNPETCAELARLLAQLGETDRSNTLFQEGLGLL
FT                   DERFLSRPVPVLTKA"
FT   gene            complement(66161..67300)
FT                   /locus_tag="PSPPH_0065"
FT                   /note="PSPPH0065"
FT   CDS_pept        complement(66161..67300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0065"
FT                   /product="uroporphyrin-III C-methyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF04375"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33638"
FT                   /db_xref="GOA:Q48QD9"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QD9"
FT                   /protein_id="AAZ33638.1"
FT                   /translation="MQRMGYVSETALPKDEESVLKTPAPKPDPVRAERTGSRSSGLVFL
FT                   ALLLGIAGVAVAGWGVWQLRMLQAGHQQQRGQVEDIAEQTLVLAQNDQQLSARLAQFPP
FT                   ADQLADSRRLVAQLQGDQQRLSQRLETVLGASRKDWRLAEAEHLLRLASLRLSALQDIN
FT                   SAQALVQGADEILREQDDPGSFAAREQLAKSLAALRSVEQPDRTGLFLQLAALREQAEQ
FT                   LNKLAPEYEDKGESLLGLTADKTEQSRWTQWWDEISHYFRIDFNADKDIRPVLAGQSLS
FT                   QVRLALSLALEQAQWAALNGEPQVYTKAITEAQSVLKANFDQDDPQSKVLAQGLEALAN
FT                   QPVSVKTPDLAQSLSSVQAYLERRHAAGQPAEAQQGTSR"
FT   gene            complement(67336..68109)
FT                   /gene="hemD"
FT                   /locus_tag="PSPPH_0066"
FT                   /note="PSPPH0066"
FT   CDS_pept        complement(67336..68109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="PSPPH_0066"
FT                   /product="uroporphyrinogen-III synthetase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36837"
FT                   /db_xref="GOA:Q48QD8"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QD8"
FT                   /protein_id="AAZ36837.1"
FT                   /translation="MSTWRLLLTRPAEESAALAKVLAEAGIFSSSLPLLETEPLPLTPA
FT                   QRSIIFELLNYCAVIVVSKPAARLAIELIDEVWPQPPMQPWFSVGSATGQILLDYGLDA
FT                   SWPEQGDDSEALLELPRLKQAIAVPGSRVLIMRGDEGRELLAEQLRALGVGVDYLPLYR
FT                   RYLPEHAPDAVPQRVAVERLNGLVVSSGQGFEHLLQLAGDSWPDLADLPLFVPSPRVAS
FT                   IAQAAGARTVIDCRGASATALLAALRDQPQPAVKA"
FT   gene            complement(68106..69092)
FT                   /gene="hemC"
FT                   /locus_tag="PSPPH_0067"
FT                   /note="PSPPH0067"
FT   CDS_pept        complement(68106..69092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="PSPPH_0067"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="identified by match to protein family HMM PF01379;
FT                   match to protein family HMM PF03900; match to protein
FT                   family HMM TIGR00212"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37910"
FT                   /db_xref="GOA:Q48QD7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QD7"
FT                   /protein_id="AAZ37910.1"
FT                   /translation="MSCYYPSHSLSTDCSMSSREIRIATRKSALALWQAEYVKARLEQA
FT                   HPGLLVTLVPMVSRGDKLLDSPLSKIGGKGLFVKELETALLEDNADIAVHSMKDVPMDF
FT                   PQGLGLFCICEREDPRDAFVSNTFASLDELPAGSIVGTSSLRRQAQLLARRPDLQIRFL
FT                   RGNVNTRLAKLDAGEYDAIILAAAGLIRLGFENRITSAISVDDSLPAGGQGAVGIECRS
FT                   VDAEIHALLAPLHHEDTAVRVIAERSLNKHLNGGCQVPIACYAVLEGDDVWLRGLVGDP
FT                   AGSVLLHAEARAPQTSAQALGVQVAEALLAQGAADILKAVYGEANNE"
FT   gene            69120..69218
FT                   /locus_tag="PSPPH_0068"
FT                   /note="PSPPH0068"
FT   CDS_pept        69120..69218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37877"
FT                   /db_xref="GOA:Q48QD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QD6"
FT                   /protein_id="AAZ37877.1"
FT                   /translation="MKLASDTEPINQSAVAEGRMGKAARRPAEKHM"
FT   gene            complement(69280..70026)
FT                   /gene="algR"
FT                   /locus_tag="PSPPH_0069"
FT                   /note="PSPPH0069"
FT   CDS_pept        complement(69280..70026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algR"
FT                   /locus_tag="PSPPH_0069"
FT                   /product="alginate biosynthesis regulatory protein AlgR"
FT                   /note="identified by similarity to GB:AAD31823.1; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35798"
FT                   /db_xref="GOA:Q48QD5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QD5"
FT                   /protein_id="AAZ35798.1"
FT                   /translation="MNVLIVDDEPLARERLSRMVNEIEGYRVLEPSASNGEEALALIET
FT                   HKPDVVLLDIRMPGLDGLQVAARLCEREAPPAVVFCTAHDEFALEAFQVSAVGYLVKPV
FT                   RSEHLVEALRKAERPNRVQLAALTRPAAESGSGPRSHISARTRKGIELIPLDQVIYFIA
FT                   DHKYVTLRHEGGEVLLDEPLKALEDEFGDRFVRIHRNALVARERIERLQRTPLGHFQLF
FT                   LRGLNGDALIVSRRHVAGVRKMMQQL"
FT   gene            complement(70023..71105)
FT                   /gene="fimS"
FT                   /locus_tag="PSPPH_0070"
FT                   /note="PSPPH0070"
FT   CDS_pept        complement(70023..71105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimS"
FT                   /locus_tag="PSPPH_0070"
FT                   /product="sensor histidine kinase FimS"
FT                   /note="fimS, which was also named algZ by Yu et al (1997),
FT                   is distinct from the algZ described by Baynham and Wozniak
FT                   (1999).; identified by similarity to GB:AAC44751.1; match
FT                   to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35859"
FT                   /db_xref="GOA:Q48QD4"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QD4"
FT                   /protein_id="AAZ35859.1"
FT                   /translation="MRIEPVKHEARPVPGKDFFLPEPCLPQALLVLVVLAELLVLVLVL
FT                   VEPMRTGFDWVRLALMSLFVQWIVLLSAALLCGLRPWLARLTPGLAGMLSCLLVVGLTL
FT                   LCTAVTDVCQLTGRISIGGMVERYLRYSTIALIMSALMLRYFYLQSQWRKQQQGELRAR
FT                   IESLQARIRPHFLFNTLNSIASLVASNPVKAEQAVLDLSDLFRASLAKPGSLVTWGEEL
FT                   ALAKRYLSIEQYRLGERLQLDWRVSAIPDDLPIPQLTLQPLLENALIYGIAPRVEGGVV
FT                   TVEANYEGGEFILSVNNPYEEVANRQTSNGTQQALTNIGARIAALFGPHASLSVERRDG
FT                   RHYTCLRYPCARLTQEARAI"
FT   gene            71239..72633
FT                   /gene="argH"
FT                   /locus_tag="PSPPH_0071"
FT                   /note="PSPPH0071"
FT   CDS_pept        71239..72633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="PSPPH_0071"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37507"
FT                   /db_xref="GOA:Q48QD3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QD3"
FT                   /protein_id="AAZ37507.1"
FT                   /translation="MSTDKTNQSWGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIA
FT                   HATMLAKVGVLTDAERDTIVDGLNTIQAEIEAGNFEWRVDLEDVHMNIEARLTDRIGIT
FT                   GKKLHTGRSRNDQVATDIRLWLRDEIDLILSEITRLQQGLLGQAEREAETIMPGFTHLQ
FT                   TAQPVTFGHHMLAWFEMLSRDYERLVDCRKRLNRMPLGSAALAGTTYPIDRELTCKLLG
FT                   FDVVGGNSLDGVSDRDFAIEFCSAASIAMMHLSRFSEELVLWTSAQFQFIDLPDRFCTG
FT                   SSIMPQKKNPDVPELVRGKSGRVFGALMGLLTLMKGQPLAYNKDNQEDKEPLFDAADTL
FT                   RDSLRAFADMIPAIKPRHAIMREAALRGFSTATDLADYLVRRGLPFRDCHEIVGHAVKY
FT                   GVETGKDLAEMSLEELRQFSNQIEQDVFAVLTLEGSVNARNHIGGTAPEQVRAAVVRGQ
FT                   ELLAGR"
FT   gene            73092..74333
FT                   /locus_tag="PSPPH_0072"
FT                   /note="PSPPH0072"
FT   CDS_pept        73092..74333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0072"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37298"
FT                   /db_xref="GOA:Q48QD2"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QD2"
FT                   /protein_id="AAZ37298.1"
FT                   /translation="MLNGLWLGFFVVATISALVQWLVGGNAGIFAAMVESIFAMAKLSV
FT                   EVMVLLFGTLTLWLGFLRIAEKAGIVDWLAKVLGPLFLRLMPEVPPGHPALGLITLNFA
FT                   ANALGLDNAATPIGLKAMRSLQELNPSKTAASNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAPDPTLVFLPILLATSVSTIVGLLSVAFMQRLRLWDPVVLAYLIPGALLLGTFMAFL
FT                   GTLSAAALAGLSSILGNLTLFGLIMMFLIIGTLRKVLVYEAFVEGAKEGFDVAKSLLPY
FT                   LVAMLCAVGVLRASGALDFGLEGIRHVVQWLGLDTRFVDALPTAMVKPFSGSAARALLI
FT                   ETMQTQGVDSFAALAAATIQGSTETTFYVLAVYFGAVGIQRARHAVGCALLAEFSGVVA
FT                   AIFVCYWFFGATAT"
FT   gene            complement(74338..75561)
FT                   /locus_tag="PSPPH_0073"
FT                   /note="PSPPH0073"
FT   CDS_pept        complement(74338..75561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0073"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33904"
FT                   /db_xref="GOA:Q48QD1"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QD1"
FT                   /protein_id="AAZ33904.1"
FT                   /translation="MYEQNRVNPRMFDVNRYVTPVLNLMQRYPGLIAAFGFVSGIASFI
FT                   LVDRQAGLATWIAVVMLISWLWLMVENTMVGLLNKALGREIPQGLLRYGTQMIHQESLF
FT                   FVLPFFFITTTWNSGQAVFTAVLGAAGLISIIDPLYYKWLAPRRWLFMTLHTLTLFAAL
FT                   LTALPIILHLTTAESYKLALGVAMVLSAPSLMSNFPLNTWRSALAVISIILAIGAAGWL
FT                   LRSWVPPATLWLTEVAVSPDFDNKNRTPGDSISLISAKQLRNGGLYAYTAINAPRGLDE
FT                   RIYHVWWHEGEEMDRIALDIHGGRKEGYRAWTRKQNFPEDVTGRWQVRVLTEDGQMIGV
FT                   LRFVVTDNDQPAVKRPTGRIIKLKPGGDSAEETTPESAPADGPKQEKQEAAPAEAAPAE
FT                   SAPQAPAQ"
FT   gene            complement(75628..77004)
FT                   /locus_tag="PSPPH_0074"
FT                   /note="PSPPH0074"
FT   CDS_pept        complement(75628..77004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0074"
FT                   /product="peptidase, M16 family"
FT                   /note="identified by match to protein family HMM PF00675;
FT                   match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36652"
FT                   /db_xref="GOA:Q48QD0"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QD0"
FT                   /protein_id="AAZ36652.1"
FT                   /translation="MRCLLFACLLLGSLPSFALDRLQVEGYLLPNGLQVLLKPGSEKGH
FT                   VAIRLVVGIGFDDFPCQDKELPHLLEHLLFSGVDDSGEGGLEERMQALGGEWNAFTSNA
FT                   DTTFVIEAPARNQRKVLDLLLEIMTRTELSQARLDGVKRVVEREDGGHFSHLQRLLDRR
FT                   DSGRSASSQLAVELGLKCAERPEVDGIKLGHIEDVFANWYAPNNMTLIVVGDLDKLLPA
FT                   YLERTYGKLAPTDPIDHPPLAQSSGSAEPRRELERGGLGESAKLHLIYPEPQLDDQHDE
FT                   TWELVKAYLDWTLYTELRLKHSLSYGPSAEREVFGDVGFLSLNADVERDDADEAERDIR
FT                   NMVERLQKEGMQPATFARLQQLAIDRQSWATQGNSALADYYWSALNDYENGRFEDPAKR
FT                   IKAVKLETASQAIRQLLAQPGYMRIEKPLFSYDGLYWLIGGVLGLIALLAMWRWRVRNK
FT                   "
FT   gene            complement(77062..78714)
FT                   /locus_tag="PSPPH_0075"
FT                   /note="PSPPH0075"
FT   CDS_pept        complement(77062..78714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0075"
FT                   /product="Na/Pi cotransporter family protein"
FT                   /note="identified by match to protein family HMM PF02690;
FT                   match to protein family HMM TIGR00704; match to protein
FT                   family HMM TIGR01013"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35963"
FT                   /db_xref="GOA:Q48QC9"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QC9"
FT                   /protein_id="AAZ35963.1"
FT                   /translation="MLTLLDLLSAVALLIWGTHIVRTGILRVYGAQLRRLLSQNMSKRP
FT                   LAFIAGILVTAMVQSSNATAMLVTSFVGQGLMTLTPALVIMLGADVGTALMSRVLTFDL
FT                   SWLSPLLIFLGVVFFLSRKQTRAGQLGRVGIGLGLIVLALQLIVAAAAPITQAAGVKVL
FT                   FASLTGDLLLDALVGAMFALISYSSLAAVLLTATLAGTEVIGLPVAIGLVIGANIGSGL
FT                   LAFLSTSMQNVAGRQVDLGSLLYKLFGLLLIFPVLDPLVAWIDTLGFRPQELVIGFHLI
FT                   YNTLRCLIMLPTVGPMARLCAALLPQQNEVGGLAKPRHLDLTALSTPSLALANAVRETL
FT                   RMGDLIESMLGSMLAVLRGTQTAVTQEVRRLNDDVEALYSAIKLYLAQMPREDLGEHDN
FT                   RRWAEIIELTINLELASGLIERMLRKIQQQKTSHRRSFSEVGLEELADLHIQLQSNLRL
FT                   GLSVFLSGDEESARQLLREKRRFRAQERRLAHAHVSRLRQKVVQSIETSSLHLELIADM
FT                   KRLNSLFCSSAYVVLETADTGALSSESEPERSL"
FT   gene            complement(79986..81962)
FT                   /locus_tag="PSPPH_0076"
FT                   /note="PSPPH0076"
FT   CDS_pept        complement(79986..81962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0076"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35546"
FT                   /db_xref="GOA:Q48QC8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QC8"
FT                   /protein_id="AAZ35546.1"
FT                   /translation="MSKPRTRIASQLGIALAVILAVVISGSTLFALRSLDASNLVIREE
FT                   HMSSEARLLADQLSTFHSTLRDSTQRLSGLFEKRFAGGLSLQPDKPVTVAGTSTPGLFL
FT                   RDTALNNDFAEVDEFRSMTAGVATIFVRSGDDFVRISTSLSKQDGTRAIGTVLDRKGAA
FT                   YERLIAGQSYVGKAVLFDRYYMTQYSPVRDSSGKIIAALFVGFDYTDAHKTQFDNLKSF
FT                   RIGSTGSLALLDEKGTWLVPPAGVKSLDGAAKSVADLASKQGKAQFWNDGDDDYYSVGQ
FT                   PFAGGPWTVIASMPRDEISEVTWNVGTQLAIGSVLAMLIAVISAIWLLRSKLRPLSELV
FT                   RQADALGAGDLSVRLNVTSNDEIGQLSGSFNKMSEALSSMVSHIRTAAQEVSTRAHALS
FT                   GLSGGAFEGMEQQSGEITSMAGAVEEFSATSMNIADNMSNTERLAQENAQQTRIGRTSM
FT                   DEASSSLQQIATSLSSTATVIDTLGQRSQEIGSIVGVITSIADQTNLLALNAAIEAARA
FT                   GEQGRGFAVVADEVRSLASRTREATDEISGMIASIQQETGNAISTMQQGNTLMQEGLSL
FT                   NAKVASALAQIDEQSRSAGHQFAAITTATQEQSSTATMLSSNLQSIAMANSEQRQVMSN
FT                   LAVTAQELNGLATELRNEVDRFR"
FT   gene            complement(82147..83067)
FT                   /locus_tag="PSPPH_0077"
FT                   /note="PSPPH0077"
FT   CDS_pept        complement(82147..83067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0077"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37606"
FT                   /db_xref="GOA:Q48QC7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QC7"
FT                   /protein_id="AAZ37606.1"
FT                   /translation="MPRSLPPLYALRAFEAAARHTSFTRAAEELSITQSAVSRHIRTLE
FT                   DHFACRLFQRNGRNLQLTESARALLPGVRDGFLALERACSTLQTDEGILRMKAPSTLTM
FT                   RWLLARLSRFRHLQVGNEVQLTSAWMDIDAVDFTLEPFDCAILLSHGHFPSDWEATLLF
FT                   PELLIPVGAPTLLKDPPWDVKRLAKAELLHPTPDRRDWRTWLNRMGLADQVSLKGGQVF
FT                   DTLELGMIAAARGYGVSMGDLLMVAEDVAQARLSLPWRTAVFSGENYYLVWPRTRPGAE
FT                   RLRRLSDFLQTEVNAMELPLVEVLH"
FT   gene            83223..84602
FT                   /locus_tag="PSPPH_0078"
FT                   /note="PSPPH0078"
FT   CDS_pept        83223..84602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0078"
FT                   /product="multidrug resistance protein NorM, putative"
FT                   /note="identified by similarity to SP:P37340; match to
FT                   protein family HMM PF01554; match to protein family HMM
FT                   TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36782"
FT                   /db_xref="GOA:Q48QC6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QC6"
FT                   /protein_id="AAZ36782.1"
FT                   /translation="MQPALKELWIILRLAGPLIASQMAHMLMVFTDTVMMGKIGPEALA
FT                   GGGLGAATYSFVSFFCVGVMAAVGTLVAIRHGAGDTEGATRLTQAGLWLAWGMALVAAL
FT                   LLWNLEPILLQFGQAEANVHMAAQFLITLPFALPGLLSFMALRGFTSALGRAGPVMTIS
FT                   LAGAAANFVLNYAMIHQWLGLPNLGLMGIGLVTAIVTNCMALALALHIKRHPAYAAYPI
FT                   SKGLSKLSRSHLKELWRLGLPIGGTYAVEVGLFTFAAFCMGAMGSTQMAAHQIALQTVS
FT                   MAFMVPVGMSYAVTIRIGQHYGAGNLLMVRMAGRLGIGFGGCVMLMFGLLFWLAPNVVI
FT                   GLFLDINDPAFAEIVVLAAKLLAIAALFEFFDGTQTIAMGAIRGLKDARTTFLIGLGCY
FT                   WLIAAPAAWLLGFSTDAGASGVWWGLALGLFCSAVALTYAFEWKTARLLRREAAGLAVP
FT                   A"
FT   gene            complement(84615..86279)
FT                   /locus_tag="PSPPH_0079"
FT                   /note="PSPPH0079"
FT   CDS_pept        complement(84615..86279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0079"
FT                   /product="GGDEF domain/EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36272"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QC5"
FT                   /protein_id="AAZ36272.1"
FT                   /translation="MPTPVEPLRLLLLAHEPFWYALLRDCLTAPGSNVILLHGENWDAF
FT                   SAGYANERSTVLLTTPDLQPRTGTCLLLTVVLLEKEPLVGPSGVSDWLVRDALTGDALR
FT                   RCLRYVHERSRLEDSLRRLVGQDPLTGIANRQGFQALLTARLAEGGSLALGHLDLDNFR
FT                   RANDSLGHQAGDRLILQVVARLKNQLAAGDQLARLGGDEFALLIDTRTTPARAMQLAER
FT                   ITDVLSEPYWVDGESLLLGCSLGIAHSQTRPEADPLMWHAHIAMRQAKSMQGCTFHLFD
FT                   ERINRNARSLADLEGELRRALRRDELELHYQPRLCLETGRVVGLEALVRWRHQARGLLP
FT                   PSEFVPLAEQSGLIVPLGYWVIFRALRDMQALREQGFAPLHMAINLSFRQFQDSQLLPT
FT                   LSRLIEELSVDAHWLEFELTETAVMRRSDQVLQTMDAMRRLGVRFSLDDFGTGYSSFMH
FT                   LNSLPIALLKIDMGFVGQMELREENRKLVNAMIKLAHNLNLEVVAEGVETAGQLELLRD
FT                   FGCDQVQGYLISRPLPIADLVAYLRSEAANTGASNSG"
FT   gene            86485..88494
FT                   /gene="rep"
FT                   /locus_tag="PSPPH_0080"
FT                   /note="PSPPH0080"
FT   CDS_pept        86485..88494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="PSPPH_0080"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P09980; match to
FT                   protein family HMM PF00580; match to protein family HMM
FT                   TIGR01074"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35738"
FT                   /db_xref="GOA:Q48QC4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QC4"
FT                   /protein_id="AAZ35738.1"
FT                   /translation="MSRLNPRQQEAVNYVGGPLLVLAGAGSGKTSVITRKIAHLIQNCG
FT                   IRAQYIVAMTFTNKAAREMKERVGTLLRGGEGRGLTVSTFHNLGLNIIRKEHTRLGYKP
FT                   GFSIFDETDVKALMTDIMQKEYSGDDGVDEIKNMIGSWKNDLILPADALENARNPKEQT
FT                   AAIVYTHYQRTLKAYNAVDFDDLILLPVKLFQEHADILEKWQNKVRYLLVDEYQDTNAS
FT                   QYLLVKLLIGSRHQFTVVGDDDQSIYAWRGARPENLMLLKDDYPSLKVVMLEQNYRSTS
FT                   RILRCANVLISNNPHAFEKQLWSEMGHGDEIRVIRCRNEDAEAERVAMEILTLHLRTDR
FT                   PYSDFAILYRGNYQAKLIELKLQHHQVPYRLSGGNSFFGRQEVKDLMAYFRLLVNPDDD
FT                   NAFLRVINVPRREIGSTTLEKLGNYATERKVSMYAATEEIGLGEHLDSRYTDRLQRFKR
FT                   WMDGVRQQCAQNDPIAALRSMVMDIDYENWLRQNSSSEKAADYRMSNVWFLIEALKNTL
FT                   EKDEEGGMTIEEAIGKLVLRDMLERQQEEEDGAEGVQMMTLHASKGLEFPYVFIMGMEE
FT                   EILPHRSSIEADTIEEERRLAYVGITRARQTLAFTFAAKRKQYGEIIDCAPSRFLDELP
FT                   PDDLAWEGNDDTPTEVKAVRGNTALADIRAMLKR"
FT   gene            88548..89117
FT                   /gene="xpt"
FT                   /locus_tag="PSPPH_0081"
FT                   /note="PSPPH0081"
FT   CDS_pept        88548..89117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="PSPPH_0081"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01744"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37375"
FT                   /db_xref="GOA:Q48QC3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48QC3"
FT                   /protein_id="AAZ37375.1"
FT                   /translation="MEALHKKIREEGIVLSDQVLKVDAFLNHQIDPALMKEIGDEFARL
FT                   FADAGVTKIVTIEASGIAPAVMAGLNMGVPVIFARKHQSLTLTENLLSATVYSFTKQVE
FT                   STVAISPRHLSSDDHVLIIDDFLANGKASQALISIIKQAGATVAGLGIVIEKSFQGGRA
FT                   ELDAQGYRVESLARVESLAGGVVTFK"
FT   gene            complement(89366..90688)
FT                   /locus_tag="PSPPH_0082"
FT                   /note="PSPPH0082"
FT   CDS_pept        complement(89366..90688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0082"
FT                   /product="sigma-54 dependent transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33709"
FT                   /db_xref="GOA:Q48QC2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QC2"
FT                   /protein_id="AAZ33709.1"
FT                   /translation="MTLIATDLPGSRMQSLVSYLEHDLRPTIVLDTDYNIIAANTAYQR
FT                   QFGVEGTPHVGEKCYRVSHQFAVPCDQAGEHCPMRKAHDTRLPERLLHIHHTPRGPEHV
FT                   DVELRPILDDGGEVIAYVERLSSVAVASVQPQQHGLVGRSAAFKEVLSALQRAAPAQIP
FT                   VLLQGESGTGKELFARALHASSARSAGPLVVVDCTGLTETLLESELFGYEKGAFTGALQ
FT                   RKTGLAEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHSDFRLVMATH
FT                   KPLKEMVTNGSFRQDLFYRISAFPIRLPALRERSEDLPLLIDSLLQRIAPGAAPRVDAE
FT                   AMKLLSLYSYPGNIRELRNILERARLFTDDGVIRVQDLPAEVRGQGEEAGGVTYRQQDD
FT                   GLEKLAHALRVFNGSRSELARELGLSERTLYRRLRALGIPR"
FT   gene            90955..91839
FT                   /locus_tag="PSPPH_0083"
FT                   /note="PSPPH0083"
FT   CDS_pept        90955..91839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0083"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33023"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QC1"
FT                   /protein_id="AAZ33023.1"
FT                   /translation="MIIGEKLYVEALFDSHTWTISYLVMDLASKQCALIDSVLDYDPKS
FT                   GRTRTESADRMIGRVQALGASVQWIFETHVHADHLTAAPYLKQQLGGQIVIGSHITAVQ
FT                   ETFGALFNAPSDFARNGSQFDVLLEDNASFALGTLQVKAMHTPGHTPACMSYLVQVGDA
FT                   TVAFVGDTLFMPDYGTARCDFPGADARTLYRSIHKLLALPPDTLLFMCHDYLPNGRELK
FT                   YMTTVAEQRASNIHVHDGVDEDAFVSMREARDMTLDMPVLMLPSVQVNMRCGHFPEPED
FT                   NGVVYLKIPLNAF"
FT   gene            91867..93120
FT                   /locus_tag="PSPPH_0084"
FT                   /note="PSPPH0084"
FT   CDS_pept        91867..93120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0084"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by similarity to GB:AAN65687.1; match to
FT                   protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35149"
FT                   /db_xref="GOA:Q48QC0"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QC0"
FT                   /protein_id="AAZ35149.1"
FT                   /translation="MNASITTCQILIVGGGAAGIATAASLLARDAALQITLVDPADTHY
FT                   YQPGWTMVGAGIFTPQSTARSMASLIPKGVQWIKAAVATFEPQHNTLTLADGRTLGYQQ
FT                   LVACPGLKLDWAAIDGLVETLGANGVTSNYRYDLAPYTWKLVQGLKQGRALFTQPPMPI
FT                   KCAGAPQKAMYLSCDHWLKTGRLAQINTQFFNAGGVLFGVADYVPALMNYIERYAIDLK
FT                   FSHRLVAVDGPGKRATFVCTQADGSSETVEHSFEMLHVVPPQIAPDFIRSSPLADPAGW
FT                   VDVDPATLRHRQFANVHALGDATNTSNAKTAAAARKQAPVVANNVLVALGRLSESAVYD
FT                   GYGSCPLTVEKGRIVLAEFTYGGKVAPSFPRWLLDGRQPTRLAWWLKERVLPVLYWHGM
FT                   LKGREWLAKPEKADARHG"
FT   gene            93113..93925
FT                   /locus_tag="PSPPH_0085"
FT                   /note="PSPPH0085"
FT   CDS_pept        93113..93925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0085"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36490"
FT                   /db_xref="GOA:Q48QB9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB9"
FT                   /protein_id="AAZ36490.1"
FT                   /translation="MDEHQLLGVGLGAIIGVVLALTGAGGGILAVPLLVFGLGLSIVEA
FT                   APVGLLAVGLAAGIGAVLGLRQGIVRYRAAGYIASIGVLMAPLGLWLAHRLPNTPLALV
FT                   FSVVLLYACTRMFIRASRELRHGQPPPRAEMLPCVLNPLQGRLHWTMPCLRALTLTGVG
FT                   SGLLSGLLGVGGGFVIIPALTRYSDLSMKSVVATSLAVIALVSTGSVITASLSGVMHWT
FT                   VGAPFALGAVIGLIAGRQVARYLVGPRLQQLFALCGIVAAFMLALSVR"
FT   gene            complement(94167..95147)
FT                   /locus_tag="PSPPH_0086"
FT                   /note="PSPPH0086"
FT   CDS_pept        complement(94167..95147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0086"
FT                   /product="Sulfate/thiosulfate import ATP-binding protein
FT                   cysA(Sulfate-transporting ATPase)"
FT                   /EC_number="7.3.2.3"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00968"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37885"
FT                   /db_xref="GOA:Q48QB8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB8"
FT                   /protein_id="AAZ37885.1"
FT                   /translation="MSIEVRNVSKNFNAFKALNNISLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDDGSIVFHGEDVSGHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   RERPNETRIAEKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPSNDFVYHFLGDSNRLSLGEEGHLLFRPHEVSLSHQEIEDHHAAEVRDIRPLGA
FT                   TTRVTLKVEGQSELIEAEVVKDHDSLVGLAKGETLFFKPKVWQKL"
FT   gene            complement(95150..96022)
FT                   /gene="cysW"
FT                   /locus_tag="PSPPH_0087"
FT                   /note="PSPPH0087"
FT   CDS_pept        complement(95150..96022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="PSPPH_0087"
FT                   /product="sulfate ABC transporter, permease protein CysW"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02140"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37229"
FT                   /db_xref="GOA:Q48QB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB7"
FT                   /protein_id="AAZ37229.1"
FT                   /translation="MSYSSVSAAASANAARRGSAVSRRILIGLCWLVFFLFLGLPLFIV
FT                   VSQGLKNGLGAFFTAILEPDALSALKLTVIAVLISVPLNLVFGVSAAWCVSKYSFRGKS
FT                   ILVTLIDLPFSVSPVIAGLVYVLMFGAQGLFGPWLQDHDIQIVFALPGIVLATIFVTVP
FT                   FVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTVPNIKWGLIYGVVLCTARAMGEF
FT                   GAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFAVASLLLILALFILLLKQWSESRIN
FT                   RLRHNAAEE"
FT   gene            complement(96036..96857)
FT                   /gene="cysT"
FT                   /locus_tag="PSPPH_0088"
FT                   /note="PSPPH0088"
FT   CDS_pept        complement(96036..96857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PSPPH_0088"
FT                   /product="sulfate ABC transporter, permease protein CysT"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02139"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36459"
FT                   /db_xref="GOA:Q48QB6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB6"
FT                   /protein_id="AAZ36459.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLIVLIPLAAMFVHAAQLTWDQ
FT                   FWTIITAPRVIAALKLSFGTAFYAALINGVIGTLLAWVLVRYTFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPNGWVGQFAADLGFKIAYTPLGITLALTFVALPFVVRTVQPVLA
FT                   DIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVMMLVVSFILLLLINLLQRRIETPS"
FT   gene            complement(96952..97962)
FT                   /gene="sbp"
FT                   /locus_tag="PSPPH_0089"
FT                   /note="PSPPH0089"
FT   CDS_pept        complement(96952..97962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="PSPPH_0089"
FT                   /product="sulfate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34374"
FT                   /db_xref="GOA:Q48QB5"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB5"
FT                   /protein_id="AAZ34374.1"
FT                   /translation="MSIRRFALAALASAVFAGSAVAKDYELLNVSYDPTRELYQDYNAE
FT                   FVNFWKKSHPDDKVEIKQSHGGSGKQARGVIDGLRADVVTLALAGDIDEIAKLGKTLPE
FT                   NWQTRLPDASTPYTSTIVFLVRKGNPKGIKDWGDLIKKDVSVITPNPKTSGGARWNFLA
FT                   AWAYGLKAGGGDEAKAKEYVQTLFKHVPILDTGARGSTITFVNNGQGDVLLAWENEAFL
FT                   ALKEDGGKDKFDIVVPSLSILAEPPVAVVDKNAEKKGNTEIATEYLKHLYSKEGQEIAA
FT                   KNFYRPRDAEVAAKYEKQFPKLDLVTIDKDFGGWKTAQPKFFNDGGVFDQIYQAQ"
FT   gene            complement(98113..98295)
FT                   /locus_tag="PSPPH_0090"
FT                   /note="PSPPH0090"
FT   CDS_pept        complement(98113..98295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34899"
FT                   /db_xref="GOA:Q48QB4"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB4"
FT                   /protein_id="AAZ34899.1"
FT                   /translation="MSASLRSVDGQDEAAILREIQSALRDLRFGAVEITVHNAQVVQIE
FT                   RKEKFRLQNPAAKQS"
FT   gene            complement(98492..100420)
FT                   /locus_tag="PSPPH_0091"
FT                   /note="PSPPH0091"
FT   CDS_pept        complement(98492..100420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0091"
FT                   /product="sensory box-containing diguanylate cyclase,
FT                   putative"
FT                   /note="identified by similarity to GB:AAP85527.1; match to
FT                   protein family HMM PF00563; match to protein family HMM
FT                   PF00785; match to protein family HMM PF00989; match to
FT                   protein family HMM PF00990; match to protein family HMM
FT                   TIGR00229; match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33218"
FT                   /db_xref="GOA:Q48QB3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB3"
FT                   /protein_id="AAZ33218.1"
FT                   /translation="MSDYSLGALRTAVLYGLLSILWFVTCDLLLPFFIKEPARLAFWQL
FT                   MAGYSWVLLSAVMIFIARDRLRSLIGGDALFQRQQADYDRLRLAEAVFDSTREGVLVSD
FT                   AQGHIVHVNRAFVDITGYQAEEVLGLNPSKFKSGRHGPKFYKQMYHSIISEGQWSGEIW
FT                   NRRKSGEIYPQWQTIRSVMGDDGQPRHFVAVFSDITAIKRSEQELAQLIHFDGLTDLPN
FT                   RLLLTDRISQTLTSARASKRGCALLLIDLDHFKNINDSLGHNVGDDVLRAVAERLKSVS
FT                   GNEMTLARPGGDEFALLIKNCSQLVQAAALAQQVINALKAPFAIAAHQLFVTASIGISL
FT                   FPGDALTAEQLLRNADSALFKAKGDGRECYALYTEELTAHAQQRVQLAYELRQAVELEQ
FT                   LRVFYQPVHDLVTRRIRGVEALVRWQHPERGMVSPGEFIPIAEQSGLIADIDAWVLKTA
FT                   CLQMKAWLAEGVPVEFVAVNVSSRLFNHGDLDRRVAQALHETGLEPAFLELEVTESAVM
FT                   EDPEQAIEQLHRLRELGLSLAIDDFGTGYSSLLRLKRMPVQKLKIDQGFVAGLPGDDDD
FT                   IAIVRAVIALAGSLGMRVLAEGIEHANQAAFLLGNSCQLGQGYWFARPMVAQAIDWTHA
FT                   PVFEQPG"
FT   gene            100492..101760
FT                   /locus_tag="PSPPH_0092"
FT                   /note="PSPPH0092"
FT   CDS_pept        100492..101760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0092"
FT                   /product="fatty acid desaturase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33112"
FT                   /db_xref="GOA:Q48QB2"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB2"
FT                   /protein_id="AAZ33112.1"
FT                   /translation="MTGFLWNVSDNARVTFFFMSIFTRAKQPMCYNGLLDLSVWQVIAV
FT                   TLAMTHVTIVGVTVYLHRYSAHRSLELNAGLKHFFRFWLWLTTAQNTREWTAIHRKHHA
FT                   KCETVDDPHSPVVKGLSTVLRKGAELYREEAQNQDTLRIYGKNCPEDWIERNLYSRYKL
FT                   LGIALMAVIDVALFGALGITVWAVQMMWIPFWAAGVVNGLGHAVGYRNFECRDAATNLV
FT                   PWGIVIGGEELHNNHHTYPNSAKLSVKPWEFDMGWAWIKLFSFLGLAKVQRVAPIAHRV
FT                   EGKGHMDMDTAMAILNNRFQIMGQYRKLVIAPLVAQELAKADESVRHQFSRAKRLLSRE
FT                   TSLLDDKHHLRIQTMLEHSHALKVIYEKRLALQQIWVKTSSNGHDMLSAIKEWIHEAEA
FT                   SGIHSLREFADQLKTYSLRPAHA"
FT   gene            101938..102888
FT                   /locus_tag="PSPPH_0093"
FT                   /note="PSPPH0093"
FT   CDS_pept        101938..102888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0093"
FT                   /product="sensory box/GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00785;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33837"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB1"
FT                   /protein_id="AAZ33837.1"
FT                   /translation="MPAAAETLLALMHAQAEVARLSEREQLFSSLLVSVNAVLWAFDWE
FT                   TQHMIYVSPAYERIFGRSAGLLLADYSEWRDSIYPDDLNYAERSLNEVIEKGSIEDREY
FT                   RIIRADGEVRWLSDKCFVSHRADASQRLIVVGIAEDITDKKHLEDELQRLATTDVLTQS
FT                   SNRRHFFECAQREFELARLNGTPLAFLLLDIDDFKLVNDTYGHQEGDTVLQRIAESGRS
FT                   ALRRGDLFGRIGGEEFAAVFPGCAPDMAMQIAERLQREIQRQNFQSGGTTFSITASQGL
FT                   TNLGPEDSSLETLYGRADAAMYQAKRQGKNQIVLV"
FT   gene            complement(103160..104551)
FT                   /locus_tag="PSPPH_0094"
FT                   /note="PSPPH0094"
FT   CDS_pept        complement(103160..104551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0094"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37927"
FT                   /db_xref="GOA:Q48QB0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QB0"
FT                   /protein_id="AAZ37927.1"
FT                   /translation="MTAVDLPAVPRVLIAESDPWVRETLSDLVLGVRADVDLEMCTDGK
FT                   QAVEWMKKQLPDLIIAARELPGIDGLSLLRGVRNLRRQPAIPFILISNRNDSASVREVL
FT                   PLAPTAYLTKPLNTEGLRQRLESLLLERQAPVAGAVPALTPGLTLTKFLDKRRDVADGA
FT                   PLFVDVATAIKLSQTANGLDAALLEQELRNDPHITAVLIAAANSAAQHLGKPVQTMGGA
FT                   LAILGPVQGANIASGLAKKRMAVLTSDALLARASELWTMSQRTADYARILGGMLELDVE
FT                   RCFCAGLLQSLGDLAVLGCLQEWLLAGGELNEDVIKQSLEQYSAAFGSALRTRWRLPLE
FT                   LRELIAAVYQYNTGIFTREVLAMNLAGQMARLGEEESVNTLIKTKSAKLLKLSVGDLQR
FT                   LRKKLTGVTDPSLLKPLPTEPEVAAETVEGEDEPDLLDLTPEPPAEEAAVIEDPASAIQ
FT                   GPLEK"
FT   gene            complement(104710..105990)
FT                   /gene="gabT1"
FT                   /locus_tag="PSPPH_0095"
FT                   /note="PSPPH0095"
FT   CDS_pept        complement(104710..105990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT1"
FT                   /locus_tag="PSPPH_0095"
FT                   /product="4-aminobutyrate transaminase"
FT                   /EC_number="2.6.1.19"
FT                   /note="identified by similarity to SP:P22256; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36014"
FT                   /db_xref="GOA:Q48QA9"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA9"
FT                   /protein_id="AAZ36014.1"
FT                   /translation="MSKTNESLMQRRHAAVPRGVGQIHPIFAASAKNATVTDVEGREFI
FT                   DFAGGIAVLNTGHLHPKIIAAVQEQLTKLSHTCFQVLAYEPYVELCEKINAKVPGDFDK
FT                   KTLLVTTGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALYPCELHGVSVDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKAF
FT                   MLRLRELCDKHGILLIADEVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVC
FT                   GKAEYMDAIAPGGLGGTYAGSPVACAAALAVLDIFEEEHLLDRCKAVGERLVTALKGIQ
FT                   AKYPVIGEVRALGAMIAVELFEDGDSHKPNAAAVVQVVAKARDKGLILLSCGTYGNVLR
FT                   VLVPLTAEDELLTRGLAILEECFAEIA"
FT   gene            complement(106198..107640)
FT                   /gene="gabD1"
FT                   /locus_tag="PSPPH_0096"
FT                   /note="PSPPH0096"
FT   CDS_pept        complement(106198..107640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD1"
FT                   /locus_tag="PSPPH_0096"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="identified by similarity to SP:P25526; match to
FT                   protein family HMM PF00171; match to protein family HMM
FT                   TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34523"
FT                   /db_xref="GOA:Q48QA8"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA8"
FT                   /protein_id="AAZ34523.1"
FT                   /translation="MQLKDSTLFRQQAYINGQWLDADGGQSIKVNNPANNEILGTVPKM
FT                   GAAETRRAIEAADKALPAWRALTAKERGNKLRRWFELMIENQDDLGLLMTLEQGKPLAE
FT                   AKGEITYAASFIEWFAEEAKRVYGDVIPGHQPDKRLIVLKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVLKPASQTPFSALALAELAERAGIPAGVFSVVTGSAGDIGAELTG
FT                   NPIVSKLSFTGSTDIGRQLMAECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAMISK
FT                   YRNNGQTCVCANRIYVQDAVYDAFAEKLKAAVGKLKIGNGLEDGVTTGPLIDDKAVAKV
FT                   KEHIADAVSKGATVLTGGNSLEGSFFEPTILVNVSKDAAVAREETFGPLAPLFRFKDEA
FT                   EVIAMANDTEFGLASYFYAQNMSRVFRVAEALEYGMVGINTGLISNELAPFGGIKSSGL
FT                   GREGSKYGIEDYLEIKYLCLSV"
FT   gene            complement(108096..109361)
FT                   /locus_tag="PSPPH_0097"
FT                   /note="PSPPH0097"
FT   CDS_pept        complement(108096..109361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0097"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01360;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35013"
FT                   /db_xref="GOA:Q48QA7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA7"
FT                   /protein_id="AAZ35013.1"
FT                   /translation="MHDAPHTTQPDRSHRGPLINQFKSIERSPCRVLITGASIAGCAAA
FT                   WWLAQRDCDVTVVEQASAFRDGGQNVDVRGAARQVLRLMGLEQAVKGLNTGETGLAWVD
FT                   EDNRTAAQIDLSGLEGDGPTAELEVLRGDLARLLYEASSADAFYRFGDRIVSVEHDDEG
FT                   VSVTFESGGEERFDLLIIAEGVGSRTRELVFPGENQPRRMDLASAFFTVPRAPTDSQTA
FT                   RWYNAVGGRSAGVRPDNRGTTRAFFNVHGRSHLTVGNSIAEQKAFLRASFAGAGWEVPR
FT                   LLEGMEAAEDFWFDDLRQVKMDRWSNGPVVLLGDAAWCVTPLGGVGASLALIGAYVLAG
FT                   ELTRTDTIAGALAAHEYLLRPVVKKSQNVPKLVPRLVHPRSRTGVKVLRAVQRLVATPF
FT                   ISKRAAKALTPAIQSFTLPDYR"
FT   gene            109533..109609
FT                   /locus_tag="PSPPH_0098"
FT                   /note="PSPPH0098"
FT   tRNA            109533..109609
FT                   /locus_tag="PSPPH_0098"
FT                   /product="tRNA-Arg"
FT   gene            109724..110797
FT                   /locus_tag="PSPPH_0099"
FT                   /note="PSPPH0099"
FT   CDS_pept        109724..110797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0099"
FT                   /product="shufflon-specific recombinase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33471"
FT                   /db_xref="GOA:Q48QA6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA6"
FT                   /protein_id="AAZ33471.1"
FT                   /translation="MATIRNRGEYQWEAQIRRKGYPAQRKTFETKSDAQAWARMIESEI
FT                   DRGIFVSRVEAERTAFHQLIDRYISEIAPKHKGAYSEIKRLEALKRHPLATRIVATLTS
FT                   SDFARYRDERLKIRKGNTVKRELALFQCVIEVARREWGIHLAENPVRMVSRPSYNDERS
FT                   RRLDPIEEQYMLGALELRERRTDGTYADASHNPWIRPIVQLAIETAMRRGEIFELRWKH
FT                   VNLDRRTAHLPATKNGLPRTVPLSPKAIQLLKDLPRSLCGRVFPTTADALKKAFVRGLE
FT                   RARLKYLGDCGAAQVTPQEDFLINLRFHDLRHEATCRLATKLPNLIELASVTGHREVNM
FT                   LKRYYNITAEELAAKLA"
FT   gene            111138..112709
FT                   /locus_tag="PSPPH_0100"
FT                   /note="PSPPH0100"
FT   CDS_pept        111138..112709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0100"
FT                   /product="recombinase"
FT                   /note="identified by match to protein family HMM PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35139"
FT                   /db_xref="GOA:Q48QA5"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA5"
FT                   /protein_id="AAZ35139.1"
FT                   /translation="MPSPPKRKKSEDSSASLIQAAEYVRMSTDHQRYSTENQSAAIHAY
FT                   ATSHGMEIVRTYRDEGKSGLDIGGRDALRRLIDDVQAGNIQFQVILVYDVSRWGRFQNT
FT                   DESAHYEYLCTSSGIQVVYCAEPFENDGSPLATIYKGIKRSMAGEYSRELSQKVFAGQC
FT                   RLVEKGFHQGGPAGYGLRRALIDEKNEFKAELSRGQQKSIQTDRVILVPGPEAEIEVVQ
FT                   HIYHQFIHSGLNEREIANVLNADGLLTDFDRPWSRGSVHQVLTNEKYIGNNVYNKTSSK
FT                   LRKRISRNPPDKWVRCDGAFQGVVSLEVFTCAREIILQRSYRLDDVQMLELLGALLQQA
FT                   GSLSGMLIDEQDNMPSSAAYISRFGGLLRAYTLVGYAPDRDYRYLDINRSLRQLHPQVF
FT                   ENVIKHLKLAGASVEISAQNDVLTVNDEWTASVVIARCQSTPAGTLRWKLRFDNSLAPD
FT                   ITIAVRMEQANQKVRDYYLVPLIDMGAWPQKMAEENSPLIDSYCFATLDVLNGLAARCS
FT                   LKEACQ"
FT   gene            112706..113614
FT                   /locus_tag="PSPPH_0101"
FT                   /note="PSPPH0101"
FT   CDS_pept        112706..113614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0101"
FT                   /product="ParB family protein"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM PF07506; match to protein
FT                   family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34572"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA4"
FT                   /protein_id="AAZ34572.1"
FT                   /translation="MTGPSTIRDRVTLIPIAQIHILNPRTRNKKVHSELIENIRTAGLK
FT                   RPITVSRKASPQGPIKYDLVCGQGRLEAFLALEALEIPAFVIDADEEECLVMSLVENVA
FT                   RRQHRPIDLMNEVGRLKERGKTDADIAKIIGSTASWVSMIVVLIERGEEKLLSAVETGL
FT                   IPLSMATDIARSSESDIQNLLTDAYERGFKGKKITKLRHLLELRAKKDKLVRGSALGIS
FT                   QNNKKKRLTPADLRRLFEREAERQRLMVKKAAFTHDRVVFSIQAIKELLSVSDFEKLLF
FT                   DEHLDSLPKLIQARLWNGGGL"
FT   gene            113614..114579
FT                   /locus_tag="PSPPH_0102"
FT                   /note="PSPPH0102"
FT   CDS_pept        113614..114579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0102"
FT                   /product="ParB-like nuclease"
FT                   /note="identified by match to protein family HMM PF07506"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34178"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA3"
FT                   /protein_id="AAZ34178.1"
FT                   /translation="MSSRRYASSNTQPTHVPKNAFLDECVRVEIINIMPLKISRPAVKE
FT                   SLKYQQILASIQDVGLVEPPVVIPVPGQTGHYFLLDGHLRIEALKDLDELEVDCLVATD
FT                   DDTYSYNKRTNRLSAVHSNKMIVRAMERGVSAERLGKALGLSQQTIKQRFRLLNGICAE
FT                   VISLLGDTDCPANVFNLLRQMKPLRQIEAAELMIGNRNLSVLLAKALLAATPSDQLVFT
FT                   RKPLPDQPISPESIARLERELAALQMQIKTIEDDYGPDVLHLTVIKGYLTKLLANASVV
FT                   RWLARHQPEYLKEFQSIAELTELPWGNDEAGPVPKPTPDQ"
FT   gene            116302..116691
FT                   /locus_tag="PSPPH_0103"
FT                   /note="PSPPH0103"
FT   CDS_pept        116302..116691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37623"
FT                   /db_xref="GOA:Q48QA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA2"
FT                   /protein_id="AAZ37623.1"
FT                   /translation="MLELMQYAWCFNPEAQEFHSVPTLLVRNDPGEYYVIRDGYGDLWV
FT                   HDPWGRECHADFNFVEVHGMKFDRGQFDPEKVDDQRTSKEPPTRTLFFLSPEEIEDLRV
FT                   EMKRDGAYMRERLQKLGKLKFGKDD"
FT   gene            complement(116979..119996)
FT                   /locus_tag="PSPPH_0104"
FT                   /note="PSPPH0104"
FT   CDS_pept        complement(116979..119996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0104"
FT                   /product="type I restriction-modification system
FT                   restriction subunit"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF04313; match to protein
FT                   family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33623"
FT                   /db_xref="GOA:Q48QA1"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA1"
FT                   /protein_id="AAZ33623.1"
FT                   /translation="MVSKTNEQALEASIEKYLTGNCLEEQATIRDGVKELPFDPNHGYQ
FT                   LGRVQDFNARYAVDTRCLWRFLHDSQGDELERLKQRYDDWDLRILERFDRLAKKYGVLH
FT                   LFKRGLAIDDVHLNLMYPAPLASSSGRVKRQFAANIFSSTRQVRYSLSNPLEEIDLVLF
FT                   VNGLPVATLELKNPWTGQTARYHGQKQYRQGRDSSQPLLQFGRCLVHMTVDTDEVYMTT
FT                   KLAGTATFFLPFNKGHNYGAGNPPNLAGHKSAYLWREIFSRESVANIIQHFVRLDGSSK
FT                   TPLAKRTLFFPRYHQLDVVRRLVAHASQQGVGQRYLIQHSAGSGKSNSITWAAYQLIET
FT                   YPASLNVAGARGLDVPLFDSVIVVTDRRLLDKQLRENLREFSEVKNIIAPALKSSDLKQ
FT                   ALEQGKKIIITTIQKFPWIVDGIDDMAGKRFAVIIDEAHSSQDGSSHGTMNSVMGGDDQ
FT                   DDTQEKILSAIKNSKMRGNASYFAFTATPKNSTLEKFGEQQADGRFEPFHLYSMKQAIE
FT                   EGFILDVLANYTTYRSYYEIQKSIEDDPLFDKLKAQKKLRAYVERDQQTIDVKAEVMLD
FT                   HFIDQVVTPKKLKGQGKGMVITQNIESAIRYHKAISRLLAARGNPFKALIAFSGDKLVD
FT                   GIEYSEAGINGSAEADTRDKFDTDEYRLLVVANKYLTGFDQPKLCAMYVDKKLQYVLAV
FT                   QALSRLNRAAPKWGKKTEDLFVLDFFNLVEDIKASFDPFYTATSLSRATDINVLHELKD
FT                   QLDELGVYEWPEVEAFAAQYFDNVDAEQLAVLIDIAVERFEVELELEDEAKVDFKIKAK
FT                   QFVKIYGQMASIMPYEIVAWEKLFWFLKFLIPKLKVQDKDADEIDALLNSVDLSSYGLE
FT                   RVKLNHSIALDDADTELDPANPNPRGVHGGEQEKDPLDQIIQSFNERWFQGWGVTTEEK
FT                   RVKFLSILQGIQEHPDFEPKYQKSQDEDHRALAFEKMFEEVMLMRRRQDLELYRLVASD
FT                   AVLKSSLQQSMRGMLD"
FT   gene            complement(120413..121882)
FT                   /locus_tag="PSPPH_0105"
FT                   /note="PSPPH0105"
FT   CDS_pept        complement(120413..121882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0105"
FT                   /product="carbon storage regulator related protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35316"
FT                   /db_xref="GOA:Q48QA0"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:Q48QA0"
FT                   /protein_id="AAZ35316.1"
FT                   /translation="MSVERDVGYLQSLLRELRALPQETEWVEFKQSNDDAPLIGEYISA
FT                   LANAAALLGKQYGYLLWGIDDASHAVIGTAFKPSATRYKQQELESWLLQKTAPKIHFRF
FT                   FEFAAADGQSVVILEVQAASHTPVQFDGVEYIRVGSYKKKLREFPEKERALWRVFDRVP
FT                   FEQQLAAQNLGVDQVLKLLDYSAYFDLTHQPLPEGREAILAALASDRMIQRSDSGQWHI
FT                   SNLGAILFAKRLQDFPALGRKAVRLIHYKGNGKLETVRELTGNKGYALGFEGLIDTLKT
FT                   LLPANEEIGKAFRQEVPMYPELALRELVANAIIHQDFNLSGTGPMIELFERRMEITNPG
FT                   VPLVDPQRFLDSPPRSRNEVLASFMRRIGICEERGSGIDKVIAQTELYQLPAPIFERTD
FT                   EHTRVVLFAHKDYRDMEQEDRVRACYQHCCLKYVNREPMNNTSLRERFHIEEGNSAMAS
FT                   RIIKHTIEAGLIRLYDPKANRKTYRYVPSWA"
FT   gene            complement(121882..123228)
FT                   /locus_tag="PSPPH_0106"
FT                   /note="PSPPH0106"
FT   CDS_pept        complement(121882..123228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0106"
FT                   /product="type I restriction-modification system
FT                   specificity subunit"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34772"
FT                   /db_xref="GOA:Q48Q99"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q99"
FT                   /protein_id="AAZ34772.1"
FT                   /translation="MAAPEILQLQVAEGTCSSSDTAKKWRICRLKHVALINPYLSLSRV
FT                   RWGEPASFLPMEAVSADGQVDYSEPKDSKNLVSGFTNFEAGDVILAKITPCFENGKGAV
FT                   LSDMPTRVGFGSTEFHVLRANKKAIPNFIYYITKSDLFMRQGEALMIGSAGQKRVSTSY
FT                   VENFQLALPSLHEQRKIVDFLEEKTSLIAQAISKKEHQIELLEERKQILVQQAVTRGLD
FT                   PASPMRNAGIEWIGEIPKHWEVRRSKFTFAQRKELARKNDIQLSATQSYGVIPQDEYEE
FT                   KVGRKVVKILFNLEKRKHVEVDDFVISMRSFQGGLERAWASGCIRSSYVILKPLPGIDP
FT                   DYYSYLLKSKRYIAALQATANFIRDGQDLNFENFALVDLPIPPLDEQKEIARYLASWLS
FT                   KADRSLYLLEQQITKLKEYKATLINSAVTGKIKVPGVVEPAEIKEREFA"
FT   gene            complement(123215..125620)
FT                   /locus_tag="PSPPH_0107"
FT                   /note="PSPPH0107"
FT   CDS_pept        complement(123215..125620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0107"
FT                   /product="type I restriction-modification system DNA
FT                   methylase"
FT                   /note="identified by match to protein family HMM PF02384;
FT                   match to protein family HMM PF02506"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36943"
FT                   /db_xref="GOA:Q48Q98"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q98"
FT                   /protein_id="AAZ36943.1"
FT                   /translation="MNHAVHNKLVSFIWSIADDCLRDVYVRGKYRDVILPMVVLRRLDA
FT                   LLEPSKAKVMEELAFQQGEMSQTELDDSALRSASGYVFYNTSKWTLSQLQKTATNNQQI
FT                   LLNNVEEYLDGFSDNVKDIVRRFNLKSQMRHMASKDVLLDVLEKFTSPYVNLTPTDIED
FT                   PEGNRLPALSNLGMGYVFEELIRKFNEENNEEAGEHFTPREVIELMTHLVFDPIKDSLP
FT                   PVMTIYDPACGSGGMLTESQNFIEEKYPDPTTQRDIHLYGKEINDETYAICKSDMMIKG
FT                   NNPAHIRPGSTLSVDEFAGSRFDFMLSNPPYGKSWASEQKFIKDCGEVIDPRFKVSLRD
FT                   YWDNPEMQDATPRSSDGQLLFLMEMVNKMKASGEGSLGSRIASVHNGSSLFTGDAGSGE
FT                   SNIRRHLIENDLLDAIIQLPNNLFYNTGITTYIWLLSSNKPVQRRGKVQLIDASLLYRK
FT                   LRKNLGNKNCEFAPEHIELITQTYLDLASLDRPAGGDGIAAQVFDNRDFGYHKVSIERP
FT                   DRRKAQFSAERIETLRFDKALREPMQWIYQQWGEALYQDEALATHEKAILAWCEEQGLE
FT                   LNIKQRKKLLNLETWAKQALLVTVANYLMQAIGSDEYDDFNLFAKLVDKVLKQLNKEVG
FT                   IKLGASERNQVLNAVSWYDENAVKVLRKVEKFDRAELAALLERLDCIEADLADFGYYPS
FT                   DKAGEWITYESNSDLRDSESIPLADSIHHFFKAEVQPHVEEAWINLESVKIGYEISFNK
FT                   YFYKHQPLRSTDEVAREIIALEQQAEGLIAEILGISVDTVSGAQYGRA"
FT   gene            126146..126481
FT                   /locus_tag="PSPPH_0108"
FT                   /note="PSPPH0108"
FT   CDS_pept        126146..126481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0108"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36507"
FT                   /db_xref="GOA:Q48Q97"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q97"
FT                   /protein_id="AAZ36507.1"
FT                   /translation="MKSFSKVVAAAVCGLVLAGCTGTPMKTPQYDSNQYTVVGHSEASA
FT                   TGLMLFGLIPIRQNDRFVRAQNGAIQAKGGDALINTQVQEKWFWAWVLNGYTTTVSGDV
FT                   IKLKTAK"
FT   gene            126723..127403
FT                   /locus_tag="PSPPH_0109"
FT                   /note="PSPPH0109"
FT   CDS_pept        126723..127403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0109"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ32963"
FT                   /db_xref="GOA:Q48Q96"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q96"
FT                   /protein_id="AAZ32963.1"
FT                   /translation="MAGLLSGLPMTSALVMLFLSLEQGTAFVSMAVPGALAGLAAIQAT
FT                   YLFYFLVTRRVSAVTGCTLALAVYGVTAFAMNLSGSLALSIIFTLLMVALIVVATSKQA
FT                   PPDVASYVAMPRCVIPMRMLTATLLLLAITASATWLGPVVSGLLAPIPVIAWPLAVFVH
FT                   VQGGRYELAAIVRGNAIGAVGVVSFYLTLRYSILQWGALVSITAAVLLAVVVTAGLARL
FT                   LAKR"
FT   gene            127470..128234
FT                   /locus_tag="PSPPH_0110"
FT                   /note="PSPPH0110"
FT   CDS_pept        127470..128234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0110"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36530"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q95"
FT                   /protein_id="AAZ36530.1"
FT                   /translation="MIPELNSEASVLICGASRGIGLAMCAALLARDDVAQVWAVARQAS
FT                   SSTELEKLAEQYGQRIKRVDCDARDEQSLEALVSETLEGCEHLHLVISTLGILHQDGAK
FT                   AEKGLAQLTLASLQASFATNTFAPIQLLKHLLPLLRKQPSTFAALSARVGSIGDNRLGG
FT                   WYSYRASKAALNQLLHTASIELKRLNPASTVLAIHPGTTDTELSQPFQANVPEGQLFEP
FT                   AFSADRIIEVVGAHGPADSGTFWAWDDKPIVW"
FT   gene            128275..128730
FT                   /locus_tag="PSPPH_0111"
FT                   /note="PSPPH0111"
FT   CDS_pept        128275..128730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0111"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34324"
FT                   /db_xref="GOA:Q48Q94"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q94"
FT                   /protein_id="AAZ34324.1"
FT                   /translation="MEIRHITHLPAQILALEKEAIGEGFRFITRLIAEWHSGANRFDAP
FT                   GECFMAAYLNQQLIGIGGLSVDPYVKTNTARLRRVYVSASSRGCHVGRTLVKALVAHAA
FT                   LRFQSVRLATDTSAGDAFYLKCGFMRIDHDDATHAMCLSSIERPTEV"
FT   gene            128727..129446
FT                   /locus_tag="PSPPH_0112"
FT                   /note="PSPPH0112"
FT   CDS_pept        128727..129446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34878"
FT                   /db_xref="GOA:Q48Q93"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q93"
FT                   /protein_id="AAZ34878.1"
FT                   /translation="MNLAREEIRDFLINGVVVGDLLLPTHYAKLDRLDDFQAGFRTHGN
FT                   TGESLVSDTEGEWNPDWHVLAMTGLDDPVFIAATEAPSGYPVYIAAHGAGRWDAIQIAP
FT                   SLMVFRRLLEALVEVNDDVVEFNRLIMAEIGSANQYWREVIEARQEAELLEQSTPEISA
FT                   CDPADFESGDLIVIALGLHKLKVVQLVSKERELSLKEALALADASEFKAGSGSKRQLRQ
FT                   LCDQLKELGATVEFRPN"
FT   gene            complement(130159..131262)
FT                   /locus_tag="PSPPH_0113"
FT                   /note="PSPPH0113"
FT   CDS_pept        complement(130159..131262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0113"
FT                   /product="ISPsy19, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36225"
FT                   /db_xref="GOA:Q48B81"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q48B81"
FT                   /protein_id="AAZ36225.1"
FT                   /translation="MPKTGRPRSIAAEHYPVLVKLAHAQPYSSQAELALVFFAETGITA
FT                   HPDTFAKALKMAGITRVKQRAKGSFQSPEPNKAYGYNETHRRQLPEQLYPSCLTDTEWA
FT                   LVADLFESQGGRGVPPLHSRRTLLEACCYVVRTGCSWRMLPRDFPHWDNVYKTFRRWSA
FT                   QGKFEQMHDRLRAQWREREERADSPSAAILDSQSTRSSPQGGDSGYDAGKKVKGRKRSL
FT                   IVDTLGLLLAVSISAASVQDRDAADDAVAYSKEKYPSLSTLFVDSAYAGKWAQRTHQLH
FT                   AIDVQVIRGPNNRRTGQWHSEQGDLFSVEPVQTGFVVMPKRWVVERTHAWNERARRLIM
FT                   HHDRLFAVSEAWVWLAEARILARRLTT"
FT   gene            131400..132371
FT                   /locus_tag="PSPPH_0114"
FT                   /note="PSPPH0114"
FT   CDS_pept        131400..132371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0114"
FT                   /product="ISPsy2, transposase"
FT                   /note="identified by similarity to GB:BAB60892.1; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35839"
FT                   /db_xref="GOA:Q48Q41"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q41"
FT                   /protein_id="AAZ35839.1"
FT                   /translation="MTFADAEYAGKRKQTRKELFLIEMDQVVPWKGLIALIEPYYPKGE
FT                   GGRPAYPLMAMLRVHLMQNWFGYSDPAMEEALYETTILRQFSGLSLERIPDETTILNFR
FT                   RLLEKHELATGILGVINGYLGDRGLSLRQGTIVDATLIHAPSSTKNKDGKRDPEMHQTK
FT                   KGNQYYFGAKAHIGADDESGLVHSVVVTAANVADVTQVAKLLHGEENVVCADAGYTGVE
FT                   KREEHAGRKVIWQIAARHSTYKKHGKRSILYKAIRKIEKAKAQVRAKVEHPFGVIKRQF
FT                   GYEKVRFRGLAKNTAQMVTLFALSNLWMAGRHLLASAGEVRV"
FT   gene            complement(132507..133010)
FT                   /locus_tag="PSPPH_0115"
FT                   /note="PSPPH0115"
FT   CDS_pept        complement(132507..133010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0115"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34866"
FT                   /db_xref="GOA:Q48Q90"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q90"
FT                   /protein_id="AAZ34866.1"
FT                   /translation="MFTRLVFLAILTTSLCACEKKGHDSVTDEDMAKAMERLSFTCTHE
FT                   ADNLPAISEDAQALYRYALFLESKKGTKDYQQIGRYYRLAYATGNYKAATNLHILISQG
FT                   AVDSNNRSKEAIDIVEHLIAQGIPGGYYDMAHYLEKGYGVKQDLPASKAYFRQAADLGD
FT                   LGKV"
FT   gene            complement(133108..134130)
FT                   /locus_tag="PSPPH_0116"
FT                   /note="PSPPH0116"
FT   CDS_pept        complement(133108..134130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0116"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34475"
FT                   /db_xref="GOA:Q48Q89"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q89"
FT                   /protein_id="AAZ34475.1"
FT                   /translation="MPTRIILIILIAAALCACKKEDAMHITKDQMTHALDRLSFTCVKE
FT                   ADSLPKISENSQQLYRYALFLRLREGAKDFVKIARYYRLAYAAGSYKAATNLHALISEG
FT                   LIESTDPENEVIDIVESLIAREIPGGYYDMGHYLETGYGVKQDTSRANAYFRRAADLGN
FT                   AYAQYYVSNLLENIEDAKQVVLDMRRCAMDQGHAEAAYSYGIFQKARDIYPEAVQGFQA
FT                   GVRNGSSNSAGFLSGGFKTTEAKNRLYYFALEADSERSVRYKKIEKFLSRYEHLGPKVP
FT                   DIDQIVPLPPAKLPEWDGTFEWLKKRESTPPAEKPSEDMIRALSQEKGLDPETGLPLPK
FT                   "
FT   gene            complement(134132..136063)
FT                   /locus_tag="PSPPH_0117"
FT                   /note="PSPPH0117"
FT   CDS_pept        complement(134132..136063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0117"
FT                   /product="phospholipase D family protein"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33451"
FT                   /db_xref="GOA:Q48Q88"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q88"
FT                   /protein_id="AAZ33451.1"
FT                   /translation="MTTPLITTPVATSKNMSCNINLPWFVQGTEYCPTEATFEPLVNGE
FT                   RAFGAVYDAIMKAEQSVEIICWGFQPSMYFKRGDTSSLCIGQLLAMKADKGVKVRILCW
FT                   SDSAHVTAAFSENMTPGRNLASVMDDLRNETQHAIDWEWYRRATKSTLGNRSLLLDRNG
FT                   TALAGAFSFGKEPFKNIEFVVRDMSLSDRVEIAWQVAMRSTDKDRPTWNKIMTTVGMTS
FT                   IPTHHQKMVLVDYETPNKAVGFVMGHNSLDAYWDNDDHSAARMHAQFGRNGATPRQDIS
FT                   SRVTGPILEYLNHNFTQAWQHETGVDLLPARRHVADQLKPRKGHGPRLIAQVLRTQPQE
FT                   NKRDIKEMYLKAAGNANSFMYLENQYFRWPPLAEKIKENVLRQFAEGRSLIEHGPLYLF
FT                   VVTNSTKEGMGDGTINTYRMLRQLGRPELMPEVTRYERDKELEAQVAQAKERYDTAKGK
FT                   ITIIEGTYGRSFNPAMSKLWEPQRKAAEAAEAEYRALKAKLPADKAKPLTVPGTEGLKV
FT                   LICTLVASDSPPEKWMDIYIHSKLMIIDDVFTTLGSSNINTRSMEVDSELNICVEDPAV
FT                   TKPLRKHLWSIHTDSEGSGDDIETAFSTWSRIASFNAANRKNKENTNRPTHSLTEFYRD
FT                   SKKRSNLD"
FT   gene            complement(136114..136368)
FT                   /locus_tag="PSPPH_0118"
FT                   /note="PSPPH0118"
FT   CDS_pept        complement(136114..136368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0118"
FT                   /product="gp28"
FT                   /note="identified by match to protein family HMM PF05488"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33066"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q87"
FT                   /protein_id="AAZ33066.1"
FT                   /translation="MRPIIVINDPTSDAGQVLEGSPSTFINGLAVARVGDRVSCPHGIG
FT                   TIVSGDETLLVDGRPVAREGDFISCGARLMATQQDTVDL"
FT   gene            complement(136714..137973)
FT                   /locus_tag="PSPPH_0119"
FT                   /note="PSPPH0119"
FT   CDS_pept        complement(136714..137973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0119"
FT                   /product="ISPsy18, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37080"
FT                   /db_xref="GOA:Q48Q86"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q86"
FT                   /protein_id="AAZ37080.1"
FT                   /translation="MPTKKKSANATARELPSIPQELIEQFVKGPMSAEAIQDASMAFKK
FT                   ALIERALGAELGHHLGYPQGAERPEESTNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFA
FT                   PILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEV
FT                   GAWQQRPLEPMYPVIFFYALRVKIRDEGLVCNKAIYLALGVLPDGTRDILGIWIESTEG
FT                   AKFWMKVFNDLKTRGVEDVLIAVTDGLKGIPEALGAVFPATTLQTCIVHLIRNSLDYAA
FT                   WDKRRALAKALKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVF
FT                   PAGIRKVVYMTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDW
FT                   KVAMNQFAILYGDRFTRPSW"
FT   gene            complement(138214..138638)
FT                   /pseudo
FT                   /locus_tag="PSPPH_0120"
FT                   /note="PSPPH0120; conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:CAE16327.1"
FT   gene            complement(138816..139919)
FT                   /locus_tag="PSPPH_0121"
FT                   /note="PSPPH0121"
FT   CDS_pept        complement(138816..139919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0121"
FT                   /product="ImpA-related N-terminal family"
FT                   /note="identified by match to protein family HMM PF06812"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33498"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q85"
FT                   /protein_id="AAZ33498.1"
FT                   /translation="MTMSEFLNDLSLADLTAPINGGSGEDLSFSTLFDQVKEARRADPD
FT                   YLTQGDWQTDLKSSDWDQTITLAAQGLAEQSKDLMLVAWLSEALAHKYHFVGITFGLTV
FT                   AERILQNFWDDLYPSLEDGVEERAARLAWLKTTLTEVVGGLPITQGQNFGLLRYDESRH
FT                   VENLALQNPKAMQAAVDEGKINAEIFQRSVVLTDSDHLRLKASEIAASLYACQQLQATA
FT                   DTLFGSDAPSLVTLSDILQRAGQLTEKLLKDRGIELSPAPAAAAQTAPEIAIDQPAGAA
FT                   MTQPTQDSASAPLRTTPATRDEAFTMLAGIAQFFKNTEPQSPVPYLIERAIKWGNMPLE
FT                   GWLNDVIKDSNVVDSIRDVLGTKEPKQ"
FT   gene            complement(140006..140524)
FT                   /locus_tag="PSPPH_0122"
FT                   /note="PSPPH0122"
FT   CDS_pept        complement(140006..140524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN68697.1; match to
FT                   protein family HMM PF05638"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37244"
FT                   /db_xref="GOA:Q48Q84"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q84"
FT                   /protein_id="AAZ37244.1"
FT                   /translation="MAFDAYIQIDGIPGEVLDDKHKDWIEVLGYEFGATQATSATASSS
FT                   GGASSERVALSDFSIRKSVDKASAKLFEACCKGTHIAKIQLNVNRAGGDKLTYLTINLE
FT                   EVVVSSVKAVAGGNQKGEDNAVSDLPIEEISFNFARIKTTYTQQSRSDGQGGGNVTGGW
FT                   DRTANKVFA"
FT   gene            complement(140680..143172)
FT                   /locus_tag="PSPPH_0123"
FT                   /note="PSPPH0123"
FT   CDS_pept        complement(140680..143172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0123"
FT                   /product="OmpA domain protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37781"
FT                   /db_xref="GOA:Q48Q83"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q83"
FT                   /protein_id="AAZ37781.1"
FT                   /translation="MNKIKYYFLRYQPYVLGVCFFLSIFIIWSIGRALGFSSMNSLLTG
FT                   IGLFLLLSAAYVLLLYRGVSQHQNLEGLLRDDADQAVLNASPADREEVSLLRERLLQSI
FT                   ERLQSNKPNGSNAKDALYALPWYLVVGQPAAGKSTMLYQSGLNFPYAEREGARVAGLGG
FT                   TRNCDWFFSSEAVLLDTAGRYMNDQQEAGKWRAFLQLLRQHRQRRPLNGLIVTVSIHDI
FT                   LQSSVEDQERIAKRLRERIQETHALLEVRLPVYLVFTKCDLVPGFVPFYRQLDDVARGE
FT                   VMGKTFPHKGFEQADWGQRFGVAMDELINYWKEIANQQLVLQDIQITRQDTAVYRFPLE
FT                   LEALKPRLLMFVDALLRANPYQSAEMLRGFYFTSALDADQPEMGGHTRQVTERFQLESE
FT                   QDLVDGNAQPHPLFINSLFRKVIIPDQHLVALYTTNHRERRRKAAWIGGASLVALLICS
FT                   LWGWSYWNNKDNIQSISTELAQAAADDSKATGQYTEWQTLDRMRFWTSLYYDRHHDEGV
FT                   PLRLRLGLYRGYDVEPLLRTRYFNRLETVMLKPTADNLTRSLYLLTTIKVYQRNAKDLM
FT                   PVTGVDSVEPKALPPDNRAQSIAAFGKATLDTYVMLSRAQREKADPAFLKAKMPDYWYP
FT                   AIARQTGKTITANAEAGSNQDYEYASRQINFYSDQIHELDVPRILDNAFLTSSSRNYIN
FT                   SLLTQSLKAIETITLESDTLFAFGRADFQSLKTEGQNQLSAIAGKLLSTPNIGKIVIAG
FT                   HADQLGDPQSNMQVSKQRAQTIKTYLVGKGVPAELVDAVGEGSEKPLVNCDMQQPRAQL
FT                   IQCLEPNRRVEIEVRALN"
FT   gene            complement(143169..144092)
FT                   /locus_tag="PSPPH_0124"
FT                   /note="PSPPH0124"
FT   CDS_pept        complement(143169..144092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35830"
FT                   /db_xref="GOA:Q48Q82"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q82"
FT                   /protein_id="AAZ35830.1"
FT                   /translation="MIGCFGKVPASADFVSLHGASDDVCEFDAWLQGALADMQQRDDWR
FT                   TLFDQLPVCFFSYRARSGNWLVGGLISSRDSSARRYPFFIFQTVKSSDAGVFVNPFTLS
FT                   ELFAGQIKPLLHMAAQGEGTSVLFERIRALRPLQGQDFELFRRVHEKFLVNFTLRDIAT
FT                   SLESSYPEFISNAVLTRLQALGRPSYRAPIGISLPLPAERGLKNPTADLWVNWLTRIDP
FT                   NKAVPQISILADDFMRPRLFCFPSRNTSGVYRVVTGVGEHSENYDVLAPFDAFDEHHRG
FT                   HVFPDIDRPLYDVIDRFVDVLDLKSV"
FT   gene            complement(144124..148044)
FT                   /locus_tag="PSPPH_0125"
FT                   /note="PSPPH0125"
FT   CDS_pept        complement(144124..148044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0125"
FT                   /product="ImcF-related family"
FT                   /note="identified by match to protein family HMM PF06744;
FT                   match to protein family HMM PF06761"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36384"
FT                   /db_xref="GOA:Q48Q81"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q81"
FT                   /protein_id="AAZ36384.1"
FT                   /translation="MKTLLRLLKSFWFLVPILWLISLAVCWFFAPRISWLQGYTLEAMA
FT                   IISAFYLLLIVLRQYRRIRTEHNLENLVQIEVDRSLKSTGEFRDQQVLRDRLKHAIAML
FT                   RTDRSAGGGGSSALYDLPWYLVIGMSAAGKTSLLTRSGLSASIASSANDTESGTQHCDW
FT                   YFSPEAVMIDTAGRYLRDDQSASEFAAFLRMLKKQRSKAAVNGLVLVVSLPELLAASAA
FT                   ERNEMGARLVTRIEEYTDCLDANPPIYLMLTKTDQLPGFNQAFDGMDLHERQQPLGMTF
FT                   GLTEITTESLRSVLDRKLANLQAHVSRHVDAQMIALGADANSALLNFPNYFAELSAILE
FT                   QFLQHFARSNVNGTQLLLRGLYFTSALQTDKQLTPVYEDELSESFVLRPATAPDALEED
FT                   EQRKISDRSYFITDTFRRVIFPDRDLTLYQSRHGRDKSLGPIVIALALFAGLSFIGWQA
FT                   LSFQKNREWLAAISQQLTELEQSPDRAQRLASGQGLELLRNQLAAIEKYRTKGVPLQLS
FT                   GGLYRGDDIYFATQTAYLQQLRTQALEPITLKLQLQMREFNEFAKTMDPQYGFGATPAG
FT                   SETKTGKVRAQGQKLLDRGARNVAAGRPTSLSSIPRSTGEVANRLTGAARGTASQTRSE
FT                   AIAALRNPATANDAAELSATTGGLSLSEEMLGRLDERQVASIIESYNALKLYLILTQPT
FT                   THPETEFVNAALPVAWAGISSETNPISDDVIEDNSPVYVQLLKNGDAPAMPRNEQLIDE
FT                   TRKSLKFFMISSSLVDREYLRLQLESSRQFPAIGLNDLVPMPGRQLLYGSEAVPAIFTR
FT                   QGWEEFVKPELIKLVSGNLRNESDWVLDGEGGDSVVQKANFVREFMARYKRDYTQVWYT
FT                   MIDSVGVRRFSDMANATQQLSLLSDVRNSPVKLLLSAVNDNTQWDVPAPREAQQTGVKR
FT                   DDGFWGKVSGIFDNKEAAASVLISPLPAVDDGSLAKRFEPVSRVFAAQNAEGADSTIMD
FT                   RYLAALRKLKVRMNNIQRSQDVGKSSKQLISETLEGQPSEVTNVRNYVETTVDTSQGGL
FT                   STSLQSLFSLPIQFAWETLRDPAGEQIAKAWAKQVAKPWEQVMAHRYPIAADSRNEASV
FT                   KDLQRFVDPESGLLPNFKRNEIGNLSDGEGLGMGSGSKAAPLVNPKMVSNIDKASSLGE
FT                   VIASLSDRDNGFEIMLEPSAYFTDIIFTLDGQEQHYRNGKTSWSRFSWPGTTTAPGARL
FT                   DVVTLTGERITVFDYTGRWGLLRMNDSARVADLDGIQQRFSWNTAKGPVSLVVRNYGGV
FT                   KLTDLANVKALSALNATDGRTK"
FT   gene            complement(148075..148788)
FT                   /locus_tag="PSPPH_0126"
FT                   /note="PSPPH0126"
FT   CDS_pept        complement(148075..148788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33671"
FT                   /db_xref="GOA:Q48Q80"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q80"
FT                   /protein_id="AAZ33671.1"
FT                   /translation="MTEAVMQGAAAAATEKPTLKDLVRDFITMALIVRRGRQAISVTAF
FT                   EASVDTFFANLERQARSANYSVEQVKDAQYALCAFLDESVLRSGDNDMRRHFEMEPLQF
FT                   RYFGVHLAGEGFFEKIELLRADVKKNLDVLEVYHLCLALGFEGKFGLGQKDQLRYLANT
FT                   LGQDIARYRKTPKALSPDWALPDQVSQMLRHEVPVWLYLVLIALVCLGVYLTLDWLLGK
FT                   DVAALAEQISQLFNA"
FT   gene            complement(148785..150128)
FT                   /locus_tag="PSPPH_0127"
FT                   /note="PSPPH0127"
FT   CDS_pept        complement(148785..150128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN68701.1; match to
FT                   protein family HMM PF05936"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34216"
FT                   /db_xref="GOA:Q48Q79"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q79"
FT                   /protein_id="AAZ34216.1"
FT                   /translation="MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAESTLRSTPFHWGV
FT                   QTLEVDVEALATGSLQLKRLKLVFPDGSLYDAPQHDPLPAARDLKNLIKGGEIKVYAAL
FT                   KLPEPFGLNYVEDGQEQKSARRFRKQFDTLPDLNEGDLENEITSLRLNVVMLVDGDTLD
FT                   GYSYCPIARLARNSIGGFNLDAHFVHPTLHVGTHETLVGLGRRLISVLQAKSKALSGRR
FT                   RERADQIAEFGSSDVTLFWLLNTVNRAYPQLAHLLAHPRLHPERLYLFLAELAGGLLTF
FT                   SLDTQLTDIPDYDHQDPAASLVKLDELVRLLLENVIPNQCIVINLSQVRPSYWQGQLLD
FT                   PRLTEADFYISVHADMPGSSLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHSTRLPNA
FT                   IPVRLDNHYFSIEPHGRVYERMMEAQAISFYAPSAFTNLKLELLAVLK"
FT   gene            complement(150125..150880)
FT                   /locus_tag="PSPPH_0128"
FT                   /note="PSPPH0128"
FT   CDS_pept        complement(150125..150880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0128"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33123"
FT                   /db_xref="GOA:Q48Q78"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q78"
FT                   /protein_id="AAZ33123.1"
FT                   /translation="MNKRLQGNCSSKPALARCLAVLAMMLALSACGVTDRVAKRMDDTW
FT                   AGDMMFGDNEKVILTTDGGNQLNPDEYGKPLSVVVRVYQLSSLERFESINADTLWDDPQ
FT                   KALGNTLVESRELILLPGIGETDQWPLNPNASYVGIAAFFRTDVDSRWKVAFDANTLRK
FT                   DGIWFSSDGVRVLVDNNYILAVRGVDVLNRLKTEEQFTKSNSMPEQPAGKGITERVQDA
FT                   AVQQVQDSAGSAAKKAADSQFNSLLEGAK"
FT   gene            complement(150906..153509)
FT                   /gene="clpB1"
FT                   /locus_tag="PSPPH_0129"
FT                   /note="PSPPH0129"
FT   CDS_pept        complement(150906..153509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB1"
FT                   /locus_tag="PSPPH_0129"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36280"
FT                   /db_xref="GOA:Q48Q77"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q77"
FT                   /protein_id="AAZ36280.1"
FT                   /translation="MNLKSLFAKLNETSRTATESAAALCLSENHYDVEVEHLLLQLLDN
FT                   NDNDLPVILRHYDVVPDRLQAQLVTALGTFKKGNTRTPALSPHITRMIEQAWVLASIEF
FT                   GQSQIRTGHLIQALLDDDALRRVVIGSAPELEKINADDLRLNMSALVEGSPETKLSKPL
FT                   ANADASTGATTKGNGKPPALDQYTVNLTQSARDGRIDPVLGREFEVRQMVDILTRRRQN
FT                   NPILTGEAGVGKTAVVEGLALRIVQGDVPSVLKGVAIHTLDLGLLQAGAGVKGEFENRL
FT                   KSVIEETKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAE
FT                   YKKYFEKDAALARRFQVVKVEEPDEDKAIHMLRGLLAKMQEHHKVTVMDEALVQAVRLS
FT                   NRYITGRQLPDKAVSVLDTACARVALGQSAQPGALEDCKRHIDNLNAEITVLEQETAKG
FT                   SDHARRLTALHEELKAEQETRESLEQQWKRELELVEKLGALSVPEDGAPDAEQIAAVRA
FT                   ELASVQGEQPLVHALVDGGTIGEVISGWTGIPLGKMLRDEIDTVQSLPALLGERVLGQD
FT                   HALEEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERNVITIN
FT                   MSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQ
FT                   VFDKGVLDDGEGREINFRNTVIILTSNTGTDRIMQWCLNTEQKPTPDDIVEGLRDELNQ
FT                   VFKPAFLGRLTIVPYYPVQDAILERIVGLKLERIRKRFERNHQAVLRYDEALIKAIASR
FT                   CTEVDSGARNIDNILSKTLMPELAQRVLERMAQDKPIQSLTIDLGSDGDFAYTLT"
FT   gene            complement(153506..154576)
FT                   /locus_tag="PSPPH_0130"
FT                   /note="PSPPH0130"
FT   CDS_pept        complement(153506..154576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0130"
FT                   /product="ImpH"
FT                   /note="identified by match to protein family HMM PF06996"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37653"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q76"
FT                   /protein_id="AAZ37653.1"
FT                   /translation="MAPANRRSTPGLIDQARAEPHRFEFFQLVRLLRLHYSRNGRMDLE
FT                   TRPHEDPLRFRSQLSLNFPASEVSDLQFEREGKLSAAGLPLSEVQVTFMGLVGPSGVLP
FT                   RPYTELLIDRHIQYRDDAAHAFLDIFSHRMTTLFYEAWQKYKFYIEYERNGTSNFDRYL
FT                   LNLVGFGPEALKQKFDKGESPLRRELFSYFSGMFAQKPRNALNLEVMLSFYFSLPFKIQ
FT                   QFAGRWLKLDSSQCTQLGRKNAVLGQSAVAGNRVWDYQSCVRIEMGPLELADYQRFQPG
FT                   TEDYQKLVELVRFYIGAELDFQIAPKLKREAVPVARLGRQGNVSLGWLGWLKRPGVDVE
FT                   PSRCAVFHIPFDGVSL"
FT   gene            complement(154540..156372)
FT                   /locus_tag="PSPPH_0131"
FT                   /note="PSPPH0131"
FT   CDS_pept        complement(154540..156372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0131"
FT                   /product="ImpG"
FT                   /note="identified by match to protein family HMM PF05947"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35182"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q75"
FT                   /protein_id="AAZ35182.1"
FT                   /translation="MLDDLLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPH
FT                   TERLIEAFSFLSARVHKKLDDEFPEIVESFLEVLYPHYLRPTPSMSIVEFNMGKQEKVT
FT                   ESYRVARHTELHATPIDGIVCKFRTCYPVELWPVAVQSASFIEMERSAFNGHSADLIAR
FT                   LRIGLGATSDVLFGKMELDRLRFFLDGESTLMHQLYELLFNNLAKATLSFEDEGRIREV
FT                   VLPADALKSVGYGLDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILAGKEI
FT                   AKVEINFYFSDYDLTDRLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHVQHEYAV
FT                   TPDVRLQSSAEVVSIDRVRRVKKINGNDQVGTCHPFFEPRGDQGPGQSFWIARRRPTQS
FT                   RQSDGSNMFIRVVDRDLELIDSNNDTLSIRLTCSNRDLPLMLPFGGERGDFNIPSNSVI
FT                   KDIRCLRKPTATVRVPLGNGVIWRLISHLSLNHMSLVSKGREVLLELLSLYNYRNVSAI
FT                   RKQINGIVSVSSEPVVARIGHPRPNFVRGVGITLKFDESQYTGSGVFLFGMVLDHFFGQ
FT                   YCSMNSFTQLTLRTVQREKRVVQWPPRTGDQPLV"
FT   regulatory      complement(155095..155127)
FT                   /locus_tag="PSPPH_0131"
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans (PMID: 17073302)"
FT                   /regulatory_class="promoter"
FT   gene            complement(156372..156854)
FT                   /locus_tag="PSPPH_0132"
FT                   /note="PSPPH0132"
FT   CDS_pept        complement(156372..156854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0132"
FT                   /product="Protein of unknown function (DUF1316) subfamily"
FT                   /note="identified by match to protein family HMM PF07025"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36015"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q74"
FT                   /protein_id="AAZ36015.1"
FT                   /translation="MSSQHKLLPSLLDRLLDDRPHQSVESSSQRLSSLADYKASIVRDL
FT                   EILVNTRQSLVANELEGFANLSGTILDYGMPDFTSRSVLDPQDRLLIQRQLEKAISVGD
FT                   RRFRSVKVQLLAQQTGQRMLTFRVDAVLRLQDISRQVSFDAVLQVNTQEYKVQNLN"
FT   gene            complement(156880..158382)
FT                   /locus_tag="PSPPH_0133"
FT                   /note="PSPPH0133"
FT   CDS_pept        complement(156880..158382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN68707.1; match to
FT                   protein family HMM PF05943"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34098"
FT                   /db_xref="GOA:Q48Q73"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q73"
FT                   /protein_id="AAZ34098.1"
FT                   /translation="MTDKQPVTQQDSALVEVENFAPQSSLLDSIISESRVARSETERTR
FT                   TRDLIGELVAQVLEGEMTPSKDLIAVLDARIAEIDSMLSEQMNEIMHAREFQQLEASWR
FT                   GLKYQVDQTETSTTLKIHLLNASKKDLVRDLKASSEFDQSALFKKIYEEEYGTFGGAPF
FT                   GMLLGDYEFNRSPEDMYLLEEISHVAAAAHAPFISAASAELFGWDSFTDMAGPRDLAKI
FT                   FDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKYL
FT                   WMNAAYALGTRVTDAFSRYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAI
FT                   TDRREKELSDLGFIPLVHCKGTDYAAFFGTQSTQKQKQYNTDIANANARLSAQLQYIFA
FT                   TSRIAHYMKAIMRDKIGSFASRKDVELFLNKWLSSYVLLDDTASQEAKAKFPLREARAE
FT                   VFEVPGKPGVYKAVTYLRPHYQLDELTASLRLVAELPQSTRG"
FT   gene            complement(158397..158930)
FT                   /locus_tag="PSPPH_0134"
FT                   /note="PSPPH0134"
FT   CDS_pept        complement(158397..158930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN68708.1; match to
FT                   protein family HMM PF05591"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34356"
FT                   /db_xref="GOA:Q48Q72"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q72"
FT                   /protein_id="AAZ34356.1"
FT                   /translation="MAKKESTQHKLDRVRAPRVHITYDVDIGDAQEKKELPFVVGVLGD
FT                   FSGNPLEPLPKLKDRKFIFIDRDNFNGVLKGIKPRLAYRVDNTLAKNGTQLGVELNFNA
FT                   LEDFEPQNVVRQVEPLRKLLEVRNKLADLRNKMGGNDKLEELLMDVLQNTEKLKTLGKE
FT                   FGREAAVPATDSKE"
FT   gene            complement(158999..159883)
FT                   /locus_tag="PSPPH_0135"
FT                   /note="PSPPH0135"
FT   CDS_pept        complement(158999..159883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0135"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36815"
FT                   /db_xref="GOA:Q48Q71"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q71"
FT                   /protein_id="AAZ36815.1"
FT                   /translation="MAVRFALRTWQNHFMSRCAVEKFATLPRPRSDPGSGREGFKDDVP
FT                   MTQTFDIEALIKLRKQTRAISDALKVQASDYLSTLALLIRPQTFFGEYLQGAQRSSGRE
FT                   TQHHFKELKELYDRIASAEPFKLVNELEVPLNLISTTPELFPLEYDMVLSQSGQTIRIT
FT                   SPVRWVVGFNSFDLAQFRKVIKDPNRSSAELYRYVVHYLVLFYCLSKSPGMSRLFEGLR
FT                   FPVSFERLKDFGDLPFCVISSPVRSELPDESVIRNSTQIAGNTSFEELVGHENILEMND
FT                   EIRQRLLLTIEGL"
FT   gene            complement(160913..161734)
FT                   /locus_tag="PSPPH_0136"
FT                   /note="PSPPH0136"
FT   CDS_pept        complement(160913..161734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37350"
FT                   /db_xref="GOA:Q48Q70"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q70"
FT                   /protein_id="AAZ37350.1"
FT                   /translation="MDSTQQPEDDGIIRIQRLVPGQVDVVLGAHPSRKLSARPGKSRPY
FT                   WLWLAGLIVAGCLAGLVVSHGRSPKVVLAPPVERPAPEPETTVIDSEPTMVASPAPAPS
FT                   IHAPDLIPVAATREQPAAVQPLDNCMKSGNVIDESVLNCRFGQVPRPAQAEPAKGMVSA
FT                   DYMADFKANAARNPARSARPYSVATASIREWDGRNRYRAQWRVYGNTIDGDSVCENFAI
FT                   RSFERRECRKAAQVNFKEECREWTKRAARNRDEDSKNAEQRYCEVAATFSP"
FT   gene            161910..163837
FT                   /pseudo
FT                   /locus_tag="PSPPH_0137"
FT                   /note="PSPPH0137; ATP-dependent DNA helicase, RecQ family,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   similarity to GB:CAD76227.1"
FT   gene            complement(163896..164447)
FT                   /locus_tag="PSPPH_0138"
FT                   /note="PSPPH0138"
FT   CDS_pept        complement(163896..164447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33028"
FT                   /db_xref="GOA:Q48Q69"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q69"
FT                   /protein_id="AAZ33028.1"
FT                   /translation="MWQSCYSSELHCYILHLTPRSRRHPYEIPYMKYSSILLLSLALIS
FT                   GAASAGNLESGAGGALGGVLGSVVGQQLGGSTGSAIGAGLGGAAGGAVGADRRNRTEAA
FT                   IGGGLGAAGGNVVGRSVGGSTGSLIGSAVGGGGGAALGNYMGNESRSDDRRYRGGRDDR
FT                   RYYRDHDRRPKHHGHRRHRD"
FT   gene            complement(164567..166903)
FT                   /locus_tag="PSPPH_0139"
FT                   /note="PSPPH0139"
FT   CDS_pept        complement(164567..166903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0139"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM TIGR01701"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33698"
FT                   /db_xref="GOA:Q48Q68"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q68"
FT                   /protein_id="AAZ33698.1"
FT                   /translation="MSTHHQADKTPIPRYKPYKGAAGGWGALISVTQHWLGSDNALKNL
FT                   RMMLKTNQNGGFDCPGCAWGDSPESGMVKFCENGAKAVNWEATKRRVDPAFFARYSVSA
FT                   LLEQSDYWLEYQGRLTEPLAYDAETDRYKPISWDNAFALIAKHLKNLPSPNMAEFYTSG
FT                   RASNEAAYLYQLFVRAYGTNNFPDCSNMCHEASGVALSQSVGVGKGTVTFEDFEHADAI
FT                   FVLGQNPGTNHPRMLEPLREAVQRGAQVVCVNPLKERGLERFQHPQHPVEMLTNGDRPT
FT                   NTAYFRPALGGDMALLRGMAKFLLQWERDAQLANEPSVFDHAFLNEHTEGVLEYLAAID
FT                   DTSWDEIVEQSGLPLTDIEQSARMYAKGKNVIMCWAMGITQHRHSVATIQEIANLMLLR
FT                   GNIGRPGAGLCPVRGHSNVQGDRTMGINERPPVFLLDALEKRFQFKVPRENGHNVVEAI
FT                   HAMAEGRAKVFIALGGNFAQATPDSHRTAEALSNCDLTVQISTKLNRSHLFHGKDALIL
FT                   PCFGRTDIDIQANGPQAVTVEDSFSMVHASNGQLKPSSKQMRSEPAIIAGIANATLGKT
FT                   PVDWLWLVEDYDRIRDLIADTIPGFKDFNERVKHPGGFYLGNAAGARRWNTASTRANFK
FT                   SNALPLSLIHEDISSTGQIPDLIMQSMRSHDQYNTTIYGLDDRYRGVKGQRDVLFVNEA
FT                   DIIRLGFQPGQKADVISIWSDNRERRVKGFTLLAFDIPAGQAAAYYPEVNPLVPLESVG
FT                   DGSSTPTSKFVAIRLERSAESARII"
FT   gene            complement(166900..167736)
FT                   /gene="fdhD"
FT                   /locus_tag="PSPPH_0140"
FT                   /note="PSPPH0140"
FT   CDS_pept        complement(166900..167736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="PSPPH_0140"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="identified by match to protein family HMM PF02634;
FT                   match to protein family HMM TIGR00129"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34240"
FT                   /db_xref="GOA:Q48Q67"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q67"
FT                   /protein_id="AAZ34240.1"
FT                   /translation="MPVTRKVSSASFATPAPEASQSYSYSNLEGTDSARNELAEEVALA
FT                   IAYNGISQAVMLVSPTDLEDFIVGFSLGSGIIASHDEIYDFKISGCGSAMQAEVEIASR
FT                   AFWELKQQRRQLAGTSGCGLCGVEAVEQALPDLKALPGAPLPPIEWLEGLRQRIGEFQP
FT                   LGRHCGAVHAAVFMDGNGQLLLGREDIGRHNALDKLIGALIRQDIPLAGGVAIVTSRCS
FT                   LELIQKVLRAGIQTLVSLSSPTGLALQWARRHNLNLIHLPQHSAPRVYSPAMEIQA"
FT   gene            complement(167840..168721)
FT                   /locus_tag="PSPPH_0141"
FT                   /note="PSPPH0141"
FT   CDS_pept        complement(167840..168721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0141"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35078"
FT                   /db_xref="GOA:Q48Q66"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q66"
FT                   /protein_id="AAZ35078.1"
FT                   /translation="MDIKQLKFLIALDETRHFGHAAARCNITQPTLSMRLRNLEEELGL
FT                   PLVNRGQRFEGFTAPGERVLAWARTVLAAYDGLQAEAAACRGHLVGTLRLGVVPLSSFD
FT                   PLPLLHRLHQMHPNLRFELSSLSSEQVLEQLASNRIDLGVSYLERLDTERFDSLTLDDT
FT                   RMGLLYDRRHFTFGDEPLSWADLVELPLGTLTSGMHFRQSIDHNFHSRGLQPNPLIQTD
FT                   AVHQLLQAVHGGFCCAIMPLDGGLETLTEHLRLHPIADARTLARLGLIMRRSAPRSALA
FT                   EACFALVAEMPR"
FT   gene            complement(168763..169440)
FT                   /locus_tag="PSPPH_0142"
FT                   /note="PSPPH0142"
FT   CDS_pept        complement(168763..169440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0142"
FT                   /product="hydrolase, HAD-superfamily, subfamily IA, variant
FT                   3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33446"
FT                   /db_xref="GOA:Q48Q65"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q65"
FT                   /protein_id="AAZ33446.1"
FT                   /translation="MLSMPWSEIDTVLLDMDGTLLDLHYDEHFWMQHLPQRYAELHGVS
FT                   FAMAWLELKPLFENNAGTLNWYCLDFWSAELKLSVRDLKREIAHMIALRPDAETFLAAI
FT                   KQAGKRVIMITNAHRDSLSLKMERIELAPYFERLISSHDYGFPKESQHFWDALKADTAF
FT                   DPARSLFIDDTLPILRSARHFGVAHLLAVSQPNSQKGPKDTEEFAAVDDYRELIKGVLH
FT                   PSA"
FT   gene            169537..170103
FT                   /locus_tag="PSPPH_0143"
FT                   /note="PSPPH0143"
FT   CDS_pept        169537..170103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0143"
FT                   /product="mutT/nudix family protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33611"
FT                   /db_xref="GOA:Q48Q64"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q64"
FT                   /protein_id="AAZ33611.1"
FT                   /translation="MRQKPTVLARAIVASSRLFRVEELQLRFANGVERTYERLASRGTG
FT                   PGAVMIVAMLDADHAVLIEEYCGGTDAYELSLPKGLIEPGEDVLAAANRELKEEAGFGA
FT                   RQLELLTELSLSPGYMSQKIQVVLATDLYEERLEGDEPEPIRVDRINLRELSSLAQNAQ
FT                   FSEGRALAALYLTRDLLTQRGLFQP"
FT   gene            170100..170942
FT                   /gene="cysQ"
FT                   /locus_tag="PSPPH_0144"
FT                   /note="PSPPH0144"
FT   CDS_pept        170100..170942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="PSPPH_0144"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by similarity to SP:P22255; match to
FT                   protein family HMM PF00459; match to protein family HMM
FT                   TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37032"
FT                   /db_xref="GOA:Q48Q63"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q63"
FT                   /protein_id="AAZ37032.1"
FT                   /translation="MTDSLQNLPHPLLAPVIELVRLAGEVILPFWRANVTVTTKTDDSP
FT                   VTAADLAAHQVLVEGLQALDRSIHVLSEEDADIPFSERAKWERWWLVDPLDGTKEFISG
FT                   SEEFTVNVALIERGRVVFGVVSMPTNNRCYFGGAGLGAWRSDDIDHLQPIAVRTQPGEG
FT                   QTFTVVASRRHSSPEQEHLLAGLSSGLGHLQLTNIGSSLKFCLLAEGAADCYPRLAPTS
FT                   QWDTAAAQGVLEGAGGEVLQLDGKPFSYPARESLLNPFFLALPANAEWRDKLLVLAQS"
FT   gene            complement(171112..171585)
FT                   /locus_tag="PSPPH_0145"
FT                   /note="PSPPH0145"
FT   CDS_pept        complement(171112..171585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02447"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37834"
FT                   /db_xref="GOA:Q48Q62"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q62"
FT                   /protein_id="AAZ37834.1"
FT                   /translation="MTTIEPEHDAARELEQVLHHDIPLTREMGMRVIDWHNQTLRLHLP
FT                   LAPNVNHKNTLFGGSLYCGAVLAGWGWLHLRLREAGISDGHIVIQDGQISYPLPVRTDA
FT                   IARCEAPELALWDKFITTYQRRGRARMTLHTSITAQDSEEQAVRFVGQFVLHR"
FT   gene            complement(171572..172957)
FT                   /locus_tag="PSPPH_0146"
FT                   /note="PSPPH0146"
FT   CDS_pept        complement(171572..172957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0146"
FT                   /product="sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /note="identified by similarity to SP:P13632; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00158; match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37509"
FT                   /db_xref="GOA:Q48Q61"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q61"
FT                   /protein_id="AAZ37509.1"
FT                   /translation="MSSDTAIDSQIQVVLIDDDSHLRQALRQTLDLAGLNVLSLSEATG
FT                   LAERIGRDWPGVVVSDIRMQGMDGLELLDQLHAQDPDLPVLLITGHGDVPLAVKAMRAG
FT                   AYDFLEKPFASDAMLDSVRRALALRRLVLDNRSLRLALSDRQQLSTRLIGQSPSILRLR
FT                   EQIGALAGTRADVLILGETGAGKEVVARALHDLSNRRSGPFVAINAGALAESVVESELF
FT                   GHEPGAFTGAQKRRIGKFEFASGGTLFLDEIESMSLDVQVKLLRLLQERVVERMGSNQQ
FT                   IPLDIRIIAATKEDLRQAADQGRFRADLYYRLNVASLRIPPLRERGEDALMLFEHYADA
FT                   ASMRHGIPKHELKPGQRALLLRHNWPGNVRELQNAAERFALGLELELEGGDAEQAPPPG
FT                   GGLSDQVESFERALIAAELARPHSSVRSLAEALGVPRKTLHDKLRKHGLTFGDSSGASD
FT                   DND"
FT   gene            complement(172954..174771)
FT                   /locus_tag="PSPPH_0147"
FT                   /note="PSPPH0147"
FT   CDS_pept        complement(172954..174771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0147"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36621"
FT                   /db_xref="GOA:Q48Q60"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q60"
FT                   /protein_id="AAZ36621.1"
FT                   /translation="MTMTSAALPPRPRWRSLALLALCLAPLLWPLEHLAERYYRNVLAN
FT                   QNRQTLDLYVANLLGTLHRYETLPQILGDLPALRGALAAPSDVTTLKNANRLLSEITRQ
FT                   TGADVMYLMDANGLTLAASNSEQKDSFIGRNFSFRPYFIDALAGRTGRFFGLGTTSAKR
FT                   GYFFAGPVRDGDRVIGVLVIKVDLDHTETLWGKTPEQLLLTDQNGVVILTSNPEWRFRA
FT                   TRDLTDDEKKAIVAIQSYPTRDPRPLRIDEHAWLTQTQAIEETGWNVNILAPRALVNRQ
FT                   VRTVVAIGGAALLVLMLLLGLMMQRRRHYLDRIAFEAKARRELEMRVIERTSDLEGLNS
FT                   RLRQEVLEREQAQQELVQAQDELVQTSKLTALGTMSASISHELNQPLAAIRSYAENAEV
FT                   LLDHQRTEDARGNLKLISELTGRMASIIAHLRAFARRDRHAPESVALQPALDDALALLA
FT                   KRRRAMEVELIRDLPDATLWVQAGETRLRQVLGNLIANALDALTEKGPPRRLWISAEQT
FT                   AEGVNLYIRDNGPGFSQEALARAREPFFTTKTRTQGLGLGLAICDTLMRALGGELLFAN
FT                   HPSGGAVLTLRLRAGASGANLQPPEDLSA"
FT   gene            174775..174927
FT                   /locus_tag="PSPPH_0148"
FT                   /note="PSPPH0148"
FT   CDS_pept        174775..174927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34953"
FT                   /db_xref="GOA:Q48Q59"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q59"
FT                   /protein_id="AAZ34953.1"
FT                   /translation="MAVAEGLAMPADDKAGTGNRNTRSILTWASGAYYARRRLVRHPDI
FT                   APGGL"
FT   gene            complement(174936..175481)
FT                   /gene="rfbC"
FT                   /locus_tag="PSPPH_0149"
FT                   /note="PSPPH0149"
FT   CDS_pept        complement(174936..175481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="PSPPH_0149"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="identified by similarity to SP:P26394; match to
FT                   protein family HMM PF00908; match to protein family HMM
FT                   TIGR01221"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33013"
FT                   /db_xref="GOA:Q48Q58"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q58"
FT                   /protein_id="AAZ33013.1"
FT                   /translation="MNVVATKLPEVLILEPKVFGDERGFFYESFNARAFQAATGLTREF
FT                   VQDNHSRSQQGVLRGLHYQIENAQGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSA
FT                   ENARQLWVPEGFAHGFVVLSEHAEFLYKTTDYYTPSAERCIAWNDPDLAIDWQFDGQPN
FT                   LSAKDQQGKRLKEADLFP"
FT   gene            complement(175562..176644)
FT                   /gene="rfbB1"
FT                   /locus_tag="PSPPH_0150"
FT                   /note="PSPPH0150"
FT   CDS_pept        complement(175562..176644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB1"
FT                   /locus_tag="PSPPH_0150"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01181"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34549"
FT                   /db_xref="GOA:Q48Q57"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q57"
FT                   /protein_id="AAZ34549.1"
FT                   /translation="MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQS
FT                   IATNTRYEFVQADICDQASVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGT
FT                   YSLLEATRDYWLKLPEAERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASK
FT                   AASDHLVRAWHRTYGLPVVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQV
FT                   RDWLYVEDHARALLKVVTEGKVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPAGIA
FT                   QYNYLITYVVDRPGHDQRYAIDASKIDNDLGWTPEETFESGLRKTVQWYLDNLDWCRRV
FT                   QDGSYQGERLGFTDPKDLIA"
FT   gene            176885..179797
FT                   /pseudo
FT                   /locus_tag="PSPPH_0151"
FT                   /note="PSPPH0151; aminotransferase, class III, degenerate;
FT                   this region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to GB:CAC47276.1"
FT   gene            180221..181099
FT                   /locus_tag="PSPPH_0152"
FT                   /note="PSPPH0152"
FT   CDS_pept        180221..181099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0152"
FT                   /product="carbon-nitrogen hydrolase family protein"
FT                   /EC_number="3.5.1.6"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36705"
FT                   /db_xref="GOA:Q48Q56"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q56"
FT                   /protein_id="AAZ36705.1"
FT                   /translation="MSRIVSVAATQMACSWDLEANIETAEKLVREAAAKGAQIILIQEL
FT                   FETPYFCQKPNPDYLQLATTIESNVAIKHFQKLAKELQVVLPISFFELAGRARFNTIAI
FT                   IDADGTNLGIYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYAKIGVGICWDQWFPECA
FT                   RSMALQGAEILFYPTAIGSEPHDKTISSRDHWQRVQQGHAGANLMPLIASNRIGNEEQD
FT                   GYDITFYGSSFIANQFGEKVAELNETEEGVLVHSFDLDELEHIRSAWGTFRDRRPNLYG
FT                   AVKTLDGSLES"
FT   gene            181105..182211
FT                   /locus_tag="PSPPH_0153"
FT                   /note="PSPPH0153"
FT   CDS_pept        181105..182211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0153"
FT                   /product="peptidyl-arginine deiminase-like protein"
FT                   /note="identified by match to protein family HMM PF04371"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33821"
FT                   /db_xref="GOA:Q48Q55"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48Q55"
FT                   /protein_id="AAZ33821.1"
FT                   /translation="MTTLNSTPRADGFHMPAEWAPQTQVWMVWPERPDNWRLGGKPAQA
FT                   AHVAIAKAIARFEPVTVAVSAAQYDNARARLDVPNIRVVEMSSNDAWVRDSGPTFVINE
FT                   RGEVRGVNWEFNAWGGFDGGLYAPWNLDSQLGSKVLEIERCPRYVTKGFVLEGGSIHVD
FT                   GEGTLITTEECLLNRNRNPHLTREQIEAILGDYLAVDKVVWLPDGLFNDETDGHVDNFC
FT                   CYIRPGEVLLAWTDDPEDPNYSRCHAALGILENTLDAKGRAFIVHKMPIPGPLFATEEE
FT                   CAGVDQVHGSQERNPSVRLAGSYVNFLIVNGGIIAPSFDDPMDEKARELLQTLFPEHEV
FT                   VMAPGRELLLGGGNIHCLTQQQPAPHKA"
FT   gene            182435..182668
FT                   /locus_tag="PSPPH_0154"
FT                   /note="PSPPH0154"
FT   CDS_pept        182435..182668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36978"
FT                   /db_xref="GOA:Q48Q54"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q54"
FT                   /protein_id="AAZ36978.1"
FT                   /translation="MNAGTNQQRARGFSASLSNEARQLVADWLRTTRPAKSRPDVRAML
FT                   LQRYPAGLFNEAELEALLRVLTERVDCSGKLG"
FT   gene            182883..184157
FT                   /locus_tag="PSPPH_0155"
FT                   /note="PSPPH0155"
FT   CDS_pept        182883..184157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0155"
FT                   /product="outer membrane porin, OprD family"
FT                   /note="identified by match to protein family HMM PF03573"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33554"
FT                   /db_xref="GOA:Q48Q53"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q53"
FT                   /protein_id="AAZ33554.1"
FT                   /translation="MLNKRMGMLALGIISASQAMAEGQADSKGFVEDSRLIVNLRNAYI
FT                   NRDYKNDREDKSEWGQAFMGNFASGFTQGTVGVGVDAFALYGIRLDGGKGRSGNGGIDF
FT                   FKQGDSGAAADDLSRAGAAVKARISNTVIKYGDQMPQLPVLSYDNSRLLPESYTGTMIT
FT                   SKEIDGLEVVAGRFTQEARKSAEGRDSGDLKSINVYGASYKFTDAFSAAFYASDNEDVL
FT                   KKQYVNLNYVFALPQDQSLTFDFNGYKTKLDKDFTTSDARDNKIWSLAATWAVGIHSFT
FT                   LAHQRSTGDMGYAYGGYRNDGGFGDGGNTIYLANSYWSDFNGKDERSWQAAYGVDLSGL
FT                   VLPGLSYKAAYVRGDNIDDGTPGSGDGTEREIFSQLTYVVQSGPAKDLSIRLRNSFLRV
FT                   SDDALAYNSEGNETRIFVDYPINVF"
FT   gene            complement(184191..184721)
FT                   /locus_tag="PSPPH_0156"
FT                   /note="PSPPH0156"
FT   CDS_pept        complement(184191..184721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33440"
FT                   /db_xref="GOA:Q48Q52"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q52"
FT                   /protein_id="AAZ33440.1"
FT                   /translation="MPRIITDQTPQSVVDEQQVKLFGSPKERLDFYRREIHYETTNLSN
FT                   RTNAYLSAQSFLVIAYASSMANMNTEWGAMFTLVVPPMLALLGLLSTLFAWPGIRAACD
FT                   IIQHWHHKQSQLLLSEPVIGLTYDDSPLFSDWESSETGPKKSLLFSKRSPWLFSFFWIF
FT                   LGGFAVFVQLIAD"
FT   gene            184846..185394
FT                   /locus_tag="PSPPH_0157"
FT                   /note="PSPPH0157"
FT   CDS_pept        184846..185394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE13806.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35255"
FT                   /db_xref="GOA:Q48Q51"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q51"
FT                   /protein_id="AAZ35255.1"
FT                   /translation="MTNIPTLYTDRLLLTPLKLEDAPAIQQRFPLWEIVQYLNNRVPWP
FT                   YPEDGALHYIQDVALPAIASGTEWHWMIRLHSAPQEIIGSITLMTHRGNNRGFWLHPDW
FT                   QGNGYMKEACRVVNRQWFEVMGMPVMQVPKAVPNEASRRISINEGMRIVSTHEGEFVSG
FT                   RFEVEVWEMTREEWSARGL"
FT   gene            185495..185968
FT                   /locus_tag="PSPPH_0158"
FT                   /note="PSPPH0158"
FT   CDS_pept        185495..185968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0158"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34581"
FT                   /db_xref="GOA:Q48Q50"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q50"
FT                   /protein_id="AAZ34581.1"
FT                   /translation="MPLTRKTEPDITLVMVQPEDFETLVAIRIEAMRESLERVGRFDPV
FT                   RARERFREGFSAPCTHYIQVDGSKVGFMVVKPTSDGLLLDHLYIKPAFQGQGIGSAVLR
FT                   QVFAQADATASTVRVGALKESDSNRFYIRHGFQLVESGEFDNYYVRPQRLPMC"
FT   gene            186131..186370
FT                   /gene="relB"
FT                   /locus_tag="PSPPH_0159"
FT                   /note="PSPPH0159"
FT   CDS_pept        186131..186370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relB"
FT                   /locus_tag="PSPPH_0159"
FT                   /product="addiction module antitoxin RelB"
FT                   /note="identified by similarity to SP:P07007; match to
FT                   protein family HMM PF04221; match to protein family HMM
FT                   TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36351"
FT                   /db_xref="GOA:Q48Q49"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q49"
FT                   /protein_id="AAZ36351.1"
FT                   /translation="MASINVRIDDDLKARAYLELEKLGVTPSELLRQTLQYVAERGQLP
FT                   FKTVLMTEEDEALLATVRERLAAPQRVKVSLDDL"
FT   gene            186360..186650
FT                   /gene="relE"
FT                   /locus_tag="PSPPH_0160"
FT                   /note="PSPPH0160"
FT   CDS_pept        186360..186650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relE"
FT                   /locus_tag="PSPPH_0160"
FT                   /product="addiction module toxin RelE"
FT                   /note="identified by similarity to GB:CAA26251.1; match to
FT                   protein family HMM PF05016; match to protein family HMM
FT                   TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35637"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q48"
FT                   /protein_id="AAZ35637.1"
FT                   /translation="MTYNLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLH
FT                   ALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDKREREEVYRKATDRLGR"
FT   gene            186767..187159
FT                   /locus_tag="PSPPH_0161"
FT                   /note="PSPPH0161"
FT   CDS_pept        186767..187159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0161"
FT                   /product="ISPsy18, transposase, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37400"
FT                   /protein_id="AAZ37400.1"
FT                   /translation="MPTKKKSANATARELPSIPQELIEQFVKGPMSAEAIQDASMAFKK
FT                   ALIERALGAELGHHLGYPQGAERPEESTNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFA
FT                   PILIPKHERRFTGFDDKIIAMYVGAD"
FT   gene            complement(187305..188108)
FT                   /locus_tag="PSPPH_0162"
FT                   /note="PSPPH0162"
FT   CDS_pept        complement(187305..188108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0162"
FT                   /product="ISPsy20, transposase IstB"
FT                   /note="identified by similarity to GB:BAC55320.2; match to
FT                   protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34147"
FT                   /db_xref="GOA:Q48MW3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q48MW3"
FT                   /protein_id="AAZ34147.1"
FT                   /translation="MRDLMTELKELRLHGMASAWEELVSQGTASTASSKWLLEHLLQQE
FT                   HADRAVRSVNHQMNMAKLPMHRDLAGFDFSASSADARLVSDLSSLAFTETAQNVVFIGG
FT                   PGTGKTHLASALAVSGITAYNKRVRFFSTVDLVNLLEREKYDGKAGRIAQALLRTDLVI
FT                   LNELGYLPFSQSGGALLFHLLSKLYEHTSVVITTNLSFSEWSSVFGDAKMTTALLDRLT
FT                   HHCHIVETGNESYRLQHSTLAAQTKIKTRERKRKDGNDIEDDEPF"
FT   gene            complement(188101..188667)
FT                   /locus_tag="PSPPH_0163"
FT                   /note="PSPPH0163"
FT   CDS_pept        complement(188101..188667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0163"
FT                   /product="ISPsy20, transposase IstA"
FT                   /note="identified by similarity to GB:AAN85144.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33458"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q46"
FT                   /protein_id="AAZ33458.1"
FT                   /translation="MERTVRVSSTCLISVARNRYSVPCERVGQWVSSRLYPSRIVVIAD
FT                   ETVIASHERLFDRDQVGFDWQHYIPLIERKPGALRNGAPFADLPKPLQLLKRGLRRHTN
FT                   GDRIMMQVLAAVPIAGLEPVLVAVELVLESGSLSADHILNVVARLTSTAPPPCVETSLQ
FT                   LKVAPVANTARYDRLRTTDEENRNA"
FT   gene            189206..189700
FT                   /locus_tag="PSPPH_0164"
FT                   /note="PSPPH0164"
FT   CDS_pept        189206..189700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0164"
FT                   /product="SciM protein"
FT                   /note="identified by match to protein family HMM PF05638"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35199"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q45"
FT                   /protein_id="AAZ35199.1"
FT                   /translation="MSFDAFMKVDGVEGESLDDGHRGWIELLSYHYDAMQSISQTASSS
FT                   GGATAGGVSLGDFQISKYVDRATPKLFELCCKGSHIKNVTIRIHRAGTEKFKYLDIVLE
FT                   EVLIALVSGQGAEQSGFPVEVVTLNYGRIKFEYSQQRRADGGSAGIVSGGWDRTANKPF
FT                   A"
FT   gene            189713..190558
FT                   /locus_tag="PSPPH_0165"
FT                   /note="PSPPH0165"
FT   CDS_pept        189713..190558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33744"
FT                   /db_xref="GOA:Q48Q44"
FT                   /db_xref="InterPro:IPR041436"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q44"
FT                   /protein_id="AAZ33744.1"
FT                   /translation="MSDDGSFRVILNFAQMAAILAHESLTPAEIMSNRIFGSLRLVGGI
FT                   IELAGSGVLCALPEPTMISKVGCVAMGVHASDQLSAASTQIVTGKQTDSFAFKAGMTAA
FT                   EALGASRETGQVIGLATEFVVPLTTASMYNAFRVSSIRAGRMTIEVSEKPKNLPRKDPG
FT                   GHTRREHFQKDISGLQQRFKKVRSATVMSTFEKMDIAEWAVSQTLKANRLRILMYSKTQ
FT                   FIRKSNRLVLDFDAKQEVGWGIYRSAPDIPVAMTKVRVIIEFVEFNHMPRYILTAFPIP
FT                   "
FT   gene            complement(190536..190631)
FT                   /locus_tag="PSPPH_0166"
FT                   /note="PSPPH0166"
FT   CDS_pept        complement(190536..190631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34510"
FT                   /db_xref="GOA:Q48Q43"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q43"
FT                   /protein_id="AAZ34510.1"
FT                   /translation="MIEYSITQFFHKAYQFHISAHYKNLKESGRQ"
FT   gene            complement(191478..192626)
FT                   /locus_tag="PSPPH_0167"
FT                   /note="PSPPH0167"
FT   CDS_pept        complement(191478..192626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0167"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34326"
FT                   /db_xref="GOA:Q48Q42"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q42"
FT                   /protein_id="AAZ34326.1"
FT                   /translation="MRKARKRKHNPHIPPHIDQAALPAAIYFDHRNAGVWYTLHYDETG
FT                   TQRRRNVAPADVTLAELHQIMEHTSGVDQGTLRYVCAQFHLSDRYKKLSFKTHDDYCYS
FT                   RDVLLGIPTRLGKPLGDLLVKKLTAALIQRIVDRLADEGTPSKAAHVLRYLRRVLRWGR
FT                   NRGYLDNNPAQGIEAPVERKRRRLPEHQVMETLVDRALAFGRLARNEKGGCPEYLSYVM
FT                   EIGYLCRLRGIETITLTDAHELAEGIMTNRRKGSRDNIVRWTPRLRAAWEGAKAYRAKV
FT                   WASKSTVVPIRPDRRYIIVASHGGALRKSNLDTAWQRFITSAIEDGTIIAEQRFGLHDL
FT                   KRRGITDTVGNRADKQEASGHRDGAMMDVYDLSVPLVNPSRT"
FT   gene            192993..194647
FT                   /pseudo
FT                   /locus_tag="PSPPH_0168"
FT                   /note="PSPPH0168; conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:P51739; similarity to GB:AAL47538.1"
FT   gene            complement(195441..196412)
FT                   /locus_tag="PSPPH_0169"
FT                   /note="PSPPH0169"
FT   CDS_pept        complement(195441..196412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0169"
FT                   /product="ISPsy2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37481"
FT                   /db_xref="GOA:Q48Q41"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q41"
FT                   /protein_id="AAZ37481.1"
FT                   /translation="MTFADAEYAGKRKQTRKELFLIEMDQVVPWKGLIALIEPYYPKGE
FT                   GGRPAYPLMAMLRVHLMQNWFGYSDPAMEEALYETTILRQFSGLSLERIPDETTILNFR
FT                   RLLEKHELATGILGVINGYLGDRGLSLRQGTIVDATLIHAPSSTKNKDGKRDPEMHQTK
FT                   KGNQYYFGAKAHIGADDESGLVHSVVVTAANVADVTQVAKLLHGEENVVCADAGYTGVE
FT                   KREEHAGRKVIWQIAARHSTYKKHGKRSILYKAIRKIEKAKAQVRAKVEHPFGVIKRQF
FT                   GYEKVRFRGLAKNTAQMVTLFALSNLWMAGRHLLASAGEVRV"
FT   gene            196550..197653
FT                   /locus_tag="PSPPH_0170"
FT                   /note="PSPPH0170"
FT   CDS_pept        196550..197653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0170"
FT                   /product="ISPsy19, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37742"
FT                   /db_xref="GOA:Q48B81"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q48B81"
FT                   /protein_id="AAZ37742.1"
FT                   /translation="MPKTGRPRSIAAEHYPVLVKLAHAQPYSSQAELALVFFAETGITA
FT                   HPDTFAKALKMAGITRVKQRAKGSFQSPEPNKAYGYNETHRRQLPEQLYPSCLTDTEWA
FT                   LVADLFESQGGRGVPPLHSRRTLLEACCYVVRTGCSWRMLPRDFPHWDNVYKTFRRWSA
FT                   QGKFEQMHDRLRAQWREREERADSPSAAILDSQSTRSSPQGGDSGYDAGKKVKGRKRSL
FT                   IVDTLGLLLAVSISAASVQDRDAADDAVAYSKEKYPSLSTLFVDSAYAGKWAQRTHQLH
FT                   AIDVQVIRGPNNRRTGQWHSEQGDLFSVEPVQTGFVVMPKRWVVERTHAWNERARRLIM
FT                   HHDRLFAVSEAWVWLAEARILARRLTT"
FT   gene            complement(198685..204564)
FT                   /gene="hopR1"
FT                   /locus_tag="PSPPH_0171"
FT                   /note="PSPPH0171"
FT   CDS_pept        complement(198685..204564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hopR1"
FT                   /locus_tag="PSPPH_0171"
FT                   /product="type III effector HopR1"
FT                   /note="identified by similarity to GB:AAO54417.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37024"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q39"
FT                   /protein_id="AAZ37024.1"
FT                   /translation="MVKVTSSGFTANPLPHHADSVSPANSPPQLPEPLPLVDESPSSHK
FT                   GGMRNRAHASLNSQVLGLQAVPLQRGRHVRIRSHTDGVSVINDWLAKRPSVQSETSLDN
FT                   NGKLVRYTAMHHEPLAPRNEAFFTSVPGMLMAVLTVHPDIEYGISGEITADAVAARLAE
FT                   PPIGLLTGVWQSSHDRAYIERGGVVHTANMEERWTSLTLPGADPREPLRMIGLQADGDV
FT                   YLHNGRQLWRATDTSAESVPTERLPEGAAVRIGAGREVQWLHEGAVHSNGISRPVELLR
FT                   PEASGLGVEQSPARPVDLLPLPRGNAALILDDKGRIYQADLKGIGPVEAHRLKLPGDFA
FT                   QGKGWAVTTMGLSRDNTVHLMLQDQNGRRMSLQRAQNEVLFRPAYLLDRPLLLLYTEGL
FT                   HVPSETAVQSHVQLDGHAQVGHIDGVLHYQPAPDQPWERLRQPGGEPLTGVTALYSSAL
FT                   GFIDRKPVFALLGDARQVVELKLEGRTSWLPTDAELPRHPAGGPLAVIPDTVELRARLI
FT                   AQFDEPVQALAVHNNRQSVALMESGLLIAADADGKVRRLPLLQRPIALAIGLNDQLLVL
FT                   HHPRNQRPQLKRLSAKDDWEPVPIILPGIDHPSNLRATRTGQIQLQLGDNWHTLLPAMT
FT                   SHDNRPLPARVKPEPEADELPSENFLAGTNARVNQQQASRISTPHHDASAVTTLMGTAA
FT                   NNPLTMTSSVQAVVDTTRAQVGALARDVLGGVTKNTMRAMAHKLGVVLPPTTQERRLAS
FT                   FHYEAKQAYTSGKTLFEQLPTLAQVRVASAVGPSDGEKFGLSHQQTQRLLNLREEKLEA
FT                   LLRDLRKIGFHEGVIMGDMGDGESAGDLTSTTSTPTFRLAELWRRQHSQVNKALSSVGL
FT                   SRSEDILPNLNQSIKALAGGAALHADRMGEREAELLSVLCEVSEKIMRAGVRLPADDGS
FT                   ADSASSHAPHGLRTSGLMAGLVDYDALLTSTDTQALEMAERLQQDARLPGLCKLGLSSW
FT                   VQLAAFDDVVTTFREQISLPGSARRTQLLKNLGLPPDAAPDEMAARMSDLFLDLFNRST
FT                   FFSTQSRGLEIRGSLGGADWKHLNAFSVGITGEALQVLGVERIGDGKDGDAGLVAFFVR
FT                   HAKASVSATSGVGIDFKPGLGTGGRVLDSRPGRSMNSTWGGSANLGISGTYQHGQGAAV
FT                   IIAPSTISDFVRLLFDVNHPDSTQILRTGVNGGSIGLDLFETNLNGSVGANVSVSPFSL
FT                   SQKYGPQKPSADAAASGADNRRSTASGALSVGATAQAGAHWGQMELHLDHAWAEIIGLE
FT                   FQGRTDFNLEFNSNLNLGGALSSALGDRPQKLINASTGNGNLQLAGIRVASSDVQLPTD
FT                   SVVDDKRRGPFLSTASYKRTFDTQVAKPITADEWSQMRQRLASAFPDNIGELGALAYST
FT                   SPSERIATINQMIDRIQSSKARNVEAGGALDGNALRRQRLDAAREMSNAGNSVWQASSE
FT                   IDRASVVEMLHQLRQQEQSAVQHHARAIPGARVEFNLFGRESLETVVFHAIGHIGLGSK
FT                   LNDMAELRRKTPGLDQVMRCFQSLPNINQVRYVFEMRPQARFAINDALLAREQQASARA
FT                   LGLPGSSASELNWRGVLDKIKNTPDLYRLAAIAVHNTDENPVTSRIGLPLLNVSATGAT
FT                   SHQLFEAEIQFRYGLYDGLQGIEVLEAGSRALQSPLRVLQQSGIQALGQRTQAGDVPYG
FT                   PPSPRKEATMRTAGEAAALTTNDVWRQLDGKIQRMNSAHEREANAIGSFQHAYGTASAH
FT                   VDRLLLRIPELPAPEIDDRNADGESVRGAFASLKRNHQALDEDVKAMRQASEMVYSIPG
FT                   ERTRQTETSALAHVLSVEKSRRSLGHAMEILAGKGVEAGTATGLELNRVSSQVNALVVR
FT                   RDELLTQLERGAQEGGSNSEEMAMELQQTTSLLQRLRADLLGERQAMDATAKRLDQANR
FT                   VALEGERSFSDAVRDMTWGELDKMPQ"
FT   regulatory      complement(204736..204768)
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans; downstream gene(s) exhibit HrpL-dependent
FT                   differential expression experiment DFI screening (PMID:
FT                   15701698)"
FT                   /regulatory_class="promoter"
FT   gene            complement(205079..205555)
FT                   /locus_tag="PSPPH_5226"
FT                   /note="PSPPH5226"
FT   CDS_pept        complement(205079..205555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_5226"
FT                   /product="HrpL-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_5226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG33843"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E51"
FT                   /protein_id="ABG33843.1"
FT                   /translation="MNINNFTKVIKSLAEDLRLPAPTQTGTQFELITASGLNLVLDLVV
FT                   PDTLLISFSQNCLQKGTTEFLWNILQGNLIDDQHPAIINSDSYTNNLIISWMAIGLSDN
FT                   DRHAVLSHAERFVGYVEYLYRWVRNFISNPVVSTREDLVKIIASEGVSRINKMV"
FT   regulatory      complement(205627..205659)
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans; downstream gene(s) exhibit HrpL-dependent
FT                   differential expression experiment DFI screening (PMID:
FT                   15701698)"
FT                   /regulatory_class="promoter"
FT   gene            complement(206633..206890)
FT                   /pseudo
FT                   /locus_tag="PSPPH_0172"
FT                   /note="PSPPH0172; site-specific recombinase, phage
FT                   integrase family, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts which are not the
FT                   result of sequencing error"
FT   regulatory      206836..206868
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans (PMID: 17073302)"
FT                   /regulatory_class="promoter"
FT   gene            207138..207986
FT                   /locus_tag="PSPPH_0173"
FT                   /note="PSPPH0173"
FT   CDS_pept        207138..207986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0173"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="identified by match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33475"
FT                   /db_xref="GOA:Q48Q38"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q38"
FT                   /protein_id="AAZ33475.1"
FT                   /translation="MKGYIACVLALVPAFTQASLHMPVHIALSYDEEVGCLGVRSLLAS
FT                   LQSRPVKPMLCVIGEPTELQPVLGHKGKVAMRCDVQGAACHSAHAPIGVNAIEYAAQLI
FT                   GELGRLGEALRVADALDERFDPPFSTIQTGVISGGTALNIVPEQCRFDFEVRALPTLDP
FT                   QQIVTAMHAYAAQKLLPAMQAVSARSEIRFTELSSYPGLDIPLHSQAAELIAGFCGSRA
FT                   FGTVAFGTEGGLFDQSGIPAVVCGPGSMEQGHKPDEFISVAQLDACDEMLKRVLAFASR
FT                   P"
FT   regulatory      207821..207853
FT                   /locus_tag="PSPPH_0173"
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans (PMID: 17073302)"
FT                   /regulatory_class="promoter"
FT   gene            208088..208642
FT                   /locus_tag="PSPPH_0174"
FT                   /note="PSPPH0174"
FT   CDS_pept        208088..208642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34943"
FT                   /db_xref="GOA:Q48Q37"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q37"
FT                   /protein_id="AAZ34943.1"
FT                   /translation="MDGSMTDKRPLTRWSLAATLLLCVGTSAFAQDSALHSGKYEQLML
FT                   AVTPDHQVEGYYAEERGEDPPFSCAFYLKGNVEAGKDVAVSSWSDGAYPGTLKPSTDGV
FT                   TLTIEQGQQHSGCLNVLMPDIATGLDLTQTASKQWISLVKVKADKAWLQKTPNAKATRG
FT                   AYIVKGDVVGVLAFKDGAAQV"
FT   gene            208966..209394
FT                   /locus_tag="PSPPH_0175"
FT                   /note="PSPPH0175"
FT   CDS_pept        208966..209394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0175"
FT                   /product="ISPsy2, transposase, truncated"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34278"
FT                   /protein_id="AAZ34278.1"
FT                   /translation="MLRPRQSSILPYPMVCNRRVAKLLHGEENVVCADAGYTGVEKREE
FT                   HAGRKVIWQIAARHSTYKKHGKRSILYKAIRKIEKAKAQVRAKVEHPFGVIKRQFGYEK
FT                   VRFRGLAKNTAQMVTLFALSNLWMAGRHLLASAGEVRV"
FT   gene            209602..210705
FT                   /locus_tag="PSPPH_0176"
FT                   /note="PSPPH0176"
FT   CDS_pept        209602..210705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0176"
FT                   /product="ISPsy19, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37374"
FT                   /db_xref="GOA:Q48B81"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q48B81"
FT                   /protein_id="AAZ37374.1"
FT                   /translation="MPKTGRPRSIAAEHYPVLVKLAHAQPYSSQAELALVFFAETGITA
FT                   HPDTFAKALKMAGITRVKQRAKGSFQSPEPNKAYGYNETHRRQLPEQLYPSCLTDTEWA
FT                   LVADLFESQGGRGVPPLHSRRTLLEACCYVVRTGCSWRMLPRDFPHWDNVYKTFRRWSA
FT                   QGKFEQMHDRLRAQWREREERADSPSAAILDSQSTRSSPQGGDSGYDAGKKVKGRKRSL
FT                   IVDTLGLLLAVSISAASVQDRDAADDAVAYSKEKYPSLSTLFVDSAYAGKWAQRTHQLH
FT                   AIDVQVIRGPNNRRTGQWHSEQGDLFSVEPVQTGFVVMPKRWVVERTHAWNERARRLIM
FT                   HHDRLFAVSEAWVWLAEARILARRLTT"
FT   gene            210746..211510
FT                   /locus_tag="PSPPH_0177"
FT                   /note="PSPPH0177"
FT   CDS_pept        210746..211510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0177"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34543"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q35"
FT                   /protein_id="AAZ34543.1"
FT                   /translation="MLMRTTRKISITDYGVYYYKTCRSIFDLLHESAEVASNVIHNPEG
FT                   VLNISMPRSFGIFGFLPTLEKFYRIHPKIRVDVSISDSLVDFSENRFDAAVRLGVLSDS
FT                   SLVARPLRPYKLVLCASPAYLARKGRPATPKDLIVHDCIATYFDEYRTAWNTLQNTWEF
FT                   LCADGEFIKVSVPARMQVNDAQGVCIMVLSGQGIALLPEIIVSAHLTEGRLIELLPDYQ
FT                   IPSRPMSLVYRKNSLMPFKLKAFIGFLMDEFS"
FT   gene            211856..212719
FT                   /locus_tag="PSPPH_0178"
FT                   /note="PSPPH0178"
FT   CDS_pept        211856..212719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0178"
FT                   /product="Mg-chelatase subunits D/I family, ComM subfamily
FT                   protein"
FT                   /note="identified by similarity to SP:P45049; match to
FT                   protein family HMM PF01078"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33836"
FT                   /db_xref="GOA:Q48Q34"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q34"
FT                   /protein_id="AAZ33836.1"
FT                   /translation="MSLAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKES
FT                   KDRVRSAILNSGLDFPARRITLNLAPADLPKDGGRFDLAIALGLLAASGQVPLVALQDV
FT                   ECLGELALSGAIRPIQGVLPAALAARAAERTLIIPAVNAEEACLASGLRVIAVNHLLEL
FT                   VAHFNGRTVIAPYQSSGLLHQPKPYPDLSEVQGQTAAKRALVIAAAGAHNLLFSGPPGT
FT                   GKTLLASRLPGLLPPLDEHEALEVAAIQSVASQVPLTSWPQRPFRQPHHSASGPALVGG
FT                   GCRLSN"
FT   gene            212966..214093
FT                   /locus_tag="PSPPH_0179"
FT                   /note="PSPPH0179"
FT   CDS_pept        212966..214093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0179"
FT                   /product="ATPase, AAA family"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33718"
FT                   /db_xref="GOA:Q48Q33"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q33"
FT                   /protein_id="AAZ33718.1"
FT                   /translation="MARLALSEKNEDVRLFVARLVRQYRGMEPELAEQLETFLRTIAPS
FT                   GNGHFMRREAPSKIEGGVLPVDNESKLSLLKVFNDGPEFPAPMLDNVVQASLAQLIKER
FT                   KQTSKLLSLGLQPTRSSVFVGAPGVGKTITARWIAAQLGVPLFVLDLTAVMSSLLGKSG
FT                   ANIRAALDYAKRTPSVLFLDEIDAIAKRRSDDSDIGELKRLVTVILQEVDDWPSSSLLL
FT                   AATNHPELIDPALWRRFDLVIEFKTPDAEAVAVAIKRFLGTDLPRFEKWIGVLSYAYQK
FT                   HSFSDIERDMQRFRRSLALGSSNAEKLVEDIVRLKTPHLERAEQIEFALLLDNETSLSQ
FT                   RAIHEITGVSRDTIRKHRSVTSTPVKRSSRTSTTV"
FT   gene            214090..216300
FT                   /locus_tag="PSPPH_0180"
FT                   /note="PSPPH0180"
FT   CDS_pept        214090..216300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0180"
FT                   /product="unnamed protein product"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33093"
FT                   /db_xref="GOA:Q48Q32"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q32"
FT                   /protein_id="AAZ33093.1"
FT                   /translation="MSQTNFLIGRGELLTQSIKGVGRKIDKADAYTFKRAKERLSEQAN
FT                   EAAASLDNLSPAACPQDFGVARLVLNPSYIAKSLYPANMLRAVGLESIGSRKVKVTPES
FT                   WTRKTAPRETTTTEIFVAGKRRAFRAFSQWMETVERESDEALELTRIESILAFEPEGRI
FT                   VNPGSAQDTYFECGLHMLPAQDSTFIQQAFVAFATERGVTVHSDLGFEVGNLWFVPVQG
FT                   KQTSTLLLAEFVFLRVIRPVPKMRGLLPTTKRSGPSVGCMLPTQGPLSSDPRVAILDAG
FT                   LPQEHSIGRWLNNYRVLDEKAGDDPEGPEHGLAATSAFLFGPIEPEGSANRPYSFVDHL
FT                   RVLDEGASLENPLELYRTLGHVEEVLLSRQYEFINLSIGPDVAIEDDDVHAWTSVIDHL
FT                   LSDGSTFMTIAAGNNGTRDSIVQLDRVQVPSDCVNAVTVGAANCTSSAWARASYSARGP
FT                   GRSPGVIKPDLMAFGGGKQYFHALAPGIKHNLVPLLGTSFAAPYVLRAAVGVRAILGPD
FT                   LSPLAIKALLIHAADRNGHDTIDVGWGKIPEDLMQVITCPSGVARIVYQGELKPGKYIR
FT                   APIPLPPEALTGKVKVKATFSFASTTDPQDSASYTRAGLEVTFRPHKGKIEDGAANAKS
FT                   KSFFLKRTFATEEELRSDAGKWETVLHDSKSMYGSSLKDATFDIHYNARHNGRTADKAD
FT                   KIRYAMIITLEAPKHPNLFNEILEAYSALVEIQPQVALPVRV"
FT   gene            216810..218234
FT                   /locus_tag="PSPPH_0181"
FT                   /note="PSPPH0181"
FT   CDS_pept        216810..218234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35111"
FT                   /db_xref="GOA:Q48Q31"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q31"
FT                   /protein_id="AAZ35111.1"
FT                   /translation="MNELNRKNALAKLVEELDRLHLPPSPGAETNIEKTGPFDFVTVRD
FT                   GHQRHFNSAANRALLALAQAWQKEVPRLAIKVETKELVTLLRQTVADFHAAGKLGEDAK
FT                   QNLLAIDEYVQQILKQTTTNFAHSFPARTAEMEYIEPFVIGPVTIMTREQWLDTVDFSS
FT                   GTKQYTIDGEEANRGWKEAVLQELSPRKSPASTDAEPMPSLAASMYGPLKSGRSMVRVT
FT                   LTGYERSLSSKAARHICKTALDGLSLILGGNSNFHIQTLADERMAPVSHHTIIEENGFL
FT                   LSPGFGLTPQIPIWNGPRVKKELEKDRYRAPQDALANILHGLVTPDSHRHPLLAMRWAT
FT                   ALDWLAEGTREVNEAIALAKIGTSLDVLTEGGKFGKILDMLTHLTGWSEEKEFQVGPYP
FT                   RTLRSLVKELYDHCRSKILHGNVFDRLQSFTEMRSVGAELARIALMECALRLQRYEGED
FT                   GHTVFRDIPASPPQPE"
FT   gene            complement(220514..221149)
FT                   /locus_tag="PSPPH_0182"
FT                   /note="PSPPH0182"
FT   CDS_pept        complement(220514..221149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0182"
FT                   /product="transposition helper protein, truncated"
FT                   /note="identified by similarity to GB:AAO53612.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36461"
FT                   /protein_id="AAZ36461.1"
FT                   /translation="MTDYSHLHVDFKPVLMLSDKERIRFMGEPRWIGYQAAHNILDTLE
FT                   SLLDAPKRPRMPNLLIVGDSNNGKTTIVRHFVKNHGEGYIDEHSEAVRPVILAQAPPSA
FT                   DEKDLYAAILETFWMPYRRTDSKLVLRYQVIHTMRELKVRMLIIDEIHSMLTGAVAKQR
FT                   EVMNALKMLCNELAIPIVGVGTPDAVQVLHHTVTVKHEALCSTEVSHE"
FT   gene            complement(221146..221817)
FT                   /pseudo
FT                   /locus_tag="PSPPH_0183"
FT                   /note="PSPPH0183; transposase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error"
FT   gene            complement(222198..222554)
FT                   /locus_tag="PSPPH_0184"
FT                   /note="PSPPH0184"
FT   CDS_pept        complement(222198..222554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37430"
FT                   /db_xref="GOA:Q48Q30"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q30"
FT                   /protein_id="AAZ37430.1"
FT                   /translation="MRNIFELDATGSKMSGNSCNQIQQVRRIKPTRRSVSGVMPFRGAG
FT                   GVPFESLLERDFLKRMRFSHRVFSVVAQPCQIDFIDTSGRDQIYTPDYLVYFHQRNVSA
FT                   SQFIRPMLVEVKPA"
FT   gene            222660..223280
FT                   /locus_tag="PSPPH_0185"
FT                   /note="PSPPH0185"
FT   CDS_pept        222660..223280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0185"
FT                   /product="magnesium chelatase, subunit D/I family"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34037"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q29"
FT                   /protein_id="AAZ34037.1"
FT                   /translation="MAHHGVLFLDELPEFDRRVLEVLREPLESGHIVISRARDRVRFPA
FT                   RFQLVAAMNPCPCGYLGEPTGRCRCSTEQVQRYRNKLSGPLLDRIDLHLTVAREATALN
FT                   PDPTTSENTASAAAVVAQARERQQRRQGCANAFLDLPGLREHCALSSVDERWLETACER
FT                   LTLSLRSAHRLLKVARTLADLEQVDAIARSHLAEALQYRPSTN"
FT   gene            complement(223350..224657)
FT                   /locus_tag="PSPPH_0186"
FT                   /note="PSPPH0186"
FT   CDS_pept        complement(223350..224657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0186"
FT                   /product="citrate transporter"
FT                   /note="identified by match to protein family HMM PF03600;
FT                   match to protein family HMM TIGR00784"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33822"
FT                   /db_xref="GOA:Q48Q28"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q28"
FT                   /protein_id="AAZ33822.1"
FT                   /translation="MLTFLGFAMVIAFMYLIMSKRLTALIALILVPIIFALFGGFAAQI
FT                   GPMMLAGITKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKMVKGDPMRISVGTAVL
FT                   ALVVSLDGDGATTYMICVAAMLPLYSRVGMSPRIMAGLIILAGGVMNMTPWGGPTARAA
FT                   SALHVDASDIFVPMIPAMLAGVVAILAIAYFYGKRERARLGELHLKGDEVDHSEISVSQ
FT                   FPDARRPKLIWFNGALTFALMVALIMGLLPLPVLFMIAFSIAMIINYPNLQDQKDRVSA
FT                   HAGSVLAVVGLIFAAGIFTGILSGTGMVDAMSKSLLAVIPDALGPYLAVITALVSMPFT
FT                   FFMSNDAFYYGVLPVLSEAAAHYGISPVEMARASIVGQPVHLLSPLVPSTYLLVALAGI
FT                   EFGDHQRFTLKWAILVCMCILVAALLMGIFPFYSSM"
FT   gene            224952..225353
FT                   /locus_tag="PSPPH_0187"
FT                   /note="PSPPH0187"
FT   CDS_pept        224952..225353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0187"
FT                   /product="Protein of unknown function (DUF636) family"
FT                   /note="identified by match to protein family HMM PF04828"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33861"
FT                   /db_xref="GOA:Q48Q27"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q27"
FT                   /protein_id="AAZ33861.1"
FT                   /translation="MSEIHSGGCHCGGLRYQFDAPLRDIAHCHCSICRRTSGATVVTWI
FT                   SVPLASFTWLTGSPCAYDSSPSCVRYFCGKCGAHLALFTRNSPDEIDVTIATLDQPELA
FT                   TPSRHIWIENRLPWLRLDEHLPGVEGEPF"
FT   gene            complement(225420..226817)
FT                   /locus_tag="PSPPH_0188"
FT                   /note="PSPPH0188"
FT   CDS_pept        complement(225420..226817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN70876.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36744"
FT                   /db_xref="GOA:Q48Q26"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014627"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q26"
FT                   /protein_id="AAZ36744.1"
FT                   /translation="MTEVAHVNDPQHAPSVIRQLLEKLAISYNEVMDNKSLPPARKVQA
FT                   VLVEDAVGALLILFPQSQLLDLSRITELTGRQLTAVPHDRLQRMLTKHNLQVLPGLPAL
FT                   TSSPCLYDDRLLQEPTLLVGSGEKGLLLEISSDDFKGMLSKASAAHFGQSVAAIRPNLD
FT                   RPDDDPAEITQAMHVFTARRIQQRLEATLEIPPLAGTAQKIIKLRVDPDATIDDITGVV
FT                   ETDPALAAQVVSWAASPYYASTGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKD
FT                   QPQQTTPYWQQSIYTAAVIEGLTRAIPRASRPEAGLSYLAGLLHNFGYLLLAHVFPPHF
FT                   TLICRQLEVNPHLHHSFIEQHLLGISREQIGAWLMRYWDMPDELAIALRFQHDPHYKGE
FT                   HHVYANLVYLAVRLLRVNGIGAGPEQEIPDELFERLGLSREKANESVKKVLEAEVLLRE
FT                   LASQFSK"
FT   gene            complement(226904..228979)
FT                   /gene="recG"
FT                   /locus_tag="PSPPH_0189"
FT                   /note="PSPPH0189"
FT   CDS_pept        complement(226904..228979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="PSPPH_0189"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P24230; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF01336; match to
FT                   protein family HMM PF04851; match to protein family HMM
FT                   TIGR00643"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33271"
FT                   /db_xref="GOA:Q48Q25"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q25"
FT                   /protein_id="AAZ33271.1"
FT                   /translation="MSELSRVSVTALKGVGEAMAEKLARVGLETLQDVLFHLPLRYQDR
FT                   TRVVPIGALRPGQDAVIEGVVSGADVVMGKRRSLLIRLGDGTGVVSLRFYHFSNAQKES
FT                   MKRGTHLRCFGEARPGASGLEIYHPEYRAITGDEPAPVEQTLTPIYPTTEGLTQQRLRQ
FT                   LCQQSLAMLGPKSLPDWLPDELARDYQLAPLDDAIRYLHHPPADADVEELALGHHWAQH
FT                   RLAFEELLTHQLSQQRLRESLRSQRAPALPVAKKLPKQFLANLGFAPTGAQQRVGKEVA
FT                   YDLSQPEPMLRLIQGDVGSGKTVVAALAALQALEAGYQVALMAPTEILAEQHYINFQRW
FT                   LEPLGVGVAWLAGKLKGKARATSLEQIASGTPMVVGTHALFQDEVQFKNLALVIIDEQH
FT                   RFGVQQRLALRKKGVGGLMCPHQLIMTATPIPRTLAMSAYADLDTSILDELPPGRTPVN
FT                   TVLVADSRRLEVVERVRAACAEGRQAYWVCTLIEESEELTCKAAETTYEELSSALGEVR
FT                   VGLIHGRMKPAEKAAIMAEFKQGALQLLVATTVIEVGVDVPNSSLMIIENPERLGLAQL
FT                   HQLRGRVGRGSAVSHCVLLYHPPLSQIGRQRLGIMRETNDGFVIAEKDLELRGPGEMLG
FT                   TRQTGLLQFKVADLMRDADLLPAVRDAAQALLERWPQHVSPLLDRWLRHGQQYGQV"
FT   gene            complement(228991..229914)
FT                   /gene="oxyR"
FT                   /locus_tag="PSPPH_0190"
FT                   /note="PSPPH0190"
FT   CDS_pept        complement(228991..229914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="PSPPH_0190"
FT                   /product="oxidative stress regulatory protein OxyR"
FT                   /note="identified by similarity to GB:AAK72465.1; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33160"
FT                   /db_xref="GOA:Q48Q24"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q24"
FT                   /protein_id="AAZ33160.1"
FT                   /translation="MTLTELRYIVTLAQEQHFGHAAERCHVSQPTLSVGVKKLEDELGV
FT                   LIFERSKSAVRLTPVGEGIVAQAQKVLEQAQGIRELAQAGKNQLTAPLKVGAIYTVGPY
FT                   LFPHLIPQLHRVAPQMPLYIEENFTHVLRDKLRNGELDAVIIALPFNEADVLTLPLYDE
FT                   PFSVLMPADHPWTQKETIDASALNDKSLLLLGEGHCFRDQVLEACPTLGKGNEGAKHTT
FT                   VESSSLETIRHMVASGLGISILPLSAVDSHHYAPGVIEVRPLTPPVPFRTVAIAWRASF
FT                   PRPKAIEILADSARLCSVARPKTVAS"
FT   gene            complement(230007..230753)
FT                   /gene="tonB1"
FT                   /locus_tag="PSPPH_0191"
FT                   /note="PSPPH0191"
FT   CDS_pept        complement(230007..230753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB1"
FT                   /locus_tag="PSPPH_0191"
FT                   /product="ferric siderophore transporter, periplasmic
FT                   energy transduction protein TonB"
FT                   /note="identified by similarity to SP:Q05613; match to
FT                   protein family HMM PF03544; match to protein family HMM
FT                   TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34742"
FT                   /db_xref="GOA:Q48Q23"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q23"
FT                   /protein_id="AAZ34742.1"
FT                   /translation="MISTRQKLTRYSGSLLLVLAVHAIAIIIAVRWPASQAIELPPAAM
FT                   MVELAPLPEPAPPPPPKVVQPPPPPAPEEPEPMPEVAQAPKPEIVVPKKVEKPKPKPQP
FT                   PKPQKKPEPPQEKPADEKPVDTPPTTAKPEKAAAPKPAPAPAPPSNALPSWQGDLLSHL
FT                   SKYKKYPEDARRRGMQGVARLRFVVDADGNVLSYSIANSSGSPALDRATMEMIRRAQPL
FT                   PKPPKEILNNGTIEILAPFVYSLDKR"
FT   gene            complement(230750..231175)
FT                   /gene="exbD1"
FT                   /locus_tag="PSPPH_0192"
FT                   /note="PSPPH0192"
FT   CDS_pept        complement(230750..231175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="PSPPH_0192"
FT                   /product="TonB system transport protein ExbD1"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35438"
FT                   /db_xref="GOA:Q48Q22"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q22"
FT                   /protein_id="AAZ35438.1"
FT                   /translation="MGLHLNEGGDDLAENHEINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   KVDLPASTATPQPRPEKPIFLSVKTDKSLYLGEEKVAREQIGQVLDARTKGKKDTTIFF
FT                   QADKGVDYGDLMEVMNTLRGAGYLKVGLVGLQTAGKK"
FT   gene            complement(231179..232123)
FT                   /gene="exbB1"
FT                   /locus_tag="PSPPH_0193"
FT                   /note="PSPPH0193"
FT   CDS_pept        complement(231179..232123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /locus_tag="PSPPH_0193"
FT                   /product="TonB system transport protein ExbB1"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35524"
FT                   /db_xref="GOA:Q48Q21"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014164"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q21"
FT                   /protein_id="AAZ35524.1"
FT                   /translation="MTRIQSIASPTRMPRLPRAWRGVAALVLSLMFVPMALADQSAPTA
FT                   ASAAPAATAPVVPDAAAPVQAMEPAAEDNSLGMAHDLSPWGMYQNAEVVVKAVMIGLAI
FT                   ASIITWTIWISKGFELLGAKRRLRGEIVNLKKARSLNEASSTASKEGTLAHLLVHDALE
FT                   EMRLSANSREREGIKERVSFRLERLVAACGRNMSMGTGVLATIGSTAPFVGLFGTVWGI
FT                   MNSFIGIAKTQTTNLAVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGYKAQVSD
FT                   ASAHVLLLVSRDLDHLPEPTERNQQQPHMVKVG"
FT   gene            232333..233181
FT                   /locus_tag="PSPPH_0194"
FT                   /note="PSPPH0194"
FT   CDS_pept        232333..233181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0194"
FT                   /product="ActC family protein"
FT                   /note="identified by similarity to GB:AAK38651.1; match to
FT                   protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35669"
FT                   /db_xref="GOA:Q48Q20"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q20"
FT                   /protein_id="AAZ35669.1"
FT                   /translation="MTAPSLLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVHG
FT                   VAGDLFDTRKPALWPAAALDYVVYCATPSKRDEAGYRMAYVEGLRNVLSWLEQTGQRPK
FT                   RLIFVSSSGVYGQQNGEWVDEDSITEPANYTGTVMLEAEQLALNSGLPATAVRLTGIYG
FT                   PGRSDLSNRVRQGHSVRIDPPVYANRIHADDAASLLEHLLQADQRGVALESCYLGVDDD
FT                   PAALADVVAWIREYLGVTEWSEEVSVQRVGSKRCSNARARALGWTPMYPDYRAGYAALL
FT                   G"
FT   gene            complement(233233..233970)
FT                   /locus_tag="PSPPH_0195"
FT                   /note="PSPPH0195"
FT   CDS_pept        complement(233233..233970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0195"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37756"
FT                   /db_xref="GOA:Q48Q19"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q19"
FT                   /protein_id="AAZ37756.1"
FT                   /translation="MRSALAISLLAVILGGCASHADRNPDGTWINQTAIDAAVKQGNLR
FT                   QALLANSPNLEWKINSKANQAIYSNGFELGEGKIVSAAEGKLHIDFYGNFFEDLSVKGD
FT                   ELVQAASESGPEQHFQKPENPAPEGAQPGTSFEKALYGAYMGGKWTIVEGDGQGSTVQF
FT                   MPDGSVQGLPENDRYALCLAGDCAAMSGEYDSMWLEKAEKGNPWIFARKGKQLEIFQAM
FT                   NNAGADQMPELRPGPRRWLLEQQ"
FT   gene            complement(234025..234405)
FT                   /locus_tag="PSPPH_0196"
FT                   /note="PSPPH0196"
FT   CDS_pept        complement(234025..234405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0196"
FT                   /product="endoribonuclease L-PSP, putative"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34577"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q18"
FT                   /protein_id="AAZ34577.1"
FT                   /translation="MTKTVITSDKAPAAIGPYSQAIKAGNTVYMSGQIPLDPSSMELVE
FT                   GIEAQITQVFENLKSVAEAAGGSFKDIVKLNIFLTDLGHFAKVNEIMGTYFTQPYPARA
FT                   AIGVAALPRGAQVEMDAILVIE"
FT   gene            complement(234430..236535)
FT                   /gene="spoT"
FT                   /locus_tag="PSPPH_0197"
FT                   /note="PSPPH0197"
FT   CDS_pept        complement(234430..236535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="PSPPH_0197"
FT                   /product="guanosine-3,5-bis(diphosphate)
FT                   3-pyrophosphohydrolase"
FT                   /EC_number="3.1.7.2"
FT                   /note="identified by similarity to SP:P17580; match to
FT                   protein family HMM PF01842; match to protein family HMM
FT                   PF01966; match to protein family HMM PF02824; match to
FT                   protein family HMM PF04607; match to protein family HMM
FT                   TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36567"
FT                   /db_xref="GOA:Q48Q17"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q17"
FT                   /protein_id="AAZ36567.1"
FT                   /translation="MPSIDALAERLSAYLGKDQVNLVRRAYFYAEQAHDGQRRRSGEAY
FT                   VTHPLAVANILADMHMDHQSLMAAMLHDVIEDTGIAKEALSAQFGETVAELVDGVSKLT
FT                   QMNFETKAEAQAENFQKMAMAMARDIRVILVKLADRLHNMRTLEVLSGEKRRRIAKETL
FT                   EIYAPIANRLGMHSVRIEFEDLGFKAMYPMRSSRINQAVKRARGNRKELVNKIEESLSH
FT                   CLAVDGIEGDVSGRQKHLYGIYKKMRGKRRAFNEIMDVYAFRIIVDKVDTCYRVLGAVH
FT                   NLYKPLPGRFKDYIAIPKANGYQSLHTTLFGMHGVPIEIQIRTREMEEMANNGIAAHWL
FT                   YKSSDDEQPKGTHARARQWVKGVLEMQQRAGNSLEFIESVKIDLFPDEVYVFTPKGRIM
FT                   ELPKGSTAVDFAYAVHTDVGNSCIACRINRRLAPLSEPLQSGSTVEIVSAPGARPNPAW
FT                   LNFVVTGKARTHIRHALKLQRRSESINLGERLLNKVLNGFECSLDKITQERIQLVLNEY
FT                   RVEVLEDLLEDIGLGNRMAYVVARRLLGEGEQLPSPEGPLAIRGTEGLVLSYAKCCTPI
FT                   PGDPIVGHLSAGKGMVVHLDNCRNISEIRHNPEKCIQLSWAKDVTGEFNVELRVELEHQ
FT                   RGLIALLASSVNAADGNIEKISMDERDGRISVVQLVVSVHDRVHLARVIKKLRALTGVT
FT                   RITRMRA"
FT   gene            complement(236596..236937)
FT                   /gene="rpoZ"
FT                   /locus_tag="PSPPH_0198"
FT                   /note="PSPPH0198"
FT   CDS_pept        complement(236596..236937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="PSPPH_0198"
FT                   /product="DNA-directed RNA polymerase omega chain (RNAP
FT                   omegasubunit) (Transcriptase omega chain) (RNA polymerase
FT                   omega subunit)"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01192;
FT                   match to protein family HMM TIGR00690"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33420"
FT                   /db_xref="GOA:Q48Q16"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48Q16"
FT                   /protein_id="AAZ33420.1"
FT                   /translation="MLSACKLSSPLAHPGIAYPHLLRGIPMARVTVEDCLEHVDNRFEL
FT                   VMLSTKRARQLATGGKEPKLAWENDKPTVMALREIAAGLMDYAVIAEAEIVEDEPLFAA
FT                   FEDESNEAV"
FT   gene            complement(237007..237672)
FT                   /gene="gmk"
FT                   /locus_tag="PSPPH_0199"
FT                   /note="PSPPH0199"
FT   CDS_pept        complement(237007..237672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="PSPPH_0199"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34297"
FT                   /db_xref="GOA:Q48Q15"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48Q15"
FT                   /protein_id="AAZ34297.1"
FT                   /translation="MSKAEPDMTHITGTLYIISAPSGAGKTSLVKALMDAQQEPQHGAQ
FT                   AKIRVSVSHTTRAMRPGEVNGVNYNFVDRAEFVRMIEHGDFLEQAEVFGNLYGTSQSHL
FT                   QQTLDEGHDLILEIDWQGARQVRAQMPQARSIFILPPTQQALRQRLTNRGQDSDEIIEA
FT                   RMREAVSEMSHYNEYEYVVVNDDFAGALEDLKAIFRANRLTQQHQQEQYSELFQELLA"
FT   gene            complement(237665..238528)
FT                   /locus_tag="PSPPH_0200"
FT                   /note="PSPPH0200"
FT   CDS_pept        complement(237665..238528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0200"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /note="identified by match to protein family HMM PF03755;
FT                   match to protein family HMM TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33583"
FT                   /db_xref="GOA:Q48Q14"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q14"
FT                   /protein_id="AAZ33583.1"
FT                   /translation="MVHSMTAFARVERAGAQGTLSWELRSVNHRYLEPHLRLPESFRDL
FT                   EGAIREALRQGLSRGKVECTLRFVEETAGKPLQVDLERAGQLIAAAESVAGLIKQPAAL
FT                   NPLEVLAWPGVLVADASDPQVLNTEALKLFNDALTELKSGRGREGADLARLLDDRLSSI
FT                   VEEVATLRTLVPQMLATQRQKVLDRFADMKAELDPQRLEQEMVLLAQKSDVAEELDRLS
FT                   THVTEVRRVLKAGGQAGRRLDFLMQELNREANTLGSKAFDPRSTQAAVNLKVLIEQMRE
FT                   QVQNIE"
FT   gene            238677..239561
FT                   /gene="rph"
FT                   /locus_tag="PSPPH_0201"
FT                   /note="PSPPH0201"
FT   CDS_pept        238677..239561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="PSPPH_0201"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by match to protein family HMM PF01138;
FT                   match to protein family HMM PF03725; match to protein
FT                   family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33204"
FT                   /db_xref="GOA:Q48Q13"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q13"
FT                   /protein_id="AAZ33204.1"
FT                   /translation="MTQGVPCDHARASKALIQSLLFVANRHWRLLEMPSGSCDLYNAQQ
FT                   FSVSVQVSQMKRPSGRAADQLRSIRITRNYTKHAEGSVLVEFGDTKVICTVSVENGVPR
FT                   FLKGQGQGWLTAEYGMLPRATGERNQREASRGKQGGRTLEIQRLIGRSLRAALDMSKLG
FT                   DVTLYVDCDVIQADGGTRTASITGAMVALADALKVIKKRGGLKGGDPLKQMIAAVSVGM
FT                   YQGEPVLDLDYPEDSAAETDLNVVMTSAGGFIEVQGTAEGAPFQPEELNAMLALAQKGM
FT                   TELFELQRAALAD"
FT   gene            239582..239950
FT                   /locus_tag="PSPPH_0202"
FT                   /note="PSPPH0202"
FT   CDS_pept        239582..239950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37757"
FT                   /db_xref="GOA:Q48Q12"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q12"
FT                   /protein_id="AAZ37757.1"
FT                   /translation="MSDSLQPFSKPPQSARQWAMFCHLSAFAGLMFPFGNLLGPLIIWQ
FT                   LKKDSDPFIDAQGKEALNFQITVAIAATVSMLLVLLIIGFALLTLVGIGAAVLAIIAGI
FT                   KANDGVDYRYPFTLRLIK"
FT   gene            complement(240019..240798)
FT                   /locus_tag="PSPPH_0203"
FT                   /note="PSPPH0203"
FT   CDS_pept        complement(240019..240798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0203"
FT                   /product="exodeoxyribonuclease III, putative"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37059"
FT                   /db_xref="GOA:Q48Q11"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q11"
FT                   /protein_id="AAZ37059.1"
FT                   /translation="MRIISVNVNGIQAAVERGLLSWLQAQNADVICLQDTRASTFELDD
FT                   PAFQLDGYFLYACEAEVPAQGGVALYSRLQPKAVISGLGFETADRYGRYLQADFDKVSI
FT                   ATLLFPSGMNGDEDLNQKFKLMDDFGKYMDKQRRKRREYIYCGSLYVAQQKLDIKNWRD
FT                   SQQSPGFLAPERAWMDEIVGTMGYVDALREVSREGDQYSWWPDNEQAEMLNLGWRFDYQ
FT                   ILTPGLRRFVRSARLPRQPRFSQHAPLIVDYDWTLTI"
FT   gene            240881..241522
FT                   /gene="pyrE"
FT                   /locus_tag="PSPPH_0204"
FT                   /note="PSPPH0204"
FT   CDS_pept        240881..241522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="PSPPH_0204"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36832"
FT                   /db_xref="GOA:Q48Q10"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48Q10"
FT                   /protein_id="AAZ36832.1"
FT                   /translation="MQAYQRDFIRFAIDRGVLRFGEFTLKSGRTSPYFFNAGLFNTGSA
FT                   LAQLGRFYAAAVVESGIAFDVLFGPAYKGIPLASATAVALAEHHDRDLPWCFNRKEAKA
FT                   HGEGGSLVGSPLAGNVLIIDDVITAGTAIREVMQIIKDQSATAAGVLIALNRQERGNGE
FT                   LSAIQEVERDFGIPVVSIVSLNQVLEFLADDPQLKQHLPAVEAYRMQYGI"
FT   gene            241533..242165
FT                   /locus_tag="PSPPH_0205"
FT                   /note="PSPPH0205"
FT   CDS_pept        241533..242165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36374"
FT                   /db_xref="GOA:Q48Q09"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q09"
FT                   /protein_id="AAZ36374.1"
FT                   /translation="MAVSGTERASVSGVLSVLGFWLALGMLAPLLAQAADAPEARLYRY
FT                   VDSRGVTVIDTQGVPPDYVAKGYEVLNGRGRVIQVVPPAPTAEQIRQSEADKRQAAADA
FT                   QLLSLYSSVDEVDRVKVRKLAELDALIGVAQGNIQGLAAQQRNLQGQAADLERAGRPVQ
FT                   QGLVDQLNDLRDQQQKLQTDIAGYQAARVKAEAGFAEDRLRVQRLTQ"
FT   gene            complement(242377..243282)
FT                   /gene="argB"
FT                   /locus_tag="PSPPH_0206"
FT                   /note="PSPPH0206"
FT   CDS_pept        complement(242377..243282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="PSPPH_0206"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36759"
FT                   /db_xref="GOA:Q48Q08"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48Q08"
FT                   /protein_id="AAZ36759.1"
FT                   /translation="MTLERDAASNVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELK
FT                   TGFARDIVLMKAVGINPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAQTMDVVEMVL
FT                   GGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGQVGEVV
FT                   GVNTGLLNMLVKGDFIPVIAPIGVGPDGESYNINADLVAGKVAEALKAEKLILLTNIAG
FT                   LMNKQGEVLTGLTTEQVDGLIADGTIYGGMLPKIRCALEAVQGGVNSSHIIDGRVPNAV
FT                   LLEIFTDSGVGTQITNRKRH"
FT   gene            complement(243311..244708)
FT                   /gene="algC"
FT                   /locus_tag="PSPPH_0207"
FT                   /note="PSPPH0207"
FT   CDS_pept        complement(243311..244708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algC"
FT                   /locus_tag="PSPPH_0207"
FT                   /product="alginate biosynthesis protein AlgC"
FT                   /EC_number="5.4.2.8"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37738"
FT                   /db_xref="GOA:Q48Q07"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q07"
FT                   /protein_id="AAZ37738.1"
FT                   /translation="MNSPASVAPNLPETIFRAYDIRGVVGDTLNAETAYWIGRAIGSES
FT                   LAQNEPNVSVGRDGRLSGPELVQQLIQGLHDSGCHVSDVGLVPTPALYYAANVLAGKTG
FT                   VMLTGSHNPKDYNGFKIVIAGDTLANEQIQALHERIKTNNLTSQKGSITKVDILDRYFK
FT                   QIKDDIVMARKLKVVVDCGNGAAGVIAPQLIEALGCEVISLFAEVDGNFPNHHPDPGKL
FT                   ENLQDLIAKVKETGADLGLAFDGDGDRVGVVTNKGNVVYPDRLLMLFALDVLKRNPGAD
FT                   IIFDVKCTRRLTPLISEHGGRPVMWKTGHSLIKKEMKKSGALLAGEMSGHIFFKERWFG
FT                   FDDGIYSAARLLEILSQESANAEDLFETFPNDISTPEINVKVTDVTKFSIIKALETDAQ
FT                   WGDAKLTTIDGVRVDYPKGWGLVRASNTTPVLVLRFEAETEAELQRIKDVFHAELKKVA
FT                   PDLDLPF"
FT   gene            complement(245948..246403)
FT                   /gene="dut"
FT                   /locus_tag="PSPPH_0208"
FT                   /note="PSPPH0208"
FT   CDS_pept        complement(245948..246403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="PSPPH_0208"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by similarity to SP:P06968; match to
FT                   protein family HMM PF00692; match to protein family HMM
FT                   TIGR00576"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33315"
FT                   /db_xref="GOA:Q48Q06"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48Q06"
FT                   /protein_id="AAZ33315.1"
FT                   /translation="MHALQAKILDPRIGNEFPLPAYATVGSAGLDLRAMLKEDTVLEPG
FT                   QTLLIPTGLSIYIGDPGLAALILPRSGLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG
FT                   QTAFNIAVGERIAQLVLVPVVQAHFELVEAFDESQRGAGGFGHSGSH"
FT   gene            complement(246410..247657)
FT                   /gene="coaBC"
FT                   /locus_tag="PSPPH_0209"
FT                   /note="PSPPH0209"
FT   CDS_pept        complement(246410..247657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="PSPPH_0209"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM PF04127; match to protein
FT                   family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34137"
FT                   /db_xref="GOA:Q48Q05"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q05"
FT                   /protein_id="AAZ34137.1"
FT                   /translation="MGVAYSLDQKGRSMQRLYRKRIVLGVGGGIAAYKSAELVRRLRDQ
FT                   GAEVRVVMTKGGAEFITPLTMQALSGHPVHLDLLDPAAEAAMGHIELAKWADLILIAPA
FT                   TADLIARLAQGIANDLLTTIVLATDATVAIAPAMNQAMWRDASVQANTRQLEERDFRVF
FT                   GPASGSQACGDVGFGRMLEADDLTQCAADCFQRLSLTGKHVLITAGPTQENIDPVRYIT
FT                   NHSSGKMGFALAEAAVEAGARVTLITGPVNLPTPDRVSRIDVVSARDMLAACEAAIPCD
FT                   LFVASAAVADYRPEVVAPHKLKKDPSNGDGLLLQMVRNPDILATIATRPDRPFSVGFAA
FT                   ETEHLLDYAARKLKDKNLDLIVANDVANPSIGFNSEENACSVIDRALHATLFAQTSKAK
FT                   IARQLITFIADRMNQV"
FT   gene            247754..248428
FT                   /gene="radC"
FT                   /locus_tag="PSPPH_0210"
FT                   /note="PSPPH0210"
FT   CDS_pept        247754..248428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="PSPPH_0210"
FT                   /product="DNA repair protein RadC"
FT                   /note="identified by match to protein family HMM PF04002;
FT                   match to protein family HMM TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34699"
FT                   /db_xref="GOA:Q48Q04"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48Q04"
FT                   /protein_id="AAZ34699.1"
FT                   /translation="MSIRSWPAAERPRERLLELGAGSLSDAELLAIFLRTGVAGKSAVD
FT                   LARHLLNQFDGLRSLLDADLSTFTSQLGLGPAKFAQLQAVMEMARRHMAESLRRDSALE
FT                   NPTQVRNYLKAQLRHEQHEVFACLFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMA
FT                   HNAASLILCHNHPSGITTPSRSDIDLTKRLKEALMLVDVHVLDHVIVGDGEPLSMVERG
FT                   LM"
FT   gene            complement(248585..250171)
FT                   /locus_tag="PSPPH_0211"
FT                   /note="PSPPH0211"
FT   CDS_pept        complement(248585..250171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0211"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35550"
FT                   /db_xref="GOA:Q48Q03"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q03"
FT                   /protein_id="AAZ35550.1"
FT                   /translation="MRLAALPFLLVPLLLPIAAQASSLVVCTEASPEGFDVVQYNSLTT
FT                   TNASADVLMNRLVDFDAQSGKLVPSLAESWTVSKDGLTYDFKLRSGVKFHTTDYFKPSR
FT                   ELSADDVLFSFQRMLDPQNPWHKIAQSGFPHAQSMQLPALIKSIEAPDAHSVRFTLNRA
FT                   DSTFLATLSMGFASIYSAEYTAQLLKAGTPEKLNSQPIGTGPFVFKRFQKDAVVRYEAF
FT                   KDYFAGKSDVDTLVYAITADANVRLQKVRQNECQIALSPKPLDIQAASEDDSLKVEKTE
FT                   AFMTAFVAINSQHPPFDKPEVRQAINLAFDKANYLKAVFEGTAEAANGPYPPNTWSYAK
FT                   DLPGYHHDVAKAKTLLAKAGLKDGFKTTIWTRPSGSLLNPNPSLGAQLLQSDLKQIGID
FT                   AEIKIIEWGELIRRAKAGEHDLLFMGWAGDNGDPDNFLTPQFSCAAVQSGTNFARYCDK
FT                   TLDKLITDGKSVSDQGERSKLYHSAQQQIQQQALWIPLAHPTAAALVRKDVTGYQVSPF
FT                   GRQDFYKVQVK"
FT   gene            250536..250769
FT                   /gene="rpmB"
FT                   /locus_tag="PSPPH_0212"
FT                   /note="PSPPH0212"
FT   CDS_pept        250536..250769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="PSPPH_0212"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36091"
FT                   /db_xref="GOA:Q48Q02"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48Q02"
FT                   /protein_id="AAZ36091.1"
FT                   /translation="MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEGEKR
FT                   FVRLRVSAKGMRIIDKRGIEVVLAELRRDGKI"
FT   gene            250781..250936
FT                   /gene="rpmG"
FT                   /locus_tag="PSPPH_0213"
FT                   /note="PSPPH0213"
FT   CDS_pept        250781..250936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="PSPPH_0213"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35556"
FT                   /db_xref="GOA:Q48Q01"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q01"
FT                   /protein_id="AAZ35556.1"
FT                   /translation="MRELIRLVSSAGTGHFYTTDKNKRTTPDKIEIKKFDPVVRKHVIY
FT                   KEGKIK"
FT   gene            complement(251018..251386)
FT                   /locus_tag="PSPPH_0214"
FT                   /note="PSPPH0214"
FT   CDS_pept        complement(251018..251386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0214"
FT                   /product="Transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF05899"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33808"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q48Q00"
FT                   /protein_id="AAZ33808.1"
FT                   /translation="MSIESIVDFSEASTAAEHYRPAPEKVFKGDPAQTLYNHYNSPCGQ
FT                   MSAGVWNGEPGQWQVNYSEHEYCEIVQGVSVLRDEQGNAKTLRAGDRFVIPAGFKGTWE
FT                   VLETCRKIYVVFEAAADK"
FT   gene            251626..253119
FT                   /locus_tag="PSPPH_0215"
FT                   /note="PSPPH0215"
FT   CDS_pept        251626..253119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0215"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34381"
FT                   /db_xref="GOA:Q48PZ9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PZ9"
FT                   /protein_id="AAZ34381.1"
FT                   /translation="MTTLTRADWEQRAQHLKIEGRAFIQGEYTAASSGETFDCISPVDG
FT                   RMLAKVASCDTADAQRAVDSARSAFNSGAWSRLAPAKRKETMIRFAGLLKQNAEELALL
FT                   ETLDMGKPIGDSFGVDIPGAARALSWSGEAIDKLYDEVAATPHDQLGLVTREPVGVVAA
FT                   IVPWNFPLMMACWKLGPALSTGNSVILKPSEKSPLTAIRIAQLAIEAGIPAGVLNVLPG
FT                   YGHTVGKALALHMDVDTVVFTGSSKIAKQLMIYAGESNMKRVWLEAGGKSPNIVFADAP
FT                   DLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKERFLPMVLEALATWKPGNPLDPATN
FT                   VGALVDTQQMNTVLSYIEAGHAEGARLVAGGKRILQETGGTYVEPTIFDGVNNAMKIAQ
FT                   EEIFGPVLSVLTFDSDEEAIQIANDTPYGLAAAVWTANISRAHLTAKALRAGSVWVNQY
FT                   DGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKSTWIKL"
FT   gene            253704..254852
FT                   /locus_tag="PSPPH_0216"
FT                   /note="PSPPH0216"
FT   CDS_pept        253704..254852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0216"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34986"
FT                   /db_xref="GOA:Q48PZ8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PZ8"
FT                   /protein_id="AAZ34986.1"
FT                   /translation="MRWGTYFAVLASVLGVGLAMGVSMPLVSLRLADWGYGSFAIGIMA
FT                   AMPAVGVLVGAALASRLAARFGTAKLMRLCLWGGAVSVGALALLPYYGVWLVLRLALGV
FT                   ILTIVFVLGESWINQLVIERLRGRLVALYGSTYALSQLAGPLLLGVIGTQADYGFWIGV
FT                   LLLVGSPFLLLGRTGAPSTESCNVTFTDLAGFCRGMPAIAWAVALFAAFEALILTLLPL
FT                   YCIRHGFTPEVALIMVSVVVIGDALLQLPIGMLADRVSRRAMFTGCAVLLLASSLLVPL
FT                   LIDTVLIWPLWTVFGASAGGLFTLSLILIGERYRDDSLVRANAHVAQLWGIGCLIGPLI
FT                   AGAGSQWVSGEALPLLMAAGAFGLLILIRRRGAFGVAQAAPA"
FT   gene            complement(254849..256429)
FT                   /locus_tag="PSPPH_0217"
FT                   /note="PSPPH0217"
FT   CDS_pept        complement(254849..256429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0217"
FT                   /product="phospholipase D family protein"
FT                   /note="identified by similarity to GB:AAO53649.1; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36201"
FT                   /db_xref="GOA:Q48PZ7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PZ7"
FT                   /protein_id="AAZ36201.1"
FT                   /translation="MNNSWALPFCLLVALCVSGCAHQQLASEPSQAMPPSSSAFGRSIQ
FT                   AMAMPHDGRSGFRLLPDSSDAFKARAELIRNAKSSLDLQYYIVHDGLSTRALIDELLKA
FT                   ADRGVRVRILLDDTTSDGLDQAIATLAAHPNIQIRLFNPQNLGRETGITRSLGRLMNLS
FT                   RQHRRMHNKLWLADGSVAIVGGRNLGDEYFDAEPNLNFTDIDMLSVGPVAEQLGHSFDQ
FT                   YWNSTLSKPIDAFMYFLPDGEDLAQARQRLDDSLEQAHQQHKALYERLMAYKTQPRMKT
FT                   WLNELVWAHNQALWDAPTKVLAQGDPDPHLLLTTQLAPELLNTRKELMLISAYFVPGQE
FT                   GLLYLTGRADAGVNVSLLTNSLEATDVPAVHGGYAPYRKALLEHGVKLFELRRQPGDTE
FT                   TMRGSGPHLFKKSSSLASSESSLHSKAMIFDRQKVFVGSFNFDPRSVLWNTEVGVLVDS
FT                   PQLAEELRELTLQGMAPSLTYQAKLEDGKVVWVTEDNGQIHTLHTEPGDWWRRFNAWMS
FT                   RAIGLERML"
FT   gene            complement(256502..257923)
FT                   /locus_tag="PSPPH_0218"
FT                   /note="PSPPH0218"
FT   CDS_pept        complement(256502..257923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0218"
FT                   /product="transcriptional regulator, GntR
FT                   family/aminotransferase, classes I and II family protein"
FT                   /note="identified by similarity to SP:P39389; match to
FT                   protein family HMM PF00155; match to protein family HMM
FT                   PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36920"
FT                   /db_xref="GOA:Q48PZ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PZ6"
FT                   /protein_id="AAZ36920.1"
FT                   /translation="MTLYVNLAELLGSRIENGFYRPGDRLPSVRALSVEHGVSLSTVQQ
FT                   AYRVLEDNGLAAPKPKSGYFVSVSRAAPALPAVGRPVQRPVDISQWDQVLDLIRVAPLE
FT                   AVTQLGRGMPDATSPTLKPLMRALSQLSRHQDMPGLYYDNIYGVRRLREQIARLMLDSG
FT                   CNLTANDQIVTNGCHEALSASVRAICSPGDIVAVDSPSFFGAMQTLKGVGMKALEIPTD
FT                   PLTGISLEALELALEQWPIKVIQLTPNCNNPLGYVMPEARKRALLTLAQRFDVAIIEDD
FT                   VYGDLAYNYPRPRTIKSFDEDGRVLLCSSFSKTLAPGLRIGWVAPGRYLEQVLHMKYIG
FT                   TGSTAPQPQLAIADFIEGGHYEPHVRRMRTQYQRSRDQMIDWVMRYFPEGTRASRPQGG
FT                   FMLWVELAEGFDTLRLNRALLDKGVQIAVGSIFSASGKYRNCMRMNFAAKPSREIENAV
FT                   RIVGETIALLNAQTD"
FT   gene            258045..258350
FT                   /locus_tag="PSPPH_0219"
FT                   /note="PSPPH0219"
FT   CDS_pept        258045..258350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37614"
FT                   /db_xref="GOA:Q48PZ5"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PZ5"
FT                   /protein_id="AAZ37614.1"
FT                   /translation="MAVRFIIDPHPPRMRETEMNGFSDVRLALHSQELNDYRPTAVRTV
FT                   RSNKADLLAGMGRWALYRHRWASRRTLLELTDDQLRDIGLDFQQARVEAMKPFWRP"
FT   gene            complement(258356..259672)
FT                   /locus_tag="PSPPH_0220"
FT                   /note="PSPPH0220"
FT   CDS_pept        complement(258356..259672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN54332.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33913"
FT                   /db_xref="GOA:Q48PZ4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PZ4"
FT                   /protein_id="AAZ33913.1"
FT                   /translation="MNARVQHPTLHDDQHVASYYAASSHPQPDYPALQGEVKVDVCVVG
FT                   GGFSGLNTAIELAERGLSVALLEARRIGWGASGRNGGQLIRGVGHGVEQFANVIGSEGV
FT                   RQLKLLGIEAVNIVRQRIERHAIDCDLKWGYCDLANKPRDLHSLAEDADELRSLGYRHE
FT                   LKLLQADQMRSVVGSDRYVGGLIDMGSGHLHPLNLALGEAAVAQSLGVRLFEHSAVTRI
FT                   DYGPQVKVHTAQGAVLAKTLVLGCNAYLNDLNPEISGKVLPAGSYIIATEPLSEAQARE
FT                   VLPQDMAVCDQRVTVDYYRLSADRRLLFGGACHYSGRDPRDIAAYMRPKMLDVFAQLAS
FT                   VKIDYQWGGMIGIGANRLPQIGQLKQHPNVFYAQAYSGHGLNATHLAGRLLAEAIAGQH
FT                   SDGFELFAKVPHMTFPGGKHLRSPLLALGMLWHRLKELR"
FT   gene            259724..260131
FT                   /locus_tag="PSPPH_0221"
FT                   /note="PSPPH0221"
FT   CDS_pept        259724..260131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0221"
FT                   /product="Uncharacterized protein family (UPF0153) family"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33265"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR016928"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PZ3"
FT                   /protein_id="AAZ33265.1"
FT                   /translation="MSLPTGANSAHCVGMVDSMSCNRQKISDLRRQIPSFECVPGCHDC
FT                   CGPVTTSPEEMSRLPRKTAAEQDAALDELNCVHLGPQGCTVYDERPLICRLFGTTDSLP
FT                   CPNGRRPVELIHPRVEKQIHEYMASTRQVLV"
FT   gene            complement(260137..260625)
FT                   /gene="lrp"
FT                   /locus_tag="PSPPH_0222"
FT                   /note="PSPPH0222"
FT   CDS_pept        complement(260137..260625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="PSPPH_0222"
FT                   /product="leucine-responsive regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34023"
FT                   /db_xref="GOA:Q48PZ2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PZ2"
FT                   /protein_id="AAZ34023.1"
FT                   /translation="MRTQHQSNRELDKIDRNILRILQADGRISFTELGERVGLSTTPCT
FT                   ERVRRLEREGIIMGYNARLNPQSLKASLLVFVEISLDYKSGDTFEEFRRAVLKLPHVLE
FT                   CHLVSGDFDYLVKARISEMASYRKLLGDILLKLPHVRESKSYIVMEEVKESLNLPIAD"
FT   gene            260783..262084
FT                   /gene="dadA"
FT                   /locus_tag="PSPPH_0223"
FT                   /note="PSPPH0223"
FT   CDS_pept        260783..262084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="PSPPH_0223"
FT                   /product="D-amino acid dehydrogenase, small subunit"
FT                   /EC_number="1.4.99.6"
FT                   /note="identified by similarity to SP:P29011; match to
FT                   protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34759"
FT                   /db_xref="GOA:Q48PZ1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PZ1"
FT                   /protein_id="AAZ34759.1"
FT                   /translation="MRVLVLGSGVIGTTSAYYLARAGFQVTVVDRQPAAAMETSFANAG
FT                   QVSPGYASPWAAPGVPLKAIKWLLQRHAPLAIKATADIDQYLWMAQMLRNCTASRYTVN
FT                   KERMVRLSEYSRDCLDELRLETGIAYEGRSLGTTQLFRTQAQLDNAAKDIAVLEQSGVP
FT                   YELLDRDGIARVEPALAGVTGILSGALRLPNDQTGDCQLFTTRLAEMAVELGVEFRYGQ
FT                   NIERLDHAGDRINGVWIDGKLETADRYVLALGSYSPQLLKPLGIKAPVYPLKGYSLTVP
FT                   ITNPAMAPTSTILDETYKVAITRFDNRIRVGGMAEIAGFDLSLNPRRRETLEMIVGDLY
FT                   PQGGDLTQASFWTGLRPTTPDGTPIVGATPFRNLFLNTGHGTLGWTMACGSGRLLADLI
FT                   ARKTPRISAEGLDISRYGNTQENAQHVNPAPAHQ"
FT   gene            262056..262409
FT                   /locus_tag="PSPPH_0224"
FT                   /note="PSPPH0224"
FT   CDS_pept        262056..262409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0224"
FT                   /product="endoribonuclease L-PSP family protein"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35432"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PZ0"
FT                   /protein_id="AAZ35432.1"
FT                   /translation="MSIQRQLTNERMSQVVVHNGTVYLSGQVGDDMTAGVEQQTREVLN
FT                   SIERLLDLAGTDKTRILSVTIYLKDIDAHFAGMNSVWDKWLPKGVAPARATVEAKLCEP
FT                   EILVELSVVAALP"
FT   gene            262498..263571
FT                   /gene="alr"
FT                   /locus_tag="PSPPH_0225"
FT                   /note="PSPPH0225"
FT   CDS_pept        262498..263571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="PSPPH_0225"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="identified by similarity to SP:P29743; match to
FT                   protein family HMM PF00842; match to protein family HMM
FT                   PF01168; match to protein family HMM TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36688"
FT                   /db_xref="GOA:Q48PY9"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PY9"
FT                   /protein_id="AAZ36688.1"
FT                   /translation="MRPARALIDLQALRHNYQLAREHRGGKALAVIKADAYGHGAVRVA
FT                   QALEAQADGFAVACIEEALELRAAGIRAPVLLLEGFFEADELALIVEHNFWTVVHSTWQ
FT                   LEAIEQAQLAKPLTVWLKIDTGMHRVGLYPHEYQAAYQRLLVTGKVARIVLMSHFARAD
FT                   ELNSGCSDEQFAVFESFRKGLAAEISLKNSPAVLGWPHIPSDWSRPGIMLYGATPFGQA
FT                   HPLADRLQPVMTLESKIISVRELPAGEAVGYGATFVCDRPLRIGVVAMGYADGYPRHAP
FT                   TGTPVQIDGQPSRLLGRVSMDMLCVDLTGVPQAGLGSRVELWGKHVLASEVATRAETIP
FT                   YEIFCNLRRVPRIYSQD"
FT   gene            263696..264244
FT                   /locus_tag="PSPPH_0226"
FT                   /note="PSPPH0226"
FT   CDS_pept        263696..264244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0226"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37582"
FT                   /db_xref="GOA:Q48PY8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PY8"
FT                   /protein_id="AAZ37582.1"
FT                   /translation="MDVGERLQSIRKLKGLSQRELAKRAGVTNSTISMIEKNSVSPSIS
FT                   SLRKVLGGIPMSMVEFFSEETVPENAAQVVYKASELIDISDGAVTMKLVGKSHQGRAIA
FT                   FLTETYPPGADTGEEMLVHDGEETGILVEGRLELVVGLDTYVLEAGDSYYFESTRPHRF
FT                   RNPFDVPARLISAATPANF"
FT   gene            264269..264592
FT                   /locus_tag="PSPPH_0227"
FT                   /note="PSPPH0227"
FT   CDS_pept        264269..264592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0227"
FT                   /product="cytochrome c5, putative"
FT                   /note="identified by similarity to SP:P11732"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36816"
FT                   /db_xref="GOA:Q48PY7"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PY7"
FT                   /protein_id="AAZ36816.1"
FT                   /translation="MKLTRKILSTAGVLTLWVFNVQAADTARAPDDIIAAHCVACHSVG
FT                   LLNAPKTGDTAAWEERARQKGGLDGLLASTIKGIGIMPPKGTCGDCTDDELKSAIQSIS
FT                   GLK"
FT   gene            complement(264656..264775)
FT                   /locus_tag="PSPPH_0228"
FT                   /note="PSPPH0228"
FT   CDS_pept        complement(264656..264775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37589"
FT                   /db_xref="GOA:Q48PY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PY6"
FT                   /protein_id="AAZ37589.1"
FT                   /translation="MNMLGQLRQNVIDSVLDGTGIRHPSSPELLLVQLGPVAI"
FT   gene            264911..266647
FT                   /locus_tag="PSPPH_0229"
FT                   /note="PSPPH0229"
FT   CDS_pept        264911..266647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0229"
FT                   /product="acetyl-CoA hydrolase/transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36881"
FT                   /db_xref="GOA:Q48PY5"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PY5"
FT                   /protein_id="AAZ36881.1"
FT                   /translation="MQARFLEPFLERVFGDYPELEFLAALRRDKLPHNIRVQQFFMQPG
FT                   SLLNSESAQQDYVSSNYSHAARDINANGLNLVAQLVARDDQHLGKLSLSCNPDVTLDLL
FT                   PMIAKRRAAGETILMLGQVHADLPYMPGDSELDVEAFDLLINEDERSTLFSTPNMPVGY
FT                   QDHLIGLHASTLVRDGGTLQIGIGSMGDALTGALLARQADNETWRSLLAELNMSNWQTL
FT                   IDREGGVQPFASGLYGCSEMFVNGLLVLADAGIVRRKVYADAELQRLANLGTLDEDAHP
FT                   DGVVVHGGFFLGPSSFYERLRELPAERLAQFNMTAISYINELYGQEELKRLQRRDARFI
FT                   NSAFTVTLMGAAVADQLEDGRVLSGVGGQYNFVAQAHALEGARSILMLRSWRESGGEVS
FT                   SNIVWQYGHTTIPRHLRDIVVTEYGIADLRGQTDATVIERILNITDSRFQPGLIEQAQK
FT                   AGKLPKEFRLDPRFTENTPKRLKDTASRYPSLFTEYPLGCDFTGEERDLMRALNWLKSK
FT                   LKLTEILELGKATLDAPDPEAFPEHLQRMQLDQPQGLREELYQRLLLAGLHNTSGTSGL
FT                   TS"
FT   gene            complement(266675..267199)
FT                   /locus_tag="PSPPH_0230"
FT                   /note="PSPPH0230"
FT   CDS_pept        complement(266675..267199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0230"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06127"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34005"
FT                   /db_xref="GOA:Q48PY4"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PY4"
FT                   /protein_id="AAZ34005.1"
FT                   /translation="MKTLVDHLSQYAAYHRDSRNIVTHFVGIPLIVLAVAVLLSRPGWA
FT                   VSGLWVSPAALLALGSTIFYLRLDRALGVVMAVLLALCIWAGANLAQQATMVWLSAGVG
FT                   LFVIGWIIQFIGHYYEGRKPAFIDDVTGLIIGPLFVIAELAFLMGLRKPLQHAIEERSG
FT                   PEGRNTRKAAI"
FT   gene            267281..267988
FT                   /locus_tag="PSPPH_0231"
FT                   /note="PSPPH0231"
FT   CDS_pept        267281..267988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0231"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33325"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PY3"
FT                   /protein_id="AAZ33325.1"
FT                   /translation="MTNGVSWRSRLLSDYWFSHLPAGLQDSLLDAARQQRRTPGRTLFE
FT                   KGDLPCGLYVLLEGCVRIGAAHEQRLSGVEPMRAPMWFGEVSLFDGLPRRFEVCSLEQS
FT                   IFLHVPQQFLLELLDRHPEYWRWFAALLSQKIGLPLQNPEKMRRLPPRARVAWRLLMLS
FT                   EGYGPLSHARRLIVLEDIQAVECLALSPPALLEVLQDLHERKIVRLGEGQLEVFDVDKL
FT                   RRVANFSKARAVC"
FT   gene            268098..269099
FT                   /locus_tag="PSPPH_0232"
FT                   /note="PSPPH0232"
FT   CDS_pept        268098..269099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0232"
FT                   /product="iron ABC transporter, periplasmic iron-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35451"
FT                   /db_xref="GOA:Q48PY2"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PY2"
FT                   /protein_id="AAZ35451.1"
FT                   /translation="MQASKRLLAALTLTLLGSTVQATDEVVVYSSRIDELIKPVFDAYT
FT                   AKTGVKIKFITDKEAPLMQRIKAEGENATADLLLTVDAGNLWQAEQMGILQPFTSPVIE
FT                   ANIPPQYRSSTHGWTGLSLRARTIAYSTDRVKPVELTTYEALADKNWEGRLCLRTAKKV
FT                   YNQSLTATLIETHGTEASEKILKGWVNNLSTDVFSDDIAVLEAINAGQCDVGIVNSYYY
FT                   GRLHKEKPDLAVKLFWPNQADRGVHVNLSGIGLTKYAPHPEAAKALVEWMTGPDAQKIF
FT                   SSVNQEFPANPNVAPSEEVASWGQFKADTIPVEVAGKRQAEAIRMMDRAGWN"
FT   gene            269370..270986
FT                   /locus_tag="PSPPH_0233"
FT                   /note="PSPPH0233"
FT   CDS_pept        269370..270986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0233"
FT                   /product="iron ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34604"
FT                   /db_xref="GOA:Q48PY1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PY1"
FT                   /protein_id="AAZ34604.1"
FT                   /translation="MAHPVQRRWYPLVFAIAALVLLPLSVLLLSWETIDQQIWSHLLET
FT                   QMSRLLGNTLILVLGVGLGVTLLGVSLAWLTSLCEFPGRRWLDWALMLPFAIPAYVLAF
FT                   VFVGLLDFSGPVQTLMREWFGSGLRLPRVRSTGGVIIVLVLVFYPYVYLLARTAFLAQG
FT                   KGLMEAARVLGNTPLQAFWRVALPMARPAIGAGVALALMETLADFGAVSVFNFDTFTTA
FT                   IYKTWYGFFSLSSAAQLASLLLLAVLVLLYGERRARGASRPTNERPRGAALYPLSGIKA
FT                   WGASLWCGLVFLCAFVVPVLQLIVWVWQRGRFDLDERYTGLILHTLYLGGMAALITVSV
FT                   ALILAFARRMAPTPAIRSGVSLANLGYALPGSVLAVSIMLAFSYLDRELVVPLSGWLGG
FT                   AGKPLLLGSLSALLLAYLVRFIAVAFGPLEHSLSRIRPSLPEAARSLGVSGPKLFLNVY
FT                   LPLLVPGALSAALLVFVDVLKEMPATLLMRPFGWDTLAVRVFEMTSEGEWARAALPALS
FT                   LVLVGLLPVIGLIRRSARQIG"
FT   gene            271139..272221
FT                   /gene="gcvT1"
FT                   /locus_tag="PSPPH_0234"
FT                   /note="PSPPH0234"
FT   CDS_pept        271139..272221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT1"
FT                   /locus_tag="PSPPH_0234"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="identified by similarity to SP:P27248; match to
FT                   protein family HMM PF01571; match to protein family HMM
FT                   TIGR00528"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36661"
FT                   /db_xref="GOA:Q48PY0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PY0"
FT                   /protein_id="AAZ36661.1"
FT                   /translation="MGQRTPLFDLHLALGAKMVDFGGWDMPLHYGSQVEEHHQVRRDCG
FT                   VFDVSHMNVIDVVGRQARTWLRYLLANDVEKLKTPGRALYSAMLDERGGVIDDMIVYLT
FT                   PEGYRLVVNAATGVKDLAWMQSQLGDFDVQLIARSEMAMLAIQGPKARTRIAELVSSAR
FT                   AELIHQLKPFEGLDDGDWFIARTGYTGEDGLEIMLPAEEAQRFFNELVGAGISPIGLGA
FT                   RDTLRLEAGMNLYGQDIGEHVSPLASNMAWSIAWEPADRDFIGREALESERAEGTAFKL
FT                   VGLVLEERGVLRAHQVVRVAEIGEGEITSGSFSPTLSKSIALARVPMATADRAEVEIRG
FT                   KWYPVRVVQPAFVRHGKTLI"
FT   gene            272265..272654
FT                   /gene="gcvH1"
FT                   /locus_tag="PSPPH_0235"
FT                   /note="PSPPH0235"
FT   CDS_pept        272265..272654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH1"
FT                   /locus_tag="PSPPH_0235"
FT                   /product="glycine cleavage system H protein"
FT                   /note="identified by similarity to SP:P23884; match to
FT                   protein family HMM PF01597; match to protein family HMM
FT                   TIGR00527"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35783"
FT                   /db_xref="GOA:Q48PX9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PX9"
FT                   /protein_id="AAZ35783.1"
FT                   /translation="MSNIPAELRFAESHEWARLEADGTVTVGISDHAQEALGDVVFVEL
FT                   PEIGKVFAARDPAGVVESVKAASDIYSPVAGEVVEVNEALGDSPESLNRDPYGSAWIFK
FT                   LKPSDASGHLAKLLDAAGYKSAIGE"
FT   gene            complement(272723..273043)
FT                   /locus_tag="PSPPH_0236"
FT                   /note="PSPPH0236"
FT   CDS_pept        complement(272723..273043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02448"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36136"
FT                   /db_xref="GOA:Q48PX8"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PX8"
FT                   /protein_id="AAZ36136.1"
FT                   /translation="MRLKFAVATVALLSIPMGSAMADTFWRNVLSSGATTGSTYLTFKD
FT                   HKLIVAAQDDAGSFVASDGGIRGPFLEAAIEQVRKDNPGLKATDMELANAILDKNLVAE
FT                   NQ"
FT   gene            complement(273184..274968)
FT                   /locus_tag="PSPPH_0237"
FT                   /note="PSPPH0237"
FT   CDS_pept        complement(273184..274968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0237"
FT                   /product="type IV pilus biogenesis protein"
FT                   /note="identified by similarity to GB:AAO53864.1; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   PF05157"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35616"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PX7"
FT                   /protein_id="AAZ35616.1"
FT                   /translation="MAALAPSSQDRWLDLNDVLRDLVAEGYLGQDDAETALTQRRSAVN
FT                   IQLHPLEFLASLQFDDLKRPGKKLDLETLTAWLAKACGQPYMRIDPLKINVAAVTPLMS
FT                   YAFAQRHKILAVAVDRESVTIASAQPYVRSWEGDLAHVLKLQIKRVVANPTDIQRMAME
FT                   FFRLAKSVSGASASEQKMSNMGNFEQLLKLGASDQEPDANDAHIVNIVDWLFQYAFQQR
FT                   ASDIHIEPRREQGTVRFRIDGVLHNVYQFPAQVIMAIVSRLKSLGRMNVAEKRKPQDGR
FT                   VKTTTPENREVELRLSTLPTAFGEKMVMRIFDPEVLLKDFDQLGFSSDDLRRWQEMTRQ
FT                   PNGIILVTGPTGSGKTTTLYTTLKKLATSEVNLCTIEDPIEMVEPAFNQMQVQHNIELS
FT                   FAAGVRALMRQDPDIIMIGEIRDLETAEMAIQAALTGHLVLSTLHTNDAPSAISRMLEL
FT                   GVPHYLLKATILGVMAQRLVRTLCPHCKAPINLNETDWQTLTRPWQAPVPPGAHQAVGC
FT                   VECRDTGYRGRAGVYEIMVMSDNIKALISADLDLTAMRRQAFKEGTRSLRLSGAQKVSA
FT                   GLTTLEEVLRVTPQSEQR"
FT   gene            complement(275079..275426)
FT                   /locus_tag="PSPPH_0238"
FT                   /note="PSPPH0238"
FT   CDS_pept        complement(275079..275426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37547"
FT                   /db_xref="GOA:Q48PX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PX6"
FT                   /protein_id="AAZ37547.1"
FT                   /translation="MPDLEAVTATLQRPDNWSSSNAACCARYQIVAAAEPALLCQVLNL
FT                   FAMQYLIPDQLSVARQEKTLLIGLQVASLSWHRAQVIGEKMRNLIDVCSVEVEQIDAQN
FT                   SPQTHVVLATG"
FT   gene            275551..276030
FT                   /locus_tag="PSPPH_0239"
FT                   /note="PSPPH0239"
FT   CDS_pept        275551..276030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0239"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36958"
FT                   /db_xref="GOA:Q48PX5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PX5"
FT                   /protein_id="AAZ36958.1"
FT                   /translation="MQTELDVYDRKILALLQEDASLSSAQIAEQVGLSQSPCWRRIQRL
FT                   KDEGVIRRQVALLDRKKIGLNTQIFAEVKLNAHGRSNLTEFTDSIRGFPEVLECYVLMG
FT                   SVDFLLRIVTPDIEAYERFFFEKLSLVPGIQEVNSTVALSEIKSTTSLPLLRQGG"
FT   gene            complement(277190..278644)
FT                   /locus_tag="PSPPH_0240"
FT                   /note="PSPPH0240"
FT   CDS_pept        complement(277190..278644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01928"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33364"
FT                   /db_xref="GOA:Q48PX4"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PX4"
FT                   /protein_id="AAZ33364.1"
FT                   /translation="MSCTLTALAAVQSWAALPFISISVWIPPAMQKETEIKLRVSRETL
FT                   AALREHPLLKKRNKSGWERLELSNQYFDTPEGELAQAKVALRIRRDGDQIIQTMKTRGQ
FT                   SVAGLSERNEYNWDLSKAKLDLKKLEGDCWPEQLAGLDKKTIKPLFTTDFIREKAEIAW
FT                   GRGKTKVVIEAALDLGQVVAGKQKEEICELELELREGEPAALLELAAELAATLPLMPCD
FT                   ISKAERGYRLLDAGSYSLSLPAPALNAETPLDEAYSALAWHLLGSSQRLAEQYRFNGHW
FT                   RLLQDWVEMLAELRALTSSLGQAAPRASTAQLRTSLDALLEDWRPLVQAGQEDADVRGA
FT                   AHEQFLEELQDTRWGEFSLNTSRWLLARSWTTERNTRGNRQGAALLSSWLPRLLGEEAT
FT                   SLQLSRYQQQPEDLAEQLPRIERIQAWLHWARGALDLPELDRLYGELRKLEELANLDIS
FT                   DEVLDARVQQAITVFQSRAWKTLLRL"
FT   gene            278721..279869
FT                   /gene="argE1"
FT                   /locus_tag="PSPPH_0241"
FT                   /note="PSPPH0241"
FT   CDS_pept        278721..279869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE1"
FT                   /locus_tag="PSPPH_0241"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /EC_number="3.5.1.16"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01892"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35027"
FT                   /db_xref="GOA:Q48PX3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PX3"
FT                   /protein_id="AAZ35027.1"
FT                   /translation="MPLPSMKDQFAALIAAPSVSCTQPSLDQTNRPVIDLLAGWLGDLG
FT                   FACDIQQVSPGKFNLLATYGTGPGGLVLAGHSDTVPFDEALWKTDPLKLTEVDGRWVGL
FT                   GSCDMKGFFALIIEAVRGLIGQPFKQPLLILATCDEESSMAGARALAEAGRPLGRAAVI
FT                   GEPTGLKPIRLHKGVMMERIHILGRSGHSSDPSLGHSALEAMHDAISELKGLRTQWQAQ
FT                   YRNPQFTVPQPTLNLGCIHGGDNPNRICGQCSLEFDLRPLPGMDPEVLRAAIRHKLEPL
FT                   AELHQVKIDYAPLFPECAPFEQAADAELVRVAERLTGHTAAAVAFGTEAPYLQRLGCET
FT                   LVLGPGDIACAHQPGEYLEMSRLDPTVRLLRQLIEHYCLTPQ"
FT   gene            279948..281294
FT                   /gene="argA"
FT                   /locus_tag="PSPPH_0242"
FT                   /note="PSPPH0242"
FT   CDS_pept        279948..281294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="PSPPH_0242"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF00696; match to protein
FT                   family HMM TIGR01890"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34783"
FT                   /db_xref="GOA:Q48PX2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PX2"
FT                   /protein_id="AAZ34783.1"
FT                   /translation="MRAFSLRPFSLQALVVMPEYVNWLRHASPYINAHRDCTFVVMLPG
FT                   DGVAHPNFGNIVHDLVLLHSLGVRLVLVHGSRPQIESRLAQCGITPRYHRDMRITDTET
FT                   LECVIDAVGQLRISIEARLSMDMAASPMQGSRLRVTSGNVVTARPIGVLEGVDYQHTGE
FT                   VRRVDRKGINRLLDERHIVLLSPLGYSPTGEIFNLACEDVATRAAIDLAADKLLLFGAE
FT                   TGLLDEQGRLVRELRPQQVPAHLQRLGTNYQAELLDAAAEACRGGVARSHIVSYAENGA
FT                   LLTELFTRDGGGTLVAQEQFELVREAVIEDVGGLMDLITPLEEQGILVRRSREVLEREI
FT                   TQFSVVEREGLIIACAALYPIADSESGELACLAVNPEYRHGGRGDELLERIENRARALG
FT                   IKTLFVLTTRTAHWFRERGFEPSSVDRLPSARASLYNYQRNSKIFEKAI"
FT   gene            complement(281401..283008)
FT                   /gene="gshA"
FT                   /locus_tag="PSPPH_0243"
FT                   /note="PSPPH0243"
FT   CDS_pept        complement(281401..283008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="PSPPH_0243"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04262;
FT                   match to protein family HMM TIGR01434"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34309"
FT                   /db_xref="GOA:Q48PX1"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PX1"
FT                   /protein_id="AAZ34309.1"
FT                   /translation="MKDYTLSELLNRRLALLGERNNLSLLEQCLHGIERECLRVTATAE
FT                   LAQTPHPQALGAALTNGQVTTDYSESLLEFITPALKNPAETIDSLDKIHRFAYSKLGDE
FT                   LLWSPSMPCPLPDEEHTPIAYYGTSNIGKLKYVYRKGLALRYGKTMQCIAGIHYNFSLP
FT                   EDAWALLKQTEDFAGDARDYQSHSYIALIRNFRRYSWLLMYLFGASPALDAGFLRGRKH
FT                   QLEQHFDADTLYLPYATSLRMSDLGYQSDAQADLTPCYNDLVSYTDSLRKAVATPYKPY
FT                   VDVGTHDQNGEWVQLNTNVLQIENEYYSNIRPKRATYSGERPIQALVARGVQYVEVRCL
FT                   DINPFLPTGISLEQSRFIDAFVLYCALEESQQLASHECSNASSNFLAVVKEGRRPGLSL
FT                   QRNNSPVDLKTWATELLEKITPIARLLDQAQGIDEHIKSIAVQQAKIDDASLTPSAQVL
FT                   ASMKAHNEGFTAFSLRQSQAHAEYFRTHPLSAQEQADFEAQAKTSIEEQAELEATEEVV
FT                   DFDTFVGSYQASILSISN"
FT   gene            complement(283236..283619)
FT                   /locus_tag="PSPPH_0244"
FT                   /note="PSPPH0244"
FT   CDS_pept        complement(283236..283619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0244"
FT                   /product="thioesterase family protein"
FT                   /note="identified by similarity to SP:P76084; match to
FT                   protein family HMM PF03061; match to protein family HMM
FT                   TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36770"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PX0"
FT                   /protein_id="AAZ36770.1"
FT                   /translation="MDIPEDLTQSAYFKMLGCELRRLDEGVAEVALPLEAHLRNRGNVM
FT                   HGGAIFSLVDIAMGLACSSSHGFDQRSVTIECKINYVRGVSDGEVLCIAKVLHAGRRTL
FT                   VVEAEVVQGDKLVAKAQGTFAVI"
FT   gene            complement(283619..285940)
FT                   /gene="tex"
FT                   /locus_tag="PSPPH_0245"
FT                   /note="PSPPH0245"
FT   CDS_pept        complement(283619..285940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tex"
FT                   /locus_tag="PSPPH_0245"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37343"
FT                   /db_xref="GOA:Q48PW9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PW9"
FT                   /protein_id="AAZ37343.1"
FT                   /translation="MDSINSRIAEELGVRPQQVAAAVALLDEGSTVPFISRYRKEVTGS
FT                   LDDTQLRHLEERLRYLRELDDRRVSILASIEEQGKLTPELARDIKLADTKTRLEDLYLP
FT                   YKQKRRTKGQIALEAGLGELADGLFNDPSLAPETEAARFVDAEKGVADVKAALEGAKCI
FT                   LMERFAEDASLLDKLRSFLKQEAVISARVVPGKEEEGAKFRDYFEHDEPLKSMPSHRAL
FT                   AIFRGRNEGFLSSALKVGEELPGAMHPCELMIGERFGIQNQNRPADKWLAEVVRWTWKV
FT                   KLYSHLETDLLGELRDGAETEAINVFAHNLHDLLLAAPAGQRATLGLDPGLRTGCKVAV
FT                   VDATGKLLDYATVYPHVPKNQWDQTIAVLAALCAKHSVDLIAIGNGTASRETDKLAADL
FT                   IKKYPGLKMTKVMVSEAGASVYSASELAAKEFPDLDVSIRGAVSIARRLQDPLAELVKI
FT                   DPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLARISGLNTTLAQN
FT                   IVAHRDENGAFKTRAALKKVSRLGEKTFEQAAGFLRVMTGDNPLDSSAVHPEAYPLVQR
FT                   IAAETDRDIRSLIGDASFLKRLDPKKFTDETFGLPTVTDILQELEKPGRDPRPEFKTAE
FT                   FQDGVEELKDLQPGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFIKDPREAVK
FT                   AGDVVKVKVMEVDIPRKRVGLSMRMSDTPGEKVDGARGARPGSSPRQQNSAPRKETTAP
FT                   APINNAMASLFANAKQLKKR"
FT   gene            286240..286980
FT                   /gene="ompR"
FT                   /locus_tag="PSPPH_0246"
FT                   /note="PSPPH0246"
FT   CDS_pept        286240..286980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="PSPPH_0246"
FT                   /product="DNA-binding response regulator OmpR"
FT                   /note="identified by similarity to SP:P03025; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37739"
FT                   /db_xref="GOA:Q48PW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PW8"
FT                   /protein_id="AAZ37739.1"
FT                   /translation="MSSTAQNAEGEKILIVDDDPGLSSLLERFFTSKGYRARAVANVEQ
FT                   MDRLLAREVFNLVVLDLMLPGEDGLSACRRLRAANNQVPIIMLTAKGDELSRIKGLELG
FT                   ADDYLAKPFNPDELMARVKAVLRRQAAPVPGAPGSEDESVSFGDYELSLATRELKRGDV
FT                   VHMLTTGEFAVLKALVMHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRLIEPDP
FT                   SKPRYIQTVWGVGYVFVPDGAGNR"
FT   gene            287132..288454
FT                   /gene="envZ"
FT                   /locus_tag="PSPPH_0247"
FT                   /note="PSPPH0247"
FT   CDS_pept        287132..288454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="PSPPH_0247"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36380"
FT                   /db_xref="GOA:Q48PW7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PW7"
FT                   /protein_id="AAZ36380.1"
FT                   /translation="MAAVMKTPLWFPQSFFSRTLWLVLIVVLFSKALTLVYLLMNEDVL
FT                   VDRQYSHGVALTLRAYWAADENDREAIAEAAGLIRVVGGGVPEGEQHWPYSEIYQRQMQ
FT                   AELGADTEVRLRVHAPPALWVRAPSLGDGWLKVPLYPHPLRGQKIWSVLGWFLAIGLLS
FT                   TASAWIFVRQLNQPLKRLVFAARQLGQGRSVRLPVSDTPSEMTEVYRAFNQMAEDVEQA
FT                   GQERELMLAGVSHDLRTPLTRLRLSLELMNDNEFSEGMVRDIEDMDAILDQFLAFIRDG
FT                   RDEEIEEVDLGHLVRDVVAPFNNDEDSIRLCLEPIPPFPLRRVSMKRLLTNLIGNARHH
FT                   AGNGIEVAAYVSGDRNAPYVVLSVLDRGAGIDPSELDTIFNPFIRGDRARSGKGTGLGL
FT                   AIVKRIAAMHGGNVELRNRSGGGLEARVRLPLGLMLPRDAI"
FT   gene            complement(288702..289169)
FT                   /locus_tag="PSPPH_0248"
FT                   /note="PSPPH0248"
FT   CDS_pept        complement(288702..289169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0248"
FT                   /product="Inhibitor of vertebrate lysozyme precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35967"
FT                   /db_xref="GOA:Q48PW6"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PW6"
FT                   /protein_id="AAZ35967.1"
FT                   /translation="MHTSFRTLAAALLMGGSAMVMAANDRQSRVNELLSSAPEYRTTWA
FT                   KVVKKEERLPDWVINLSGASEQQMTAATEDGDKYLVGPLCETADTCKSKRLIVAFSLDM
FT                   EDAYAMLVEVPAGLPADKSPTRHATYRYLGKPDEGMQKLLNEELRKDPNWY"
FT   gene            complement(289172..289336)
FT                   /locus_tag="PSPPH_0249"
FT                   /note="PSPPH0249"
FT   CDS_pept        complement(289172..289336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0249"
FT                   /product="Protein of unknown function (DUF1328)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF07043"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34567"
FT                   /db_xref="GOA:Q48PW5"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PW5"
FT                   /protein_id="AAZ34567.1"
FT                   /translation="MLSWAITFLIIAIVAAVLGFGGIAGTATGIAKILFVVFLVMFVVS
FT                   FFFGRRGRG"
FT   gene            complement(289394..289714)
FT                   /locus_tag="PSPPH_0250"
FT                   /note="PSPPH0250"
FT   CDS_pept        complement(289394..289714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37826"
FT                   /db_xref="GOA:Q48PW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PW4"
FT                   /protein_id="AAZ37826.1"
FT                   /translation="MNAHSGQGSLQMNSQRIAQLRISPLHIQQGLFLLLALLVTLIAIQ
FT                   QFQRWNQANEATQARQQFIQTSSISYRGVSAPAVKDASSSLRPVDGLVSVDEVAPQQKW
FT                   VF"
FT   gene            complement(289910..290749)
FT                   /locus_tag="PSPPH_0251"
FT                   /note="PSPPH0251"
FT   CDS_pept        complement(289910..290749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0251"
FT                   /product="osmotically inducible protein, putative"
FT                   /note="identified by similarity to SP:P27291; match to
FT                   protein family HMM PF04972"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35254"
FT                   /db_xref="GOA:Q48PW3"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PW3"
FT                   /protein_id="AAZ35254.1"
FT                   /translation="MFSLKKIALITAAAALLGSGPVLAQPDLPTQLAEARQEGSIWTAF
FT                   ALNKHLSPFKIDVNVDQGTATLKGKVENEVDRELAERIALDTKGIEKVDNQLEVDPAVA
FT                   SEPGTRTNMAQRFEDATLVATVKSKLLWSSVTEALTIDVDSKDGVVTLKGRAQSPEAKE
FT                   LAGSLASNTDGVISVNNLISLSAADSIAAKTQPQTLTPTEEMSDAWITSKVKASLIYSR
FT                   TLDGLNIKVDTKAGVVSLNGVVANFAEKELAVEIARNIRGVKGVNGDALKVMARSAG"
FT   gene            290947..292293
FT                   /gene="algB"
FT                   /locus_tag="PSPPH_0252"
FT                   /note="PSPPH0252"
FT   CDS_pept        290947..292293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algB"
FT                   /locus_tag="PSPPH_0252"
FT                   /product="alginate biosynthesis transcriptional regulatory
FT                   protein AlgB"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954; match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33467"
FT                   /db_xref="GOA:Q48PW2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PW2"
FT                   /protein_id="AAZ33467.1"
FT                   /translation="MEAATENQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQAD
FT                   TLMQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAVDTAVDAIQAGAA
FT                   DYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEVRKPKDGLDSHSPSMMAILETARQ
FT                   VAVTDANILILGESGTGKGELARAIHGWSKRAKKSCVTINCPSLTAELMESELFGHSRG
FT                   AFTGASESTLGRVNQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADV
FT                   RILAATNLNLEDMVRSGRFREDLLYRLNVITLHLPALRERSEDILTLADRFLARFVKEY
FT                   ARPARGFSEEARAALLNYRWPGNIRELRNVIERASIICPQERVEISHLGMAEQPTNNAP
FT                   RVGAALSLDELEKAHIGAVLATSETLDQAAKTLGIDASTLYRKRKQYNL"
FT   gene            292304..294091
FT                   /locus_tag="PSPPH_0253"
FT                   /note="PSPPH0253"
FT   CDS_pept        292304..294091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0253"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33679"
FT                   /db_xref="GOA:Q48PW1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PW1"
FT                   /protein_id="AAZ33679.1"
FT                   /translation="MKLAMKLRTRLFLSISALITVALLGLLLGLVSVMQMARTQESLIQ
FT                   HNFAILDLGLKLRQNLGDQLVLMTGAKRDQAELERIQSQFEELLEEGSVQDTQQNVRNG
FT                   FEKTKGDYRQFIDTWKQYGNDARGIRGVPQLSDSFDNLRNGLLAVHRKALENISSAEIN
FT                   SRDRALWIAGLLGLVGLAVLCIGFVTAHGIARRFGAPIEALAKAADRIGEGDYEVTLPI
FT                   SSAAEMNLLTRRFGIMAEALRQHQATNIDELLAGQQRLQAVLDSIDDGLLMIDRQGHLE
FT                   HLNPVAQRQLGWDESRLGQSLGDALGRPELDEQLHLVLRGGTLERAPEDLAIEIDGESR
FT                   LLTYSMTPVSHTKGHILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAFG
FT                   LLQERLHFAPETREADLLNTVTEEMQRLMQLINDLLNFSRYQNGLQKLKLAPCSIETLL
FT                   EEARARFEDKALEQDIVLMLDMQEPMPRLHADQSQLERVLDNLLDNALRHTPQNGLIRL
FT                   QARRHGERAIISVEDNGEGIAYGQQGRIFEPFVQVGRKKGGAGLGLALCKEIVQLHGGR
FT                   MGVYSRPGQGTQFYMALPL"
FT   gene            complement(294160..294939)
FT                   /locus_tag="PSPPH_0254"
FT                   /note="PSPPH0254"
FT   CDS_pept        complement(294160..294939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0254"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33814"
FT                   /db_xref="GOA:Q48PW0"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PW0"
FT                   /protein_id="AAZ33814.1"
FT                   /translation="MKLYFSAFLLLILTACASGPRLDTSHPSVNFDGRVQYVIMHYTST
FT                   SMEKSLQLLTHGEVSSHYLIGDDSKATIYKLVDESARAWHAGESEWEGRTWLNSSSIGI
FT                   EIVNPGFKDTPAGRLWYPYTEAQIQSITVLLKDIVKRNKIDPKHIIGHSDIAPTRKQDP
FT                   GPLFPWKRLAAEGLGIWPDERLVAQHQALLATNLPSISWFQQQLARLGYSTPQTGELDT
FT                   ATRQVLAAFQMHYRPARFDGEPDAQSAAILQVLNRVN"
FT   gene            complement(295035..297095)
FT                   /locus_tag="PSPPH_0255"
FT                   /note="PSPPH0255"
FT   CDS_pept        complement(295035..297095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0255"
FT                   /product="diguanylate cyclase, putative"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34893"
FT                   /db_xref="GOA:Q48PV9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PV9"
FT                   /protein_id="AAZ34893.1"
FT                   /translation="MSDDAERWKEKYLKGIEQQDKLEKRWDARLDLLRRGLVRSSLAAE
FT                   GSDRAVDECMKEMREIVRKDDMDAGLAALIPRLEKAVLDSEHRREVRVGQIGSALTALV
FT                   AQLQALPLPREVRKPLKRFAKDLEERASQARELPLLLSELSGLQGQALTLLEKHEEGPR
FT                   QGLLQRLFGSRDEHGNERPPEAAHPENAPSAQETHETHVQPEAANAQAPIDVAAAEVEA
FT                   AIAPDIVNQKTKDAHTLPPQVSEAETAIVTAPETPVPSPAAAALAPALAETVTEPAVVP
FT                   VEPIDFTDLLGPVPSVPYQQRPAPIIQALEQPQEDAESETETVEGEEGYSLPSSPEPSY
FT                   SSVAAHIEETLLGLLDDLTLSEHFRPQVEDMQLRLKHGLNWYELLPILDDLAVLMLAIN
FT                   NGGQQEFSTYLKQLNERLESFQSHLQAASEDHAEDQSTARDLNEQLREQVGGLQISVQD
FT                   ASDLTSLKQVLDNRFEGLLSTMDHYQLKRDAREREVASRLQGLSARVASMEQEALGFRT
FT                   HLEEQRQKALIDPLTGLPNRAAWGERLEQEMSKWQHEKNSLLVCILDLDHFKRINDGYG
FT                   HLAGDKVLKIVANVFRKRLRSDDFLARFGGEEFVMLLPATPPGTGLTLLDELRAAVESC
FT                   PFHFKGERVTITVSIGVTAFRTAERSDTAIKRADQALYRAKENGRNRVEQG"
FT   gene            complement(297092..297967)
FT                   /locus_tag="PSPPH_0256"
FT                   /note="PSPPH0256"
FT   CDS_pept        complement(297092..297967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0256"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37169"
FT                   /db_xref="GOA:Q48PV8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PV8"
FT                   /protein_id="AAZ37169.1"
FT                   /translation="MRRWGKGSTRIVGLHDPQVNEHHLTQNGLPEDGRLRLLSFNIQVG
FT                   ISTQRYHHYLTRSWQHLLPHGGRAGNLQKIGDLINDFDLVALQEVDGGSMRSGFVNQVE
FT                   HLAQLGGFPYWYQQLNRNLGRLAQHSNGVLSRLRPTKIEDHPLPGPAGRGAILVRFGEG
FT                   EDALVVVMMHLALGTRTRTRQLAYIRDLIGGYRHQVLMGDMNTHANDLLEHSPLRDLGL
FT                   LAPQIEATFPSWRPQRCLDHILLSPTLTLERVQVLAQPISDHLPVAVEIRLPDSLRGDS
FT                   LPVPSGGSLA"
FT   gene            complement(297977..298621)
FT                   /gene="dsbA"
FT                   /locus_tag="PSPPH_0257"
FT                   /note="PSPPH0257"
FT   CDS_pept        complement(297977..298621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="PSPPH_0257"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33977"
FT                   /db_xref="GOA:Q48PV7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PV7"
FT                   /protein_id="AAZ33977.1"
FT                   /translation="MRNLIISAALVAASLFGMSAQAATPIEAGKQYVELASAVPVAEPG
FT                   KIEVVELFWYGCPHCYAFEPTINPWIEKLPSDVKFVRIPAMFGGPWDAHGQLFITLDTM
FT                   GVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKEDFLKTFDSFAVKGKIAQYKE
FT                   LAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLEVADQLIAKERAAATAAK"
FT   gene            298916..299551
FT                   /locus_tag="PSPPH_0258"
FT                   /note="PSPPH0258"
FT   CDS_pept        298916..299551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0258"
FT                   /product="GTP-binding protein XF1430"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36510"
FT                   /db_xref="GOA:Q48PV6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PV6"
FT                   /protein_id="AAZ36510.1"
FT                   /translation="MQLKNPILGLCQQATFMLSAAKVDQCPDDEGFEVAFAGRSNAGKS
FT                   SALNTLTHASLARTSKTPGRTQLLNFFGLDEDRRLVDLPGYGYAKVPIPLKLHWQRHLE
FT                   AYLGSRESLKGLILMMDIRHPMTDFDLLMLDWAIASNMPMHILLTKADKLTYGAAKNTL
FT                   LKVQTEIRKGWGDAVSIQLFSAPKRMGLEEAYTVLADWMELEDKAPAE"
FT   gene            complement(299793..302558)
FT                   /gene="polA"
FT                   /locus_tag="PSPPH_0259"
FT                   /note="PSPPH0259"
FT   CDS_pept        complement(299793..302558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="PSPPH_0259"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P00582; match to
FT                   protein family HMM PF00476; match to protein family HMM
FT                   PF01367; match to protein family HMM PF01612; match to
FT                   protein family HMM PF02739; match to protein family HMM
FT                   TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35823"
FT                   /db_xref="GOA:Q48PV5"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PV5"
FT                   /protein_id="AAZ35823.1"
FT                   /translation="MTQAPLVLIDGSSYLYRAFHALPPLTTSKGLPTGAVKGVLNMLKS
FT                   LRRQYPDSPFAVVFDAKGGTFRDALYTDYKANRPSMPDDLRVQVDLLHACVKGMGYPLL
FT                   CVEGVEADDVIGTLARSSAAADRPVIISTGDKDMAQLVDGHITLVNTMTGSALDVAGVK
FT                   EKFGVGPEHIIDYLALMGDKVDNIPGVPGVGEKTAVGLLVGVGGGIKELYERLETVATL
FT                   PIRGAKTLAAKLEEHRAMAFLSYELATIKIDVPLDIELDQLHCGEPDRDKLMELYAELE
FT                   FKSWIEDLQRDAKRAGQELAVEEPTVEAKEAAYEVILEQSQFDAWLKKLNAAPLFAFVI
FT                   QSNGTDAQRAQLVGLSFAIQTHEAAYIPLTHSYMGVPQQLDRDTVLKALKPLLEDPDKT
FT                   KVGQHAKFAINLLANCALDGDQTQGIDLQGVRFDTILESYVLDSTATRHDRDSLVAKYL
FT                   THTPINFQEIAGKGAKQLTFDQIAIEQAGDYAAEEADLTLRLHEVFEARLAAIPTLQPV
FT                   LNDIEMPLVPVLAGIERQGALVDANLLGIQSVELGDKMTALEREAFAIAGEEFNLGSPK
FT                   QLGVILYEKLGMPILSKTATGQASTAEAVLAELAEQDFPLPKVLMQYRSMSKLKSTYTD
FT                   RLPEQINPRTGRIHTSYHQAVAVTGRLSSSDPNLQNIPIRTAEGRRIRQAFVAPKGYKL
FT                   LAADYSQIELRIMAHLAQDEGLLHAFRNDLDVHRATAAEVFGVELENVTTDMRRSAKAI
FT                   NFGLIYGMSAFGLAKQIGVDRKQSQAYVDRYFARYPGVLDYMERTRAQAAEQGFVETIF
FT                   GRRLYLPDINAKNQSLRKGAERMAINAPMQGTAADIIKKAMVAVNGWLEESGLDARVIL
FT                   QVHDELVLEVREDLVDQISEQIRPHMSGAAELAVPLLVEVGVGNNWDEAH"
FT   gene            302633..302920
FT                   /locus_tag="PSPPH_0260"
FT                   /note="PSPPH0260"
FT   CDS_pept        302633..302920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34525"
FT                   /db_xref="GOA:Q48PV4"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PV4"
FT                   /protein_id="AAZ34525.1"
FT                   /translation="MCKVNRLILTGLLAFCPLLAVSAEDPPSAAPDVTIRTDGDKTIQE
FT                   YRQNGFLYAVKITPKHGKPYFLVRSDGTSPNFIRSDQPDMLIPEWKIFEW"
FT   gene            302957..303907
FT                   /gene="thrB"
FT                   /locus_tag="PSPPH_0261"
FT                   /note="PSPPH0261"
FT   CDS_pept        302957..303907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="PSPPH_0261"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="identified by match to protein family HMM PF01636;
FT                   match to protein family HMM TIGR00938"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36224"
FT                   /db_xref="GOA:Q48PV3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PV3"
FT                   /protein_id="AAZ36224.1"
FT                   /translation="MSVFTPLARPELEAFLAPYGLGRLLDYQGIAAGSENTNYFISLEQ
FT                   GEFVLTLVERGPVQEMPFFIELLDVLHDADLPVPYALRTTDGEALRQLADKPALLQPRL
FT                   PGKHISEPNTQHCVQIGELLANLHLATREQVLERKTDRGLDWMLSEGRNFLSHLGETQR
FT                   ALLEKSLQEIEDFKPQIMALPRANLHADLFRDNVLFEGTHLTGLIDFYNACSGPMLYDL
FT                   AIALNDWCSRENGQLDAVRARALLGAYAGLRPFTAAESKLWTTMLRIACVRFWLSRLIA
FT                   AETFAGQDVLIHDPAEFERRLAERQEAHIALPFAL"
FT   gene            complement(304157..305098)
FT                   /gene="znuA"
FT                   /locus_tag="PSPPH_0262"
FT                   /note="PSPPH0262"
FT   CDS_pept        complement(304157..305098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="PSPPH_0262"
FT                   /product="zinc ABC transporter, periplasmic zinc-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34925"
FT                   /db_xref="GOA:Q48PV2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PV2"
FT                   /protein_id="AAZ34925.1"
FT                   /translation="MRRLLNLVAVLWVSLLVISPVQAEVRVLTSIKPLQLIAAAVQDGV
FT                   GTPEVLLPPGASPHNYALRPSDVRRVQEVELLYWIGPDMEAFLPRVIQGRKLPAVAVQS
FT                   LPGMHLRHFGEDNASHDDHEHDHDNDADEHDHDHRPGSLDSHLWLSTVNARVIAAKMAT
FT                   DLSAADPANAARYASNAAAFSKRLDALDARIKGRVSAVAGKPYFVFHEAFDYFEEAYGL
FT                   KHAGVFAIAAEIQPGAQHVAAMRERLKAAGKTCVFSEPPLRPRLAETLSAGLPVKLAEL
FT                   DGLGGYTPATAQGYEQVLQKLADDLAGCLSSL"
FT   gene            305166..305648
FT                   /locus_tag="PSPPH_0263"
FT                   /note="PSPPH0263"
FT   CDS_pept        305166..305648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0263"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by similarity to SP:P32692"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34331"
FT                   /db_xref="GOA:Q48PV1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PV1"
FT                   /protein_id="AAZ34331.1"
FT                   /translation="MPNTPLASRPHDHSHCVHSALAEADALCAKQGLRLTNLRRRVLEL
FT                   VWQSHKPLGAYDILAVLSDEDGRRAAPPTVYRALDFLLENGLVHRIASLNAFTGCNHPT
FT                   HAHQGQFLICRLCHAAIELQHPAISNAIIDAAAGVGFAVEGQTVEIVGVCAGCKAA"
FT   gene            305648..306445
FT                   /gene="znuC"
FT                   /locus_tag="PSPPH_0264"
FT                   /note="PSPPH0264"
FT   CDS_pept        305648..306445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="PSPPH_0264"
FT                   /product="zinc ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33771"
FT                   /db_xref="GOA:Q48PV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PV0"
FT                   /protein_id="AAZ33771.1"
FT                   /translation="MTDALIRLEQVAVTLSGQSVLDNIQLSVKPGEIVTLIGPNGAGKT
FT                   TLVRAVLGLLKPDSGTVWRKPKLRVGYMPQKLHVDQTLPLSVLRFLRLVPGVDRMAAES
FT                   ALEEVGAEKVIDSPIQGISGGEMQRVLLARALLRKPELLVLDEPVQGVDVAGQAELYGL
FT                   ITRLRDRHQCGVLMVSHDLHLVMSTTDQVVCLNRHVCCSGHPEHVSHDPAFVELFGKNA
FT                   QSLAIYHHHHDHAHDLHGAVVNDAPATSSHTHTHVHGDHCKHG"
FT   gene            306438..307226
FT                   /gene="znuB"
FT                   /locus_tag="PSPPH_0265"
FT                   /note="PSPPH0265"
FT   CDS_pept        306438..307226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="PSPPH_0265"
FT                   /product="zinc ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37626"
FT                   /db_xref="GOA:Q48PU9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PU9"
FT                   /protein_id="AAZ37626.1"
FT                   /translation="MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLG
FT                   VALGFLLDISPTIAVTVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFM
FT                   HEVRIDLMAYLFGDLLAISPADLTWILGGSALVLVLIVALWRPLLAITVHEELARVEGL
FT                   PVAALRMALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGV
FT                   IAVCVGLSLSWFKDTPAGPSIVVSAAALFLLSFVLPRRAV"
FT   gene            307265..307981
FT                   /locus_tag="PSPPH_0266"
FT                   /note="PSPPH0266"
FT   CDS_pept        307265..307981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0266"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33351"
FT                   /db_xref="GOA:Q48PU8"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PU8"
FT                   /protein_id="AAZ33351.1"
FT                   /translation="MKPFAPRYLLLVAFSILLGACQSAPTAETPASDVQPDAFAQLEQN
FT                   IVSNELATAEDQLAALQAANPADIRLEPFQRRLAEAYLSRSQISLQKGDMNAAANALTR
FT                   ARALMPKAPALTSGVNGAIAHARKAELEKAEADLKAAEARRVAKLIDPSAESTTIELKI
FT                   GDMRALRRQLDDIAADTVAFNCEVLMVVPRTEDYPWLATLLTKRVVKANPDFELQLRRE
FT                   IERNEKAQIILTPAKS"
FT   gene            complement(308133..310283)
FT                   /gene="katE"
FT                   /locus_tag="PSPPH_0267"
FT                   /note="PSPPH0267"
FT   CDS_pept        complement(308133..310283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katE"
FT                   /locus_tag="PSPPH_0267"
FT                   /product="catalase HPII"
FT                   /EC_number="1.11.1.6"
FT                   /note="identified by similarity to SP:P21179; match to
FT                   protein family HMM PF00199; match to protein family HMM
FT                   PF06628"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36605"
FT                   /db_xref="GOA:Q48PU7"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PU7"
FT                   /protein_id="AAZ36605.1"
FT                   /translation="MASKNAPPVTATPKSELAGTDTLDRGNTNDKLESLEQFRSDATQQ
FT                   ALRTNHGVKISDNQNTLKVGSRGPSLLEDFIMREKITHFDHERIPERIVHARGTAAHGY
FT                   FQTYEDHGALSKAGFLRDPGKKTPVFVRFSTVQGPRGSGDTVRDVRGFAVKLYTEEGNF
FT                   DLVGNNMPIFFIQDAIKFPDFVHAVKPEPHNEIPTGGSAHDTFWDFVSLVPESAHMVLW
FT                   TMSDRAIPKSLRTMQGFGIHTFRFINTEGKSSFVKFHWKPKFGVCSLVWDEAQKLAGKD
FT                   TDFHRRDLWESIEMGDYPEWELGVQIVAEEDEHKFDFDLLDPTKIIPEELVPVTPLGKM
FT                   VLNRNPDNYFAETEQVAFCPGHIVPGIDFSNDPLLQGRLFSYTDTQISRLGGPNFHEIP
FT                   INRPIAPNHNGQRDAQHRTTIDKGRASYEPNSIDGGWPKETPAGPVDGGFETYPERVEA
FT                   HKVRERSESFGDHFSQATLFFQSMSHHEKEHIIAAYSFELGKVEREYIRARQVNEILAN
FT                   IDLELASRVAANLGLPAPTAGTVPVRQTSVKESPALSQVNLLSGDIVSRKVAILVADGV
FT                   DGKAVEAMKAALTAEGAHAKVLGPTSAPVKTADGQSLPVDASAEGLPSVAFDAVFVPGG
FT                   KASIEALKGDGVALHFILEAYKHLKAISFAGEAKELLSLLRLEEDAGLLEVSDSKSFKA
FT                   FFNAIAQHRVWDREVKAKAVPA"
FT   gene            310590..311597
FT                   /locus_tag="PSPPH_0268"
FT                   /note="PSPPH0268"
FT   CDS_pept        310590..311597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0268"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37258"
FT                   /db_xref="GOA:Q48PU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PU6"
FT                   /protein_id="AAZ37258.1"
FT                   /translation="MIEFHNVHKTYRVAGKEIPALHPTSLRVDGGQVFGIIGHSGAGKS
FT                   TLLRLINRLETPSGGQIVVDGEDVTALDANGLRRFRQQVGMIFQHFNLLASKTVADNVA
FT                   MPLTLAGDMSRKQIDQRVAELLKRVGLSDHAKKYPAQLSGGQKQRVGIARALATKPKIL
FT                   LCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDAGVIVE
FT                   QGKVADVFLHPQHPTTRRFVQEDDQIDENEQRDDFAHVQGRIVRLTFQGDATYAPLLGT
FT                   VARETGVDYSILAGRIDRIKDTPYGQLTLAITGGDMDAAFARFTAADVHMEVLR"
FT   gene            311597..312271
FT                   /locus_tag="PSPPH_0269"
FT                   /note="PSPPH0269"
FT   CDS_pept        311597..312271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0269"
FT                   /product="D-methionine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36013"
FT                   /db_xref="GOA:Q48PU5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PU5"
FT                   /protein_id="AAZ36013.1"
FT                   /translation="MDAFLNLFSNVDWYEIWVATGDTLIMLGVSLGFTILLGLPLGVLM
FT                   FLTSPRQLLEHKQLYATVGLIVNMLRALPFIILLIVMMPLTEIITGTSLGILGTLPPLI
FT                   AGATPFFARLVETALREVDRGIIEATQAMGATTRQIIVKALLPEARPGILAAITVTAIA
FT                   LVSFTAMAGAVGAGGLGDLAIRYGYQRFQNDVMFVTVVLLLVLVQILQTIGDRLVAHFT
FT                   HR"
FT   gene            312322..313095
FT                   /locus_tag="PSPPH_0270"
FT                   /note="PSPPH0270"
FT   CDS_pept        312322..313095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0270"
FT                   /product="D-methionine-binding lipoprotein MetQ"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36631"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PU4"
FT                   /protein_id="AAZ36631.1"
FT                   /translation="MKKLLAIFAAVTALSAQANETLTVAASAVPHAEILEFVKPTLAKE
FT                   GVDLNIKVFNDYIQPNVQVSQNRMDANFFQHQPYLDEFNKGKGTDLVAVAKVHVEPFGA
FT                   YSDKFKKLEELPNGANVALPNDATNEGRALLLLAKAGLITLKDPTNILSKPSDVVNNPK
FT                   DLKFRELEAATLPRVLTQVDLALINTNYALSAKLEPTKDALIIEGADSPYANILVARPD
FT                   NKDSDAMKKLVAALQSPEVKTFLAEKYKGAVVPAF"
FT   gene            complement(313250..313909)
FT                   /locus_tag="PSPPH_0271"
FT                   /note="PSPPH0271"
FT   CDS_pept        complement(313250..313909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0271"
FT                   /product="Sco1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33763"
FT                   /db_xref="GOA:Q48PU3"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PU3"
FT                   /protein_id="AAZ33763.1"
FT                   /translation="MPITTRVDAMTRTQKTVFIAAAIVALVLGLILSQLLPGSGSEDQA
FT                   ALNDAGIVLLPKSRQLPALSMSDQNGAAVALDDLKGKWTLMFFGYTFCPDICPTTLAQI
FT                   KQIRTELPEKVVERMRVVLVSVDPDRDTPQQLKQYLGYFDKQYIGLTSPVADIQKLANA
FT                   VSIPFIPADTSKPNYFVDHSGNLALIGPDGTQRGFIRAPLNNQKLVKQLPGLLERD"
FT   gene            complement(313946..314434)
FT                   /locus_tag="PSPPH_0272"
FT                   /note="PSPPH0272"
FT   CDS_pept        complement(313946..314434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0272"
FT                   /product="cytochrome c oxidase assembly protein, CtaG/Cox11
FT                   family"
FT                   /note="identified by match to protein family HMM PF04442"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34258"
FT                   /db_xref="GOA:Q48PU2"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PU2"
FT                   /protein_id="AAZ34258.1"
FT                   /translation="MTQPLLSKRLALRLICLLVIMFICGFALPSLYALLTGHDRNGDQD
FT                   ASRQNEVQFTATNSAGMVWAFYPRASQMQINPGAVNEMIFVAQNPTDKPMKAQAVPGIS
FT                   PGKAAEWFHKTECFCFTQQTLQPGERIEMPVRFIVDRDLPAEVKRLTLAYTLFDVTAP"
FT   gene            314704..315354
FT                   /locus_tag="PSPPH_0273"
FT                   /note="PSPPH0273"
FT   CDS_pept        314704..315354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33186"
FT                   /db_xref="GOA:Q48PU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PU1"
FT                   /protein_id="AAZ33186.1"
FT                   /translation="MNTAALREQIQLAHQHEAETGHLLQQLEQKLPHLHPAIHLPDVDA
FT                   KDVLTRFVTAYIDLVPDLLDAAHEVAVEAGIEGQIKPVLKIAEHFFAAPPSIMDGHEGL
FT                   ESLLDEAYLAHRLVEEVNDLYIKHFGQPLIPSNTTVASVIAHQLIGEQFANQLDEAVHH
FT                   AVDKLLDDESFALDSVEAYREKLTSPDTGAAWKRWPSLSRQLGIGLELERSVI"
FT   gene            complement(315477..316994)
FT                   /locus_tag="PSPPH_0274"
FT                   /note="PSPPH0274"
FT   CDS_pept        complement(315477..316994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0274"
FT                   /product="sulfate transporter family protein"
FT                   /note="identified by match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36607"
FT                   /db_xref="GOA:Q48PU0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PU0"
FT                   /protein_id="AAZ36607.1"
FT                   /translation="MKTALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLITGIVGG
FT                   LIVGWIAGSPLQVSGPAAGLAVLVFEVVREHGMAMLGPILVLAGLLQLLAGRFKLGCWF
FT                   RVTAPAVVYGMLAGIGVLIVLSQAHVMFDSSPKPSGLDNLIAFPSTLIQAFGPGTGMQA
FT                   GMLGLGTMLIMWGWEKLRPQSLRFVPGALLGVGIATGISLFMALQVKRVEVPDNLADAI
FT                   DWLRPTDLMNLADPAILVAAIVVAFIASAETLLSASAVDRMHSGQRSDFDKELSAQGVG
FT                   NMLCGVLGALPMTGVIVRSSANVQAGATTRFSTIFHGLWLLAFVLLLSSVLQSIPVASL
FT                   AGVLVYTGLKLVDLKAFRGLGRYGRMPMFTYAATAVAIIFTDLLTGVLVGFGLTLVKLA
FT                   FKASRLKINVVELAGEKEFELRLVGAATFLKVPALTQALGTIPQGSTVHVPLGNLSYID
FT                   HSCLELLEEWGRSNAAHGTRLLIEPHGLKRRLEGRIYTTTGIGSGAA"
FT   gene            complement(317114..317779)
FT                   /gene="cynT"
FT                   /locus_tag="PSPPH_0275"
FT                   /note="PSPPH0275"
FT   CDS_pept        complement(317114..317779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="PSPPH_0275"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="identified by similarity to SP:P17582; match to
FT                   protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33738"
FT                   /db_xref="GOA:Q48PT9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT9"
FT                   /protein_id="AAZ33738.1"
FT                   /translation="MKHIVDGFVHFRNEVFPQQEELFKKLATAQSPRAMFITCADSRIV
FT                   PELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTALEYAVVALGVQHIIVCGHSDCGAM
FT                   RAVLNPDSLDKMPTVKAWLRHAEVARTVVEQNCSCSGELETMQVLTQENVISQLHHLRT
FT                   HPSVAAKMASGQLFIHGWVYSIETSEILAYDAELDRFIPLDGSGPTPMASPKARFSAD"
FT   gene            complement(318060..319118)
FT                   /locus_tag="PSPPH_0276"
FT                   /note="PSPPH0276"
FT   CDS_pept        complement(318060..319118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0276"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33221"
FT                   /db_xref="GOA:Q48PT8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT8"
FT                   /protein_id="AAZ33221.1"
FT                   /translation="MSSPYPVRGRGTASNPHNRFAPSQSVAEDDGWYQEVPLTQGTQVT
FT                   SETAKSIITRNSSPDIPFDRSINPYWGCEHGCIYCFARPSHAYWDMSPGLDFETKLIAK
FT                   TNAAALLEQQLSKPGYRCAPITLGANTDPYQPIEREYRITRATLEVLLRYRHPVSIITK
FT                   GSLILRDLDLLAEMARLRLVSVFISLTTLDDELKCILEPRAAAPKARLRAIRVLRQAGV
FT                   PVGVLCAPMIPMINDSELEALLSEAKAAGALSASYVMLRLPLEVAPLFDEWLKTHYPQR
FT                   AEHVMSLIRQSRGGALYDSQFGSRMRGEGPFADLLAQRYALAIKRLGLNKRGGFTLDCD
FT                   AFCPPGGQMSLL"
FT   gene            complement(319242..319910)
FT                   /gene="elbB"
FT                   /locus_tag="PSPPH_0277"
FT                   /note="PSPPH0277"
FT   CDS_pept        complement(319242..319910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /locus_tag="PSPPH_0277"
FT                   /product="enhancing lycopene biosynthesis protein 2"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34338"
FT                   /db_xref="GOA:Q48PT7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT7"
FT                   /protein_id="AAZ34338.1"
FT                   /translation="MQKKVAVILSGCGVYDGAEIHESVLTLLRLDQRGAQVQCFAPNIA
FT                   QHHVINHLTGEEMPESRNVLIESARIARGDVKDIRDANAEDFDALIIPGGFGSAKNLSD
FT                   LALQGPACQVEAGLLELAEAFAEAGKPVGLICITPALAAKIYGPGVTCTIGNDPDTAAA
FT                   ITKMGGSHAPCAVDDIVEDEARKLVCTPAYMVAKSISEAASGINKLVDRVLELTHEGDA
FT                   "
FT   gene            complement(320118..320780)
FT                   /locus_tag="PSPPH_0278"
FT                   /note="PSPPH0278"
FT   CDS_pept        complement(320118..320780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0278"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF00597"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33754"
FT                   /db_xref="GOA:Q48PT6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT6"
FT                   /protein_id="AAZ33754.1"
FT                   /translation="MLQNFLNEFGYFALFLGTFFEGETILVLAGFLAFRGYMDLNIVIL
FT                   VAFCGSYAGDQLWYFMGRKHGRKLLARKPRWQLMGDKALRLVRKHPDIWVLSFRFVYGL
FT                   RTVMPVAIGLSGYPPGRYLLLNGIGAAVWAAALGSGAYHFGAVLEGLLGNVKKYELWVL
FT                   GALILLGLGLWLRRRIKNARIAREEREEKSRFCASAAASDLDTPVPVPVDLTKKSDE"
FT   gene            321012..322022
FT                   /gene="hemB"
FT                   /locus_tag="PSPPH_0279"
FT                   /note="PSPPH0279"
FT   CDS_pept        321012..322022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="PSPPH_0279"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="identified by match to protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35734"
FT                   /db_xref="GOA:Q48PT5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT5"
FT                   /protein_id="AAZ35734.1"
FT                   /translation="MSFTPANRLFPLTRLRRNRRDDFSRRLVRENVVTVDDLILPVFVL
FT                   DGENRRESIASMPGVERLSVDLLLEEAEHWVALGIPALALFPVTPAEKKSLDGAEAWNP
FT                   DGIAQRATRALRDRFPELGVITDVALDPFTTHGQDGILDEEGYVQNDITVDALVKQALS
FT                   HADAGAQVIAPSDMMDGRIQAIRESLELAGHVNVRIMAYSAKYASAYYGPFRDAVGSSL
FT                   NLGKANKASYQMDPANSNEALHEVAADLAEGADMVMVKPGMPYLDILHRVKDEFKVPTF
FT                   VYQVSGEYAMHMAAIQNGWLSEGVILESLTAFKRAGADGILTYFAVRAAQLLKGQ"
FT   gene            322039..324249
FT                   /gene="ppk"
FT                   /locus_tag="PSPPH_0280"
FT                   /note="PSPPH0280"
FT   CDS_pept        322039..324249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="PSPPH_0280"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="identified by similarity to SP:Q9S646; match to
FT                   protein family HMM PF02503"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36440"
FT                   /db_xref="GOA:Q48PT4"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT4"
FT                   /protein_id="AAZ36440.1"
FT                   /translation="MNTEALIEAAVEVDVPQATPAVEPDIEVIPAIEAPAATVPAIVAP
FT                   NLDDSSLYIHRELSQLQFNIRVLEQALDESYPLLERLKFLLIFSSNLDEFFEIRVAGLK
FT                   KQITFAREQAGADGLQPHQALARISELVHGHVDRQYAILNDILLPELEKHQVRFIRRRH
FT                   WTAKLKAWVRRYFRDEIAPIITPIGLDPTHPFPLLVNKSLNFIVELEGIDAFGRDSGLA
FT                   IIPAPRLLPRVIKVPEEVCGPGDNFVFLSSMIHAHADDLFQGMKVKGCYQFRLTRNADL
FT                   ALDSEDVEDLARALRGELFSRRYGDAVRLEVADTCPKDLSDYLLKQFNLNESELYQVNG
FT                   PVNLTRLFSITGLDSHPELQYPPFTPAIPKLLQNSENIFSVISKQDILLLHPFESFTPV
FT                   VDLLRQAAKDPHVLAVRQTLYRSGANSEIVDALVDAARNGKEVTAVIELRARFDEESNL
FT                   QLASRLQAAGAVVIYGVVGFKTHAKMMLILRREAGEIVRYAHLGTGNYHAGNARLYTDY
FT                   SLLTSDDALCEDVGKLFSQLIGMGKTLRMKKLLHAPFTLKKGMLDMIARETQFALDGKP
FT                   AHIIAKFNSLTDPKIIRALYKASQSGVRIDLVVRGMCCLRPGIAGVSHNIHVRSIIGRF
FT                   LEHTRVFYFLNGGDEQMFLSSADWMERNLDKRVETCFPVEGKKLILRVKKELESYLTDN
FT                   THSWLLQPDGRYVRSMPTGNQNARSAQATLLERLSNPVLSVR"
FT   gene            complement(324236..325738)
FT                   /gene="ppx"
FT                   /locus_tag="PSPPH_0281"
FT                   /note="PSPPH0281"
FT   CDS_pept        complement(324236..325738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="PSPPH_0281"
FT                   /product="exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="identified by similarity to SP:P29014; match to
FT                   protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35075"
FT                   /db_xref="GOA:Q48PT3"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT3"
FT                   /protein_id="AAZ35075.1"
FT                   /translation="MPHSTPKNFSLIAAIDLGSNSFHMVVAKANQGEIRILERLGEKVQ
FT                   LAAGIDEERQLTEESMQRGLDCLKRFAQLINGLPPGAVRIVGTNALREARNRNDFIHRA
FT                   EEILGHPVEVISGREEARLIYLGVSHTLADTPGKRLVADIGGGSTEFIIGQRFEPLLRE
FT                   SLQMGCVSFTQRYFRDGKVTPARYAQAYTAARLEIMSIEHALHRLKWDEAIGSSGTIRA
FT                   IGLALKANGYGAGEVNAEGLAWLKRKLFKLGDVEKIDFDGIKPDRRAIFPAGLAILEAI
FT                   FDALELKRMDHCEGALREGVLYDLMGRHHHEDVRERTLSSLMERYHVDLEQAARVEAKA
FT                   LHALEQVAESWELQHESYAELLSWAAKVHEIGLDIAHYHYHKHGAYLIEHSDLAGFSRE
FT                   DQQMLALLVRGHRRNIPKDKFADFGAEGIKLIRLCVLLRFAILFHHIRGTQEMPRVILR
FT                   ADGPNLDAEFPTGWLENNQLTQADFALEAEWLTRVGIVFSVR"
FT   gene            complement(326114..326878)
FT                   /locus_tag="PSPPH_0282"
FT                   /note="PSPPH0282"
FT   CDS_pept        complement(326114..326878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0282"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35891"
FT                   /db_xref="GOA:Q48PT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT2"
FT                   /protein_id="AAZ35891.1"
FT                   /translation="MPLLRISALHKYYGDHHVLKGIDLSVEEGQVVAIIGRSGSGKSTL
FT                   LRTLNGLESINDGVIEVDGEYLDAARADLRTLRQKVGMVFQQFNLFPHLSVGENVMLAP
FT                   QVVQKVPKAEAAKLARKMLERVGLGEKFDAFPDRLSGGQQQRVAIARALAMSPKVLLCD
FT                   EITSALDPELVNEVLSVVRQLAADGMTLIMVTHEMRFAREVGDKLVFMHQGKVHEVGDP
FT                   KVLFANPKTPELANFIGTVEHAWQEPTQSVAR"
FT   gene            complement(326865..327512)
FT                   /locus_tag="PSPPH_0283"
FT                   /note="PSPPH0283"
FT   CDS_pept        complement(326865..327512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0283"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37827"
FT                   /db_xref="GOA:Q48PT1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT1"
FT                   /protein_id="AAZ37827.1"
FT                   /translation="MDFTLWDILRNLLIGLQWTVALSLMAFIGGGLIGLLVMGMRTSEK
FT                   TGPRVTAKLYIELFQGTPLLMQLFLVFFGVALMGMNISPWAAAALALTLFTSAYLAEIW
FT                   RGCVESISKGQWEASASLAMTPFEQMRYVILPQALRIAVAPTVGFSVQVVKGTAVTSII
FT                   GFTELTKTGSMLANATFEPFMVYGFVALGYFILCYPLSLCARHLERRLHASA"
FT   gene            complement(327512..328177)
FT                   /locus_tag="PSPPH_0284"
FT                   /note="PSPPH0284"
FT   CDS_pept        complement(327512..328177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0284"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34375"
FT                   /db_xref="GOA:Q48PT0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PT0"
FT                   /protein_id="AAZ34375.1"
FT                   /translation="MAYHFDFTPVLQNIDVLLRGALFTLELTAIGTLLGVSLGIVGAVV
FT                   RAWKIQPFATIFAIYVELIRNTPFLVQLFFIFFGLPSLGVQISEWQAAVLAMVINLGAY
FT                   STEIIRAGIQAIPKGQLEASAALAMNRYEAFRYVVLVPALGKVWPALSSQIIIVMLGSA
FT                   VCSQIATEELSFFANFIQSRNFRSFETYIVTTLIYLAMALLIRQLLAWIGRRYISRNS"
FT   gene            complement(328207..329169)
FT                   /locus_tag="PSPPH_0285"
FT                   /note="PSPPH0285"
FT   CDS_pept        complement(328207..329169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0285"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33680"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PS9"
FT                   /protein_id="AAZ33680.1"
FT                   /translation="MLGRQRFSTRQSRASHTFTGQTSKTINTLQSLSYGTSSPDGMRCA
FT                   LETDQHPTFRPEISMTKRYSALLAALFASLMLSQTPAHANGLDDVVARGTLKVAVPQDF
FT                   PPFGSVGPDMKPRGLDIDTAQLLADQLKVKLELTPVNSTNRIPFLTTGKVDLVISSLGK
FT                   NPDREKVIDFSRAYAPFYLAVFGPPDSPVKDIADLKGKTISVTRGAIEDIELSKVAPEG
FT                   ATIKRFEDNNSTIAAYLAGQTDLIASGNVVMVAISERNPKRIPALKVKLKDSPVYVGVN
FT                   KGQPELLGKVDEILNAAKADGALEKASQKWLKQPLPADL"
FT   gene            329239..329946
FT                   /locus_tag="PSPPH_0286"
FT                   /note="PSPPH0286"
FT   CDS_pept        329239..329946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0286"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ32990"
FT                   /db_xref="GOA:Q48PS8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PS8"
FT                   /protein_id="AAZ32990.1"
FT                   /translation="MMPHTSLAVPESALRAIRKLIAEQGYKPGESLPSQRDLAVLLGVS
FT                   RASLREALSSLSALGVVSVQPGKGVFVQSISEPEQRTSGFSWPFEAQVSPADTFQLRYA
FT                   LEGFAAGLAAVTLTADERDVLEDNVEAMRMELRAGDFEAAARLDFEFHRHILVASGNQA
FT                   MLGIVTAGADIFLESQKMPFIRAARVMETWQEHRKILRALARHASGPAQKAMQDHIRGA
FT                   ALRTGIVFVSPSS"
FT   gene            330068..330397
FT                   /gene="trxA"
FT                   /locus_tag="PSPPH_0287"
FT                   /note="PSPPH0287"
FT   CDS_pept        330068..330397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="PSPPH_0287"
FT                   /product="thioredoxin"
FT                   /note="identified by similarity to SP:P00274; match to
FT                   protein family HMM PF00085; match to protein family HMM
FT                   TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35226"
FT                   /db_xref="GOA:Q48PS7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PS7"
FT                   /protein_id="AAZ35226.1"
FT                   /translation="MSNEKIKHVTDANFEAEVLKAEGAVLVDYWAEWCGPCKMIAPVLD
FT                   EIADTYAGKLTIAKLNIDENQETPAKHGVRGIPTLMLFKNGNVEATKVGALSKSQLAAF
FT                   LDANI"
FT   gene            330629..331888
FT                   /gene="rho"
FT                   /locus_tag="PSPPH_0288"
FT                   /note="PSPPH0288"
FT   CDS_pept        330629..331888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="PSPPH_0288"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34363"
FT                   /db_xref="GOA:Q48PS6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PS6"
FT                   /protein_id="AAZ34363.1"
FT                   /translation="MNLTELKQKPITELLEMAEQAGIENMARSRKQDVIFSLLKRHAKS
FT                   GEEISGDGVLEILQDGFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPP
FT                   KEGERYFALLKVDTINYDRPENAKNKILFENLTPLFPTIRMKMEAGNGSTEDLTGRVID
FT                   LCAPIGKGQRGLIVAPPKAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRT
FT                   VRGEVVASTFDEPPTRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDAHALEKPKRFFGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGN
FT                   MELPLDRKIAEKRVFPAININRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFL
FT                   IDKLKQTKTNDEFFLSMKRK"
FT   gene            332017..333483
FT                   /gene="ubiD"
FT                   /locus_tag="PSPPH_0289"
FT                   /note="PSPPH0289"
FT   CDS_pept        332017..333483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="PSPPH_0289"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="identified by match to protein family HMM PF01977;
FT                   match to protein family HMM TIGR00148"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36611"
FT                   /db_xref="GOA:Q48PS5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PS5"
FT                   /protein_id="AAZ36611.1"
FT                   /translation="MKFKDLRDFVQQLEQRGELKRIQMPISPVLEMTEICDRTLRAKGP
FT                   ALLFEKPVGFDIPVLGNLFGTPERVAMGMGAEAVSELREIGKLLAFLKEPEPPKGLKDA
FT                   WSKLPIFRKVIAMAPKVVKDAPCQEIVIEGDDVDLGMLPVQTCWPGDVAPLITWGLTVT
FT                   KGPNKERQNLGIYRQQVIGRNKIIMRWLSHRGGALDFRDWCAKHPGEPYPVAVALGADP
FT                   ATILGAVTPVPDSLSEYAFAGLLRGSRTELIKCRGSNLQVPASAEIVLEGVIHPGEMAD
FT                   EGPYGDHTGYYNEVDSFPVLTVERITHRIKPIYHSTYTGRPPDEPAILGVALNEVFVPI
FT                   LQKQFPEIVDFYLPPEGCSYRMAVVTIKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVTD
FT                   DDINARDWNDVIWAITTRMDPKRDTVMIDNTPIDYLDFASPVSGLGSKMGLDVTNKWPG
FT                   ETTREWGRAIVKDEATTRRVDEIWTQLGID"
FT   gene            333483..334451
FT                   /locus_tag="PSPPH_0290"
FT                   /note="PSPPH0290"
FT   CDS_pept        333483..334451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0290"
FT                   /product="oxidoreductase, iron-sulfur-binding"
FT                   /EC_number="1.17.1.-"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35792"
FT                   /db_xref="GOA:Q48PS4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PS4"
FT                   /protein_id="AAZ35792.1"
FT                   /translation="MRVTLQPSGAVLDTLPGERILDAAQRLGYECPQSCRNGNCHICSA
FT                   LLVEGRVMQSGQELDHGEIHTCVAEPLEDCVVLWDGVLAKGELPVRSFACQLSECVEIG
FT                   GDVWRVGLRAPAGKPPRYHAGQYLMIERENGEKSAFSIASAPHSGRDLELHVLAREDSA
FT                   RSLIEQLQRNKMARVELPFGDTHLAELPDGPLVLIAAGTGMAQMNSLLEHCRSAGFSHP
FT                   VHLYWGVRRPEDFYQVSHWDEWTALPNLFLHKVVSDLCGWEGRCGLLHEAVCEDIKDLS
FT                   AVYVYASGSPAMVYGTLDALVSAGMDAHQMRADVFAYAPRP"
FT   regulatory      complement(334205..334237)
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans (PMID: 17073302)"
FT                   /regulatory_class="promoter"
FT   gene            334660..335328
FT                   /locus_tag="PSPPH_0291"
FT                   /note="PSPPH0291"
FT   CDS_pept        334660..335328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0291"
FT                   /product="cation transport protein chaC"
FT                   /note="identified by match to protein family HMM PF04752"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36774"
FT                   /db_xref="GOA:Q48PS3"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PS3"
FT                   /protein_id="AAZ36774.1"
FT                   /translation="MENPINELAAAVHDGLGLTYPPVIDLGPQLTREQLLASMDATMRL
FT                   HKGGPVWLFAYGSLIWRPECTAVESQRGRVHGYHRGLYLWSHEHRGTPEVPGLVFGLDR
FT                   GGSCTGFAYRLPDECLEKSLLALWEREMRYPSYRPHWLNCRLEDGRKVQALGFVLERHL
FT                   PSYAGNLPDSVLSQVLASASGRYGTTREYVEQTAKALRSHAMPDLNLEARLKRCKSETA
FT                   "
FT   gene            complement(335341..336690)
FT                   /gene="glpT"
FT                   /locus_tag="PSPPH_0292"
FT                   /note="PSPPH0292"
FT   CDS_pept        complement(335341..336690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="PSPPH_0292"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00712; match to protein
FT                   family HMM TIGR00881"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37197"
FT                   /db_xref="GOA:Q48PS2"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PS2"
FT                   /protein_id="AAZ37197.1"
FT                   /translation="MFGFFRPARHQAPLPEEKVDSTYRRLRWQIFAGIFIGYAGYYLLR
FT                   KNFSLAMPYLIDEGYTRGQLGVAMSAIAIAYGLSKFLMGIVSDRSNPRYFLPFGLLVSA
FT                   GIMFIFGFAPWATSSVTIMFVLLFINGWAQGMGWPPSGRTMVHWWSQKERGGVVSVWNV
FT                   AHNVGGGLIGPLFLLGMGWTNDWHAAFYVPAAVALLVAVFAFATMRDTPQSVGLPPIEH
FT                   YKNDYPEGYDASHEEEFSAREIFVKYVLRNKFLWYIAMANVFVYLLRYDVLDWAPTYLK
FT                   EAKHFTVDKTSWAYFLYEWAGIPGTLLCGWMSDRIFKGNRGLTGMVFMFLVTIATLVYW
FT                   LNPEGNPTVDMIALVSIGFLIYGPVMLIGLQALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAAMGYTVDHFGWDGGFVLLIGACILAMAFLAPTLRHKQVASTSRDTKD"
FT   gene            336965..337630
FT                   /locus_tag="PSPPH_0293"
FT                   /note="PSPPH0293"
FT   CDS_pept        336965..337630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0293"
FT                   /product="tonB domain protein"
FT                   /note="identified by match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37681"
FT                   /db_xref="GOA:Q48PS1"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PS1"
FT                   /protein_id="AAZ37681.1"
FT                   /translation="MRISAFMIAVALAPHVGATESFLVPVYTPAPVFPPELVKTRYAGK
FT                   VRAQLWIKSDGQVREVRAVESGHPQLAEAVEQALRQWRYKPWVGTVGAPPMTTITVPVI
FT                   FGSHGYRRFNTEVTVGLGNIRCGYLNHEVKSARQDYPKEPLSKVDVFWYTGQALFGSHV
FT                   AHQRSEPQRKALLELLGASIPAVVSNCRSNPDHLYGDYLPGPVKVLMVGLAEQAEGSE"
FT   gene            337627..338262
FT                   /locus_tag="PSPPH_0294"
FT                   /note="PSPPH0294"
FT   CDS_pept        337627..338262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33927"
FT                   /db_xref="GOA:Q48PS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PS0"
FT                   /protein_id="AAZ33927.1"
FT                   /translation="MSRVLSVIVLAGLLSAGTAQALPSYPVPLYMPEPDYPASMRYALV
FT                   KNSVTVRIFIQADGGVRFLEVQGATDPRFISLTRSAVELWTFEPWDPPASHPEGEAVTV
FT                   TFTFTGRPHSNPPLTANAELKQELCWQLNREMFEGRKWRKDVKPDALMRTELYLSSGPV
FT                   IAQFLTLDERQALVLELLEAVPDIIAQCQKNPMRKYVDYLPENVRSAL"
FT   gene            complement(338360..339097)
FT                   /locus_tag="PSPPH_0295"
FT                   /note="PSPPH0295"
FT   CDS_pept        complement(338360..339097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34447"
FT                   /db_xref="GOA:Q48PR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PR9"
FT                   /protein_id="AAZ34447.1"
FT                   /translation="MEELNYHLRQLPDHIHTELAAYVGDWSGMNYIEIADKYIHAANHL
FT                   ISSKRAHLQPGYIELANTPKENIRIAPGNGGLADLVAEARSFLDSILGLENFKRSIEDL
FT                   FARLSELGRQHAERLAQEAQVEEAARARAEAEAAVRRLAEEQAAQQRAIEAALQLAQRQ
FT                   VEEAKHALALRNAEEARAKEAESRHAVEVTFGPEASREIDNAIKVLKGTIEIAITDFSN
FT                   AFNAHGALGLSRLETIQNMSATH"
FT   gene            complement(339145..339417)
FT                   /locus_tag="PSPPH_0296"
FT                   /note="PSPPH0296"
FT   CDS_pept        complement(339145..339417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0296"
FT                   /product="colicin/pyocin immunity family protein"
FT                   /note="identified by similarity to SP:Q03708; match to
FT                   protein family HMM PF01320"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35598"
FT                   /db_xref="GOA:Q48PR8"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PR8"
FT                   /protein_id="AAZ35598.1"
FT                   /translation="MIFKEKLEDYTEEEFLEFLRGLSSQHIQLHGDEFVKHMDRLVKHF
FT                   VKVTEHPAQTDVIFYPEEGQEDTPEGILKTIKEWRAKNGKPGFKN"
FT   gene            complement(339414..341467)
FT                   /pseudo
FT                   /locus_tag="PSPPH_0297"
FT                   /note="PSPPH0297; S-type pyocin, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error; identified by
FT                   similarity to GB:AAO58658.1"
FT   gene            complement(341598..342575)
FT                   /gene="qor2"
FT                   /locus_tag="PSPPH_0298"
FT                   /note="PSPPH0298"
FT   CDS_pept        complement(341598..342575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor2"
FT                   /locus_tag="PSPPH_0298"
FT                   /product="quinone oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33355"
FT                   /db_xref="GOA:Q48PR7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PR7"
FT                   /protein_id="AAZ33355.1"
FT                   /translation="MKALLCKAFGPASTLVLEDVPGPEIKKNEILLDVHAAGVNFPDTL
FT                   IIEGKYQFKPPFPFSPGGEAAGVISAVGEKVTHLKPGDRVMALTGWGSFAEQVAVPGYN
FT                   VLPIPTSMDFTTAAAFSMTYGTSMHALKQRANLQAGETLLVLGASGGVGLAAVEIGKAL
FT                   GARVIAAASSAEKLEVAKNAGADELINYSETSLKDEVKRLTNDNGADVIYDPVGGDLFD
FT                   QAIRAIAWNGRLLVVGFASGRIPDLPVNLTLLKGASVVGVFWGSFAQRQPQDNAANFKQ
FT                   LFAWFEEGKLKPLVSTVYPLEKAGEAIDLLGERRAVGKVVVLVN"
FT   gene            342706..343113
FT                   /locus_tag="PSPPH_0299"
FT                   /note="PSPPH0299"
FT   CDS_pept        342706..343113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0299"
FT                   /product="flagellar protein FliL, putative"
FT                   /note="identified by match to protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34659"
FT                   /db_xref="GOA:Q48PR6"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PR6"
FT                   /protein_id="AAZ34659.1"
FT                   /translation="MKAWILVLLALSLPVMAQEEAKEEGGPPKAAYVSLTPPFVGNYAL
FT                   DGGPKLRVYKADIALRVTGADAEAAVKRNDALIRNQLVSLFTQQTVDSMSSAEAKENIR
FT                   QEALKQVQRVMTDEEGKPIVEDLLFNNFIVQ"
FT   gene            complement(343120..343569)
FT                   /locus_tag="PSPPH_0300"
FT                   /note="PSPPH0300"
FT   CDS_pept        complement(343120..343569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN70770.1; match to
FT                   protein family HMM PF04543"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34791"
FT                   /db_xref="GOA:Q48PR5"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PR5"
FT                   /protein_id="AAZ34791.1"
FT                   /translation="MAYWLMKSEPDEFSISDLQKRGNARWDGVHNYQARNFLRTMAEGD
FT                   EFFFYHSSCPEPGIAGIGKIAKAAYPDPTALDPDSHYHDAKATADKNPWSAIDVEFVDI
FT                   FKSVLGLGYLKQQSQLEQLPLVQKGSRLSVMPVTAEQWAAILALR"
FT   gene            343763..343915
FT                   /locus_tag="PSPPH_0301"
FT                   /note="PSPPH0301"
FT   CDS_pept        343763..343915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34778"
FT                   /db_xref="GOA:Q48PR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PR4"
FT                   /protein_id="AAZ34778.1"
FT                   /translation="MKRKPDLLWILVILFGLGVVTTGYAQSLWTSKDDAPVEITQQQQK
FT                   VPGRH"
FT   gene            complement(343961..344572)
FT                   /locus_tag="PSPPH_0302"
FT                   /note="PSPPH0302"
FT   CDS_pept        complement(343961..344572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0302"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35334"
FT                   /db_xref="GOA:Q48PR3"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PR3"
FT                   /protein_id="AAZ35334.1"
FT                   /translation="MISAQSLTRPQLRRQLRKARRALTRSQQREAARDVYRQLAQHPLF
FT                   RRARHVSLYLPMDGEIDPRLLLREAQRRGKATYLPVLNAWPRTRMVFQRVRPGEKFIPN
FT                   RFRIPEPLINRAKQRHVWALDLVLMPLVGFDNEGGRLGMGGGFYDRSLAYLARRKAWRK
FT                   PVLLGLAHECQKVDRLAQASWDVPLQGTVSDKGWYLTQIL"
FT   gene            complement(344876..345205)
FT                   /locus_tag="PSPPH_0303"
FT                   /note="PSPPH0303"
FT   CDS_pept        complement(344876..345205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO58652.1; match to
FT                   protein family HMM PF05164"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35510"
FT                   /db_xref="GOA:Q48PR2"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PR2"
FT                   /protein_id="AAZ35510.1"
FT                   /translation="MSNGNSVTVQILDKEYSIICPQEERTNLVSAARYLDGKMREIRSS
FT                   GKVIGADRIAVMAALNITHDLLHKEHLPDVQTSGSTREQVRDLLDKVDLVLATDTPGTP
FT                   DSTRG"
FT   gene            complement(345202..345411)
FT                   /locus_tag="PSPPH_0304"
FT                   /note="PSPPH0304"
FT   CDS_pept        complement(345202..345411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0304"
FT                   /product="conserved hypothetical protein TIGR02449"
FT                   /note="identified by match to protein family HMM TIGR02449"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36369"
FT                   /db_xref="GOA:Q48PR1"
FT                   /db_xref="InterPro:IPR012662"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PR1"
FT                   /protein_id="AAZ36369.1"
FT                   /translation="MEDTDLQALMKRVELLLKYAEQLKGQNAILLAQEKTWREERAQLI
FT                   EKNEIARQKVESMISRLKALEQDS"
FT   gene            345562..346116
FT                   /locus_tag="PSPPH_0305"
FT                   /note="PSPPH0305"
FT   CDS_pept        345562..346116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q88CI0; match to
FT                   protein family HMM PF03695"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37549"
FT                   /db_xref="GOA:Q48PR0"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PR0"
FT                   /protein_id="AAZ37549.1"
FT                   /translation="MPIQNSPYKAFATLLNSGGHQVSPAELHGLLLGRSCAGAGFDNEG
FT                   WFADASVLLETEPQDNIRQALIGLQEMVKGELTGDDMTVVLLLPGDDEPLTERAAALGQ
FT                   WCQGFLAGFGLAIGDKTLGTEAKDVLEDLAAIAQVQDALDESEDGETDYMEVMEYMRVA
FT                   PLLLFTEFNEPAAPQPKPSLH"
FT   gene            346192..347526
FT                   /gene="pepP"
FT                   /locus_tag="PSPPH_0306"
FT                   /note="PSPPH0306"
FT   CDS_pept        346192..347526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="PSPPH_0306"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM PF05195"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34017"
FT                   /db_xref="GOA:Q48PQ9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ9"
FT                   /protein_id="AAZ34017.1"
FT                   /translation="MIQIPKSEYARRRKALMAQMEPDSIAILPAAAVAIRNRDVEHVYR
FT                   QDSDFQYLSGFPEPEAVVVLIPGREYGEYVLFCRERNPERELWEGLRAGQEGAIRDFGA
FT                   DDAFPINDIDEILPGLIEGRDRVYSAMGSNPEFDRHLMDWINVIRSKAHLGAQPPKEFV
FT                   ALDHLLHDMRLYKSAAEIKVMRSAADISARAHVRAMQACRAGLHEFSLEAELDYEFRKG
FT                   GSKMPAYGSIVASGRNGCILHYQQNDAVLKDGDLVLIDAGCEIDCYASDITRTFPVSGK
FT                   FSPEQKAIYELVLKSQYAAFEAIGPDKHWNQAHEATVKVITAGLVELGLLRGDVDQLIE
FT                   SEAYKMFYMHRAGHWLGMDVHDVGEYKVGGEWRVLEVGMTLTVEPGIYISPDNLDVAKK
FT                   WRGIGVRIEDDVVVTRQGCEILSGGVPKTVAEIEALMAAAKAQVA"
FT   gene            347523..348710
FT                   /gene="ubiH"
FT                   /locus_tag="PSPPH_0307"
FT                   /note="PSPPH0307"
FT   CDS_pept        347523..348710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="PSPPH_0307"
FT                   /product="2-polyprenyl-6-methoxyphenol 4-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF01360;
FT                   match to protein family HMM TIGR01984; match to protein
FT                   family HMM TIGR01988"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34770"
FT                   /db_xref="GOA:Q48PQ8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ8"
FT                   /protein_id="AAZ34770.1"
FT                   /translation="MSRFNIAIVGGGLVGASLALSLQAGARARGWKIVLIEPFAPGEAW
FT                   QPSYDARSSALSFGSRRIYERLGLWQQISRRAEPILQIQVSDRGRFGATRLSAIEEGVP
FT                   ALGYVVENAWLGQALWAALDRDVVSWRVPAEVRHMQPLADGYRLSLSDETELDCDLAVL
FT                   ADGGRSSLREQLGIGVRQRPYDQHALIANITPSEAHCGQAFERFTEDGPMALLPLPENR
FT                   CALVWTRPGNDTQRLAELDDRSFLEELQGVFGYRLGTLRQVGARHVYPLALIEAEEQVR
FT                   SHLVILGNAAHSLHPVAGQGFNLSLRDADALAGTLLDSAAPPGELSTLQLYRERQRHDQ
FT                   QLTVGFSDKVTRLFGSSRSAVATGRNVGLLGLDLLPAAKRWFARQAMGLGTRSDV"
FT   gene            348762..350000
FT                   /locus_tag="PSPPH_0308"
FT                   /note="PSPPH0308"
FT   CDS_pept        348762..350000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0308"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01360;
FT                   match to protein family HMM TIGR01988"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35347"
FT                   /db_xref="GOA:Q48PQ7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ7"
FT                   /protein_id="AAZ35347.1"
FT                   /translation="METRADVLIVGAGMVGSALALALQGSGLDVLVVDGGPLSVKPFDQ
FT                   HSAFEPRVSALSTASQRILQRLGVWEGIAARRISPYAHMQVWDGSGTGQIHFSASSVHA
FT                   DVLGHIVENRVVQDALLDRLHESDISLLANARLEQMRHSGDDWLLTLADGRQLRAPLVV
FT                   AADGANSAVRRLTETPTREWDYLHHAIVTSVRTADSHRKTAWQRFTDDGPLAFLPLERE
FT                   GEHWCSIVWSVTPAEAERLMVLEDDLFCRELEQAFEGRLGQVVSADERVCVPLRQRHAK
FT                   RYVARGLALIGDAAHTIHPLAGQGVNLGFLDAAVLAQVLTHAAGRGERWSDLRVLGRYE
FT                   RRRMPHNLALMAAMEGFERLFQANQLPLRWLRNTGLKMVNRMPEAKALFVREALGLSGD
FT                   LPELARIEPATTL"
FT   gene            complement(350167..351159)
FT                   /pseudo
FT                   /locus_tag="PSPPH_0309"
FT                   /note="PSPPH0309; transcriptional regulator, AraC family,
FT                   authentic point mutation; this gene contains a premature
FT                   stop which is not the result of sequencing error;
FT                   identified by similarity to GB:AAN70082.1"
FT   gene            351768..353078
FT                   /locus_tag="PSPPH_0310"
FT                   /note="PSPPH0310"
FT   CDS_pept        351768..353078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0310"
FT                   /product="MFS transporter, phthalate permease family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37646"
FT                   /db_xref="GOA:Q48PQ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ6"
FT                   /protein_id="AAZ37646.1"
FT                   /translation="MKIKGIRWWMVGLVAAGLVVNYLARNTLSVAAPTLMSELSISTEQ
FT                   YAHIVVAWQLCYAIMQPVAGYIIDAIGTKMGFAIFAIAWSAACAAAAFATGWQSLAIFR
FT                   GMLGLTEAAGLPAGVKATTEWFPAKERSVAIGWFNIGSSFGALLAPPLVVWAILQSGWE
FT                   LAFLIVGGLGIVWSGLWLLLYKHPRDQKRLGDAERDYILSGQESRLKDAPAQKGSWKRL
FT                   FKNRNFYAIASARILSEPAWQTFNAWIPLYLMTERHMNIKEVAMFAWLPFLAADIGCVL
FT                   GGYLSPLFHKYCKVSLFTSRKMVMLFGCSCMIGPACIGLVESPYTAIALLCIGGFAHQT
FT                   LSGALYSITSDSFGKNEVATATGMGGMFGFFGAAAFTMVFGVLVTKIGYSPLFVVLAIF
FT                   DIVAAIVVWTVAREVPQNDEAVALSVDESGSRTVPAT"
FT   gene            353293..353874
FT                   /locus_tag="PSPPH_0311"
FT                   /note="PSPPH0311"
FT   CDS_pept        353293..353874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ58056.1; match to
FT                   protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37437"
FT                   /db_xref="GOA:Q48PQ5"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ5"
FT                   /protein_id="AAZ37437.1"
FT                   /translation="MHNESIRYLIVPGWQGSPDDHWQTHWQNSLPNSTRVEQADWLKPR
FT                   REDWVGELQRTIAAHSTPVILIAHSLGCVTVAHWAQLAPLETLRQVQGALLVAPADVER
FT                   PNCPPALRNFAPIPNDLLPFPTQIVNSDNDPAVSSQRAMEMARHWGAEVGFLSQAGHIN
FT                   VKSGHQRWEQGFAYLYRLQNRLEQHARRRA"
FT   gene            353955..354905
FT                   /locus_tag="PSPPH_0312"
FT                   /note="PSPPH0312"
FT   CDS_pept        353955..354905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0312"
FT                   /product="sigma-54-binding protein"
FT                   /note="identified by similarity to SP:P17899; match to
FT                   protein family HMM PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36060"
FT                   /db_xref="GOA:Q48PQ4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ4"
FT                   /protein_id="AAZ36060.1"
FT                   /translation="MSLHENFGQPLLTFPDAEKSPLSIRAKALVFIDPRSRRLREEMEQ
FT                   LAPRSLPVLIRGESGTGKELLARHIHRGSDRSGLFVSVNCGAISPTYADAELFGYAAGA
FT                   HSGSVSSRAGWFGSANGGTLYLDEIGDLPLPIQVKLLAALENHEVTRVGAHQPSPVDVR
FT                   LVAATSIDLAQAVAAGKFHERLYHYLSEGRLDLPALREQPGNILPLAEYFVGIYSQRLS
FT                   LPVQLISEDAQRTLEAHSWPGNTRELENVIHFALLVSSGDEIRAEDINLPDIAAPLTLI
FT                   ERQARLLVSSGDREQLRALRRLLETVTSQLEQNPA"
FT   gene            355076..355858
FT                   /locus_tag="PSPPH_0313"
FT                   /note="PSPPH0313"
FT   CDS_pept        355076..355858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0313"
FT                   /product="lipoprotein, NLPA family"
FT                   /note="identified by match to protein family HMM PF01851;
FT                   match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33840"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ3"
FT                   /protein_id="AAZ33840.1"
FT                   /translation="MKKTFLMTALAAAFSIGLAHAGEKLVVGATPVPHAEILKLIQPTL
FT                   AKEGVDLEIKVFTDYVQPNVQLSEKRLDANYFQTKPYLDGFNKGKGTNLVTGVGVHVEP
FT                   FGGYSSKYKKLADLPEGATIAIPNEGSNAGRALLLLQKGGLITLKDPTNALSTPKDIAS
FT                   NPKRFKFRELESAVLPRALSQVDLALINTNYALEAKLNPKKDALIIEGADSPYVNFLVT
FT                   REDNAHADAIEKLSKALTSQEVKDFINKKYEGVVLPAF"
FT   gene            complement(356024..357283)
FT                   /locus_tag="PSPPH_0314"
FT                   /note="PSPPH0314"
FT   CDS_pept        complement(356024..357283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0314"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM PF03583"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36938"
FT                   /db_xref="GOA:Q48PQ2"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ2"
FT                   /protein_id="AAZ36938.1"
FT                   /translation="MNSSPRYSAVLATLLMVLLAACSAVPGTSMKTVAVAQSDPGEGGV
FT                   PAFYKWPDKMPSTPGQLLRSEPLTAKQSLENAGQNVRILYTSTDGLNNQPVAVSGALFM
FT                   PKGEPPKGGWPLMAWAHGTVGSADICAPSFAGRSDRDTRYLNEWLGRGYAIVATDYQGL
FT                   GTPGLHPFGLSSPLAYGVLDSIRAVQKADFNLSSRVVVFGQSQGGRAAFATAVYQKTYA
FT                   PELNIVGVVATGTPYPMAQSREKHAEPDTFRDQVTPSLAYNLLRLSTAALIDPSLHPAD
FT                   YLSDRAKPAFETSQRECLQAIERKVVADGLTFNNSFKRSPDKALDQVNRHSDYPTLKSD
FT                   IPVFIGTGGKDVISPVRSQIALVKDACKVGDRIEWHYYPQLDHSGAVNGSLPNSTRFVE
FT                   KAFSGAFMAGNCGAMRSDAR"
FT   gene            357400..358626
FT                   /locus_tag="PSPPH_0315"
FT                   /note="PSPPH0315"
FT   CDS_pept        357400..358626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0315"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35148"
FT                   /db_xref="GOA:Q48PQ1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ1"
FT                   /protein_id="AAZ35148.1"
FT                   /translation="MRKDYLAFFISLFLSRLADQILLFIVPLVVFQTTNSASWAGLAFF
FT                   VESLPRFLAFPLCGALCDKYSPIRILHISQVYRASLCVLAMVLYALFGGIGWLVVLSAL
FT                   CGVLTTQGIMAREVLMPHIFQHYSYTKTLSYSQIADQSGLVLGPLVAALMLEVWAWHWV
FT                   VLWIAGLFLLADLCMLAWQRLGRFKLEVFEQHQDIWLQPLRIAFGHIRGLAELKKIITL
FT                   AVGVNLIVGVTLATSAAMVIGQYSAGKDNYAGLQAAGAVTTIVILFFLARVVLPLRVLG
FT                   GVGYSMIAIGAFISALSPNLMGYVLGFLLIVGFDKMFNVYMRTLRQRVIPPQDFGKTVG
FT                   VITLLNNMSQPLAGLLVALLAAPLGTRQVILMLAVLTSLLGAGAMWWFAKARGPFSASI
FT                   VEANREAGK"
FT   gene            complement(358747..359364)
FT                   /locus_tag="PSPPH_0316"
FT                   /note="PSPPH0316"
FT   CDS_pept        complement(358747..359364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33928"
FT                   /db_xref="GOA:Q48PQ0"
FT                   /db_xref="InterPro:IPR014983"
FT                   /db_xref="InterPro:IPR015002"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PQ0"
FT                   /protein_id="AAZ33928.1"
FT                   /translation="MDEDFAFFLEKFGPAIEHHAVPEASIAKYKNKLPEQLLQYWSLYG
FT                   WCGYASGLFWSVNPQDYDQLLNRWLATTPLHQRDNYRVIARSAFGILYVWGENSGYCLT
FT                   LNSYISRYSGRTSIFTGEKLNFGVRAFFSSMIAEYNDLDDLFKPALKSLGPLKSDEMYG
FT                   FVPALALGGQMELKNLQKVKTIEHLTFLSQLSPLQDWGFPDL"
FT   gene            complement(359419..360072)
FT                   /locus_tag="PSPPH_0317"
FT                   /note="PSPPH0317"
FT   CDS_pept        complement(359419..360072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33421"
FT                   /db_xref="GOA:Q48PP9"
FT                   /db_xref="InterPro:IPR014983"
FT                   /db_xref="InterPro:IPR015002"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP9"
FT                   /protein_id="AAZ33421.1"
FT                   /translation="MLNLKDANRRLVMDEDYAFFLKKFGPAIEQQAVPTSSIERYKKRL
FT                   PEQLLKYWEDFGWCGYAKGLFWTVNPQDYEDLLTDWLVGKEAFKNDNYHVIARSAFGEL
FT                   YLWGEKSADSLSITSYMSRYSTNNSIFADGEKDFGIRVFFSSMQLEHNDLDSFFEPALK
FT                   NLGQLQSDEMYGFVPALALGGPVELKNLQKVKTTEHLMFLSQLSPLQDWGFPDV"
FT   gene            complement(360047..361411)
FT                   /locus_tag="PSPPH_0318"
FT                   /note="PSPPH0318"
FT   CDS_pept        complement(360047..361411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34693"
FT                   /db_xref="GOA:Q48PP8"
FT                   /db_xref="InterPro:IPR028949"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP8"
FT                   /protein_id="AAZ34693.1"
FT                   /translation="MPLWSIVPSWLDIERRFSRSMGYQPGASFQRSLNNEPVSTLQLNL
FT                   RRVGNIRSAFNRGELEAARRLGRRFADIDISSIINDLIDVVSQMAMIVAGSTLAGGAIG
FT                   AGVGSFFFGAGAVPMGMAGAAIGLELSTWILGILGLASIAEFFVDGLPRIVDNYTRGIA
FT                   IAWQGTRGEPGLNPFGGDDPQVVSRAAHHIAQGHEEVVILLLGAIVAYLTRGRGNASVL
FT                   ANEMQASKKGAKLGQWMLQHEDALTRHPDLQNASPRKSALDKQEPPPPPPNRRADEPEP
FT                   KRASGMPEHKVPCFNVSDKHLDRIPEFDRQLAGQEKGLNDLTVEEYLKGREAFKSGEAL
FT                   RDPKVAADARKLLGRKMELNIFRELRLGGMSPEVAEATAKKEVLEKMTTLAALHNPDII
FT                   AGGKDVINDLGDRRINSSIGPQWPSRIGELDRAANLVPNELRNATKINAKLERCK"
FT   gene            complement(361572..364670)
FT                   /locus_tag="PSPPH_0319"
FT                   /note="PSPPH0319"
FT   CDS_pept        complement(361572..364670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0319"
FT                   /product="autotransporter"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF03797;
FT                   match to protein family HMM TIGR01414; match to protein
FT                   family HMM TIGR02601"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35404"
FT                   /db_xref="GOA:Q48PP7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP7"
FT                   /protein_id="AAZ35404.1"
FT                   /translation="MRCNKPVAHVMMSSLILSLLAVSVQAASRANDDRINGVDLLSGFN
FT                   TLWTTGATWDTGTPTALGQSLLRRNLQIVVDRANSRTLAQETAAYFDDRRDQSYSAISG
FT                   LGSLSDAYKAGAGAFTTITQFDDSNKTVKYDDKGNGAGSSSSALGKVVDLVGAVRNDAS
FT                   TTPAKSHYLYPRPWRQSLDGQNLAFVVAPSLRPAESTTPASDSGFPSGHTNAAYLSAYA
FT                   LAYAIPERFSELMLRASEIGDNRIEAGMHSPFDVMGGRITATYFAIDNLSNSANAQLRA
FT                   DARAQALTYFTAQCGGNINNCIASIDPATDRTSQHAQDKALYTSRMTYGFDPVGPTNLA
FT                   PVVPTNAEVLLETRFPYLDASQRREVLGTTEMSSGYAVIDQSGGYGRLNLYAAGDGYGA
FT                   FNSNVTVNMNASLGGYNAIDAWRNDISGSGALIKNGTGNLILTGNNTYSGGTVINGGTL
FT                   TGHAQAFGSGTITDNATLVLDQSTNNTLANTLTGSGALIKRGAGSLNLTGNSSLSGATT
FT                   VQAGRLAVNGNLGNSIVSVQQGATLGGNGTVGGINVAQGGVVAPGNSVGQLNVNGDVNL
FT                   AQGSVYQVESDANGNADRIVASGRATLNNSTLSLVEGGNWVAASRYSIISAAGGVSGAF
FT                   AAVQTNFAFLTPTLNYTATDVGLTLDRNAQTFASLATTRNASAVAQGLDSAGAGNALWR
FT                   QVVQDDAATAQATFKALSNELHASTQSALIEDSRLVRNAMNDRMQQAQSAQSFGSTTQT
FT                   LAGDASRGVVWTQAIGATGQTDSSRDASGLETRTSGLLFGTDVPLDDTWRVGALAGFSN
FT                   SSFDLRHASGSTDSDNYHLGVYGGAKWGQLGLRLGAVHTWHELTAKRTLDLPGSSEHFK
FT                   EDYKAATNQVFGELGYTLEMGNAQLEPFANLAHVRLDTDAFDENSNAISLQNKSQDNHI
FT                   TFSTLGLRAATRLNAGSVTIKPNATLGWRRAYGDVTPESRSAFSGGSTFELSGAPIARS
FT                   AAVLGAGVDLGLSDTLSVGLSYDGQVSNDASDQSLNARVTLAF"
FT   gene            364889..365785
FT                   /locus_tag="PSPPH_0320"
FT                   /note="PSPPH0320"
FT   CDS_pept        364889..365785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0320"
FT                   /product="dioxygenase, TauD/TfdA family"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37170"
FT                   /db_xref="GOA:Q48PP6"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP6"
FT                   /protein_id="AAZ37170.1"
FT                   /translation="MPAASLASSSAQSASQSFDVRPFTGKVGAEIVGLDLSRPLNDADF
FT                   ARVHQAHLDHHVVVFRDQQITPQQQVDFSRRFGVLQIHVLKQFLLANHPEILIVSNIVE
FT                   NEKPVGLGDAGKYWHSDLSYKELPSLGSMLYAQELPSEGGDTLFADMHQAWDTLPQHLR
FT                   DAVEGRSAVHSYTARYAEGHNAANWRPTLTAEQLAQVVEVSHPIVRSHPETGRKALFVS
FT                   EGFTTRILDLPEDESRQILNEIYAHSVKPEHIYRHQWQANDMVFWDNRSLIHLAAGCPA
FT                   HLRRKLHRTTIQGTAPF"
FT   gene            365802..366683
FT                   /locus_tag="PSPPH_0321"
FT                   /note="PSPPH0321"
FT   CDS_pept        365802..366683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0321"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36673"
FT                   /db_xref="GOA:Q48PP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP5"
FT                   /protein_id="AAZ36673.1"
FT                   /translation="MNAVAQGHTASTSAQPQPTVQHTTEALLQVRGVSLEYRTPERVVR
FT                   ATHQVSFEVDPADRFVLLGPSGCGKSTLLKAVAGFIRPSEGEIRLAGHQVTEPGPDRIV
FT                   VFQEFDQLPPWKTVIENVMFPLLASRTLKRPEALERARYYLEKVGLSAFADAYPHTLSG
FT                   GMKARVAIARALAMQPKILLMDEPFAALDALTRRKMQEELLELWDEVRFTLLFVTHSIE
FT                   EALVVGNRILLLSPHPGRVRAEINSHQYDLKSLGGVGFQQTAQRIHRLLFDEGDAGPVE
FT                   QDLNFQDIRIAY"
FT   gene            366775..367641
FT                   /locus_tag="PSPPH_0322"
FT                   /note="PSPPH0322"
FT   CDS_pept        366775..367641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0322"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34615"
FT                   /db_xref="GOA:Q48PP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP4"
FT                   /protein_id="AAZ34615.1"
FT                   /translation="MSLAPPAREEYEITLEPFTQEDLARDLPLAQRIWQLGWVRKCVIM
FT                   IALAVIWELAARLQNNDLLLPSFLQTAAAFYDGLISGELPGKVWISLTVLIQGYLIGIV
FT                   LAFALTTLAVSTQLGRDLLGTLTAMFNPLPAIALLPLALLWFGLGQNSLIFVLVHSVLW
FT                   ALALNTYAGFLGVSETQRMAGRNYGLKGLRFVWHILIPAALPSILAGLKIGWAFAWRTL
FT                   IAAELVFGASSGKGGLGWYIFQNRNELYTDKVFAGLAAVILIGLLVENLLFANIERLTV
FT                   KRWGMQR"
FT   gene            367680..368699
FT                   /locus_tag="PSPPH_0323"
FT                   /note="PSPPH0323"
FT   CDS_pept        367680..368699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0323"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37684"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP3"
FT                   /protein_id="AAZ37684.1"
FT                   /translation="MTTTFHRPALTVLAATLGLFGALLSSGVQAEGKISIAQQFGIGYL
FT                   ILDVVRDQKLIEKHGKEQGLDIKVDWNSISGATAMNEALLAGALDVVSAGVPPMLTVWD
FT                   RTKGKQNVKAIASLGSMPNYLLTNNPNVKTIKDFTDKDRIAVPAAGVGFQSRTLQIETA
FT                   KVFGNDNYKKFDNISVSLAHPDATAALLAGGSEINSHFSSPPFQYQALENPNVHKVLSS
FT                   YDVLGGQATFNVLYTTEKFHDENPKTYKAFYDALAEAEKIIKADKPAAAQTYIRVEQSK
FT                   LPLPLVEKIVADPEIDFTVTPQRTFIYAEKLHELGVLKNKAASWKDYFFEEAHGTEGS"
FT   gene            369195..369410
FT                   /locus_tag="PSPPH_0324"
FT                   /note="PSPPH0324"
FT   CDS_pept        369195..369410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35746"
FT                   /db_xref="GOA:Q48PP2"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP2"
FT                   /protein_id="AAZ35746.1"
FT                   /translation="MINSTPSPPLPNSLEDSLIQVSEILRCASATASETGDNLEGLKRD
FT                   LAFSVVHLINMAKAELERSLECVQSH"
FT   gene            369521..370471
FT                   /locus_tag="PSPPH_0325"
FT                   /note="PSPPH0325"
FT   CDS_pept        369521..370471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0325"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34092"
FT                   /db_xref="GOA:Q48PP1"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP1"
FT                   /protein_id="AAZ34092.1"
FT                   /translation="MRQQTTLCRYRYDALDRLAARTPVAGTIARSFYQSDTLVSEIQGA
FT                   EHVRFLHRDRQLLATQSALATLLIGSDQQHSVLHTVSASLSDPIAYTPYGHRQALNQLP
FT                   GFNGERPDPLTGHYLLGNGYRAYNPVLMRFNSPDSLSPFGKGGMNAYAYCAGDPVNRSD
FT                   PTGHKIDESQILSFVWIGLGLFGAYLGVKAAVPAIKAVAKGNASLSTKLTASSALGQIA
FT                   ASTVFTVSRVINAVDPDGPAKDVLLATAIGMVIPVLAVRTFNPRIKRWEDAGADIILLN
FT                   DRRSSLKSEFADTASAIRETRPWGDPADELSRMMY"
FT   gene            370542..371576
FT                   /locus_tag="PSPPH_0326"
FT                   /note="PSPPH0326"
FT   CDS_pept        370542..371576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0326"
FT                   /product="YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37127"
FT                   /db_xref="GOA:Q48PP0"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PP0"
FT                   /protein_id="AAZ37127.1"
FT                   /translation="MALLCTYTYDPLDRVSTLNPLAQVLSSRFYNSEQLMTELLGDRQR
FT                   TCIRAGGQLLAQQSREGEEVVTTMVASDLHNSVLHASEDGRQVDIAYTPFGHRQAEQTV
FT                   AALPGFNGEQPDLVTGHYLLGNGYRAYNPVLMRFNSPDSFSPFGEGGLNAYAYGLNNPI
FT                   KYIDPTGHFSSFLSGVLAAGLLLTGGGSIYVSTHVKESNPTLSGVLMGVGSVLAVAGVG
FT                   FALSSIVKKAAGVGRSTSRLESFGLARKNQRPAGRNSLIFPNQRPPQSSADLPAASFAL
FT                   PRPRLLPSSVAPARSATIRRTGYPKYRNIRRPVFQKYFYEVDRMPTIPEQPSHSIRGGH
FT                   ESVV"
FT   gene            371787..372905
FT                   /locus_tag="PSPPH_0327"
FT                   /note="PSPPH0327"
FT   CDS_pept        371787..372905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0327"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33049"
FT                   /db_xref="GOA:Q48PN9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PN9"
FT                   /protein_id="AAZ33049.1"
FT                   /translation="MPVLPSRLVTFGLAAALAMLTGCGEEKPAAPELPRVYVQTVKSAD
FT                   FAASVALIGDVQARVQTRLSFRVNGKIIQRNVDVGDRVTARQVLARLDPKDLQINVDSA
FT                   AASVAAEQARVNQTRAAFVRQQKLLPKGYTSRSEYDSAQAALRGSESSLKAAQAQLANA
FT                   REQLGYTALVADAPGVITARQAEVGQVVQATMPIFDLARDGDRDAVFNVYESLFVQPPT
FT                   NQPVQVTLLDNPDIKVSGKVREVTPAVSAQTGTLQVKIALDPLPEGMDLGSVVSVALSA
FT                   PANASVELPWAALTKDLGEQLGKPAVWVVDEQGKVNLRRVTVTRYLTAKVIIGDGLKSG
FT                   EKVVVAGGQLLHPDMQVEIAEQPKQQNAQVQP"
FT   gene            372902..373990
FT                   /locus_tag="PSPPH_0328"
FT                   /note="PSPPH0328"
FT   CDS_pept        372902..373990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0328"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33591"
FT                   /db_xref="GOA:Q48PN8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PN8"
FT                   /protein_id="AAZ33591.1"
FT                   /translation="MKRLSSCLLLGGLLSSGFLLSGCGKDEAPPEPVRPVVFVEARPES
FT                   NQDFGRFAGNIQARYQSVLGFRVAGRIVRRNVDVGAEVKKGDLLATLDPTDQQNTVRAR
FT                   QGDLANVQAQLINAQANARRQQELFDRGVGAQAQLDIALTDLKTASSSQEQAKAAAQQA
FT                   RDQLSYSELRSDHDAVVTEWKVEAGQVVTAGQEVVTLARPDIKEAVIDLPDTLADQLPS
FT                   DVVFTVASQLNPEVNTTATIREIEPQADRTTRTRRARLTLAQTPAAFRLGTAISVTLSS
FT                   TITPRMRLPINALQQADGKSQIWIVDPQNQTVNPRAVNIISRDSNSFVLANGVKAGEKV
FT                   VSAGVNSLKPGQKVKVDEESPR"
FT   gene            373987..377088
FT                   /locus_tag="PSPPH_0329"
FT                   /note="PSPPH0329"
FT   CDS_pept        373987..377088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0329"
FT                   /product="RND efflux transporter, hydrophobe/amphiphile
FT                   efflux-1 (HAE1) family"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35621"
FT                   /db_xref="GOA:Q48PN7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PN7"
FT                   /protein_id="AAZ35621.1"
FT                   /translation="MKGNFNLSEWAIKHQSFVWYLMFVALLMGVFSYMKLGREEDPSFT
FT                   IKTMIIQTRWPGATVDETLKQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLRDTTS
FT                   AKAIPEIWYQVRKKVDDIRGQFPQGLQGPSFNDEFGDVYGSIYAFTADGFSMRQLRDYV
FT                   EKVRADIRDVPGLGKVEMIGQQDEVVYLNFSTRKLAALGIDQSQVVQSLQSQNAVTPAG
FT                   VIEAGPERISVRTSGQFASEKDLAAVNLRINDRFYRLSDIADITRGYTDPPKPLFRFDG
FT                   KPAIGLAIAMQKGGNIQSFGKALHERMDATTAELPVGIGVHKVSDQAEVVNKAVGGFTS
FT                   ALFEAVIIVLLVSFVSLGFRAGLVVACSIPLVLAMVFVFMEYSGITMQRISLGALIIAL
FT                   GLLVDDAMITVEMMVTRLEMGESKEQAATYAYTSTAFPMLTGTLVTVAGFVPIGLNNSS
FT                   AGEYTFTLFAVIAVAMLVSWLVAVLFAPVIGVHILSANIKPKSEEPGRIGRAFNGSMLW
FT                   AMRHRWLAIAITVGLFAASLFSMQFVQNQFFPSSDRPEILVDLNLPQNASINETRKVVD
FT                   RFEASLKDDPDIERWSTYIGQGALRFYLPLDQQLENPFYAQLVIVSKGLEERSALTARL
FT                   QKRLRDDFVGIGSYVQALEMGPPVGRPLQYRVSGENIDKVRQHAIELAKLLDHNSHVGE
FT                   VIYDWNEPGKVLRIDINQDKARQLGLSSEDVAKLMNSVVSGSTVTQVRDDIYLINVIGR
FT                   AEDAERGTPETLQNLQIVTQTGTSIPLLAFATVGYELEQPLVWRRDRMPTITVKGAVRD
FT                   AIQPTDLVKQLQPEIDKFAAGLPVGYKVATGGTVEESSKAQGPIASVAPLMLFLMATFL
FT                   MIQLHSIQKMFLVASVAPLGLIGVVLALIPTGTPLGFVAILGVLALIGIIIRNSVILVT
FT                   QIDAYERSGYLPWDAVVEATEHRRRPILLTAAAASLGMIPIAREVFWGPMAYAMIGGII
FT                   IATLLTLLFLPALYVAWYRIKEPTDEQRREAADKGDGEHAQPAH"
FT   gene            complement(377141..377629)
FT                   /locus_tag="PSPPH_0330"
FT                   /note="PSPPH0330"
FT   CDS_pept        complement(377141..377629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0330"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33966"
FT                   /db_xref="GOA:Q48PN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PN6"
FT                   /protein_id="AAZ33966.1"
FT                   /translation="MANEYLENGDFSDNLTHWTAPVDFEPDFKPKGEGQSIKLNTGVTV
FT                   SQSIIELPAQRLHLEFDVLNAEDVDEVFFVVVVGGYTIKDEINLTQVVNFATQEWVHYS
FT                   GDFDFQVQLKKCFLNISAPAETSSFSPSGLTKASPFGPVRFANLTLSTIDVKDAGETD"
FT   gene            complement(377760..378386)
FT                   /locus_tag="PSPPH_0331"
FT                   /note="PSPPH0331"
FT   CDS_pept        complement(377760..378386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0331"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase ubie"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35777"
FT                   /db_xref="GOA:Q48PN5"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PN5"
FT                   /protein_id="AAZ35777.1"
FT                   /translation="MKLDPQTLAQITSTTVSHYNSVADEFREGTRDHDVSQNIGALLRH
FT                   IEGPAPLQILDFGCGPGRDLKTFTAMGHVAVGLDGSERFAEMARAETGCEVLQQNFLEL
FT                   DLPQGRFDGLFANAVLFHIPRQELPRVLRELYATLKPGGVLFSSNPRGENQEGWNGERY
FT                   GAYHDLETWRELLTEAGFSELEHYYRPAGLPREQQPWLASVWRRQ"
FT   gene            complement(378443..379087)
FT                   /locus_tag="PSPPH_0332"
FT                   /note="PSPPH0332"
FT   CDS_pept        complement(378443..379087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0332"
FT                   /product="D-methionine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37939"
FT                   /db_xref="GOA:Q48PN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PN4"
FT                   /protein_id="AAZ37939.1"
FT                   /translation="MWVDRLLQGTLDTFLMVGVSSLIALLLGIPLAVILVTSSKGGIYE
FT                   APGINRVLGAFVNLFRSIPFLILMVALIPFTRMIVGTTYGVWAAVVPLTIAATPFFARI
FT                   AEVSLREVDHGLVEAAQAMGCRRWHIIWHVLLPEARPGIVGGFTITLVTMINSSAMAGA
FT                   IGAGGLGDIAYRYGYQRFDTQVMLTVIVLLVAVVALVQLGGDRLARSFDRR"
FT   gene            complement(379077..380207)
FT                   /locus_tag="PSPPH_0333"
FT                   /note="PSPPH0333"
FT   CDS_pept        complement(379077..380207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0333"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34871"
FT                   /db_xref="GOA:Q48PN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PN3"
FT                   /protein_id="AAZ34871.1"
FT                   /translation="MTATAQRQLPLDTPSASTLAQQAELHPELNRAHVRFINLGKTYHG
FT                   KQGPVEALGNIDLAVQRGEIFGIIGRSGAGKSSLIRTINRLEQPSSGRVLIDQVDIGEF
FT                   DEDKLVELRRRIGMIFQHFNLMSAKTVWQNVELPLKVAGVPREQRARKVAQLLELVGLQ
FT                   DKHNAYPAQLSGGQKQRVGIARALVHDPAILLCDEATSALDPETTQSILGLLREINQRL
FT                   GLTIVLITHEMAVIRDICHRVVVLEQGRIVEQGPVWQVFGDPQHDVSKTLLAPLQTGLP
FT                   KEWAERLSDQPQRPDAALLLDVHFTGASDQGPDLAALFAALGGKVQLLQGGVERIQERA
FT                   IGHLILSVAGSVHTRDELLARARQLAPRAEVLGYVG"
FT   gene            complement(380204..380992)
FT                   /locus_tag="PSPPH_0334"
FT                   /note="PSPPH0334"
FT   CDS_pept        complement(380204..380992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0334"
FT                   /product="D-methionine-binding lipoprotein MetQ"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34307"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PN2"
FT                   /protein_id="AAZ34307.1"
FT                   /translation="MSKTLAALALGLLTLTAYADDKPLKVGTTAAFAIPLEAAVEEAGK
FT                   QGLKVELVEFTDWIAPNVTLAAGDIDVNYFQHIPFLTNANEAAGFGLVPYAPGIINNVG
FT                   LYSKKYKSFDELPTGATVAIANDPINSGRGLQLLAKAGLITLKQGVGYKATEEDITANP
FT                   KKLKIIQVEAVQLVRAYDDADLVQGYPAYIRLAKTFPADSAILFDGLDHPEYVIQFVIK
FT                   PDHKDDPRLAKFVDIYQHSPVVRASLDKVNGKLYQAGWKE"
FT   gene            complement(381248..382606)
FT                   /locus_tag="PSPPH_0335"
FT                   /note="PSPPH0335"
FT   CDS_pept        complement(381248..382606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0335"
FT                   /product="monooxygenase, NtaA/SnaA/SoxA family"
FT                   /note="identified by similarity to SP:P54995"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35102"
FT                   /db_xref="GOA:Q48PN1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PN1"
FT                   /protein_id="AAZ35102.1"
FT                   /translation="MARKKILLNAFNMNCIGHINHGLWTHPRDTSTQFNSLEYWTDLAK
FT                   LLERGLLDGLFIADIVGVYDVYQNSVDVTLKEAIQLPVNDPLLLVSAMAGVTKHLGFGL
FT                   TANLTYDAPYLFARRMSTLDHLSRGRVGWNIVTGYLDSAARAMGLTEQNEHDRRYDQAD
FT                   EYLEVLYKLWEGSWEDDAVINDREQRVYAQPGKVHKVRHQGEFYQVEGYHLCEPSPQRT
FT                   PVLFQAGSSERGLQFAGQNAECVFISGQNKTATREQVDKVRASAVKAGRNPEDIKVFMG
FT                   LNVIVAATEALAREKHAEYRHHASAEAGVAHFAASTGIDFADYELDEPIQYVKSNAIQS
FT                   ATRNLKNNDWTRQKLLDQHALGGRYITLVGSPEQVADELESWIAETGLDGFNLTRIVTP
FT                   ESYEDFIDLVIPELQRRGSYKTAYEDGSLRKKLFPEGTDRLPERHAGAAHRRI"
FT   gene            complement(382606..383811)
FT                   /locus_tag="PSPPH_0336"
FT                   /note="PSPPH0336"
FT   CDS_pept        complement(382606..383811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0336"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /EC_number="1.1.-.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34335"
FT                   /db_xref="GOA:Q48PN0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PN0"
FT                   /protein_id="AAZ34335.1"
FT                   /translation="MSSNLQARDNAALITSDAQALQTARELALHFKTDSAQRDRERRLP
FT                   HAELDLFSQSGLWGISVPKAFDGAGVSNVTLAKVIQLISEADGSLGQIPQNHFYALEVL
FT                   RVNGNPQQQAQLYAEALAGVRFGNALAELGTKTAHDRTTRLTRDGDGYRINGRKFYATG
FT                   ALYAQRIPTSVIDDEGVQQLVFVAHDSEGLTVIDDWSGFGQRTTGSGSVLFDNVYVRAN
FT                   DVVPFQSAFQRPTTVGPLAQILHAAIDTGIARAAFEDALTFVQTRTRPWIDSGIEKAVD
FT                   DPLTLHSFGKLGIRLHAAEALLERAGEFLDVAQADSNAETVAAASIAVAEARAISTEIS
FT                   LAAGSTLFELAGSQSTLAEHGLDRHWRNARVHTLHDPVRWKFHAIGNYYLNDTNPPLRG
FT                   TI"
FT   gene            complement(383837..385159)
FT                   /locus_tag="PSPPH_0337"
FT                   /note="PSPPH0337"
FT   CDS_pept        complement(383837..385159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0337"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /EC_number="1.1.-.-"
FT                   /note="identified by match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33968"
FT                   /db_xref="GOA:Q48PM9"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM9"
FT                   /protein_id="AAZ33968.1"
FT                   /translation="MVPFTTTPVDKPRAVPTDGERRESDPAAVAAHHVEASQEPDVAPR
FT                   LLAAKVLQNDAEAIAAAHELAAAARINAANRDRQRALPWAEIEQFTRSGLGSISIPRAY
FT                   GGPQVSFVTVAEVFRIISAADPALGQIPQNQFGILHLLQGSATEQQKKTLFQSVLDGWR
FT                   IGNAGPERGTKNTLELKARITANGDRLTITGQKFYSTGALFAHWVAVKALDDQGRQIMA
FT                   FVKRGTPGLRIVDDWSGFGQRTTASGTVLLDNVAVDAGQVVDNWRLALTPNIQGAVSQL
FT                   IQAAIDAGIARGAIDDAIAFVREKSRPWIDANVERASDDLYVIADIGKLKLELHAAGAL
FT                   LRKAGQELDEINAAPIDEHSAARASIAVARAKVLTTEISLLASEKLFELAGSRATLAEF
FT                   NLDRHWRNARVHTLHDPVRWKYHAVGTWHLNGTLPARHSWI"
FT   gene            complement(385544..386272)
FT                   /locus_tag="PSPPH_0338"
FT                   /note="PSPPH0338"
FT   CDS_pept        complement(385544..386272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33244"
FT                   /db_xref="GOA:Q48PM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM8"
FT                   /protein_id="AAZ33244.1"
FT                   /translation="MSQIICKPTPMGLSAPSIPLASRHGIGVRGASQLLVHVAPYDSMD
FT                   EGDLIELFWDGCYVASKILKASDVGKPVVLRVPESFLQNGKARTYYRVMKIGGLPVTSP
FT                   CRKLWVKLNAPGGQLVSTNTEENQGLAPLYVVPSVIRRGLSRRHLEGGLPMTIEPYLNM
FT                   AVHDEITVRWGDLRMDLPPLVAEDVGEPVDLVVPPALILEGGEEQQLEVTYCVIDRVGN
FT                   NSLWAPPRVIRVQPLGHSTD"
FT   gene            386927..388186
FT                   /locus_tag="PSPPH_0339"
FT                   /note="PSPPH0339"
FT   CDS_pept        386927..388186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0339"
FT                   /product="ISPsy18, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34507"
FT                   /db_xref="GOA:Q48PM7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM7"
FT                   /protein_id="AAZ34507.1"
FT                   /translation="MPTKKKSANATARELPSIPQELIEQFVKGPMSAEAIQDASMAFKK
FT                   ALIERALGAELGHHLGYPQGAERPEESTNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFA
FT                   PILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEV
FT                   GAWQQRPLEPMYPVIFFDALRVKIRDEGLVCNKAIYLALGVLPDGTRDILGIWIESTEG
FT                   AKFWMKVFNDLKTRGVEDVLIAVTDGLKGIPEALGAVFPATTLQTCIVHLIRNSLDYAA
FT                   WDKRRALAKALKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVF
FT                   PAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDW
FT                   KVAMNQFAILYGDRFTRPSW"
FT   gene            complement(388007..388972)
FT                   /gene="glnQ1"
FT                   /locus_tag="PSPPH_0340"
FT                   /note="PSPPH0340"
FT   CDS_pept        complement(388007..388972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="PSPPH_0340"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37879"
FT                   /db_xref="GOA:Q48PM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM6"
FT                   /protein_id="AAZ37879.1"
FT                   /translation="MIVVEKLTKKFKGNQVLKGIDLRIEAGEVVAIIGPSGSGKTTLLR
FT                   CLNLLETPDSGRIKVGDIEIDGTRSMNQQQRLIRQLRQQVGFVFQNFNLFPHRTALENV
FT                   IEGPVVVKKVAREAAEALGRKLLAKVGLTGKEDAYPRRLSGGQQQRVAIARALAMEPQV
FT                   ILFDEPTSALDPELVGEVLTTIRALAEEKRTMVIVTHEMSFAREVANRVIFIDKGVIVE
FT                   QGEAKALFADPKEERTRQFLGVSVFLCSGWLGPAVRQALVLPARSGKSVSVQDRKLIHC
FT                   HFPVVCRMTPVGGDVAQPKPYQFRRSLIGREVPSSLDDLA"
FT   gene            complement(388976..389644)
FT                   /locus_tag="PSPPH_0341"
FT                   /note="PSPPH0341"
FT   CDS_pept        complement(388976..389644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0341"
FT                   /product="cystine ABC tranporter, permease protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37782"
FT                   /db_xref="GOA:Q48PM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM5"
FT                   /protein_id="AAZ37782.1"
FT                   /translation="MIEESLQLALDSAPFLLKGAYYTVFLSLGGMFFGLLLGFGLALMR
FT                   LSRLKLVNWIARIYVSFFRGTPLLVQLFVIYYGLPEMGIQLEPLSAALIGFSLNMAAYA
FT                   CEILRAAISSVERGQWEAAASIGMTRWQTMRRAILPQAARTALPPLGNSFISLVKDTAL
FT                   AATIQVPELFRQAQLITARTFEIFTMYLAAALIYWILATALSHLQNKLEARVNRHDLET
FT                   "
FT   gene            complement(389641..390438)
FT                   /locus_tag="PSPPH_0342"
FT                   /note="PSPPH0342"
FT   CDS_pept        complement(389641..390438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0342"
FT                   /product="cystine ABC transporter, periplasmic cystine
FT                   binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37034"
FT                   /db_xref="GOA:Q48PM4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM4"
FT                   /protein_id="AAZ37034.1"
FT                   /translation="MNISAIRRTFLFSALGLMLGTGIAGQAMAGEQLQKIKDSGTLNVG
FT                   LEGTYPPFSFVDENGKLTGFEVEFSEALAKELGVKAKIQPSKWDGILAALDSKRLDVVI
FT                   NQVTISEERKKKYDFSEPYTVSGIQALVLKKNADTIKTAKDLTGKKVGVGLGTNYEQWL
FT                   KENVPGAIVKTYDDDPSKIQDLSVGRIDAILVDRLAALEMATKTKNKLVPAGDAFSRQE
FT                   SGIALRKGEPELQAAIDKAIDKLRANGTLEKLSKKYFNADVTK"
FT   gene            complement(390658..391656)
FT                   /gene="dcyD"
FT                   /locus_tag="PSPPH_0343"
FT                   /note="PSPPH0343"
FT   CDS_pept        complement(390658..391656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcyD"
FT                   /locus_tag="PSPPH_0343"
FT                   /product="D-cysteine desulfhydrase"
FT                   /EC_number="4.4.1.15"
FT                   /note="identified by similarity to SP:P76316; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   TIGR01275"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35958"
FT                   /db_xref="GOA:Q48PM3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM3"
FT                   /protein_id="AAZ35958.1"
FT                   /translation="MIKNQLARFNRLDLISAPTALEKLERLSIWADRDIYIKRDDTTTL
FT                   ALGGNKVRKLEYLAADALAQGADTLITAGAIQSNHVRQTAALAARLGFGCVALLENPIG
FT                   TEDPSYLKNGNRLLLELFDAKVELVENLDNADEQLHALAARLRSSGKKPYLVPIGGSSP
FT                   VGALGYVRAGLELAEQIKQTGIDFAAVVLASGSAGTHSGLALALAHELPQLPVIGVTVS
FT                   RSEEAQLPKVQGLAERTAELLDIALPEHFKVELWDEYFAPRYGEPNAGTLAAIKLVASH
FT                   EGLLLDPVYTGKAMSGLLDGIGRQRFNDGPLIFLHTGGAPALFAYPDAFDQ"
FT   gene            391854..392807
FT                   /locus_tag="PSPPH_0344"
FT                   /note="PSPPH0344"
FT   CDS_pept        391854..392807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0344"
FT                   /product="serine O-acetyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36677"
FT                   /db_xref="GOA:Q48PM2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM2"
FT                   /protein_id="AAZ36677.1"
FT                   /translation="MSDIPEASADGSSSHWQLQRIVSQLRGAREDWRARNRRVSGEHGG
FT                   RELPSRAAMGEILEALSGALFPMRLGPVDLREESEDFYVGHTLDVALNALLAQARLELR
FT                   YVAHQQGGDLKSIDARALELIQGFAMALPGIRLLLDTDVLAAYHGDPAARSVDEVLLCY
FT                   PGILAVIHHRLAHHLYRAGLPLLARISSEIAHSATGIDIHPGAQIGPSFFIDHGTGVVI
FT                   GETAIIGERVRIYQAVTLGAKRFPSDEDGQLQKGHARHPIVEDDVVIYAGATILGRITI
FT                   GKGSTIGGNVWLTRSVPAGCNLTQANLLQQDDCSKK"
FT   gene            complement(392821..394092)
FT                   /locus_tag="PSPPH_0345"
FT                   /note="PSPPH0345"
FT   CDS_pept        complement(392821..394092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0345"
FT                   /product="RNA polymerase sigma-70 family protein"
FT                   /note="identified by match to protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35984"
FT                   /db_xref="GOA:Q48PM1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM1"
FT                   /protein_id="AAZ35984.1"
FT                   /translation="MSSHESLFDYEATLQACARGDKQALQRLYQQESARLLGVAQRLVR
FT                   DQALAEDIVHDAFLKIWSHAASFDAARGSARGWIFSVTRHLALNTLRNTAREVRVEDDG
FT                   SDDHHEQATLEGWQETGDAFDWRVNPGRIDFMHGATRAGTPKLYLSRLRRRLFVSGNRA
FT                   EDWRAIGYGQSLDQAQPDGFAGVHGMNRPLDDNIHDLAGEYVLGTLSAQERLDVQRRLP
FT                   HEPDLQAAIDAWEQRLLPLTELAEPVTPSPGLWDRIERNLLELAAPAKALHRQRVRWWD
FT                   NLSVWRGLAGAGLAASLVLGMTLLTRAPAQPSYLVVLVGQQDKAPGWVVQASNSQEIQL
FT                   IPLGVFEVPNDKALEFWTKGDDWQGPVSLGLVKPGQSLHVPLDKLPPLQPNQLFELTLE
FT                   KSTGSPIGKPTGPIQFIGRAVKVI"
FT   gene            complement(394196..394729)
FT                   /locus_tag="PSPPH_0346"
FT                   /note="PSPPH0346"
FT   CDS_pept        complement(394196..394729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34993"
FT                   /db_xref="GOA:Q48PM0"
FT                   /db_xref="InterPro:IPR021851"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PM0"
FT                   /protein_id="AAZ34993.1"
FT                   /translation="MNAKRLLCLAGSTLAFTCLSSIAMAQTDLPESVRVPAGNKVRMTT
FT                   TGVGEITYECRAKANMPNEMEWAFVGPKAVLNDKSGKQVGTYYGPPATWEAKDGSKLTG
FT                   TQVAVAPSSAGNLPYQLVKANPAEGKGAMTGVTYIQRVALKGGVAPAKACAESNKGAKE
FT                   VVKYQADYLFWTAS"
FT   gene            complement(394835..396010)
FT                   /gene="nhaA1"
FT                   /locus_tag="PSPPH_0347"
FT                   /note="PSPPH0347"
FT   CDS_pept        complement(394835..396010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA1"
FT                   /locus_tag="PSPPH_0347"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="identified by match to protein family HMM PF06965;
FT                   match to protein family HMM TIGR00773"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34455"
FT                   /db_xref="GOA:Q48PL9"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PL9"
FT                   /protein_id="AAZ34455.1"
FT                   /translation="MTQVSNRETPRGVAVLSRFLASESAGGIVLMAAALAALIVANSSL
FT                   SASYFSILHSVWLGLSVELWINDGLMAIFFLMVGLEIKREVLAGGLATWGQRALPGFAA
FT                   AGGMLVPALIYIAINWGNPQTLSGWAIPAATDIAFALGVLSLLGNRVPTSLKVFLAALA
FT                   ILDDLGAVTIIAFFYSSGLNLPMLAAAFATLAVLIALNRLNVRRLLPYLLLGALLWFFV
FT                   LQSGVHATLAGVALALCIPMGKPEEEARSPLLFLEEKMHYWVAFAVVPIFGFANAGVSL
FT                   SGITLANLIDPVPMGVALGLFVGKQIGVFLAAVLAIRAGLATLPENSNWVQLYGVAILC
FT                   GIGFTMSLFIGNLAFPGSQHLIDEVKVGVLIGSGLAAIAGILLLRTRFSRH"
FT   gene            complement(396062..396658)
FT                   /locus_tag="PSPPH_0348"
FT                   /note="PSPPH0348"
FT   CDS_pept        complement(396062..396658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P24696; match to
FT                   protein family HMM PF05962"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33857"
FT                   /db_xref="GOA:Q48PL8"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PL8"
FT                   /protein_id="AAZ33857.1"
FT                   /translation="MSQTHLLRAVDYPRMPWKNGGGSTEEIARDAGQDLDGFGWRLSIA
FT                   DIETSGGFSVFAGYQRIITVLQGAGMTLDVDGVSSRPLLPSDPFAFSGDSEVSCTLLDG
FT                   PIRDFNLIYAPHRYTARLHWIDVRHPQRLFSSAGTFVLFSMAEQVAISVNGQPWEILGK
FT                   LDCAQVDNSGGLLEIELQSPRASRCCLIELTASGL"
FT   gene            complement(396655..397404)
FT                   /gene="hutC"
FT                   /locus_tag="PSPPH_0349"
FT                   /note="PSPPH0349"
FT   CDS_pept        complement(396655..397404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutC"
FT                   /locus_tag="PSPPH_0349"
FT                   /product="histidine utilization repressor"
FT                   /note="identified by similarity to SP:P12380; similarity to
FT                   SP:P22773; match to protein family HMM PF00392; match to
FT                   protein family HMM PF07702; match to protein family HMM
FT                   TIGR02018"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33307"
FT                   /db_xref="GOA:Q48PL7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PL7"
FT                   /protein_id="AAZ33307.1"
FT                   /translation="MSTPPASSSLAAQMGESPAPLYARVKHMIALQIQNGTWPPHHRVP
FT                   SESELVTQLGFSRMTINRALRELTVEGLLVRMQGVGTFVAEPKSQSALFEVHNIADEIA
FT                   ARGHRHTCKVMVLKEEAAGSERALALDMREGQRVFHSLIVHYENDIPVQIEDRFVNAQV
FT                   APDYLRQDFTLQTPYAYLSQVAPLTEGEHVVEAILAEADECTLLQIDAGEPCLLIRRRT
FT                   WSGRQPVTAARLIHPGSRHRLEGRFTK"
FT   gene            397568..398932
FT                   /gene="hutF"
FT                   /locus_tag="PSPPH_0350"
FT                   /note="PSPPH0350"
FT   CDS_pept        397568..398932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutF"
FT                   /locus_tag="PSPPH_0350"
FT                   /product="formiminoglutamate deiminase"
FT                   /EC_number="3.5.3.13"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR02022"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35427"
FT                   /db_xref="GOA:Q48PL6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PL6"
FT                   /protein_id="AAZ35427.1"
FT                   /translation="MSAFFAERALLPDGWANNVRLEVSQEGVLTRIEANADRQGAEIVS
FT                   GPLLPGMPNLHSHAFQRAMAGLAEVAGNPNDSFWTWRDLMYRLVGRISPQQLSVIARQL
FT                   YIEMLKGGYTSVAEFHYVHQDLDGKPYADPAELAVQISQAASSVGIGLTLLPVLYSHSG
FT                   FGGQAPNEGQRRFIHSTDSYLDLQARLRPLLAAQPTQQLGLCFHSLRAVTPQQISEVLT
FT                   ASDQQCPVHIHIAEQQKEVDDCLSWSGRRPLQWLYENAPVDNRWCLVHATLAEADEVQL
FT                   MAQSGAVAGLCLTTEANLGDGIFPAVDYIAQGGRWGIGSDSHVSLSVVEELRWLEYGQR
FT                   LRDQRRNRLYRSDQPMVGRTLYDAALAGGAQALGQQVGALQVGQRADWLVLDGNDPYIA
FT                   TASGDAILNRWLFAGSDRQIRDVAVNGRWVIREGRHAAEEQSNREFAQVLRELLG"
FT   gene            complement(399378..399956)
FT                   /gene="blc"
FT                   /locus_tag="PSPPH_0351"
FT                   /note="PSPPH0351"
FT   CDS_pept        complement(399378..399956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blc"
FT                   /locus_tag="PSPPH_0351"
FT                   /product="outer membrane lipoprotein Blc"
FT                   /note="identified by similarity to SP:P39281"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36144"
FT                   /db_xref="GOA:Q48PL5"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PL5"
FT                   /protein_id="AAZ36144.1"
FT                   /translation="MIKVLVRFGIFVMASFLAIGFAHSADNLEPRTVDSVDLKQYQGTW
FT                   YEIARLPMFFQRKCAQSEALYALKDDGNIAVTNRCRTIEGKWEEAKGTASPQVPGKTDK
FT                   LWVVFDNWFSRLLPGVAKGDYWILDVSEGYRTAVVANPDRKYLWLLSRTPTVSASVKEN
FT                   MLSKARQQGYDTSRLIWREDDSKIGKGEK"
FT   gene            complement(399960..400214)
FT                   /locus_tag="PSPPH_0352"
FT                   /note="PSPPH0352"
FT   CDS_pept        complement(399960..400214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0352"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33996"
FT                   /db_xref="GOA:Q48PL4"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PL4"
FT                   /protein_id="AAZ33996.1"
FT                   /translation="MSLRTVALLSFCVFLAACSKITQENYSKISAGMPKAQVESLLGSP
FT                   TECSGALGMSSCTWGDQNTFISVQYAADKVVLFSGQGLK"
FT   gene            complement(400455..401465)
FT                   /gene="fbp"
FT                   /locus_tag="PSPPH_0353"
FT                   /note="PSPPH0353"
FT   CDS_pept        complement(400455..401465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="PSPPH_0353"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by match to protein family HMM PF00316"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34733"
FT                   /db_xref="GOA:Q48PL3"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PL3"
FT                   /protein_id="AAZ34733.1"
FT                   /translation="MSRVTLSRYLIEQTRSNNTPADLRFLIEVVARACKEISHAVSKGA
FT                   LGGVLGSMGTENVQGEVQKKLDVISNEILLEANEWGGHLAGMASEEMDNAYQIPGKYPK
FT                   GAYLLVFDPLDGSSNIDINAPVGTIFSVLRCPNEYLSQNEALNEKAFLQPGTEQVAAGY
FT                   AIYGPQTMLVLTLGDGVKGFTLDREMGSFVLTHEDIKIPESTQEFAINMSNQRHWEAPV
FT                   QRYVNELLAGEEGPLKKNYNMRWVAAMVADVHRILTRGGLFMYPRDSREPSKPGKLRLM
FT                   YEANPMSFLVEQAGGASTDGHQRILDIQPEGLHQRVAVYLGSKEEVERATAYHKE"
FT   gene            complement(401600..402964)
FT                   /locus_tag="PSPPH_0354"
FT                   /note="PSPPH0354"
FT   CDS_pept        complement(401600..402964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33227"
FT                   /db_xref="GOA:Q48PL2"
FT                   /db_xref="InterPro:IPR025060"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PL2"
FT                   /protein_id="AAZ33227.1"
FT                   /translation="MSHPAMKIAVLGLALCTAVTAVAQDKPTDFASQPPLSLSGDGPWY
FT                   RIELPLAVQLNARQGDLGDVRVFNAEGQPQAYSITPRQPAREQEPTPIPVKWFALYSTQ
FT                   EAGDAAPVIRIERSSNGSVIEVQPQSDIEAGEEVLRGWLLDTSAIKAPLEQLVIDWSTE
FT                   REGFQNFSIEASDDLQHWRNWGEGQVARLSFADEVIEQREVGLPGQSARYLRLLWRAPH
FT                   SAPLLISAHLLSASTESPTPPLTWSPPVKGVVESPNEYVWQLPSGLPVGRVKVDIAQPN
FT                   SLAPATLYGRMDAKQPWQPISSGLLYRLSQNNSDILQDQLQLSGRIVQQLKLVVDDRGG
FT                   GLGSEAPQLSVAVPATEIVFLARGEGPFTLAIGNPNVKAANLSLATLIPDLSPEKLASL
FT                   GTAEPATASVANMAAAPIAVPQSMDFKRLGLWAVLLLGVLFLGWMAFSTLRASKR"
FT   gene            complement(402976..405660)
FT                   /locus_tag="PSPPH_0355"
FT                   /note="PSPPH0355"
FT   CDS_pept        complement(402976..405660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0355"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33920"
FT                   /db_xref="GOA:Q48PL1"
FT                   /db_xref="InterPro:IPR014600"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PL1"
FT                   /protein_id="AAZ33920.1"
FT                   /translation="MRLLGRQSADQLQQLLATRQSLDAVQQRLNALERQSAPGVPPAQD
FT                   AAPLPVDAVIIETPIGGPELIWDLPDEEPQAARPVEPATEIRQPSKAAQPNLLDSAINR
FT                   AKDWLLGGNTVLRVGVVVLFLGLAFLLRYATEGMVVPIEARYAGVAASALALLGLGWWL
FT                   RLRNGPYALMLQGAGVGVLYLTVFAAMKLHTLLDPAAGFVLLVAITAFSAILALTQNAL
FT                   ALACAGALGGFAAPLLASTGQGSHISLFSYFALLNAGIIAIAWFKAWRILNLIGFFGTF
FT                   GIGFAWGIRAYTPELFWSTEPFLILFFVMYLAIGLLYARRKLLELTDAPPEASREALLR
FT                   WSARQGDYVDGTLLFGTPIVGFGLQYALVEHLEFGAAFSALALGLIYMGLARWLAARAN
FT                   GRTVLLMETCLALGVVFATLAIPLGLGSQWTTCAWAVEGAAVFWLGLRQHRKLAQVFGL
FT                   VLQVCASAMLISDSDNSSWAGDYWTPMILAIAALISAWSVFRLNTLMIIDQKIARTVLT
FT                   IWGAIWWAASLISVVQLYAPKSVQTPLLLIAAALSVAIWAVLALRLHWPDLAVLCSVLT
FT                   PVSALLLLGSLSEHYHPAANWGWLAWAAVFAVHLLTLHYLADTLPILAQRIAHTTGCLL
FT                   IISVLALELRFGLLQLSESYNAWRWLGWAILPSLFLLAMSSERQWPWPVKACPEAYHVG
FT                   AAAPLAALMLAWFWLANTFSDGAAEPLPYIPLLNPLEIGLLLALAGVCLWIRKYLTRPR
FT                   NVALLVAGASLFALVTAMVMRTAHHWAQVPWHTEALLESMRVQAGLSIVWTLMALALMI
FT                   GGHMRSNRELWLGGAALIGVVVIKLFFVELSNRGGMERIVSFIGVGILLLVVGYFAPLP
FT                   PKHSAREVGEEPGPGPTAAPDKL"
FT   gene            complement(406033..408483)
FT                   /gene="glgP"
FT                   /locus_tag="PSPPH_0356"
FT                   /note="PSPPH0356"
FT   CDS_pept        complement(406033..408483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="PSPPH_0356"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="identified by similarity to SP:P13031; match to
FT                   protein family HMM PF00343; match to protein family HMM
FT                   TIGR02093"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36847"
FT                   /db_xref="GOA:Q48PL0"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PL0"
FT                   /protein_id="AAZ36847.1"
FT                   /translation="MSQEPLVRDADVAAFRAAVLAKLTYSVGKDPDHAFEHDWFEAVAL
FT                   AARDHMVEHWMDHTRQIYRKVQKRVYYLSLEFLIGRLLYDSLSNLGLLEVAREALTELG
FT                   VDIERIRLLEPDAALGNGGLGRLAACFMESMSTLGIAGHGYGIRYEHGLFRQGIVDGWQ
FT                   QEQTENWLDFGNPWEFERPEVVYSIGFSGSVDTVVTEAGDSRQVWRPGETVRAIAYDTP
FT                   VVGWRGKSVNTLRLWRARAVEDLHLERFNAGDHFGAVAEVVRAESISRVLYPNDATEAG
FT                   QELRLRQEYFFVSASLQDLLRRHLNQHATLTDLPDHAAIQMNDTHPSIAVAELMRQLID
FT                   NHNIPWDTAWKITVGTLGYTNHTLLPEALETWSVGLMERMLPRHMQIIYLINAQHIDTL
FT                   RAKGVDDVNVLRAVSLIEEDNGRRVRMGNLAFLGSHSVNGVSALHTQLMRKTVFAELHK
FT                   IYPERINNKTNGITFRRWLFQANPKLTEMLIEALGEDVLDNAETRLKELEPFADKSSFR
FT                   KQMADQRLHSKRALAAIIHERLGIAVNPAAMFDVQVKRIHEYKRQLLNLFHTVALYQAI
FT                   RAEPGTDWVPRVKIFAGKAAASYNSAKLIIKLTNDIARTVNNDPTVRGLLKVVFMPNYN
FT                   VSLAESIIPAADLSEQISTAGLEASGTSNMKFGLNGALTIGTLDGANVEMSEQVGLEHM
FT                   FIFGMSSQQVEARKRAGEFNAHGDVAASGRLNDVLQAIRGGVFSPDDPNRYVGLIDQLL
FT                   DYDRFLVCADFDSYWAAQAKVEERWHDSKEWWRSAVLNTARMGWFSSDRTIREYAGDIW
FT                   KALD"
FT   gene            408764..409735
FT                   /gene="pip"
FT                   /locus_tag="PSPPH_0357"
FT                   /note="PSPPH0357"
FT   CDS_pept        408764..409735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="PSPPH_0357"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01249"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37491"
FT                   /db_xref="GOA:Q48PK9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PK9"
FT                   /protein_id="AAZ37491.1"
FT                   /translation="MQTLYPQIKPYARHDLAVEQPHVLYVDESGSPEGLPVVFIHGGPG
FT                   SGCDAHSRCYFDPNLYRIVTFDQRGCGRSTPHASLENNTTWKLVEDLERIREHLGIDKW
FT                   VLFGGSWGSTLALAYAQTHPDRVHALILRGIFLARQQEIDWFYQAGASRLFPDYWQDYV
FT                   APIPLDERDNILAAFHKRLTGPDQIAQMHAAKAWSTWEGRCATLRPNPQVVDRFAEPHR
FT                   ALSIARIECHYFMNKAFLEENQLIRDMPKIAHLPAIIVHGRYDVICPLDNAWELHQNWP
FT                   GSELQVIREAGHSASESGIADALVRAAAEIARNLLDLPPEEA"
FT   gene            409775..410212
FT                   /gene="dtd"
FT                   /locus_tag="PSPPH_0358"
FT                   /note="PSPPH0358"
FT   CDS_pept        409775..410212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="PSPPH_0358"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to SP:P32147; match to
FT                   protein family HMM PF02580; match to protein family HMM
FT                   TIGR00256"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36048"
FT                   /db_xref="GOA:Q48PK8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PK8"
FT                   /protein_id="AAZ36048.1"
FT                   /translation="MKGLLQRVRNARVEVGGEVVGAIDQGILVLVGIEPQDTRASADKL
FT                   LHKLLNYRVFSDADGKMNLSLREVGGGLLLVSQFTLAADTKSGLRAGFSKAAAPALGAE
FT                   LFDYLLSQARIAHTAVAAGQFGADMQVHLINDGPVTFLFDT"
FT   gene            410478..412406
FT                   /gene="mdoG1"
FT                   /locus_tag="PSPPH_0359"
FT                   /note="PSPPH0359"
FT   CDS_pept        410478..412406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdoG1"
FT                   /locus_tag="PSPPH_0359"
FT                   /product="periplasmic glucans biosynthesis protein MdoG"
FT                   /note="identified by similarity to SP:P33136; match to
FT                   protein family HMM PF04349"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33878"
FT                   /db_xref="GOA:Q48PK7"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PK7"
FT                   /protein_id="AAZ33878.1"
FT                   /translation="MIVSPCDAPKTPVKRLRSALLASSALVCLFSAGQLWAFNLDDVTA
FT                   KAKELAGQKFEAPRSNLPNELRDMKFADYQKIRFRDDKAEWAGEKTPFKVSFYHQGMHF
FT                   DTPVKINEVTATSVDEIKYDSSRFDFGDLKIDPKSTEKLGYAGFRVLYPINKDDKQDEI
FT                   MTMLGASYFRVIGKGQVYGLSARGMAIDTASPSGEEFPRFKEFWIEKPGPDDNHLVIFA
FT                   LLDSPRATGAYQLTLRPGTNTLVDVKSRMFLRDKVNKLGVAPLTSMFLFGANQPSRVPN
FT                   YRRELHDSSGLSIQAANGEWLWRPLNNPKHLSISSFSVENPRGFGLLQRGRDFSQYEDL
FT                   DDRYDKRPSAWIEPKGDWGKGTVELVEIPTADETNDNIVAYWKPETLAEPGKEMAFDYR
FT                   LHWTMQENSIHSPDLGWVKQTQRSIGDVRQSNLIRQPDGSLAFLVDFVGPVLAALPEDK
FT                   TIRSQVTTDDNVELVENNLRYNPVTKGYRLTLRVKVKDSGKPTEMLAYLLREIPAEPGK
FT                   EPALLVADKAEEKKAAAKEAAKPAVAKESANDQVEIAKADAPKPEAAKPETAKPEAGKA
FT                   DAAKGKGEVAKADAAKADAAKADVAKDKDGKEIQQPETEAAPTHPEPAKTLQVMTETWS
FT                   YQLPSDE"
FT   gene            412399..414981
FT                   /gene="mdoH"
FT                   /locus_tag="PSPPH_0360"
FT                   /note="PSPPH0360"
FT   CDS_pept        412399..414981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdoH"
FT                   /locus_tag="PSPPH_0360"
FT                   /product="periplasmic glucan biosynthesis protein"
FT                   /note="identified by similarity to SP:P33137; match to
FT                   protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34542"
FT                   /db_xref="GOA:Q48PK6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PK6"
FT                   /protein_id="AAZ34542.1"
FT                   /translation="MSNSLPVPVSLNEYLAHLPMSDEQRAELAGCKTFAELHERLSAQP
FT                   VNDPAEAAQASVGRRLTLTTADQLEDAEMLGVDASGRLCLKATPPIRRTKVVPEPWRTN
FT                   ILVRGWRRLTGKTNPPKPEHDDLPRDLPKARWRTVGSIRRYILLILMLGQTIVAGWYMK
FT                   GILPYQGWSLVSLDEITRQTFVQTALQVMPYALQTSILLLFGILFCWVSAGFWTALMGF
FT                   LELLTGRDKYRISGASAGNEPIEKGARTALVMPICNEDVPRVFAGLRATFESVAATGDL
FT                   DRFDFFVLSDTNETDIAVAEQQAWLDVCRETKGFGKIFYRRRRRRVKRKSGNLDDFCRR
FT                   WGGEYRYMVVLDADSVMSGECLTSLVRLMEATPDAGIIQTAPRASGMDTLYARMQQFAT
FT                   RVYGPLFTAGLHFWQLGESHYWGHNAIIRMKPFIEHCALAPLPGKGAFAGAILSHDFVE
FT                   AALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRWCHGNLMNFRLFLVKGMHPVHR
FT                   AVFLTGVMSYLSAPLWFFFLVLSTALLAVNTLMEPTYFLEPRQLYPLWPQWHPEKAVAL
FT                   FSTTIVLLFLPKLLSVILIWAKGAKGFGGKFKVTVSMLLEMLFSVLLAPVRMLFHTRFV
FT                   LAAFLGWAATWNSPQRDDDSTPWIEAVKRHGPQTLLGACWALLVFWLNPSFLWWLAPIV
FT                   VSLMLSIPVSVISSRTNLGVKARDEKFFLIPEEFEPPQELISTDQYTYENRWHALKQGF
FT                   IRAVVDPRQNALACALATSRHRQAQPIEVVRMERVDQALKVGPAKLGNQERLMLLSDPV
FT                   ALGRLHERVWSEGHEEWLAAWRASIEADPHAPLLPLQPVGKASEPVPV"
FT   gene            415068..416021
FT                   /locus_tag="PSPPH_0361"
FT                   /note="PSPPH0361"
FT   CDS_pept        415068..416021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0361"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33469"
FT                   /db_xref="GOA:Q48PK5"
FT                   /db_xref="InterPro:IPR011433"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PK5"
FT                   /protein_id="AAZ33469.1"
FT                   /translation="MVKTGSPEPRSFLTLQRGNAVLDALRRKRTRSVQTGMPTRSMGTI
FT                   VLSLTTLVPHAPAWECSSRRSASQEDAERPDRHAHAEHGHDSVIPDDARSSRSSVGMQF
FT                   TTLYVVRGRGASRPACLRGAWARWCYPCRRSFLTLQRGNAVYDALRRQRRRSVQTGMPT
FT                   RSMGTIVLSLTTLVPRAPAWECSSRRGASQEDAERPDRHAYAEHGHDSVIPDDARSSRS
FT                   SVGMQFTTLYVVRGRGASRPACLRGAWARWCYPCRRSFLTLQRGNAVYDALRRQRRRSV
FT                   RTGMPTRSMGTIVLAGPPAGAMVVQLTLNFPTSVCK"
FT   gene            complement(415982..417925)
FT                   /locus_tag="PSPPH_0362"
FT                   /note="PSPPH0362"
FT   CDS_pept        complement(415982..417925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0362"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34442"
FT                   /db_xref="GOA:Q48PK4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PK4"
FT                   /protein_id="AAZ34442.1"
FT                   /translation="MFRLINHALGNMNVRFKLSLGFGLVLLLTLIITLTGWHGLYTMID
FT                   RSESLSDIAQLNSLTKDLRAERITDRVEKTPESTALVTDKLNEMKAQLTTLHRQSLETE
FT                   TITLLNGQFETVSRLEKTFADVRANRQTRNQVRTRLEQTSEQALQAIALVESEVLKSVS
FT                   QEQDSTERMEEFTNISQLRQEVQIARYQVQAYTFTTRDADEAAAIVAIDEALKEIGQIG
FT                   QDEDSESLRGLGAATTALQGYRERLNEFKQIQTKAEADQELMRSLGDQLLDSVAALNRL
FT                   QTAQRDSEAVNSSTTLSSVAGLALLVGLLAAWVMTRQITVPLQQTLLVAARIAQGDLSR
FT                   DMSVTRRDEMGQLQGSMQTMTVSLRELVGGISEGVSQIASAAEQLSAVTKQTCIGVTSQ
FT                   KDETDQVATAMNEMAATVQEVARNAQEASQAAAQADQQARSGDEVVGRAISQIEQLARE
FT                   VVNSTQSMSELKLESNKIVGVLDVIKSVSQQTNLLALNAAIEAARAGEAGRGFAVVADE
FT                   VRGLAQRTQKSTEEIEELIAALQTGTQQVATTLDNSRTLTDNTVELSRRAGSALEQITR
FT                   TVATIQHMNEQIATASEEQSVVAEQINRNVISVRDISEQNAAASEQTAASSVELARLGT
FT                   HLQTLVGKFRVS"
FT   gene            complement(418128..420044)
FT                   /locus_tag="PSPPH_0363"
FT                   /note="PSPPH0363"
FT   CDS_pept        complement(418128..420044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0363"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33984"
FT                   /db_xref="GOA:Q48PK3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PK3"
FT                   /protein_id="AAZ33984.1"
FT                   /translation="MSRGLSQRLANASVSLKLGIGFGLVMLMTLMISATGWFSNQALID
FT                   RGDRVTAIAKINELTLQLRIDRTRYEDLFNAESAAEVRKTLDQLDAALVHARNLLRSPE
FT                   NIQSLDGQIQSAREYRQSFADVTKAIDAREISRSQMGDNADKAVDQANKVEAELLKADN
FT                   ILAFNGIVGVSKLIQQARFQVRGYTYSGRPDFEKNANQAIDEAITGINTLAGDISSEYL
FT                   PLLQQAVVGLNGYRAAVGQYRDTQAASKAALEKMTALGTKMLTTSDDMIARQNKSRDAD
FT                   SEKSVFMIAVATALALVISILAAWVITRQITTPLQETLEVVERVASGDLSRNLRVDRKD
FT                   ELGKLQSTIQRMTVSLRELVGGIRDGVTQIASAAEELSAVTEQTSAGVNSQKVETDQVA
FT                   TAMHEMTATVQEVARNAEEASEAAVAADQQARDGERVVNEAIAQIERLASAVGNSSEAM
FT                   GALKQESDKIGSVLDVIKSVAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLAQRT
FT                   QKSTEEIEALIARLQSGTQQAATVMDSSRELSTSSVELTRRAGGSLENITKTVSAIQAM
FT                   NQQIAAAAEEQSATAEEINRSIINVRDVSEQTSAASEETAASSVELARLGNHLQLLVSR
FT                   FTV"
FT   gene            complement(420135..420794)
FT                   /locus_tag="PSPPH_0364"
FT                   /note="PSPPH0364"
FT   CDS_pept        complement(420135..420794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0364"
FT                   /product="Protein of unknown function (DUF558) family"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36767"
FT                   /db_xref="GOA:Q48PK2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PK2"
FT                   /protein_id="AAZ36767.1"
FT                   /translation="MVLRDRRLKHMQEVHRAEVGDSLRVGRINGLLGSAELLRLEPHEA
FT                   ELRVSLDSAPPEKLPITLLLALPRPKMLRRVFQTIATMGVPKVILLNSYRVEKSFWQTP
FT                   FLEPEAIREQLILGLEQARDSVLPEVIIEKRFKPFVEDRLPHMAAGTLGLVGHPGDLPA
FT                   CPRAVTQPVTLAIGPEGGWIPYEVDLLRQSGLQPVQLGERILRVETAVTALLARLF"
FT   gene            complement(420839..421639)
FT                   /gene="tatC"
FT                   /locus_tag="PSPPH_0365"
FT                   /note="PSPPH0365"
FT   CDS_pept        complement(420839..421639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="PSPPH_0365"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="identified by match to protein family HMM PF00902;
FT                   match to protein family HMM TIGR00945"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37941"
FT                   /db_xref="GOA:Q48PK1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PK1"
FT                   /protein_id="AAZ37941.1"
FT                   /translation="MSADTPENDQQMPLISHLTELRTRLLRCVAAVFLIFAGLFYFTQK
FT                   IYTLVSAPLRVYLPEGATMIATDVASPFITPFKLTMMVALFLSMPVILHQIWGFIAPGL
FT                   YKHEKRVAVPLLVSSIILFYAGMAFAYFLVFPLIFHFFASVTPEGVSMMTDIASYLDFV
FT                   MTLFFAFGVAFEIPVAVVLLVWIGIVDVKYLKKIRPYVIIGCFVVGMILTPPDIFSQTL
FT                   LAVPMWLLFELGVLCSSMIKKRGEHPDDQAEDADKQDQPPATAP"
FT   gene            complement(421636..422097)
FT                   /gene="tatB"
FT                   /locus_tag="PSPPH_0366"
FT                   /note="PSPPH0366"
FT   CDS_pept        complement(421636..422097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="PSPPH_0366"
FT                   /product="sec-independent protein translocase TatB"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01410"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35470"
FT                   /db_xref="GOA:Q48PK0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PK0"
FT                   /protein_id="AAZ35470.1"
FT                   /translation="MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWIGRLKRSFNA
FT                   IKQEVEREIGADEIRRQLHNEHIISLEDEARKMFAQNQHPETTYEPVSPQPASVQPDAA
FT                   NTGHNTLGPAEPAAPKPALSLEKTAKPVDADTPVPTPPVHDSSLPPRAP"
FT   gene            complement(422102..422377)
FT                   /gene="tatA"
FT                   /locus_tag="PSPPH_0367"
FT                   /note="PSPPH0367"
FT   CDS_pept        complement(422102..422377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="PSPPH_0367"
FT                   /product="sec-independent protein translocase TatA"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36212"
FT                   /db_xref="GOA:Q48PJ9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PJ9"
FT                   /protein_id="AAZ36212.1"
FT                   /translation="MGIFDWKHWIVILIVVVLVFGTKKLKGLGSDVGESIKGFRKAMND
FT                   DDKPAEQPAPQPQQAQAAPQGSPLNQPHTIDAQAHKVDEPIRKDQV"
FT   gene            complement(422422..422754)
FT                   /gene="hisE"
FT                   /locus_tag="PSPPH_0368"
FT                   /note="PSPPH0368"
FT   CDS_pept        complement(422422..422754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="PSPPH_0368"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /note="identified by match to protein family HMM PF01503"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33798"
FT                   /db_xref="GOA:Q48PJ8"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PJ8"
FT                   /protein_id="AAZ33798.1"
FT                   /translation="MTDTLSRLAEVLESRKDAAADSSYVASLYHKGLNKILEKLGEESI
FT                   ETIIAAKDAAVSGDCSDVIYETADLWFHSMVMLAALGQHPQAVLDELDRRFGLSGHAEK
FT                   AARTAE"
FT   gene            complement(422757..423149)
FT                   /gene="hisI"
FT                   /locus_tag="PSPPH_0369"
FT                   /note="PSPPH0369"
FT   CDS_pept        complement(422757..423149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="PSPPH_0369"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="identified by match to protein family HMM PF01502"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37348"
FT                   /db_xref="GOA:Q48PJ7"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PJ7"
FT                   /protein_id="AAZ37348.1"
FT                   /translation="MKDWLDEIHWNSDGLVPAIAQDHKTGRVLMMAWMNREALSLTASE
FT                   NRAIYWSRSRGKLWRKGEESGHVQKLHELRLDCDADVIILMVEQIGGIACHTGRESCFY
FT                   RVYENSGWKTVDPVLKDPDAIYSAGH"
FT   gene            complement(423217..424836)
FT                   /gene="ubiB"
FT                   /locus_tag="PSPPH_0370"
FT                   /note="PSPPH0370"
FT   CDS_pept        complement(423217..424836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="PSPPH_0370"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF03109;
FT                   match to protein family HMM TIGR01982"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34920"
FT                   /db_xref="GOA:Q48PJ6"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PJ6"
FT                   /protein_id="AAZ34920.1"
FT                   /translation="MKLLAVRRLFRIQRVVIRYRLDDLLFALPLPWWMLAVRFVLPWRW
FT                   LPRRKSELSRGVRFRLALQDLGPIFIKFGQLLSTRRDLLPEDIADELMLLQDRVPPFDQ
FT                   QVAINLIEEQLGARICDVFSRFDETPLASASVAQVHAACLKTGEEVVVKVVRPGLKPVI
FT                   GQDLAWLFILARMAERVSADARLLHPVQVVMDYEKTIYDELDLLREAANSSQLRRNFEG
FT                   SDLLYVPQVYWDWCRPKVLVMERIYGLQVTDMAGLADQRTDMKLLAERGVEIFFTQIFR
FT                   DSFFHADMHPGNIFVSTVNPWSPKYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRV
FT                   AQLHIDSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQ
FT                   PQLVLLQKTLLNIEGLGRQLYPDLDLWSTAQPYLERWMRERVSPKTLFGNLQSQVEQLP
FT                   HIAGMTRDLLERMSRPHASDPPRPWHERKDEPVLRLIGAALLVGGAIQGWVMSEAATQL
FT                   LTLTAWPAAIMLIAGLYLIVRR"
FT   gene            complement(424833..425456)
FT                   /locus_tag="PSPPH_0371"
FT                   /note="PSPPH0371"
FT   CDS_pept        complement(424833..425456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0371"
FT                   /product="Protein of unknown function (DUF1243)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06843"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35771"
FT                   /db_xref="GOA:Q48PJ5"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PJ5"
FT                   /protein_id="AAZ35771.1"
FT                   /translation="MLLRGLLASIEHGINRVLRLDSTALPRMARLSGHVIAVDCRDPSL
FT                   KIFILPSDEGLLLAADWAADADCTLRAPASSLLRLALSKDKTAVLHGPDVELDGDSGVL
FT                   LELVGILQDLELDWEHELSNWVGPVASQLFSSRLRNSGRWTRESFTSLSQNVADYLSEE
FT                   SRTLVGKHEAEARFAELDQIKLDLDRLEARFARLAHSLNTSDNA"
FT   gene            complement(425456..426226)
FT                   /gene="ubiE"
FT                   /locus_tag="PSPPH_0372"
FT                   /note="PSPPH0372"
FT   CDS_pept        complement(425456..426226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="PSPPH_0372"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33800"
FT                   /db_xref="GOA:Q48PJ4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PJ4"
FT                   /protein_id="AAZ33800.1"
FT                   /translation="MNDQRKGSDAEPTTHFGYKNVPESQKAEKVAEVFHSVAAKYDLMN
FT                   DLLSGGMHRLWKRFAIELSGVRTGNRVLDIAGGTGDLTRKFSNLVGPTGQVVLADINAS
FT                   MLKVGRDRLLDLGVSGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLR
FT                   VLKPGGRLLVLEFSKPTNKLMSKAYDAYSFAFMPLMGKLVTNDSESYRYLAESIRMHPN
FT                   QETLKSMMVEAGFDRVTYHNMTAGVVALHRGIKP"
FT   gene            426313..426648
FT                   /locus_tag="PSPPH_0373"
FT                   /note="PSPPH0373"
FT   CDS_pept        426313..426648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02610"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34688"
FT                   /db_xref="GOA:Q48PJ3"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PJ3"
FT                   /protein_id="AAZ34688.1"
FT                   /translation="MQTAVYSCAAFHLIIKEACMAKITVERPHALGREKARERAEQLVE
FT                   KLSDKYGLAHEWAGDTVKLEGKGAKGKVEVEDALIRINIELNFILSAMSGSIKTEVERV
FT                   LDKALAA"
FT   gene            426663..427220
FT                   /locus_tag="PSPPH_0374"
FT                   /note="PSPPH0374"
FT   CDS_pept        426663..427220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0374"
FT                   /product="polyhydroxyalkanoate granule-associated protein
FT                   PhaI"
FT                   /note="identified by match to protein family HMM TIGR01837"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37144"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PJ2"
FT                   /protein_id="AAZ37144.1"
FT                   /translation="MSILIFLRNVVLMPIAGRFLQLSSMRCTMARANTKKNIEDQQSST
FT                   LSDVRLYARKIWLAGLGAYSRVNEEGTQYVRDLIRTGEQAEKEVVKTVDEKRLAANSEI
FT                   DSIKGEVPYAKGRVEAQLGRIESAFDRRVAKALNRIAIPSKHDVDTLSAKLDELTALLE
FT                   RVVPKKLERSGSKRFERSESGQ"
FT   gene            427231..428016
FT                   /locus_tag="PSPPH_0375"
FT                   /note="PSPPH0375"
FT   CDS_pept        427231..428016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0375"
FT                   /product="polyhydroxyalkanoate granule-associated protein
FT                   PhaF"
FT                   /note="identified by match to protein family HMM PF05597;
FT                   match to protein family HMM TIGR01837"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37693"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PJ1"
FT                   /protein_id="AAZ37693.1"
FT                   /translation="MAGKKKTDKDGSSWIGEVEKYSRQIWLAGLGAYSKISNDGSKLFE
FT                   TLVKDGEKAEKQTKVEAQKQLDEVKDTAKTAKSRVGDVKDLAVGKWNELEGAFDKRLNS
FT                   AISRLGVPSRNEVQALHSKVDQLTRQIELLTGEKAKPVASRAAAAKPAPKTAAKPLVKA
FT                   AAKTVAKTADKTAQKTAAAKPAVKKAAAKPVDAASKAATATASKAKTVAKPAAAKKPAA
FT                   RKPAAKPAAKPAASATPATGAAPAASAPSAAPATPASQS"
FT   gene            complement(428251..428865)
FT                   /gene="phaD"
FT                   /locus_tag="PSPPH_0376"
FT                   /note="PSPPH0376"
FT   CDS_pept        complement(428251..428865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaD"
FT                   /locus_tag="PSPPH_0376"
FT                   /product="transcriptional regulator PhaD"
FT                   /note="identified by similarity to GB:AAO58572.1; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36217"
FT                   /db_xref="GOA:Q48PJ0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PJ0"
FT                   /protein_id="AAZ36217.1"
FT                   /translation="MKTRDRILECALTLFNQQGEPNVSTLEIANEMGISPGNLYYHFHG
FT                   KEPLILSLFERFQAELAPLLDPPSDARLEAEDYWMFLHLIVERLSHYRFLFQDLSNLAG
FT                   RLPKLARGIRNLLNSIKKTLASLLARLKSRGQLVSETQALGQLVEQITMNLLFSLDYQR
FT                   ILGREGNVRVVVYQIMMLVTPHLLPTSRQAAEQLAMEYLGR"
FT   gene            complement(428932..430617)
FT                   /locus_tag="PSPPH_0377"
FT                   /note="PSPPH0377"
FT   CDS_pept        complement(428932..430617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0377"
FT                   /product="poly(3-hydroxyalkanoate) polymerase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF07167; match to protein
FT                   family HMM TIGR01839"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36582"
FT                   /db_xref="GOA:Q48PI9"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PI9"
FT                   /protein_id="AAZ36582.1"
FT                   /translation="MQEKSAKVASAAPTNFINAQSAITGLRGRDLFSTLRNVAAQGLRH
FT                   PVRSARHALALGKQLGRVVVLGETPYPHNPKDPRFADPTWSLNPLYRRGLQVYLSCQHQ
FT                   VRQWIDDSDMSTEDRARAHFLFTLINDALAPSNTLLNPQAVKELFNSGGTSLIKGLSHM
FT                   ADDLLHNSGLPSQTTKDAFEVGRTVATTPGAVVFRNEMFELIQYRPMSEKQFSRPVLIV
FT                   PPQINKFYIFDLSPTNSFVQYALKNGLQTFVISWRNPDIRHREWGLSSYVEATEQAMNI
FT                   CRAITAAREVNLVGACAGGLTVAALLGHLQAKRQTRRVASATYMVSLLDSQIESPATLF
FT                   IDEQTLEAAKRRSYQRGVLEGSEMNRVFSWMRPNDLIWTYWINNYLLGKSPPPFDILYW
FT                   NNDTTRLPAALHGDLLDFFKHNPLSHPGGLEVCGTPIDLQKVTVDSFSIAGINDHITPW
FT                   DAVYRSTLLLGGERRFVLSNSGHVQSILNPPGNPKANYVENSKLSSDPRAWYYDAQHHD
FT                   GSWWPNWLKWVQEHSGAEHNTRMELGNATYPPMEAAPGTYVHVR"
FT   gene            complement(430774..431631)
FT                   /gene="phaZ"
FT                   /locus_tag="PSPPH_0378"
FT                   /note="PSPPH0378"
FT   CDS_pept        complement(430774..431631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaZ"
FT                   /locus_tag="PSPPH_0378"
FT                   /product="poly(3-hydroxyalkanoate) depolymerase"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR02240"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34271"
FT                   /db_xref="GOA:Q48PI8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR011942"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PI8"
FT                   /protein_id="AAZ34271.1"
FT                   /translation="MPQPFVFRSIDLNGHTIRTAVRPGKSHLTPLLIFNGIGANLELVF
FT                   PFVEALDPDLEVIAFDVPGVGGSSTPNRPYRFPGLAKLAARMLDYLNYGQVNAIGVSWG
FT                   GALAQQFAHDYPERCKKLVLAATSAGMAMVPGKPRVLWLMASPRRYIQPSHVIRIAPEI
FT                   YGGAFRRDPNLAANHAAKVRSSGKLGYYWQLFAGMGWTSIHWLHKVHQPTLVLAGDDDP
FT                   LIPLVNMRLLAWRIPNAQLHIIDDGHLFLITRAEAVAPIIMGFLQQERQRAVMHPQPTP
FT                   PRTR"
FT   gene            complement(431695..433374)
FT                   /locus_tag="PSPPH_0379"
FT                   /note="PSPPH0379"
FT   CDS_pept        complement(431695..433374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0379"
FT                   /product="PHA-synthase 1"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF07167; match to protein
FT                   family HMM TIGR01839"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35941"
FT                   /db_xref="GOA:Q48PI7"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PI7"
FT                   /protein_id="AAZ35941.1"
FT                   /translation="MSNAKDDDLQRQASEHTLGLNPVVGLRRKDLLSTARMVLRQAFKQ
FT                   PIHSIKHVAHLSVELGNVIFGKSALQPTPEDRRFADPAWSQNPLYRRYLQTYLAWRKEL
FT                   HDWIGGSDLTPQDISRAHFVINLMTEAMSPTNSAANPAAVKRFFETGGKSLLDGLSHLA
FT                   KDLVNNGGMPSQVNMDAFEVGKNLGTTEGAVVFRNDVLELIQYKPITEQVHERPLLVIP
FT                   PQINKFYVFDLSPEKSLARFCLRSNVQTFIISWRNPTKAQREWGLSTYIEALKEAVDVV
FT                   LAITGSKDLNMLGACSGGITCTALLGHYAALGEKKVNAMTLLVSVLDTTLDTEVALFVD
FT                   EQTLETAKRHSYQAGVLEGRDMAKVFAWMRPNDLIWNYWVNNYLLGNEPPVFDILFWNN
FT                   DTTRLPAAFHGDLIEMFKNNPLTRANALEVCGTPIDLKQVTADVFCLAGTNDHITPWAS
FT                   CYKSARLFGGKTEFVLSSSGHIQSILNPPGNPKSRYMTHDELPADPAAWQENATKHTDS
FT                   WWLHWQEWLATRSGKLKKAPAGLGNKAYPAAEAAPGTYVHER"
FT   gene            complement(433688..434107)
FT                   /locus_tag="PSPPH_0380"
FT                   /note="PSPPH0380"
FT   CDS_pept        complement(433688..434107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0380"
FT                   /product="DUF971-like protein"
FT                   /note="identified by match to protein family HMM PF06155"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34745"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PI6"
FT                   /protein_id="AAZ34745.1"
FT                   /translation="MLLPVACSCYSLRLLSMLPTAIQLHKASKTLTLKYAPDEEYHLPA
FT                   EFLRVHSPSAEVQGHGRPILQFGKLGVGLSKVEPAGQYALKLTFDDGHDSGLFTWEYLY
FT                   ELARRQESLWEDYLQELKKAGKSRDPSEQVIKLML"
FT   gene            complement(434160..435497)
FT                   /gene="hslU"
FT                   /locus_tag="PSPPH_0381"
FT                   /note="PSPPH0381"
FT   CDS_pept        complement(434160..435497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="PSPPH_0381"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM TIGR00390"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35203"
FT                   /db_xref="GOA:Q48PI5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PI5"
FT                   /protein_id="AAZ35203.1"
FT                   /translation="MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLHEELRV
FT                   EVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLAD
FT                   AAIKLLREQEIIKVRHRAEDAAEDRILDALLPPARVGFNEDPAQSNDSNTRQLFRKRLR
FT                   EGQLDDKEIEIEINEAVGVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKDALKL
FT                   VREEEAGRLVNDEELKAKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLP
FT                   LIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFER
FT                   ILSEPHASLTEQYRELLKTEGLKIEFKPEGIKRLAEIAWQVNEKTENIGARRLHTLLER
FT                   LLEEVSFSAGDLAISPDAAPIEIDAEYVNSHLGDLAENEDLSRYIL"
FT   gene            complement(435564..436094)
FT                   /gene="hslV"
FT                   /locus_tag="PSPPH_0382"
FT                   /note="PSPPH0382"
FT   CDS_pept        complement(435564..436094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="PSPPH_0382"
FT                   /product="heat shock protein HslV"
FT                   /note="identified by match to protein family HMM PF00227"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33344"
FT                   /db_xref="GOA:Q48PI4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PI4"
FT                   /protein_id="AAZ33344.1"
FT                   /translation="MTTIVSVRRHGKVVMAGDGQVSLGNTVMKGNAKKVRRLYHGEVIA
FT                   GFAGATADAFTLFERFEAQLEKHQGHLVRAAVELAKDWRTDRSLSRLEAMLAVANKDAS
FT                   LIITGNGDVVEPEDGLIAMGSGGAFAQAAARALLLKTDLSAREIAETSLHIAGDICVFT
FT                   NHNITIEEQDLVG"
FT   gene            complement(436471..437166)
FT                   /locus_tag="PSPPH_0383"
FT                   /note="PSPPH0383"
FT   CDS_pept        complement(436471..437166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0383"
FT                   /product="sporulation related repeat protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33117"
FT                   /db_xref="GOA:Q48PI3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PI3"
FT                   /protein_id="AAZ33117.1"
FT                   /translation="MAVAKKKPAPKRGASRYQAPAKKPIPGWLWLAIGLTVGAFVVFLM
FT                   KLEPGGEDVKRVKADAKAAKIAEANKTPPSPTAPVKPKYDFYTLLPESEVIVPNEAVPE
FT                   KTPPPVAPTAPVSPEQAAKIDTARAQAALSGLTPPPAPPVATTKPAAVTTFFLQAGSFR
FT                   KQADAEKVRAQIILLGQTSTVESGTVKDETWYRVLVGPFSNREQLTTAQKQLASGGFSN
FT                   LLLQQRQSR"
FT   gene            complement(437168..438904)
FT                   /gene="argS"
FT                   /locus_tag="PSPPH_0384"
FT                   /note="PSPPH0384"
FT   CDS_pept        complement(437168..438904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="PSPPH_0384"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35677"
FT                   /db_xref="GOA:Q48PI2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PI2"
FT                   /protein_id="AAZ35677.1"
FT                   /translation="MKDTIRQLIQQALTRLVTEGVLPEGLTPAIQVENARDKTHGDFAS
FT                   NIAMMLAKPAGMKPRDLAEKLIAALPSDEQVSKVEIAGPGFLNFFQNTAALAARLDAAL
FT                   ADAHLSVRKAGAVQRVVVDLSAPNLAKEMHVGHLRSTIIGDGVANVLTFLGDTVIRQNH
FT                   VGDWGTQFGMLLAYLQEKPATSDELSDLENFYRAAKQRFDESEEFAERARGLVVKLQAG
FT                   DAECLALWTRFKDISLSHCQETYERLNVKLTPADVMGESAYNDDLANVVNDLKATGLLV
FT                   ESNGAQCVFLEEFRTADDTPLPVIVQKAGGGYLYATTDLAAIRYRSKVLKADRVLYFVD
FT                   QRQALHFQQVFEVARRAGFVHDGMQLEHMGFGTMNGADGRPFKTRDGGTVKLIDLLDEA
FT                   EERAYTLVKEKNPEVAEAELRSIAKAVGISAVKYADLSKHRASDYSFNFDQMLSFEGNT
FT                   APYLLYAYTRVAGVFRKLGTPFDASKGQIVLAAPQEQELAARLAQFTETLNNVAEKGTP
FT                   HVLCAYLYDLAGLFSSFYENCPILGAENPDQQQSRLRLAALTGRTLKQGLDLLGLETLE
FT                   RM"
FT   gene            complement(439002..441221)
FT                   /gene="priA"
FT                   /locus_tag="PSPPH_0385"
FT                   /note="PSPPH0385"
FT   CDS_pept        complement(439002..441221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="PSPPH_0385"
FT                   /product="primosomal protein N'"
FT                   /note="identified by similarity to SP:P17888; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF04851; match to
FT                   protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37136"
FT                   /db_xref="GOA:Q48PI1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PI1"
FT                   /protein_id="AAZ37136.1"
FT                   /translation="MPDAILRLALPSPLRRLFDYRAPAGVSRSALQPGMRLRVPFGRRE
FT                   MIGILVEVVDHSEVPADKLKPAIALLDSEAPLPPALFKLCLWTSQYYQHSLGDTLSWAL
FT                   PVLLRQGELAESRQERFWHVAPGASVGDPRIARAPKQREALTTLAQHPHGVAHQLLSKL
FT                   MLNKDSLNLLLAKELVYVEVRSHAPSARHEHWLAQPELPLNTEQRAAYEAIRAGFDSFH
FT                   AFLLAGVTGSGKTEVYLQLIRETLEAGKQALVLIPEINLGPQTLARFEQRFNARIALLH
FT                   SAVNDRERLDAWLAARDGEADIIIGTRSALFTPMKNPGLIIIDEEHDGSYKQQEGLRYH
FT                   ARDLALVRARQENIPIVLGSATPSLESLHNAYTGRYGLLRLNQRAGGAQQPRFMRLDVK
FT                   SRPLDSGISGPMQQAIGQTLAAGQQVLVFLNRRGFAPTLLCHDCGWMSGCQRCDARMTV
FT                   HQRSGELRCHHCGYVERVPRQCPSCGKVDLRPVGAGTERAEERLAILFPDFPVLRVDRD
FT                   STSRKDAMNQLFATIQRGQPCILVGTQMLAKGHHFPRVTLVSILDADGGLFSGDFRASE
FT                   RMAQLIVQVAGRAGRAEEPGKVIIQTHLADHPLLIQLTEQGYFAFAEQALSERRSAGLP
FT                   PFSHLALLRAEAHKPGQAEAFLDQACSDAEQLVAQMGLGGIELLGPVPAPMERRAGRYR
FT                   AQLLIQSSARAPLHKLLATWLLALEQMPSGRQVRWSLDVDPVDLY"
FT   gene            441391..441612
FT                   /gene="rpmE"
FT                   /locus_tag="PSPPH_0386"
FT                   /note="PSPPH0386"
FT   CDS_pept        441391..441612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="PSPPH_0386"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35217"
FT                   /db_xref="GOA:Q48PI0"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PI0"
FT                   /protein_id="AAZ35217.1"
FT                   /translation="MKADIHPVYEAIDATCSCGNVIKTRSTLAAPLSLDVCNECHPFYT
FT                   GKQKTLDVGGRVDKFKSRFGAFGATKAK"
FT   gene            441677..442396
FT                   /locus_tag="PSPPH_0387"
FT                   /note="PSPPH0387"
FT   CDS_pept        441677..442396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0387"
FT                   /product="staphylococcal nuclease homologue"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36047"
FT                   /db_xref="GOA:Q48PH9"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PH9"
FT                   /protein_id="AAZ36047.1"
FT                   /translation="MPAIWVSGAQAFCPAPASLPVAQVQRVVDGDTLRLSDGRSVRMIG
FT                   LNTPETGKKGQSAEPFAEAAKRRLQALVDESGGQIGLRVGQQGKDHYGRTLANVYDRKG
FT                   ANLEVQLLSEGLGYLVAVAPNVALVDCQQVAERAARQAQLGVWRDPPVQPSTRLSKSGF
FT                   AIVSGQVKSVQPPRDAEPVRSIDTAFWPVVWRWVAGCSRFRHLSVKSNPVPIDSSGWPV
FT                   LLGLCILRILGGPSVPQ"
FT   gene            442416..443684
FT                   /gene="maeB"
FT                   /locus_tag="PSPPH_0388"
FT                   /note="PSPPH0388"
FT   CDS_pept        442416..443684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="PSPPH_0388"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /note="identified by similarity to SP:O30808; match to
FT                   protein family HMM PF00390; match to protein family HMM
FT                   PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33538"
FT                   /db_xref="GOA:Q48PH8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PH8"
FT                   /protein_id="AAZ33538.1"
FT                   /translation="MSDLKTAALEYHANPRPGKLSVELTKPTATARDLALAYSPGVAEP
FT                   VREIARDPELAYKYTGKGNLVAVISDGTAILGLGDLGPLASKPVMEGKGVLFKRFAGID
FT                   VFDIEVDSESPQAFIDTVKRISITFGGINLEDIKAPECFEIEKALIEQCDIPVFHDDQH
FT                   GTAIVTAAGMINALEIVGKTLDTAKIVCLGAGAAAISCMKLLVSMGAKIENIFMVDRTG
FT                   VIHSGRTDLNQYKAVFAHATEKRSLTDALDGADVFVGLSGPNLLSAENLKLMAKDPIVF
FT                   ACSNPDPEISPELAHATRSDVIMATGRSDYPNQVNNVLGFPFIFRGALDVRAKRINEEM
FT                   KIAAANALRELAKLPVPQEVSDAYGGIKLEFGREYIIPKPMDTRLLGLIADAVAKAAIE
FT                   SGVATLPYPKHYPLTSVDDVFKG"
FT   gene            complement(444289..446733)
FT                   /locus_tag="PSPPH_0389"
FT                   /note="PSPPH0389"
FT   CDS_pept        complement(444289..446733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0389"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34773"
FT                   /db_xref="GOA:Q48PH7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PH7"
FT                   /protein_id="AAZ34773.1"
FT                   /translation="MIRLLKFFWWSLVAVFCSLLLGLSGAFLYLSPTLPSVEALRSIQL
FT                   QIPLRVFSSDGKLIAEFGEMRRTPIRFAEIPPNFINALLSAEDDNFANHYGVDPSSLMR
FT                   AATQLVKSGHIQSGGSTITMQVAKNFFLTSERSFSRKTTEILLALQIERQLTKDEILEL
FT                   YVNKIYLGNRAYGIEAAAQVYYGKSIRDVSLAQMAMIAGLPKAPSRFNPLANPTRAKER
FT                   RDWILGRMYRLGKIDQTAYQTALNEPLNASYHVPTPEVNAPYIAEMARAEMVGRYGSEA
FT                   YTEGFRVTTTVPSDLQEHANKSIQQGLIDYDQRHGYRGPESRFPGMTRANWVQELTKQR
FT                   MINGLEPGIVTQVDKTGLRVLTRNGEKEETVDWATMKWARPYLNTNSLGANPKQPGDVA
FT                   KVGDLVRLLRQDDGSLKFSQIPVAQSALVSLDPQNGAIRALVGGFAFEQSNYNRAMQAK
FT                   RQPGSSFKPFIYSAALDNGYTASSLVNDAPIVFVDEYLDKVWRPKNDTNTFLGPIRLRE
FT                   ALYKSRNLVSIRLLQALGIDSTIDYITRFGFSKQDLPRNLSLALGTATLTPMEIATGWA
FT                   TFANGGYKVSPYLIQTIENRDGQTLFVANPPSVPANDVNTAPNTSTFAVHDSPSVIAGP
FT                   LGTPAQPQAPAVAERVVDGRTTYILNSMLQDVIKRGTGRRALSMNRPDIAGKTGTTNDS
FT                   KDAWFSGYNADYVTTVWSGFDQPESLGRHEFGGTVSLPIWMDYMSAALKDKPPHQQAEP
FT                   PGILSLRVDPLSGRAATPSTPNAFFELFKSEDTPPSVNELGGSSAPGSPLPADESAPID
FT                   LF"
FT   gene            446940..448004
FT                   /gene="pilM"
FT                   /locus_tag="PSPPH_0390"
FT                   /note="PSPPH0390"
FT   CDS_pept        446940..448004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="PSPPH_0390"
FT                   /product="type IV pilus biogenesis protein PilM"
FT                   /note="identified by match to protein family HMM TIGR01175"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35670"
FT                   /db_xref="GOA:Q48PH6"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PH6"
FT                   /protein_id="AAZ35670.1"
FT                   /translation="MFELFSKKANTLLGIDISSTSVKLLELSRSGTRYKVESYAVEPLP
FT                   ANAVVEKNIAELEGVGQALSRVLAKAKTSVKIVAVAVAGSAVITKTIEMDAGLSDDDME
FT                   NQLKLEADQYIPYPLEEVAIDFEVQGYSVRNPERVEVLLAACRKENVEVREAALALAGL
FT                   TARVVDVEAYALERSFGLLAAQLGNGHDELTVAVVDIGATMTTLSVLHHGRIIYTREQL
FT                   FGGRQLTDEIQRRYGLSMEEAGLAKKQGGLPDDYVSEVLDPFKDALVQQVSRSLQFFFA
FT                   AGQYNSVDHIMLAGGTASISGLEHLIQRRIGTPTMVANPFADMALSSKVNAGALASDAP
FT                   ALMIACGLALRSFD"
FT   gene            448004..448603
FT                   /gene="pilN"
FT                   /locus_tag="PSPPH_0391"
FT                   /note="PSPPH0391"
FT   CDS_pept        448004..448603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="PSPPH_0391"
FT                   /product="type IV pilus biogenesis protein PilN"
FT                   /note="identified by similarity to GB:AAA87403.1; match to
FT                   protein family HMM PF05137"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37432"
FT                   /db_xref="GOA:Q48PH5"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PH5"
FT                   /protein_id="AAZ37432.1"
FT                   /translation="MARINLLPWREELREERKKRFLTALVGVLVVSVGILFLIDRYVSN
FT                   AIEHQMARNAFVQTQIAQLDIRIKEISDLKARRKQLLERMKIIQDLQGNRPITGRVFDQ
FT                   LARTLPDGVYFSQVKMTDKLIAISGAAESNNRVSDLMRNLEASDWLEAPSLTEVKATTA
FT                   GAVDQANVFQLTVRQTQPPVAAAAPAATTPATGAKP"
FT   gene            448600..449223
FT                   /gene="pilO"
FT                   /locus_tag="PSPPH_0392"
FT                   /note="PSPPH0392"
FT   CDS_pept        448600..449223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="PSPPH_0392"
FT                   /product="type IV pilus biogenesis protein PilO"
FT                   /note="identified by match to protein family HMM PF04350"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37048"
FT                   /db_xref="GOA:Q48PH4"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PH4"
FT                   /protein_id="AAZ37048.1"
FT                   /translation="MNMSEWLEGLRKVDLSELDLNNLGSWPAAVKAIAGVLVAVLIFAL
FT                   GYFFFIQDLETQLESAQNSEVTLKEQFSNKAFQAANLEPYKKQMEEMENTFGALLRQLP
FT                   SDTEVPGLLEDITRTGLGSGLEFEEIKLLPEAVQQFYIELPIQITVVGGYHDLATFVSG
FT                   VASLPRIVTLHDFEIKPVDPKVPTKLRMSILAKTYRYNDEGLKK"
FT   gene            449220..449747
FT                   /gene="pilP"
FT                   /locus_tag="PSPPH_0393"
FT                   /note="PSPPH0393"
FT   CDS_pept        449220..449747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="PSPPH_0393"
FT                   /product="type IV pilus biogenesis protein PilP"
FT                   /note="identified by similarity to GB:AAA93089.1; match to
FT                   protein family HMM PF04351"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37763"
FT                   /db_xref="GOA:Q48PH3"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PH3"
FT                   /protein_id="AAZ37763.1"
FT                   /translation="MRAARLLCVSVVMTGLAGCGNDNDFADLSAFMDQARARPSGTIEA
FT                   LPKFRPYEAFTYNASTLRSPFQPPVKIDLLNRQKGSRLVAPDEHRVRQFLEGFNIESFE
FT                   MVGTIGNESGTFALLRGAGGVHRVKVGDYLGRNNGRVVSIGDAQVDVIEIVPDGEGAWL
FT                   ERPRTIALKERS"
FT   gene            449795..451900
FT                   /gene="pilQ"
FT                   /locus_tag="PSPPH_0394"
FT                   /note="PSPPH0394"
FT   CDS_pept        449795..451900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="PSPPH_0394"
FT                   /product="type IV pilus biogenesis protein PilQ"
FT                   /note="identified by similarity to SP:P34750; match to
FT                   protein family HMM PF00263; match to protein family HMM
FT                   PF03958; match to protein family HMM PF07660; match to
FT                   protein family HMM TIGR02515"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33134"
FT                   /db_xref="GOA:Q48PH2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PH2"
FT                   /protein_id="AAZ33134.1"
FT                   /translation="MTRILSIIGVSLCIAMLSPVLQAANLKTLDVAALPGDRIELKLAF
FT                   DSPVPAPRGYTTAQPARIALDLPGVTSQLATKSRELGNGNARSVVVVQAQDRTRVIINL
FT                   TMLSPYSSRVDGNNLYVVIGQGAAAAQASQPTTAMGAQRVAVPPPTPASARPFIPAGVK
FT                   AIRNVDFQRGELGEGNVIIDLSNPGIAPDIQEQGGKIRVDFAKTQLPEPLRVRLDVKDF
FT                   ATPVQFVSASATGDKASILIEPSGAFDYSAFQTENKLTISVRPLTNEDLDRRAADKPVY
FT                   TGEKLSLNFQDIDVRSVLQLIADFTNLNLVASDTVQGGITLRLQNVPWDQALDLVLKTK
FT                   GLDKRKVGSVLLVAPADEIAARERQELESLKQIAELAPLRRELLQVNYAKAADIAKLFQ
FT                   SVTSAESKTDERGSITVDDRTNNIIAYQTQDRLDELRRIVSQLDIPVRQVMIEARIVEA
FT                   NVDYNKQLGVRWGGSTNTSGNGKWTTYGLDNNGDEAGNTGSNVTSNVPFVDMGASGATS
FT                   GIGLGFVTNNTLLDLELSAMEKTGNGEIVSQPKVVTSDKETAKILKGTEIPYQESSSSG
FT                   ATTVSFKEASLSLEVTPQITPDNRIIMEVKVTKDEPDYLNAVLGVPPIKKNEVNAKVLI
FT                   SDGETIVIGGVFSNTQSKVVDKVPFLGDVPYLGRLFRRDVVSESKSELLVFLTPRIMNN
FT                   QAISVSR"
FT   gene            451905..452423
FT                   /gene="aroK"
FT                   /locus_tag="PSPPH_0395"
FT                   /note="PSPPH0395"
FT   CDS_pept        451905..452423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="PSPPH_0395"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33291"
FT                   /db_xref="GOA:Q48PH1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PH1"
FT                   /protein_id="AAZ33291.1"
FT                   /translation="MRNLILVGPMGAGKSTIGRLLAKELRLPFKDSDKEIELRTGANIP
FT                   WIFDKEGEPGFREREQAMIAELCEADGLVLATGGGAVMRGENRQALRAGGRVVYLHASI
FT                   EQQVGRTARDRNRPLLRTADPARVLSELLAIRDPLYREIADVVIETDERPPRMVVLEIL
FT                   ARLAELPPR"
FT   gene            452539..453642
FT                   /gene="aroB"
FT                   /locus_tag="PSPPH_0396"
FT                   /note="PSPPH0396"
FT   CDS_pept        452539..453642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="PSPPH_0396"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="identified by match to protein family HMM PF01761;
FT                   match to protein family HMM TIGR01357"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33452"
FT                   /db_xref="GOA:Q48PH0"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PH0"
FT                   /protein_id="AAZ33452.1"
FT                   /translation="MQTLKVELGERSYPIHIGEGLLDQPELLTPHIVGRQVAIVSNTTV
FT                   APLYLERLTQTLAGYNVLPIVLPDGEAFKNWETLQTIFDGLLTARHDRRTTVIALGGGV
FT                   IGDMAGFAAACYQRGVNFIQIPTTLLSQVDSSVGGKTGINHPLGKNMVGAFYQPSVVLI
FT                   DTTSLNTLPERELSAGLAEVIKYGLICDEPFLTWLEEHVDALRGLDQAALTVAIERSCA
FT                   AKALVVGADERESGVRATLNLGHTFGHAIETHMGYGVWLHGEAVAAGTVMALEMSSRLG
FT                   WISTQDRDRGIRLFQRAGLPVVPPQDMTEDNFLEHMAIDKKVIDGRLRLVLLRQMGEAV
FT                   ITDDYPKEVLQATLVADYRALVDQLRG"
FT   gene            453653..455272
FT                   /locus_tag="PSPPH_0397"
FT                   /note="PSPPH0397"
FT   CDS_pept        453653..455272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36128"
FT                   /db_xref="GOA:Q48PG9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PG9"
FT                   /protein_id="AAZ36128.1"
FT                   /translation="MTSLHADEAFLGHYQLSHDPFAARVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLLLAVTGPQGSGKTLLRQALVASTNKQSVQSVVVSARGAGDAAGVLQQVAQALS
FT                   VAQAEMQAILSQVVQLGLTGQEVYLLVDDAEQLGDSALEALLGLAAGTPEGRPHVFLFG
FT                   EPSLLDRLDQMCADLQGDVEGERFHVIELQPYTEEETREYLAQRLEGAGQGIALFTADQ
FT                   ITDIHEQSDGWPGAINQVARDSMIEAMIASRSVVKRPSVGFNMPKKHVLALGAVVIVAV
FT                   AAAVLIPGRGDKTGTPANAPASAQAQLPLGEGKPTAQQSNNGSPAIEFAGNSQPMPLPM
FT                   NGNSQPVMRGPLAEAAGSSDSDEDAVPTGSPAQPPTVTTTAPPAGVPAGQAAAQTPRSS
FT                   IPAPAAKPAPAPAPAPAQVATAKPAPAPAAKPAEKPAPAAAKPAAGSNWYSSQAPGHYV
FT                   VQILGTSSEATAQAYIAEQGGEYRYFKKTLQGKPLYVITYGNFPDRAAALAAIKVLPAK
FT                   VQAGKPWPRTVASVQQELGASR"
FT   gene            455633..460078
FT                   /gene="gltB"
FT                   /locus_tag="PSPPH_0398"
FT                   /note="PSPPH0398"
FT   CDS_pept        455633..460078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="PSPPH_0398"
FT                   /product="glutamate synthase, large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by match to protein family HMM PF01493;
FT                   match to protein family HMM PF01645; match to protein
FT                   family HMM PF04897; match to protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34434"
FT                   /db_xref="GOA:Q48PG8"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PG8"
FT                   /protein_id="AAZ34434.1"
FT                   /translation="MKAGLYQPDEFKDNCGFGLIAHMQGEPSHHLLQTAVQALTCMTHR
FT                   GGINADGKTGDGCGLLIQKPDGFLRAMAKEHFGADLPRQYAVGMVFLNQDDAKADAARE
FT                   NMNREILAEGLELVGWRQVPIDTSVLGRLALERLPKIEQVYIGGEGLSDQEFAIKLFSA
FT                   RRRSSVSNAADTDHYICSFSHKTIIYKGLMMPADLTAFFPDLSDERLQTAICVFHQRFS
FT                   TNTLPKWPLAQPFRFLAHNGEINTITGNRNWAQARRTKFTNDLMDLDELGPLVNRVGSD
FT                   SSSMDNMLELMVTGGIDLFRGVRMIIPPAWQNVETMDPDLRAFYEYNSMHMEPWDGPAG
FT                   IVMTEGRHAVCLLDRNGLRPARWVTTKNGYITLASEIGVWDYKPEDVIAKGRVGPGQIF
FT                   AVDTETGQILDTDAIDNRLKSRHPYKQWLRKNALRIQATMEDNDHGSAFYDSEQLKQYM
FT                   KMYQVTFEERDQVLRPLGEQGQEAVGSMGDDTPMAVLSRRVRSPYDYFRQQFAQVTNPP
FT                   IDPLREAIVMSLEICLGAERNIFQESPEHASRVILSSPVISPAKWRSLMNLERPGFERH
FT                   IIDLNYDESLGLEAAVRSVADQAEEAVRAGRTLIVLSDRHIAPGKLPVHASLAVGAVHH
FT                   RLTEQGLRCDSNILVETATARDPHHFAVLIGFGASAVYPFLAYEVLGDLIRTGEVLGDL
FT                   YEVFKNYRKGITKGLLKILSKMGISTVASYRGAQLFEAIGLSEEVCDTSFRGVPSRLKG
FT                   ARFVDIEAEQKALAAEAWSTRKPIQQGGLLKFVFGGEYHAYNPDVVSTLQAAVQQGDYS
FT                   KFKEYTSLVDQRPVSMIRDLLQVKTLDQPLNIDEIEPLSEILKRFDSAGISLGALSPEA
FT                   HEALAEAMNRLGARSNSGEGGEDPARYGTIRSSKIKQIATGRFGVTPEYLVNADVLQIK
FT                   VAQGAKPGEGGQLPGGKVNGLIAKLRYAVPGVTLISPPPHHDIYSIEDLSQLIFDLKQV
FT                   NPAALVSVKLVAEAGVGTIAAGVAKAYADLITISGYDGGTGASPLTSIKYAGAPWELGL
FT                   AETHQTLRGNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGTAPMIALGCKYLRIC
FT                   HLNNCATGVATQNEKLRKDHYIGTVDMVINFFTYVAEETREWLAKLGVRTLEELIGRTD
FT                   LLDILPGETEKQQHLDLTPLLGSDHIPADKPQFSLVDRNPPFDKGLLAEQMVEMAKPAI
FT                   ESLSGGEYELDICNCDRSIGARISGEIARLHGNQGMNKAPITFRFKGTAGQSFGVWNAG
FT                   GLNMYLEGDANDYVGKGMTAGKLVIVPPKGSPFKTNESAIIGNTCLYGATGGKLFAAGT
FT                   AGERFAVRNSGAHTVVEGTGDHCCEYMTGGFVCVLGKTGYNFGSGMTGGFAYVLDQDNT
FT                   FVDLVNHELVEIQRISGESMEAYRTHLQSVLNEYVAETDSEWGRNLAENLDDYLRRFWL
FT                   VKPKAANLKSLLSSTRANPQ"
FT   gene            460094..460186
FT                   /locus_tag="PSPPH_0399"
FT                   /note="PSPPH0399"
FT   CDS_pept        460094..460186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0399"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35412"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PG7"
FT                   /protein_id="AAZ35412.1"
FT                   /translation="MSFKPQANGSALIACDHDFLQLQACNLKLP"
FT   gene            460201..461619
FT                   /gene="gltD"
FT                   /locus_tag="PSPPH_0400"
FT                   /note="PSPPH0400"
FT   CDS_pept        460201..461619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="PSPPH_0400"
FT                   /product="glutamate synthase, small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01318"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35791"
FT                   /db_xref="GOA:Q48PG6"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PG6"
FT                   /protein_id="AAZ35791.1"
FT                   /translation="MAERLSNDFQFIDVGRKDPKKKLLRQRKKEFVEIYEPFKPQQSAD
FT                   QAHRCLGCGNPYCEWKCPVHNFIPNWLKLVAEGNILAAAELSHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGSVEKYITDTAFAMGWRPDMSRVVPTGKRVAIIGAGPAGLG
FT                   CADVLVRGGVTPVVFDKNPEIGGLLTFGIPEFKLEKSVLSHRREVFTGMGIEFRLNTEV
FT                   GKDVTIDQLLEEYDAVFMGMGTYTYMKGGFPGEDLPGVHDALDFLIANVNRNLGFEKAP
FT                   EDFVDMKGKRVVVLGGGDTAMDCNRTSIRQGAKSVTCAYRRDEENMPGSRKEVKNAKEE
FT                   GVKFLYNRQPIAIVGDGKVEGVKVVETRLGEPDARGRRSPEPIPGSEEIIPAEAVVIAF
FT                   GFRPSPAPWFEQFTISTDSQGRVVAPEQAQYKHQTSNPKIFAGGDMVRGSDLVVTAIFE
FT                   GRNAAEGILDYLGV"
FT   gene            461785..463329
FT                   /locus_tag="PSPPH_0401"
FT                   /note="PSPPH0401"
FT   CDS_pept        461785..463329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0401"
FT                   /product="amidase family protein"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35530"
FT                   /db_xref="GOA:Q48PG5"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PG5"
FT                   /protein_id="AAZ35530.1"
FT                   /translation="MKNQFGFCLALSIAPFAFASQTPANFDGPVFGSIIENKAVYFESS
FT                   VELQQRMSAGSLTSAELVQDLLQRIEALNNNGPQLNAVIEVNPDALQIAAQMDGERSRG
FT                   EKRGPLHGIPVLVKDNINTGDKMQTTAGALAMVGSPAPHDAFVVKRLREAGAIIIGKAN
FT                   LSEWAFFRGENPPSGWSGRDGQTLHPYNLSVDPRGSSTGSAVGLAAGFSPLALGTETNG
FT                   SIIQPAQTNGVVGLRPTLGLLSRTGLIPLTRRQDTPGPMARSVTDTAIMLTAMSGTDPL
FT                   DDATGQASTDTVNYFDHLSTDALRGKRLGYPRLTWDDKSMDDDPDFQKAKISLQSAGAI
FT                   LVPIDVPDIDNSPEFGVMLQDFKRELNAYLNTRPGLEVSTLDDIIAFNTASPSTQVYDQ
FT                   NLLIQSSNTPVDPDYLSKATDLRNANQQLIDGLVQQHSLDALVDLSYVSFKGVGAVAGY
FT                   PGITVPFMRHDDGMPEGLYFLSKAWDEANLLSYAYALEQALATSAASVHSGISQAD"
FT   gene            463663..465354
FT                   /locus_tag="PSPPH_0402"
FT                   /note="PSPPH0402"
FT   CDS_pept        463663..465354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0402"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36207"
FT                   /db_xref="GOA:Q48PG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PG4"
FT                   /protein_id="AAZ36207.1"
FT                   /translation="MLKAAPMGKLARSNEQKSLGPDRFTPSTVAVREHRTRERADRIID
FT                   QFVERFTEKDFFPEDGEDALFSLLVQLPDWPADLSIRIHNENDEVLAVFLKGSDESVVQ
FT                   DSIVLTQNVDAYIVPDNVQVADDEPLLRWVFSQLPAGSSVGMGGNFPGSSSDAGRIVTL
FT                   REQIAGLAKDQRPLLFDALVAVDEGTSKGQLDTRARNPFLPLWVRQQTPLSPALSALCA
FT                   LCPEVPAGRLEELLQQMPLTEQEEADFLNNLVLPDAFGEAMNISLDEWSNSLAIDGLSR
FT                   TRSFNSYTDELARSIVRKLLAAESGRDVLIFDAGASNYAPADTDDNRIILLHDNYGNYS
FT                   AKDTGNGEITSFKQGTDSFYLAISSQLKADERSSLGMQFEQDVQGFRDVLTQHAIEENR
FT                   GWFDPGKPTEIESGFLPDWFANATAAEKQSWKMAVQDYSQALLEAQAPDLLDPSGYGQP
FT                   TNCANMRGKSCRNGFCSTTVLQWILTISACIPSASRLIQALLLIPITNISALQNWSRIM
FT                   KRISAALQICRWKTLHSPISTFCSPAARLTIRGNWSVSSTPVICSA"
FT   gene            465495..466874
FT                   /locus_tag="PSPPH_0403"
FT                   /note="PSPPH0403"
FT   CDS_pept        465495..466874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37573"
FT                   /db_xref="GOA:Q48PG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PG3"
FT                   /protein_id="AAZ37573.1"
FT                   /translation="MAGDFLGDGGLPPELASRGYKWVAAVLDHPIDSDDRATVEGHRIQ
FT                   VSQLSINDVSLSGVLVIGAESRSSVAAFVVFTPQAPDGICFREMSDPQEFQQRILLEPD
FT                   LLDYLVDRAPLASQDDVRHILTVRRETLFMELQPCTGSFLEAVYDSEVGRVISAVDEQT
FT                   KTNWESYWESAWEITKVVGDIVLTFAPFKVRLPIAALRSFYAIWQGVAKAGGEEQGAPL
FT                   YFVQVALLLADGLTLPRARRVQTSSTTSIGRSVLDPKTAVAKTPGGLKQLDNGVYEKTQ
FT                   EGAPSRFYAVQQGKTYAVRYDADFAAWRVIDPRRPDAHYQLPIQLDRQGVWVHASAGLR
FT                   GGNKRLKGRSSNGSGSDGDSSDSNRIKRYKVDIDGFFESRRFRHAENDLPNDDLEAAVK
FT                   KAVDRYVLDGNGSLHKYGKSQFSLDLPGIGRSTGRGAWRLILARAEKSVIKAFDVIDPH
FT                   K"
FT   gene            467017..468081
FT                   /gene="hemE"
FT                   /locus_tag="PSPPH_0404"
FT                   /note="PSPPH0404"
FT   CDS_pept        467017..468081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="PSPPH_0404"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="identified by match to protein family HMM PF01208;
FT                   match to protein family HMM TIGR01464"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33525"
FT                   /db_xref="GOA:Q48PG2"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PG2"
FT                   /protein_id="AAZ33525.1"
FT                   /translation="MTALKNDRFLRALLKQPVDVTPVWMMRQAGRYLPEYRASRASAGD
FT                   FMSLCKNPQFACEVTLQPLDRYPLDAAILFSDILTIPDAMGLGLYFETGEGPRFKKTVS
FT                   TLADIEALPIPDAQKDLGYVMDAVSTIRRELNGRVPLIGFAGSPWTLATYMVEGGSSKD
FT                   FRKSKAMLYDNPQAMHLLLDKLAQSVTAYLNGQILAGAQAVQIFDSWGGSLSSAAYQEF
FT                   SLAYMRKIVNGLIREHDGRKVPVIVFTKGGGLWLESIADIGADTLGLDWTCDIGEARQR
FT                   VGSKVSLQGNMDPTVLYARPEAIRQEVARILASYGSGTGHVFNLGHGITPEVDPANAGA
FT                   FINAIHELSAQYHQ"
FT   gene            complement(468142..469617)
FT                   /locus_tag="PSPPH_0405"
FT                   /note="PSPPH0405"
FT   CDS_pept        complement(468142..469617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0405"
FT                   /product="N-acyl-D-amino acid deacylase family protein"
FT                   /note="identified by similarity to SP:P94212; match to
FT                   protein family HMM PF07908; match to protein family HMM
FT                   PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34094"
FT                   /db_xref="GOA:Q48PG1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PG1"
FT                   /protein_id="AAZ34094.1"
FT                   /translation="MIYDLIIRDALVIDGSDTPGVRADVAISDGRIQRIGNLIDATAQE
FT                   EVNAAGRVLAPGFIDVHTHDDTVVIRKPDMLPKISQGVTTVIVGNCGISASPVSLRGNP
FT                   PDPMNLLGDAAAFVYPRFADYRAAVDNARPAVNVAALIGHTALRSNHMDDLFRSASPEE
FT                   IDAMREQLRDSLEAGALGLSTGLAYASAFSAETSEVKQLAEVLSAFGAIYTTHLRSEFE
FT                   PVLEAMAEAFDIGRHARSPVVISHMKCAGAGNWGRSPQLLAALEKAAQDHPVGCDCYPY
FT                   AASSSTLDLKQVTDAFRITITWSTPHPDQGGRDLQDIAADWGLSLLDAARKLQPAGAVY
FT                   YGMDEGDVERIMSHPLSMIGSDGLPEDPFPHPRLWGAFPRVLGHFSRDKGLFALHTAVH
FT                   KMTGLSAARFALHERGFIREGYWADLVLFNPQTVHDVADFKDPQRAAQGIDGVWVNGRL
FT                   SYAEGKPQGERQGRFLPRSGSLLEGFTDGKAPT"
FT   gene            complement(469621..470481)
FT                   /locus_tag="PSPPH_0406"
FT                   /note="PSPPH0406"
FT   CDS_pept        complement(469621..470481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0406"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33739"
FT                   /db_xref="GOA:Q48PG0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PG0"
FT                   /protein_id="AAZ33739.1"
FT                   /translation="MDILYQIRARQDSLSAGEGRIARLVLSDIAFAASASLDELASRAG
FT                   VSSATLSRFARSIGCRDLRDLRLQLAQASGVGSRFLNPEPAPEQSAFFTRIVGDIEATL
FT                   HQHLAGFDESRFAAAVACLSDARMIHAFGMGGCSSLCSEELQTRLVRLGYPVAACHDPV
FT                   MMRMIAATLGPQHSLIVCSLSGRTPELLDAVTLARSYGARVLAITLPDSPLAQLAEVVL
FT                   PLQIAETNFIYKPTAARYGMLLTIDVLATELALLSPEDNQERLRRIKLALDEYRGGEDG
FT                   LPLGD"
FT   gene            complement(470482..471831)
FT                   /locus_tag="PSPPH_0407"
FT                   /note="PSPPH0407"
FT   CDS_pept        complement(470482..471831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0407"
FT                   /product="gluconate transporter family protein"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34589"
FT                   /db_xref="GOA:Q48PF9"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF9"
FT                   /protein_id="AAZ34589.1"
FT                   /translation="MSPSPGISLLVYAAVAIIALIVLIARYRLNPFIVITLVSVGLALV
FT                   AGMPASGVVASYEAGVGKTLGHIALVVALGTMLGKMMAESGGAEQVARTLIDRFGERNA
FT                   HWAMVCIAFLVGLPLFFEVGFVLLVPIAFTVARRVGVSILMVGLPMVAGLSVVHALVPP
FT                   HPAAMLAVQAYQASVGQTLFYAILIGIPTAIIAGPVYAKFIVPHIHLPAENPLAKQFLD
FT                   REPRAKLPSFGLTMATILLPVVLMLLGGWANLISTPGSAFNGFLLFIGNSVIALLLATL
FT                   LSFWTLGIAQGFNRDSILKFTNECLAPTASITLLVGAGGGLNRILVDSGVTNQIVGLAQ
FT                   DFHLSPLLMGWLFAALMRVATGSATVAMTTASGIVAPVAMGLGYPHPELLVLATGAGSV
FT                   IFSHVNDGGFWLIKEYFNMTVTQTFKTWTVLETLISIVAFALTLGLAQVL"
FT   gene            complement(472134..472778)
FT                   /locus_tag="PSPPH_0408"
FT                   /note="PSPPH0408"
FT   CDS_pept        complement(472134..472778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33858"
FT                   /db_xref="GOA:Q48PF8"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF8"
FT                   /protein_id="AAZ33858.1"
FT                   /translation="MKRVITGAEPASFIGWKARANEDWTPTYPTLQNPQKRDLHNCLLQ
FT                   EQNFSCCYCGREIELDSSHIEHFRPQDHYLPLALEYSNLHASCLRETTPGNPLHCGHYK
FT                   SNWFDEDLHISPTEDDCEQRFRYLLTGKIQSTSHTDLPATTMIEKLALDIAYLTKRRQE
FT                   AIMRVFDEQILAGISDTELNILVQGLRSGDANKQLAFGHVVARYAEQLLAS"
FT   gene            complement(472775..474040)
FT                   /locus_tag="PSPPH_0409"
FT                   /note="PSPPH0409"
FT   CDS_pept        complement(472775..474040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35676"
FT                   /db_xref="GOA:Q48PF7"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF7"
FT                   /protein_id="AAZ35676.1"
FT                   /translation="MRLDHLHLQNFRCYEDAHFDFQPGFNLVVGVNGSGKTSLLLGVAG
FT                   CVGNLLGSIGVHQPSIAESDVRFALVKFEDRIRFERSYPLVLTAQGGAFERQEWHVSLE
FT                   RSSLQTNFSALNSLVFSENLISIDVSTHGDLPVFAVYQANRRWLTMSVTAELAAQSKPS
FT                   RLDAYTSWFDAASNLKNFETWFIGKTLERFQRLSRVGSSSVFNDELTWINSAIQCALPD
FT                   AKGIEYDMELRALVVDMDDRKIPFNDLSDGQRGMVALFADIARRICLLNPHMGKDVLSK
FT                   TNGIIVIDELDIHLHPGWQRTIAPALKKAFPNIQFIAASHSPQVIGSLQPGEVILLNNH
FT                   DGSHPRATYGLDSSSILEEVMGVPQREPEIEALLDELFSTLENNELEKARLQLDALKQK
FT                   APDLPEFAGAEALLKRKELIGR"
FT   gene            complement(474118..475374)
FT                   /locus_tag="PSPPH_0410"
FT                   /note="PSPPH0410"
FT   CDS_pept        complement(474118..475374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0410"
FT                   /product="major facilitator superfamily protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34961"
FT                   /db_xref="GOA:Q48PF6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF6"
FT                   /protein_id="AAZ34961.1"
FT                   /translation="MNPAVAPPTTDLNASAKPSGDTYIEKNTPLFKRTALALFAGGFST
FT                   FTLLYCVQPMMPTLSGEFSLSAAQSSLILSVATAMLAIGLLITGPISDRLGRKSVMVMA
FT                   LFCASLFTIASALMPSWEGVLITRAMVGLSLSGLAAVAMTYLSEEIHPTHLGLAMGLYI
FT                   GGSAVGGMSGRLIVGVMIDYVSWHAAMLVVGGLALIAAVVFWKILPESRNFRPRSLHPR
FT                   SLLDGFVVQFKDAGLPLLFLVGFLLMGAFVTLFNYIAYRFLSAPYNLSQAVVGVFSVVY
FT                   LSGIYSSAKIGSLADRLGRRRVLWAVIVMMLAGLLLTLFTPLPLVIAGVLIFTFGFFGA
FT                   HSVASSWVGRRATTARGQAASLYLFCYYAGSSVAGTGGGVFWHYAGWNGIGLFIGVLLL
FT                   IALGVALRLARLQPLGAKV"
FT   gene            475491..476384
FT                   /locus_tag="PSPPH_0411"
FT                   /note="PSPPH0411"
FT   CDS_pept        475491..476384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0411"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33448"
FT                   /db_xref="GOA:Q48PF5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF5"
FT                   /protein_id="AAZ33448.1"
FT                   /translation="MELRHLRYFIAVAEELHFGRAAQALGISQPPLSQQIQTLEQELGT
FT                   RLFDRTNRRVDLSESGRLFLDEARLVLAQVDKATDVARRAQLGEIGELKIGFTSSAPFT
FT                   SSIPQAIFAFRQAYPDVHLTLTEITSQEVAAGLEDKTIQVGIMRPLALPDSLVVFELLN
FT                   EPLVAIMRADHPLAAESENGIYMSALAAEPFVFFPRTYGSGIYAQVLSLARAAGFSPLI
FT                   TQEAGEVMTIIGLVAAGLGVTVLPASYRRMRIDGVVYRNVLDPGATSAVWLVQRKDEQS
FT                   PMAKAFTELLTRNVAR"
FT   gene            complement(476540..477766)
FT                   /locus_tag="PSPPH_0412"
FT                   /note="PSPPH0412"
FT   CDS_pept        complement(476540..477766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0412"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34188"
FT                   /db_xref="GOA:Q48PF4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF4"
FT                   /protein_id="AAZ34188.1"
FT                   /translation="MKRVVVTGMSGITSVGSDWPTIDASFIANRSGIRRMDEWNRFAEL
FT                   NTRLAGPIDDFAVPAHWTRKQLRSMGRVSRLAVAAAEQALIDAGLLNDPLIRDGRMGTA
FT                   CGSSTGSTDEIKAFGNMLINSVAVGLNANSYVRMMPHTTAANISIFFGLTGRLIPTSSA
FT                   CTSGSQGIGYAYESIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTTPRPY
FT                   DSGRDGLVIGEGGGMLVLEELEHAQARGAHIYAEIVGFGSNADGAHSTRPEQATMRRAM
FT                   ELALEDANLPPDAIGYVNGHGTATEQGDIAETLATSSLFGPRMPLSSQKSFLGHTLGAC
FT                   GALESWFSIEMLNSDRYIHTLNLVDIDSQCGELDYIVGEPRRMSNEYVMNNNFAFGGVN
FT                   TSLIFKRWG"
FT   gene            complement(477766..478494)
FT                   /locus_tag="PSPPH_0413"
FT                   /note="PSPPH0413"
FT   CDS_pept        complement(477766..478494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0413"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM TIGR01831"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33516"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF3"
FT                   /protein_id="AAZ33516.1"
FT                   /translation="MTESILVTGSSRGIGRAIALRLAQAGYDLILHCRTGRSEAEAVQA
FT                   EVVALGRQARVLQFDVSDRAACKAILEQDVETHGAYYGVVLNAGLTRDGAFPALSDDDW
FT                   DQVLRTNLDGFYNVLHPLTMPMIRRRAAGRIVCITSVSGLIGNRGQVNYSASKAGLIGA
FT                   AKALAIELGKRKITVNCVAPGLIDTAMLDENVPVDELLKMIPAQRMGTPEEVAGAVNFL
FT                   MSAEASYITRQVLAVNGGLC"
FT   gene            complement(478491..478946)
FT                   /locus_tag="PSPPH_0414"
FT                   /note="PSPPH0414"
FT   CDS_pept        complement(478491..478946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0414"
FT                   /product="thioester dehydrase family protein"
FT                   /note="identified by match to protein family HMM PF07977"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33085"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF2"
FT                   /protein_id="AAZ33085.1"
FT                   /translation="MTEWSLAELIPHAGDMILIDQVLSFDQEQIQTRLTVRADGLFNQP
FT                   DGSLPAWLGIELMAQSVAAYAGCQARTKGEAVKLGFLLGSRKFECNVARIPLGSELHIH
FT                   AVRSLQDDSGMGVFECTLTGPDIKAFARLNVYCPPNTADYLAEGAPA"
FT   gene            complement(478943..480139)
FT                   /locus_tag="PSPPH_0415"
FT                   /note="PSPPH0415"
FT   CDS_pept        complement(478943..480139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0415"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35329"
FT                   /db_xref="GOA:Q48PF1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF1"
FT                   /protein_id="AAZ35329.1"
FT                   /translation="MTAYLNALGLICSLGDSREEVSRRLFAGDSSGMVFESGWVPERAL
FT                   PVGAVKSALPPIPPAMQSQRSRNNQLLLAAALQIEDDIRQAIARYGAGRIGVIVGTSTS
FT                   GIDEASESMASWLRDKTFPDDYDYRQQELGAPANFLAGWLQLSGPAYVISTACTSSARA
FT                   LLSARRALDMGLCDAVLCGGVDSLCRLTLNGFSALEAMSPQLCNPFSSHRNGINIGEAA
FT                   ALFLMTREAGNSHSIALLGAGASCDAHHISAPEPTGRGAQDAMLQALTNARLDAAQIGY
FT                   LNLHGTATPHNDAMESLAVQAVFPNGVPCSSTKPLSGHTLGAAGALEVAFCWLSLAPDN
FT                   SEQALPPHLWDGEADPLLPALQWTLPGSRLAPANARYMMSNSFAFGGNNISLIIGDAP"
FT   gene            complement(480136..480618)
FT                   /locus_tag="PSPPH_0416"
FT                   /note="PSPPH0416"
FT   CDS_pept        complement(480136..480618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0416"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34654"
FT                   /db_xref="GOA:Q48PF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PF0"
FT                   /protein_id="AAZ34654.1"
FT                   /translation="MIRVLFLAFLLLGGCAAQAPLPTTAPTMQLPMQLHIERRQADQRQ
FT                   DWMLVIQRENAGLRWSMMDPLGIPQARQLLINGQWQADGLLPPNPEARELFAAIMFAMT
FT                   SDLEMHGRYPTAYRQGMQRRLDDRWLVEYQSANAYTIRLKDGLSYRVTPLNDESMP"
FT   gene            complement(480615..481262)
FT                   /locus_tag="PSPPH_0417"
FT                   /note="PSPPH0417"
FT   CDS_pept        complement(480615..481262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35787"
FT                   /db_xref="GOA:Q48PE9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE9"
FT                   /protein_id="AAZ35787.1"
FT                   /translation="MLRVAIDDLRSLFASPPPVAPVLLDAGCGQGRSFQHLNKVFQPSR
FT                   LIGVDADPHSLEMSREEARARGVEVELIGSDCAALPVPDASVDLLFCHQTFHHLVEQEQ
FT                   ALAEFYRVLKPGGYLLFAESTEAYIDTWVIRWLFRHPMHVQKSAAQYLQMIRDQGFEFG
FT                   AQHVSYPYLWWSRARDFGLLEALKLQKPKPFGQREETLVNVVACKPLQGGAS"
FT   gene            complement(481346..482593)
FT                   /locus_tag="PSPPH_0418"
FT                   /note="PSPPH0418"
FT   CDS_pept        complement(481346..482593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0418"
FT                   /product="FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36470"
FT                   /db_xref="GOA:Q48PE8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE8"
FT                   /protein_id="AAZ36470.1"
FT                   /translation="MPITDREIRQVVVIGAGPAGSIAAALLKRQGHDVLIIERQLFPRF
FT                   SIGESLLCHCLDFVEEAGMLDAVQAAGFQLKNGAAFARGEQYSDFDFSDTFSNGKPTTF
FT                   QVQRSEFDKLLADQAALQGVDIRYQEEIVSADFDGPQPVLRVKREDGSEYSVQATFVLD
FT                   ASGYGRVLPRLLDLEAPSGFPVRQAVFTHIEDHIESPPFDRQKILVSIHPQHSDVWFWS
FT                   IPFSEGRCSIGVVASAERFKDKPDDLDACLRAFIDETPQLASVLKNAVWDTPARTIGGY
FT                   SVNVTTLHGKGFALLGNAAEFLDPVFSSGVTIAMRSASMAAGVLNRQLQGESVDWETEF
FT                   AVPLKRGVDTFRAYVEGWYDGSFQSVIFYPGSAPDIRRMISAILAGYAWDERNPFVSEP
FT                   KRRLRTLSEICADGGS"
FT   gene            complement(482648..485011)
FT                   /locus_tag="PSPPH_0419"
FT                   /note="PSPPH0419"
FT   CDS_pept        complement(482648..485011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0419"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33707"
FT                   /db_xref="GOA:Q48PE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE7"
FT                   /protein_id="AAZ33707.1"
FT                   /translation="MTSTTERLLPRLFLLILASVLALAGWQWHDRSPLSANLMELVPGT
FT                   DNDELVVSAEKRMQEPLNREMLVLVGHTDRQQAVELARTLAEQWQASGLFEKVQWSLQA
FT                   DLPALRTQLLQGRIAMLPAADRALLIDEPKTFIEQRVQTLFDPFAGFSLVPSQDDWLGL
FT                   TGRIQNGLPKQGSVEADLASGALIASAEGKSWVLLRSRTRTDAFDLHLPGQVADLLAKA
FT                   RGQAQQAGGQLLAASGLLYAADGQKQASREITWVGGGATLGILLLLLLAFRRWSVLLAF
FT                   VPVVVGMLFGAVACVALFGSMHVMTLVLGSSLIGVAVDYPLHYLSKSWSLKPWRSWPAL
FT                   RLTLPGLTLSLITSCIGYLALAWTPFPALTQIAVFSAAGLIGAYLTAVCLLPALLAKVE
FT                   ISPAQWPLKLAQLMLDCRAALLQRISTPILLALLLAFCGGGLWHLTTKNDIRQWVSAPQ
FT                   ALTDEAQAIARITGYQPTSQFFLVRGKDQQQLLDRQSALTQRLDQLISMDKLQGFMALN
FT                   QLLDSPAEQQLTRDALGKLPQHWAPLVQLGVPANALKTELSQLQALPTQDIDQALQGPL
FT                   SEPWRTLWLGASEDAEGDAQVASIVSLRGMNSMALLRVQAIGLEGVQLVDRLGELNEVF
FT                   AHTQISAAELKLASCVLIVLLLIAPFGFGGALRIVALPLLAALCSLASLGWRGQPLTLF
FT                   SLFGLLLVTAISVDYAILMREQIGGAAVSLLGTLLAAVTTWLSFGLLAVSGTPAISNFG
FT                   LSVSLGLAFSFLLAPWASPRKALHSPANAEGPHA"
FT   gene            complement(484995..485609)
FT                   /locus_tag="PSPPH_0420"
FT                   /note="PSPPH0420"
FT   CDS_pept        complement(484995..485609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34403"
FT                   /db_xref="GOA:Q48PE6"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE6"
FT                   /protein_id="AAZ34403.1"
FT                   /translation="MNRPFRALLLLGLLCLSSLAQAFDLQQLSDQLAKPAVVQGSFIQE
FT                   KHLRALPQPLLSKGRFVLARDFGLLWLLETPLKQDYRINASGISRRESVGDVSTWKPVP
FT                   NKNAGAEQNRLFLAVLQGDSSGLQRDFDLQLNGDANAWQLTLTPRSMLLQQVFKQINID
FT                   GGGLVQRIELLETQGDSTVLKMIDSSSASSLTDAQRNDFND"
FT   gene            complement(485606..486031)
FT                   /locus_tag="PSPPH_0421"
FT                   /note="PSPPH0421"
FT   CDS_pept        complement(485606..486031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0421"
FT                   /product="4-hydroxybenzoyl-CoA thioesterase domain protein"
FT                   /note="identified by similarity to SP:Q55116; match to
FT                   protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37878"
FT                   /db_xref="GOA:Q48PE5"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE5"
FT                   /protein_id="AAZ37878.1"
FT                   /translation="MRSKGFLHVDTEIVVPFFDVDMMNIVWHGHYVKYLEVARCALLDH
FT                   IGHNYMQMLESGYGWPVIDLQLRYVRSAVFGQTLNVRASLVEWENRLKINYLITDAHTG
FT                   ERLTRASTVQVAVDSQSREMQLASPQVFIDAVKRALP"
FT   gene            complement(486021..487568)
FT                   /locus_tag="PSPPH_0422"
FT                   /note="PSPPH0422"
FT   CDS_pept        complement(486021..487568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0422"
FT                   /product="phenylalanine ammonia-lyase/histidase family
FT                   protein"
FT                   /note="identified by similarity to SP:P10944; match to
FT                   protein family HMM PF00221"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ32967"
FT                   /db_xref="GOA:Q48PE4"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE4"
FT                   /protein_id="AAZ32967.1"
FT                   /translation="MMIQAPDPIIFGERALCIEDVLALANRQAPSALQGDAEFRARIAR
FT                   GAQFLDSLLNKEGVIYGVTTGYGDSCVVAVPLEHVEALPQHLYTFHGCGLGKLLDAQAT
FT                   RAVLAARLQSLCQGVSGVRVELLERLQAFIDQDVLPLIPEEGSVGASGDLTPLSYVAAT
FT                   LSGERDVMFRGERRPASDVHRELGWTPLVLRPKEALALMNGTAVMTGIACLAFARADYL
FT                   LQLATRITAMNVVALQGNPEHFDERLFAAKPHPGQMQVATWLRQDLAIDAPTAPLHRLQ
FT                   DRYSLRCAPHVLGVLADSLNWLRSFIEIELNSANDNPIIDAEAERVLHGGHFYGGHIAF
FT                   AMDSLKTLVANVADLLDRQLALLVDERYNHGLPSNLSGASAERAMLNHGFKAVQIGTSA
FT                   WTAEALKNTMPASVFSRSTECHNQDKVSMGTIAARDAIRVLELTEQVAAATLIAANQGI
FT                   WLRSKAADARPLPPALAAMHQQLGEDFAPVIEDRALENELRLCLKHIANRRWSLHAQ"
FT   gene            complement(487549..488496)
FT                   /locus_tag="PSPPH_0423"
FT                   /note="PSPPH0423"
FT   CDS_pept        complement(487549..488496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD13959.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36643"
FT                   /db_xref="GOA:Q48PE3"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE3"
FT                   /protein_id="AAZ36643.1"
FT                   /translation="MTIEKSPKEHWASHEERGSFLLMKLTAWGMRVLGRRLLSPVLYGI
FT                   VLYFFAFGRRARHSIWEYQQRLADWSARPELRPSQRSVFGQFMAFAEALLDKLDVWNGK
FT                   LGIEQIEIIDPALLRHNLRGERGQMLVGAHLGNLEVCRALAELGEKVTMNVLVHTKHAE
FT                   RFNRLLGEAGATNLRLIQVSELDPAIMLQLSQRLDEGEWLAIAGDRVALHGGRNVRVDF
FT                   LGKPATFPQGPWLLAGLLKCPVNLFFCLKGPRGYRVILEPFSDAIEWRRSDRAQVIAHW
FT                   ATRYAERLGHYCLEAPQQWFNFYPFWKSDDDSSS"
FT   gene            complement(488493..489227)
FT                   /locus_tag="PSPPH_0424"
FT                   /note="PSPPH0424"
FT   CDS_pept        complement(488493..489227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0424"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37140"
FT                   /db_xref="GOA:Q48PE2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE2"
FT                   /protein_id="AAZ37140.1"
FT                   /translation="MHKPCVIIPVFDHELAVPSVVKAVRNAGLPCILVDDASSPACAAV
FT                   LQQLAQGEGIYLLRLPVNQGKGGAVMAGFREAARLGFSHALQVDADGQHDLNDIPVFLE
FT                   QSRQYPQALICGYPQYDESVPKGRLYARYLTHVWVWINTLSLHIRDSMCGFRLYPLAPV
FT                   LALIDSVQIGRRMDFDSEILVRLSWRGQAMRWLPTRVHYPQDGLSHFRLFHDNALISKM
FT                   HAKLFFGMLMRLPVILWRRWRS"
FT   gene            complement(489220..490911)
FT                   /locus_tag="PSPPH_0425"
FT                   /note="PSPPH0425"
FT   CDS_pept        complement(489220..490911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0425"
FT                   /product="AMP-binding enzyme family protein"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF07977"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35114"
FT                   /db_xref="GOA:Q48PE1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE1"
FT                   /protein_id="AAZ35114.1"
FT                   /translation="MDRMNWLNLEHLLLDALPDRPLTLAPTLDHAQFRDQALSVAAGLQ
FT                   ARGIKNLAVHLEDAADLAVALFGAWRAGVHVLLPADLQGQTRERWANRVDLWLTDLAHD
FT                   THLSDLHAAQLAPAALDLDQCRLSLCTSGSSGEPKLIEKRLRQLANEVCGLEQLWGAQL
FT                   GSACMIGSVATQHIYGLLFRLLWPLCAARPFVRRQLPFAEDLQRASREYPSFAWVASPA
FT                   LLKRMGDNLDWSSLSAVSRVFSSGGALPAEAAQSLLQRLGQWPTEILGSSETGGIAWRQ
FT                   GEQQWQAFDGVELSQNNEGALRISSPYLPPGHVEQTADAVQIGNDGRFELLGRLDRIVK
FT                   LEEKRVSLPLIEQALTTHEWVNEARLGVVQENRASLGALLVLSDAGLLALRNQGRRALT
FT                   EALRQYLRPHCETIALPRRWRLLRQMPFNAQGKLAQMVVQNLLMASRPRQPQVLDQQTV
FT                   DGELHLQLMVPPDLAFFSGHFPKAPVLPGVVQVEWAISLGQRLLNLPTDFAGMEVLKFQ
FT                   QLVRPGDRLKLTLRFDAARSKLHFAFHNSENAPCSSGRIVLEGDHA"
FT   gene            complement(490913..491458)
FT                   /locus_tag="PSPPH_0426"
FT                   /note="PSPPH0426"
FT   CDS_pept        complement(490913..491458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0426"
FT                   /product="intracellular septation protein A, putative"
FT                   /note="identified by similarity to SP:P95745"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35211"
FT                   /db_xref="GOA:Q48PE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PE0"
FT                   /protein_id="AAZ35211.1"
FT                   /translation="MKRLIGLILVLAGVLYPFAVYWGTEHFAPWQFALLLGSLWLARAL
FT                   TGERKPGSLAMALVALVFCVALGVIDSHLMLRWYPVLVSAFMLGLFGSSLIYGPPIVER
FT                   MARINRPELPESGIRYTRKVTQIWCLFFLANGLTAAILTLWAPLSWWTLYTGLVSYGLM
FT                   GLLFAVEWIVRPPSAGGK"
FT   gene            complement(491455..491715)
FT                   /locus_tag="PSPPH_0427"
FT                   /note="PSPPH0427"
FT   CDS_pept        complement(491455..491715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0427"
FT                   /product="acyl carrier protein, putative"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37633"
FT                   /db_xref="GOA:Q48PD9"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PD9"
FT                   /protein_id="AAZ37633.1"
FT                   /translation="MNMQTREDIFEILRAAMVELFELEPERVTLEANLYQDLEIDSIDA
FT                   VDLIDHIKRKTGKKIAAEEFKSVRTVNDVVEAVYKLVNAAE"
FT   gene            complement(491719..491979)
FT                   /locus_tag="PSPPH_0428"
FT                   /note="PSPPH0428"
FT   CDS_pept        complement(491719..491979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0428"
FT                   /product="acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36766"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PD8"
FT                   /protein_id="AAZ36766.1"
FT                   /translation="MSDLHQDIKLLIIDALGLEDITPEDIGNDMTLFGEGLGLDSVDAL
FT                   ELGLAIQKRYGIKIDADAKDTRNHFASVDSLAAFVSARQPA"
FT   gene            complement(491954..492766)
FT                   /locus_tag="PSPPH_0429"
FT                   /note="PSPPH0429"
FT   CDS_pept        complement(491954..492766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0429"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36151"
FT                   /db_xref="GOA:Q48PD7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PD7"
FT                   /protein_id="AAZ36151.1"
FT                   /translation="MELATQELKKRQDAYYWRLLATAFSFALFGLSGLCLRLFVFPILS
FT                   CLPGSVASHQRRARQTISRLFWLFIRIMARMGVLTYEVQGAEKLGRPGQMIIANHPSLI
FT                   DVVFLIGLVRDANCVVKRSLWENPFTRGPVRSTGYISNDGSMDMLDAAVERLQSGQTLI
FT                   IFPEGTRTQPGQPPVFHRGAAAIALRGASMITPVTIKVQPTTLTKAEPWYRIAQRRVHF
FT                   SLRVGADIDPTAFSSLGPPPVASRKLNDYLHDYFTKELASDERSAPGH"
FT   gene            complement(492742..493461)
FT                   /locus_tag="PSPPH_0430"
FT                   /note="PSPPH0430"
FT   CDS_pept        complement(492742..493461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35433"
FT                   /db_xref="GOA:Q48PD6"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PD6"
FT                   /protein_id="AAZ35433.1"
FT                   /translation="MITFNIARWHAWAPGLASADDWLQWSRNPTLLETSDAAPDVSFLP
FT                   AMQRRRLGRMARMAFAVGWPLTEGLGRVPLVFVSRHGETPRTFEILRDLAANEPVSPTQ
FT                   FSLSVHNAVIGLWSIMRGETSEMTALAAAGDGLEYGAFEAAALLAEGAEAVLLVVTEEQ
FT                   PPHAYAQWIDDVPFPYAVGLLLTPGNQWELSLHSDTQGNPQTRWPHALNLLQALHTDQS
FT                   VCLHPWNNRLWNWQRKN"
FT   gene            493770..494549
FT                   /locus_tag="PSPPH_0431"
FT                   /note="PSPPH0431"
FT   CDS_pept        493770..494549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0431"
FT                   /product="ParA family protein"
FT                   /note="identified by similarity to SP:P37522; match to
FT                   protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34588"
FT                   /db_xref="GOA:Q48PD5"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PD5"
FT                   /protein_id="AAZ34588.1"
FT                   /translation="MRRVVFNQKGGVGKSSIACNLAAVSAHEGYRTLLIDLDAQANSTQ
FT                   YLTGLTGQDIPMGIAEFFKNTLSAAPFAKKNHVDIYETPFDNLHVVTATAELADLQPKL
FT                   EAKHKINKLRKLLDELSEDYERIYLDTPPALNFYAVSALIASDRVLIPFDCDSFSRQAL
FT                   YGLMREIEELKEDHNEDLQVEGIIVNQFQPRASLPQQMLDELIAEGLPVLPVYLGASVK
FT                   MRESHQASLPLIHLDPRHKLTQQFVDLHHLLETNAHP"
FT   gene            complement(494771..495163)
FT                   /locus_tag="PSPPH_0432"
FT                   /note="PSPPH0432"
FT   CDS_pept        complement(494771..495163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0432"
FT                   /product="PAAR motif family"
FT                   /note="identified by match to protein family HMM PF05488"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33824"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PD4"
FT                   /protein_id="AAZ33824.1"
FT                   /translation="MSFIVREGDPTTTGGFVLSGSSSEVIDQRRVARMGDPVWCPACTR
FT                   IGFIAQGNPTYVDDLVAVATQGHAVECGCKPGSNRLSASQEHVQADMDAAVTISTELAS
FT                   AARLHSEHLACSLRDGSYTPEVLRPR"
FT   gene            495426..497102
FT                   /gene="mdcA"
FT                   /locus_tag="PSPPH_0433"
FT                   /note="PSPPH0433"
FT   CDS_pept        495426..497102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="PSPPH_0433"
FT                   /product="malonate decarboxylase, alpha subunit"
FT                   /note="identified by match to protein family HMM TIGR01110"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33131"
FT                   /db_xref="GOA:Q48PD3"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PD3"
FT                   /protein_id="AAZ33131.1"
FT                   /translation="MTTTTSPDARWTRRRTEKQRRLEQVRTLADGVVLPTDKIVAALEA
FT                   LLVSGDRVVLEGNNQKQADFLSRALAKVDPGKVHDLHMIMPSVGRAEHLDLFEQGIARK
FT                   LDFSFAGTQSLRISQLLEDGLLEIGAIHTYIELYSRLVVDLIPNVVLAAGFMADRAGNI
FT                   YTGPSTEDTPALIEPAAFSDGIVIVQVNQLVDDVSELPRVDIPASWVDFVVVADKPFYI
FT                   EPLFTRDPRHIKPVHVLMAMMAIRGIYEKHNVQSLNHGIGFNTAAIELILPTYGESLGL
FT                   KGKICRNWTLNPHPTLIPAIESGWVESVHCFGTELGMENYIAARPDVFFTGRDGSLRSN
FT                   RQLCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHATPAW
FT                   LDMRQQNESGPDAYLERGKKLVVQMVETFQEGGKPTFVETLDAVEVAKKSGMPLAPIMI
FT                   YGDDVTHLLTEEGIAYLYKARSLEERQAMIAAVAGVTVIGLRHNPKDTARMRREGLIAL
FT                   PEDLGIRRTDASRELLAAKSIADLVQWSGGLYSPPAKFRSW"
FT   gene            497102..497977
FT                   /gene="citG"
FT                   /locus_tag="PSPPH_0434"
FT                   /note="PSPPH0434"
FT   CDS_pept        497102..497977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="PSPPH_0434"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase"
FT                   /EC_number="2.4.2.52"
FT                   /note="identified by similarity to SP:P77231; match to
FT                   protein family HMM PF01874"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35650"
FT                   /db_xref="GOA:Q48PD2"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PD2"
FT                   /protein_id="AAZ35650.1"
FT                   /translation="MSALQLTPQAASLAERLADLAVDALIAEADLSPKPALVDRRGSGA
FT                   HTDLHLGLMHSSALSLWPTFKLMADAAGQFNTVGQPLREALGRLGRDGEATMLRTTQGV
FT                   NTHRGAIWALGLLVTAAALDARNCAPEAVLARAASLAQIKDRQVLVQGSHGNEVVRRYG
FT                   VMGAREQAQQGFPAVRDFALPQLQRSRAAGSGEQNARLDALLAIMTTLSDTCVLHRAGI
FT                   EGLHTMQRGAQHVLDVGGSASLAGRRALNQLDQQLLALNASPGGAADLLAACLFIDGLE
FT                   PALGRVSRSV"
FT   gene            497979..498278
FT                   /gene="mdcC"
FT                   /locus_tag="PSPPH_0435"
FT                   /note="PSPPH0435"
FT   CDS_pept        497979..498278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="PSPPH_0435"
FT                   /product="malonate decarboxylase, delta subunit"
FT                   /note="identified by similarity to GB:AAB97628.1; match to
FT                   protein family HMM PF06857"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37523"
FT                   /db_xref="GOA:Q48PD1"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PD1"
FT                   /protein_id="AAZ37523.1"
FT                   /translation="METLSFEFPAGQPPKGRALVGVVGSGDLEVLLEPGSPGKLSIQVV
FT                   TSVNGASLRWKHLFERMFDGQTPPALSIDIHDFGATPGVVRLRLEQGFEEIGHD"
FT   gene            498271..499122
FT                   /gene="mdcD"
FT                   /locus_tag="PSPPH_0436"
FT                   /note="PSPPH0436"
FT   CDS_pept        498271..499122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="PSPPH_0436"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /note="identified by similarity to GB:BAA36207.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36827"
FT                   /db_xref="GOA:Q48PD0"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PD0"
FT                   /protein_id="AAZ36827.1"
FT                   /translation="MTDNARLLSQHSFIELGARQRARALLDADSFRELLGPFDRVMSPW
FT                   LARQGVVPQADDGVVVAKGTVDGRPVVIAAIEGSFQGGSMGEVGGAKMAGALELAAEDN
FT                   RNGIPTAAIVLLETGGVRLQEANLGLAAIAEIHAAMVDLRQYQPVIGVVAGSVGCFGGM
FT                   SIAAGLCSYLLVTQEARLGLNGPQVIEQEAGIEEYDSRDRPFIWSLTGGQQRFASDLVD
FT                   GFAADDVADIRQQVSGWLKQGVPAAYRSSQYELFLQRLTSLHTEAQIDPQSVRTLYQGA
FT                   RS"
FT   gene            499119..499919
FT                   /gene="mdcE"
FT                   /locus_tag="PSPPH_0437"
FT                   /note="PSPPH0437"
FT   CDS_pept        499119..499919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="PSPPH_0437"
FT                   /product="malonate decarboxylase, gamma subunit"
FT                   /note="identified by match to protein family HMM PF06833"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34162"
FT                   /db_xref="GOA:Q48PC9"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC9"
FT                   /protein_id="AAZ34162.1"
FT                   /translation="MSYSQRGLHWFNALSAGATQVDGLPASLKVADGLLGDQPVRFVAV
FT                   VADTGNRFPRARQGEVGLLEGWGLAKAVDDAIEQDRDRAEKRALIAIVDVPSQAYGRRE
FT                   EALGIHQALAGAVDSYARARLAGHAVIGLLVGKAMSGAFLAHGYQANRLIALRDPGVMV
FT                   HAMGKASAARVTLRSVEDLEKLAASIPPMAYDIDSYASLGLLWETLSVSQIEQPTANDL
FT                   TQVRNVLSSAINDVQASGVDLSSRLGASNRAASATVRQLLRAQW"
FT   gene            499913..500551
FT                   /locus_tag="PSPPH_0438"
FT                   /note="PSPPH0438"
FT   CDS_pept        499913..500551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0438"
FT                   /product="Phosphoribosyl-dephospho-CoA transferase
FT                   (Holo-ACPsynthase)"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33447"
FT                   /db_xref="GOA:Q48PC8"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC8"
FT                   /protein_id="AAZ33447.1"
FT                   /translation="MVIDSACAVLPHDLLWGMPLSALPDDAPKWAVETVLAGQPVVVRR
FT                   QAMPVGQVAVGLRGYGREQRYAASMLLTDVYRRVTPEQLVLCPVENIQDWPALRALRQV
FT                   RPVMDALELVWGVGGSAGFELASGIAALNQDSDLDLILRTPEPLSRSCAAELVEALEIS
FT                   VCRVDVQLQLDHGAVALREWARPAGRVLLKTAAGARLVADPWHLIGACA"
FT   gene            500548..501483
FT                   /gene="mdcH"
FT                   /locus_tag="PSPPH_0439"
FT                   /note="PSPPH0439"
FT   CDS_pept        500548..501483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcH"
FT                   /locus_tag="PSPPH_0439"
FT                   /product="malonate decarboxylase, epsilon subunit"
FT                   /note="identified by similarity to GB:BAA36210.1; match to
FT                   protein family HMM PF00698"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35978"
FT                   /db_xref="GOA:Q48PC7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC7"
FT                   /protein_id="AAZ35978.1"
FT                   /translation="MSSLWVFPGQGAQQAGMLHQLPDDPVVHDCLQDAADALGEDVLAL
FT                   DSTQALQATRAVQLCLLIAGVACARLLQARDCVPDYVAGLSIGAYPAAVISGALAFDDA
FT                   VRLVALRGELMQGAWPQGYGMTALVGLDQMQVEALIAQVHSAKTPVFLANINADNQMVI
FT                   SGSAEAMHQVGQLAKAAGAAAVKRLAVSVPSHCALLDAPAQQLAEAFSRVALTAPRIRY
FT                   LSGSTARPVRNAEKLRDDLAFNMCRVIDWRSTVETAWERGVRLHIELPPGAVLTGLARK
FT                   VFQQGTALAFQAARLDSLIALSREEGRRTP"
FT   gene            501553..501981
FT                   /gene="madL"
FT                   /locus_tag="PSPPH_0440"
FT                   /note="PSPPH0440"
FT   CDS_pept        501553..501981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madL"
FT                   /locus_tag="PSPPH_0440"
FT                   /product="malonate transporter, MadL subunit"
FT                   /note="identified by match to protein family HMM PF03817"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35299"
FT                   /db_xref="GOA:Q48PC6"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC6"
FT                   /protein_id="AAZ35299.1"
FT                   /translation="MIIYGVALLAICTLAGVILGDMLGVLLGVKSNVGGVGIAMILLIC
FT                   ARLWMQKHGGMTKDCEMGVGFWGALYIPVVVAMAAQQNVVTALKGGPVAVLAAVGSVVL
FT                   CACTIAVISRTNRGEPLPKEEPLLTPVIKPEIAPVGGR"
FT   gene            501983..502747
FT                   /gene="madM"
FT                   /locus_tag="PSPPH_0441"
FT                   /note="PSPPH0441"
FT   CDS_pept        501983..502747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madM"
FT                   /locus_tag="PSPPH_0441"
FT                   /product="malonate transporter, MadM subunit"
FT                   /note="identified by match to protein family HMM PF03818;
FT                   match to protein family HMM TIGR00808"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37063"
FT                   /db_xref="GOA:Q48PC5"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC5"
FT                   /protein_id="AAZ37063.1"
FT                   /translation="MWDLIEKGLEHNGLITAFAFVGIIMWVSVVLSKRLTFGRVHGSAI
FT                   AIVIGLILAWIGGTLTGGQKGLADMALFSGIGLMGGAMLRDFAIVATAFEVQATEARKA
FT                   GLIGAIALLLGTILPFIVGASIAWVFGYRDAISMTTIGAGAVTYIVGPVTGAALGATSD
FT                   VMALSIATGLIKAILVMVGTPMAARWMGLDNPRSAMVFGGLAGTVSGVTAGLAATDRRL
FT                   VPYGALTATFHTGLGCLLGPSVLYFIVRAIVG"
FT   gene            complement(502758..503684)
FT                   /locus_tag="PSPPH_0442"
FT                   /note="PSPPH0442"
FT   CDS_pept        complement(502758..503684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0442"
FT                   /product="malonate utilization transcriptional regulator"
FT                   /note="identified by similarity to GB:AAC45461.1; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35754"
FT                   /db_xref="GOA:Q48PC4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037400"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC4"
FT                   /protein_id="AAZ35754.1"
FT                   /translation="MQIDDELTLKKLEIFLAFMRTGNLARAAEELQTSNVSVHRAIHSL
FT                   ESALRCPLFKHEGRNLTPLESAYVLEKRAQKLVQDVLATVELTRQAAGFSAARFRLGAL
FT                   YSLTVKTVPQLIMGLKIRRSELNIDLILGSNMDLLYKLKNMEVDAMLVSLDESTHDPDC
FT                   EQLALFSDDIFLAVPTDSPFAEHSEVDLSDLREATFITLTQGFATHRDGIRVFQQAGFE
FT                   PKVAMQVNDIFTLLSMVSSGVGYALLPGRIAAVYENRVRLIPLQSRYRMQQHIGMVFLK
FT                   SRERDPNLLALLAECRMYANRLLEQAT"
FT   gene            503815..504453
FT                   /gene="hlyIII"
FT                   /locus_tag="PSPPH_0443"
FT                   /note="PSPPH0443"
FT   CDS_pept        503815..504453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyIII"
FT                   /locus_tag="PSPPH_0443"
FT                   /product="hemolysin III"
FT                   /note="identified by similarity to SP:P54176; match to
FT                   protein family HMM PF03006; match to protein family HMM
FT                   TIGR01065"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33092"
FT                   /db_xref="GOA:Q48PC3"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC3"
FT                   /protein_id="AAZ33092.1"
FT                   /translation="MPQEGIERMYYGEKFNAWSHLVGAVLAGVGAIWLLVMASLHGDVW
FT                   KVVSIAIYGACLVTLYSVSTIYHSVKGRSKSIMQKVDHFSIYLMIAGSYTPFCLATLRG
FT                   AWGWTLFGIVWGLALIGIVQEIKPRSEARIMSIVIYAVMGWIVLVAVKPLIAALGLTGF
FT                   IWLAGGGVLYTVGILFFAYDQIRHFHGIWHLFVIGGSLMHFVAICFYVL"
FT   gene            complement(504475..505194)
FT                   /locus_tag="PSPPH_0444"
FT                   /note="PSPPH0444"
FT   CDS_pept        complement(504475..505194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0444"
FT                   /product="uncharacterized conserved protein"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046; ortholog of YQEU
FT                   Bacillus subtilis CAC1285"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37505"
FT                   /db_xref="GOA:Q48PC2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC2"
FT                   /protein_id="AAZ37505.1"
FT                   /translation="MRLSRFFTEAPLSLGEHELPEAQTHYISRVLRMTEGDALQLFDGS
FT                   GQEFRGTLLEVGKKRVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVS
FT                   EITPIVSERCEVRLKDERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTE
FT                   ADLKLVLHPVAEPLTSHDKPASLAFLIGPEGGLNDAEVDQAQDAGFHAARLGPRVLRTE
FT                   TAPVVALSVAQQLWGDF"
FT   gene            complement(505337..506743)
FT                   /gene="bioA1"
FT                   /locus_tag="PSPPH_0445"
FT                   /note="PSPPH0445"
FT   CDS_pept        complement(505337..506743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA1"
FT                   /locus_tag="PSPPH_0445"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00508"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36933"
FT                   /db_xref="GOA:Q48PC1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC1"
FT                   /protein_id="AAZ36933.1"
FT                   /translation="MGLNDQWMQRDLKVLWHPCTQMKDHENLPLIPIKRGEGVWLEDFE
FT                   GKRYLDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQPVIELSERLVKLTP
FT                   EGLNRCFYADNGSSCIEVALKMSFHYWLNRGQPDKKRFVTLTNSYHGETMAAMSVGDVP
FT                   LFTETYKALLLDTIKVPSPDCYHRPEGMSWEEHSRNMFAAMEQTLAEHHASVAAVIVEP
FT                   LIQGAGGMRMYHPVYLKLLRDACDRYGVHLIHDEIAVGFGRTGTMFACEQAGIRPDFLC
FT                   LSKALTGGYLPLAACLTTDDVYDAFYDDYPTLRAFLHSHSYTGNPLACAAALATLDIFE
FT                   QDNVIENNKALAQRMATATAHLVDHPHVAEVRQTGMAIAIEMVQDKATKTAYPWQERRG
FT                   MKVFQHALERGALLRPLGSVVYFLPPYVITPEQIDFLAEVATEGIDIATRSSVSVAVRE
FT                   NFHPDFRDPG"
FT   gene            506953..508812
FT                   /locus_tag="PSPPH_0446"
FT                   /note="PSPPH0446"
FT   CDS_pept        506953..508812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0446"
FT                   /product="amine oxidase, flavin-containing"
FT                   /note="identified by match to protein family HMM PF01593"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33982"
FT                   /db_xref="GOA:Q48PC0"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PC0"
FT                   /protein_id="AAZ33982.1"
FT                   /translation="MLSGWLRACALIVAGLVSVSTLADEKQRTAIVVGGGLAGLTAAYE
FT                   LQAKGWQVTLLEAKPSLGGRSGLATSEWIGNTKAQPVLNRYLDSFKLPTVPAPEFVRTP
FT                   SYLIDGVYFTQADLAVKQPATAEAIKRYNDTLDNLARSVDDPENPASNSTLFALDQINV
FT                   ANWLDRLNLPATARQLINQQIRTRYDEPSRLSLLYLAQQSRVYRSVDERDLRAARLPGG
FT                   SAVLTQAFVKQLKTVKTNSPVTAVVQEKDKVTVKAGATSYTADYVVMAVPLRSLGKIQM
FT                   TPALDAQHMGAIKSTNYGWRDQIMLKFKTPVWDSKARMSGEVFSNTGLGMLWVEPALKG
FT                   GANVVINLSGDNARIMQAFGDKQMVDQVLIRLHAFYPEARGAYTGYEIRRYSVDPSTGG
FT                   SYLAFGPGQISKYWRLWERPILRVAFAGEHTDTLYPGTLEGALRSGQRAAGQVQDLAAG
FT                   KSFEPVKVAPPKAPAPASQKSEGNFFSNLFGGSSDKPAEPAKPQADKPGFFSRLFGSDE
FT                   APAPAPAPVEKAVEPAPAPAPAAAPAPVVAPVVQPAKPPVKAEPAKKPATKAEPAKKPQ
FT                   SKEAAKKEAAKKEAAKKEAAKKAQSKPAPAKTPAETAPADVNN"
FT   gene            509169..509717
FT                   /locus_tag="PSPPH_0447"
FT                   /note="PSPPH0447"
FT   CDS_pept        509169..509717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0447"
FT                   /product="cytochrome b561 family protein"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37624"
FT                   /db_xref="GOA:Q48PB9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PB9"
FT                   /protein_id="AAZ37624.1"
FT                   /translation="MQLRNSSSRYGLVSMVLHWGVAAVVFGMFALGLWMVGLDYYDTWR
FT                   KAGPDLHKSIGITLFAIMLIRVVWRLLSPPPPPLTSYSKLTRIGAAFGHLFLYVALFAV
FT                   MFAGYLISTADGVGIPVFGLFDVPALVSGLPDQAETAGWIHLYLAWVIVIFAGLHGLAA
FT                   LKHHFIDRDVTLKRMLGRN"
FT   gene            509745..510323
FT                   /locus_tag="PSPPH_0448"
FT                   /note="PSPPH0448"
FT   CDS_pept        509745..510323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0448"
FT                   /product="Protein yceI precursor"
FT                   /note="identified by match to protein family HMM PF04264"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35361"
FT                   /db_xref="GOA:Q48PB8"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PB8"
FT                   /protein_id="AAZ35361.1"
FT                   /translation="MLKKSLAALALGTALLSAGQAMAADYVIDKEGQHAFVDFKISHLG
FT                   YSFIHGTFKDWDGTFSFDAAKPEASKINVELKTASLFTNHAERDKHISSKDFLDVAKYP
FT                   EAKFVSTAVKSTGEKTADVTGDLTLHGVTKPIVIKATFNGEGKDPWGGYRAGFNGTSTL
FT                   NLNDFGIKGPGPTSQTLDLDISFEGVQKK"
FT   gene            complement(510601..512478)
FT                   /locus_tag="PSPPH_0449"
FT                   /note="PSPPH0449"
FT   CDS_pept        complement(510601..512478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0449"
FT                   /product="ATP-dependent RNA helicase RhlE, putative"
FT                   /note="identified by similarity to SP:P25888; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36206"
FT                   /db_xref="GOA:Q48PB7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PB7"
FT                   /protein_id="AAZ36206.1"
FT                   /translation="MSFASLGLSEALVRAIEAAGYTQPTPVQQRAIPAVLQGRDLMVAA
FT                   QTGTGKTGGFALPILERLFPNGVPDKSQRHGPRQPRVLVLTPTRELAAQVHESFKLYAR
FT                   DLKFVSACIFGGVGMNPQVQAMSRGVDVLVACPGRLLDLAGQGSVDLSHVEILVLDEAD
FT                   RMLDMGFVHDVKKVLARLPAKRQNLLFSATFSNDITSLAGKLLHNPERIEVTPPNTTVE
FT                   RIEQRVFRLAANHKRSLLAHLITVGAWEQVLVFTRTKHGANRLAEYLDKHGLAAVAIHG
FT                   NKSQNARTKALADFKAGDVRIMVATDIAARGLDIDQLPHVVNFELPNVDEDYVHRIGRT
FT                   GRAGRSGEAISLVAPDEEKLLKSIERMTKQKIADGDLMGFDITAVEAEKPEVRERPDVR
FT                   NSRGARPAGDKNNGGRRDKGKDKGKEKPAAAAATGERPARQPREKKPREGTPRSEQRAS
FT                   QPSIPRPAADRAPDEFRDDEVDNFGNRADYVSPYQGKGQNRGRRPAAAPGAAPAAGGAA
FT                   RPANSGRPAGGARNGSGTGAPKRNGSGSSAPRSRDGQPRGRRPAREDQPLPREGQEPAV
FT                   RAPRDGQPQPKIVHKESKIDRFPSAEQLDQLPTRPRGEKPALLTRNRDS"
FT   gene            complement(512790..513665)
FT                   /gene="metF"
FT                   /locus_tag="PSPPH_0450"
FT                   /note="PSPPH0450"
FT   CDS_pept        complement(512790..513665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="PSPPH_0450"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="identified by match to protein family HMM PF02219;
FT                   match to protein family HMM TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33925"
FT                   /db_xref="GOA:Q48PB6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PB6"
FT                   /protein_id="AAZ33925.1"
FT                   /translation="MFVSISRSASMSQERRFSFEFFPTKTDAGHEKLLTVARQLATYNP
FT                   DFFSCTYGAGGSTRDRTLNTVLQLENEIKVPAAPHLSCVGDSKDDLRNLLAQYKDAGIK
FT                   RIVALRGDLPSGMGMASGELRHANDLVSFIRQESGSHFHIEVAAYPEMHPQARNFEDDL
FT                   KHFVNKANAGADSAITQYFFNADSYFNFVERVEKMGVSIPIVPGIMPITNYSKLARFSD
FT                   ACGAEIPRWIRKQLEAYGDDVQSIQAFGEEVITQMCERLLQGGTPGLHFYTLNQAEPSL
FT                   AVWNNLQLPR"
FT   gene            complement(513828..515237)
FT                   /gene="ahcY"
FT                   /locus_tag="PSPPH_0451"
FT                   /note="PSPPH0451"
FT   CDS_pept        complement(513828..515237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="PSPPH_0451"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by match to protein family HMM PF00670;
FT                   match to protein family HMM PF05221; match to protein
FT                   family HMM TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33540"
FT                   /db_xref="GOA:Q48PB5"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PB5"
FT                   /protein_id="AAZ33540.1"
FT                   /translation="MSAVITPAEFNDYKVADISLAAWGRRETIIAESEMPALMGLRRKY
FT                   AGDQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIP
FT                   VFAWKGETEEEYEWCIEQTILKDGQPWDANMILDDGGDLTVIIHKKYPAMLDKIHGVTE
FT                   ETTTGVHRLLDMLAKGELKIPAINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGK
FT                   QALVIGYGDVGKGSAQSLRQEGMIVKVTEVDPICAMQACMDGFELVSPFIDGENDGTEA
FT                   SIDKALLGKIDLIVTTTGNVNVCDSNMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWE
FT                   EVKPQVHKIHRTGPGSFDAQNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQI
FT                   FLFEQKYADLAPAKKAERLTVEVLPKKLDEEVALEMVRGFGGVVTKLTKTQADYIGVTV
FT                   EGPFKPHAYRY"
FT   gene            515592..515987
FT                   /locus_tag="PSPPH_0452"
FT                   /note="PSPPH0452"
FT   CDS_pept        515592..515987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0452"
FT                   /product="4-hydroxybenzoyl-CoA thioesterase domain protein"
FT                   /EC_number="3.1.2.-"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33628"
FT                   /db_xref="GOA:Q48PB4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PB4"
FT                   /protein_id="AAZ33628.1"
FT                   /translation="MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQR
FT                   VVTKYISEINFVSASRQGDIIELGITATEFGRTSITLKCQVRNKITRKSILTVDKIVFV
FT                   NLDEDGQPAPHGRTEIRYIKDQFDVED"
FT   gene            complement(516142..516927)
FT                   /locus_tag="PSPPH_0453"
FT                   /note="PSPPH0453"
FT   CDS_pept        complement(516142..516927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0453"
FT                   /product="hydroxypyruvate isomerase, putative"
FT                   /note="identified by similarity to SP:P30147"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33230"
FT                   /db_xref="GOA:Q48PB3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PB3"
FT                   /protein_id="AAZ33230.1"
FT                   /translation="MPRFAANLSMLYPQHDFLERFAAAAADGFGAVEYLFPYAYSPQEL
FT                   KQRLSDNGLVQALFNAPPGDWEAGERGIATLPGREAEFRSGIERALEYAQVLGNDRVHL
FT                   MAGLLADESLRERHQAVYLENLAFAAEQAKGAGVTILIEPINTRDMPGFFLNRQDQAQE
FT                   ICKLVGADNLKVQFDCYHCQIVEGDLTSKLRRDFAGIGHIQIAGVPDRHEPNLGELNYE
FT                   HLFNVIDELGYSGWIGCEYRPKGDTSVGLAWLRKLQAKS"
FT   gene            complement(516950..518407)
FT                   /locus_tag="PSPPH_0454"
FT                   /note="PSPPH0454"
FT   CDS_pept        complement(516950..518407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0454"
FT                   /product="gluconate transporter family protein"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33770"
FT                   /db_xref="GOA:Q48PB2"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PB2"
FT                   /protein_id="AAZ33770.1"
FT                   /translation="MTPLMLMIVAGAGIALLLFLVLKYKFQPFVALMLVSIIVALVAGV
FT                   KPADLVTTIEGGMGKTLGHIAIIIALGAMIGRIIDLSGGAEALAKTLINRFGNKRTPLA
FT                   LTVAGFMVGIPVFFEVGVIILMPLAYGVARAARKPLLIFALPMCAALLAVHAFLPPHPG
FT                   AVAAASQLGADLGRVLMLGIPIVAVLCMIGYFVAGRMTRKTYPMTDDIRAEVYGPHVTN
FT                   EDLEAWARNDYSAVREATETRAMGIEESASSLASKLPPAPAPGFGLIIALILLPIVLIL
FT                   MGTLATTMLPATSTLRAVLTVLGAPLVALLIDTLLCAWLLGSRRGWSRTQVSDVIGSAL
FT                   PGVAMVILIAGAGGVFGKVLVDTGIGAVVSEALRNTGLPVLALGFLLTLLLRAVQGSTT
FT                   VALVTTAGILSPLIATLDLSANHLALLCLAMGGGGLAMSHINDAGYWMFTKLAGLNVAD
FT                   GLRTWTVLVTLLGTLGFVITLLLWPFV"
FT   gene            complement(518543..519181)
FT                   /gene="fucA"
FT                   /locus_tag="PSPPH_0455"
FT                   /note="PSPPH0455"
FT   CDS_pept        complement(518543..519181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucA"
FT                   /locus_tag="PSPPH_0455"
FT                   /product="class II aldolase/adducin domain protein"
FT                   /EC_number="4.1.2.17"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33247"
FT                   /db_xref="GOA:Q48PB1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PB1"
FT                   /protein_id="AAZ33247.1"
FT                   /translation="MIDENALRQEICDVGRLLYGRGYTVGSAGNISARLDDGWLITPTD
FT                   ACLGRMDPADIAKVNLAGEWVSGSKPSKTLALHREVYDRNPEVGGVVHTHSTHLVALTL
FT                   AGVWREDDILPPLTPYQVMKVGHIPLIPYERPGSPKVAERVAELANSVRGVMLERLGPV
FT                   VWESSVAKACYALEELEETARLWLMSNPKPAPLDPAALEELRQVFGAKW"
FT   gene            complement(519181..520470)
FT                   /locus_tag="PSPPH_0456"
FT                   /note="PSPPH0456"
FT   CDS_pept        complement(519181..520470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0456"
FT                   /product="HopAN1 protein"
FT                   /note="identified by match to protein family HMM PF07005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35071"
FT                   /db_xref="GOA:Q48PB0"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PB0"
FT                   /protein_id="AAZ35071.1"
FT                   /translation="MSLNNARPLLGCIADDFTGATDLANMLVRGGMRTVQSIGIPSAEM
FT                   AAGLDADAIVIALKSRTTPSADAVAESLAALEWLRERGCEQIFFKYCSTFDSTAAGNIG
FT                   QVSEALLEQLDSDFTLACPAFPENGRTIFRGHLFVQDQLLSESGMQNHPLTPMTDANLV
FT                   RVLQAQTRHKVGLLRYDSIAQGVEGVRNRIAELRAEGVSMAIADALSDADLYTLGEACA
FT                   DLPLLTGGSGLALGLPGNFRKAGKLRDIDAAKQVAISGGEVVLAGSASVATNGQVAAWL
FT                   EDNRPALRINPLDLAAGKPVVEQALTFARDAGQTVLIYATSTPDEVKAVQKELGVERSG
FT                   AMVEAALGEIAKGLLNAGVRRFVVAGGETSGAVVQALGVQLLQIGAQIDPGVPATVSSG
FT                   AQPLALALKSGNFGARDFFAKALKQLAGAA"
FT   gene            complement(520481..521386)
FT                   /locus_tag="PSPPH_0457"
FT                   /note="PSPPH0457"
FT   CDS_pept        complement(520481..521386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0457"
FT                   /product="3-hydroxyisobutyrate dehydrogenase family
FT                   protein"
FT                   /note="identified by similarity to SP:Q46888; match to
FT                   protein family HMM PF03446"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34229"
FT                   /db_xref="GOA:Q48PA9"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PA9"
FT                   /protein_id="AAZ34229.1"
FT                   /translation="MTNKNVGVIGLGAMGLGIARSLLRSGFTVHACDVRSSVTEAFAQE
FT                   GGVACQSPASMAAACDVIITVVVNAEQTETVLFGENGAIAALRPGCLVIGCATVAPTFA
FT                   VELGERLAAQNLLYLDAPISGGAAKAAAGQMTMMTSGPAESYAKAEAILNGMAGKVYRL
FT                   GDVHGLGSKVKIINQLLAGVHIAASAEAMALGLREGVDADALYEVITNSAGNSWMFENR
FT                   VPHILNADYTPLSAVDIFVKDLGLVLDTARSSKFPLPLSATAHQMFMQASSTGFGREDD
FT                   SAVIKIFPGIELPKAKPEKA"
FT   gene            complement(521614..522069)
FT                   /locus_tag="PSPPH_0458"
FT                   /note="PSPPH0458"
FT   CDS_pept        complement(521614..522069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0458"
FT                   /product="Uncharacterized protein family (UPF0153) family"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36716"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PA8"
FT                   /protein_id="AAZ36716.1"
FT                   /translation="MKPTLIAAAELDRIDTWAKYSSHMCGGCVSSCCTLPVEVKIKDLI
FT                   RIGIVDEFERGDPAKNIAKRLQKEGIVERYNQKSEIFTLQRMSNNDCLYLDRKSRLCTI
FT                   YDKRPDTCRNHPKIGPRPGYCAYKPKEVVRQESGSLRNATSAPVPKF"
FT   gene            complement(522244..523452)
FT                   /locus_tag="PSPPH_0459"
FT                   /note="PSPPH0459"
FT   CDS_pept        complement(522244..523452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0459"
FT                   /product="aminotransferase, classes I and II"
FT                   /note="identified by similarity to SP:P77434; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36040"
FT                   /db_xref="GOA:Q48PA7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PA7"
FT                   /protein_id="AAZ36040.1"
FT                   /translation="MADQGSPRRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGN
FT                   PDGATPPHIVEKLITVAQREDTHGYSTSRGIPRLRRAISNWYKKRYEVDIDPESEAIVT
FT                   IGSKEGLAHLMLATLDQGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVPGVDFFDELEK
FT                   AIRGSIPKPKMMILGFPSNPTAQCVELDFFERVVALAKQYDVLVVHDLAYADIVYDGWK
FT                   APSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVNALARIKSYHDYGTFTPL
FT                   QVAAIAALEGDQQCVLDIAEQYRQRRNVLVKGLHELGWMVENPKASMYVWAKIPEAYAH
FT                   LGSLEFAKKLLAEAKVCVSPGIGFGEYGDDHVRFALIENQDRIRQAVRGIRSMFRADDK
FT                   LKS"
FT   regulatory      523477..523509
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans (PMID: 17073302)"
FT                   /regulatory_class="promoter"
FT   gene            523790..525637
FT                   /gene="ilvD"
FT                   /locus_tag="PSPPH_0460"
FT                   /note="PSPPH0460"
FT   CDS_pept        523790..525637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="PSPPH_0460"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37903"
FT                   /db_xref="GOA:Q48PA6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PA6"
FT                   /protein_id="AAZ37903.1"
FT                   /translation="MPDYRSKTSTHGRNMAGARALWRATGMKDEDFKKPIIAIANSFTQ
FT                   FVPGHVHLKDMGQLVAREVERAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMVNAHCADAIVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLASHGLDLV
FT                   DAMVIAADSTASDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLALPGNGSALAT
FT                   HSDREQLFLQAGRTIVDLCRQYYKENDDSVLPRNIANFKAFENAMTLDIAMGGSTNTIL
FT                   HLLAAAQEAEIDFDLRHIDRLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSILGELARG
FT                   GLLHTDLPTVHSKTLAEGIAKWDITQTDDEAVHTFFKAGPAGIPTQTAFSQSTRWDSLD
FT                   DDRENGCIRSVEHAYSQEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGNAKIFESQDS
FT                   AVRGILADEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKDCALLTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLVRDGDKVLIDIPNRSINLLIDDAEMAERRTEQDKKGWK
FT                   PVESRPRKVTTALKAYALLATSADKGAVRDKALLDKLVP"
FT   gene            complement(525707..526030)
FT                   /locus_tag="PSPPH_0461"
FT                   /note="PSPPH0461"
FT   CDS_pept        complement(525707..526030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37018"
FT                   /db_xref="GOA:Q48PA5"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PA5"
FT                   /protein_id="AAZ37018.1"
FT                   /translation="MDFVLDLLATVSRWSRSNLSEIALALVGCLLVLFGSDIKGWLEQR
FT                   ISGITGALRIPLIALLCAVGSGAALIYATPWVVRGLSQFNNYSLAPVLLVVLVLIGVIA
FT                   DRK"
FT   gene            complement(526040..527254)
FT                   /locus_tag="PSPPH_0462"
FT                   /note="PSPPH0462"
FT   CDS_pept        complement(526040..527254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0462"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase, putative"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00539"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34767"
FT                   /db_xref="GOA:Q48PA4"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PA4"
FT                   /protein_id="AAZ34767.1"
FT                   /translation="MTHDSPAQPLFLGESGFSSESPRPALPHLPPLSLYIHIPWCVRKC
FT                   PYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFFGGGTPSLFSADALGR
FT                   LLKGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIGIQSFQESKLKALGR
FT                   IHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAIALAPTHLSWYQLT
FT                   LEPNTVFWNQPPVLPEDDILWDIQETGQQLLATHGYAQYEVSAYAQPGKPARHNLNYWA
FT                   FGDFIGIGAGAHSKLSHPDGRIMRTWKTRLPKDYLNPDKPFQAGAKLLPLDELPFEFLM
FT                   NALRLTNGVDAALFRKRTGLSLDSLTEARRQAEQKGLLHQDPTRLIATPQGQLFLNDLL
FT                   QYFLI"
FT   regulatory      complement(526485..526517)
FT                   /locus_tag="PSPPH_0462"
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans (PMID: 17073302)"
FT                   /regulatory_class="promoter"
FT   gene            complement(527251..527844)
FT                   /gene="rdgB"
FT                   /locus_tag="PSPPH_0463"
FT                   /note="PSPPH0463"
FT   CDS_pept        complement(527251..527844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="PSPPH_0463"
FT                   /product="non-canonical purine NTP pyrophosphatase"
FT                   /note="identified by similarity to SP:Q8XCU5; match to
FT                   protein family HMM PF01725; match to protein family HMM
FT                   TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35297"
FT                   /db_xref="GOA:Q48PA3"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PA3"
FT                   /protein_id="AAZ35297.1"
FT                   /translation="MNLTQLVLASHNGGKLKELQAMLGGSVTLRSVSEFSLVEPEETGL
FT                   SFVENAILKARNASRLSGLPALADDSGLAVDFLGGAPGIYSARYAEGKGDAANNAKLLE
FT                   ALKDVPDEQRGAQFVCVLALVRHADDPLPILCEGLWHGRILHAASGEHGFGYDPLFWVP
FT                   ERNCSSAELGPSEKNQLSHRARAMVLLRQRLGLQ"
FT   gene            complement(527878..528498)
FT                   /gene="metW"
FT                   /locus_tag="PSPPH_0464"
FT                   /note="PSPPH0464"
FT   CDS_pept        complement(527878..528498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="PSPPH_0464"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="identified by match to protein family HMM PF07021;
FT                   match to protein family HMM TIGR02081"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34299"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PA2"
FT                   /protein_id="AAZ34299.1"
FT                   /translation="MRADLEIIQEWIPAGSRVLDLGCGDGELLTWLRDHKQVTGYGLEN
FT                   DAANIAECVAKGINVIEQDLDKGLGNFASNSFDVVVMTQALQAVHYPDRILDEMLRVGR
FT                   QCIITFPNFGHWRCRWYLASKGRMPVSEFLPYTWYNTPNIHFCTFGDFEELCRERDAKV
FT                   LDRLAVDQQHRHGWASKLWPNLLGEIGIYRVTSPGLTDHKIAV"
FT   gene            complement(528506..529645)
FT                   /gene="metX"
FT                   /locus_tag="PSPPH_0465"
FT                   /note="PSPPH0465"
FT   CDS_pept        complement(528506..529645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="PSPPH_0465"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34858"
FT                   /db_xref="GOA:Q48PA1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48PA1"
FT                   /protein_id="AAZ34858.1"
FT                   /translation="MPTVFPHDSVGLVTPQTAHFSEPLALACGRSLPAYDLIYETYGQL
FT                   NAARSNAVLICHALSGHHHAAGFHSADDRKPGWWDSCIGPGKPIDTNTFFVVSLNNLGG
FT                   CNGSTGPSSIDPDTGKPLGANFPVVTVEDWVNSQARLADLLGIDTWAAVIGGSLGGMQA
FT                   LQWTISYPDRVRHCLAIASAPKLSAQNIAFNEVARQAILTDPEFHGGSFQERGVIPKRG
FT                   LMLARMVGHITYLSDDSMGEKFGRGLKSEKLNYDFHSVEFQVESYLRYQGEEFSGRFDA
FT                   NTYLLMTKALDYFDPAANFNDDLAKTFANATAKFCVMSFTTDWRFSPARSRELVDALMA
FT                   ARKDVCYLEIDAPQGHDAFLIPIPRYLQAFGNYMNRISL"
FT   gene            complement(529838..530428)
FT                   /locus_tag="PSPPH_0466"
FT                   /note="PSPPH0466"
FT   CDS_pept        complement(529838..530428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0466"
FT                   /product="YGGT family protein"
FT                   /note="identified by match to protein family HMM PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34145"
FT                   /db_xref="GOA:Q48PA0"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q48PA0"
FT                   /protein_id="AAZ34145.1"
FT                   /translation="MIGLNTAAIYVLQTLGSLYLLIVLLRFVLQLVRANFYNPLCQFIV
FT                   RATQPLLKPLRRIIPSLGGLDMSSLVLAIIVQMILMALTLLLMFGTTGDPLHLLLWSII
FT                   GVTALFLKIFFFALIISVILSWVAPGSSNPGAELVNQICEPALAPFRKIVPNLGGLDIS
FT                   PILAFLVLKLLDMLVINNLAAMSGMPDVLRLLM"
FT   gene            complement(530454..531308)
FT                   /gene="proC"
FT                   /locus_tag="PSPPH_0467"
FT                   /note="PSPPH0467"
FT   CDS_pept        complement(530454..531308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="PSPPH_0467"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF01089;
FT                   match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34559"
FT                   /db_xref="GOA:Q48P99"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P99"
FT                   /protein_id="AAZ34559.1"
FT                   /translation="MVSHNLPHKDPFMSKTRIAFVGAGNMAASLIGGMRAQGVDAALIC
FT                   ASAPGAETRERIANDHGIQVFADNAEAIKGADVVVLAVKPQMMKNVCQALKSSLEANQL
FT                   IVSVAAGITCASLTQWLGDQPVVRCMPNTPSLLRQGASGLYATDKVTAEQREQAEQLLS
FT                   AVGVAVWVEQEKHMDAVTAVSGSGPAYFFLMMEAMTAAGVKLGLPEDIAKKLTLQTALG
FT                   SALIATGSDVGAGELRRRVTSPGGTTEAAIKAFQAGGFEALVETALTAADHRAAELAEQ
FT                   LGK"
FT   gene            complement(531295..531981)
FT                   /locus_tag="PSPPH_0468"
FT                   /note="PSPPH0468"
FT   CDS_pept        complement(531295..531981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0468"
FT                   /product="conserved hypothetical protein TIGR00044"
FT                   /note="identified by match to protein family HMM PF01168;
FT                   match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37752"
FT                   /db_xref="GOA:Q48P98"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P98"
FT                   /protein_id="AAZ37752.1"
FT                   /translation="MSTIAANISTLEQRIRDAALAANREPASVGLLAVSKTKPAGDLRE
FT                   AYTAGLRNFGENYLQEALGKQLELSDLPLCWHFIGPIQSNKTRAIAENFAWVHSVDRLK
FT                   IAQRLSEQRPEALEPLNICIQVNVSGEASKSGCTPQDLPTLAAAIIALPRLKLRGLMAI
FT                   PEPTDDPAAQHASFAAVRTLQEQLNLALDTLSMGMSHDLEAAIAQGATWVRIGTALFGA
FT                   RDYGQP"
FT   gene            532037..533071
FT                   /locus_tag="PSPPH_0469"
FT                   /note="PSPPH0469"
FT   CDS_pept        532037..533071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0469"
FT                   /product="twitching motility protein"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33151"
FT                   /db_xref="GOA:Q48P97"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P97"
FT                   /protein_id="AAZ33151.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLDAK
FT                   EVKALIYDIMNDKQRQDFEERLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKIL
FT                   SMEDLGMGSVFRKITDVARGLILVTGPTGSGKSTTLAAMIDYLNCNKHHHILTIEDPIE
FT                   FVHESKKCLVNQREVHRDTLGFSEALRSALREDPDVILVGEMRDLETIRLALTAAETGH
FT                   LVFGTLHTTSAAKTIDRIVDVFPAQEKSMIRSMLSESLHAVVSQALLKKVGGGRVAAHE
FT                   IMMGTPAIRNLIREDKVAQMYSSIQTGGSMGMQTLDMCLADLVKKGLITRESARERAKV
FT                   PDNF"
FT   gene            complement(533166..534044)
FT                   /locus_tag="PSPPH_0470"
FT                   /note="PSPPH0470"
FT   CDS_pept        complement(533166..534044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0470"
FT                   /product="NLP/P60 family protein"
FT                   /EC_number="3.2.1.14"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36337"
FT                   /db_xref="GOA:Q48P96"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P96"
FT                   /protein_id="AAZ36337.1"
FT                   /translation="MVSLFRRMAHEAVLCRQALVVKGISKKKERVCRIKRNDTSVMRST
FT                   NGVRFSEKAVIKLRADHYEPCRMRPFFKTWLTICLFMPLAAHATNREQQLPASFTGYTA
FT                   KSHSSPALATRNAPQEATPVPVHPKNARASKPVSRKNASKATLQASAAVPAKQGNAVVK
FT                   RALQAVGTPYRWGGTTPGKGLDCSGLVKYAYTDVREVDLPRTSNAMAQGHGQTVDRKDL
FT                   KPGDLLFFNIKSRNINHVAIYLGDNKFVHAPRRGKAVTVDTLNKPYWNSHYKIAKRVLP
FT                   KQPGQMRVVQR"
FT   gene            534094..534498
FT                   /locus_tag="PSPPH_0471"
FT                   /note="PSPPH0471"
FT   CDS_pept        534094..534498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0471"
FT                   /product="TM2 domain family"
FT                   /note="identified by match to protein family HMM PF05154"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36743"
FT                   /db_xref="GOA:Q48P95"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P95"
FT                   /protein_id="AAZ36743.1"
FT                   /translation="MNAYRSDTHSKVMGYLMWIFGFLGAHRFYYGKPVTGTLWFFTFGL
FT                   FGIGWLIDLFLIPSMDREADLRFTSGSTDYSLAWILLTFLGLFGVHRMYQGKWITGIIY
FT                   LCTGGLFLLGILYDFWTLNDQISMKNAQRG"
FT   gene            complement(535569..536840)
FT                   /locus_tag="PSPPH_0472"
FT                   /note="PSPPH0472"
FT   CDS_pept        complement(535569..536840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0472"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="2.1.3.2"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36100"
FT                   /db_xref="GOA:Q48P94"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P94"
FT                   /protein_id="AAZ36100.1"
FT                   /translation="MKLSILGARVIDPVSGMDQVTDLHVEAGKLTAIGAAPEGFEPTQT
FT                   IDAAGLVAAPGLVDLNVSLREPGYSRKGSIASETRAAVAGGVTSLCCPPQTKPVLDTSA
FT                   VAELILDRAREAGFSKVFPVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTL
FT                   CRALEYAATFDLTVIFNSQDRDLAEGGLAHDGATAAFLGLAGIPETAETVALARDLLLV
FT                   EQSGVRAHFSQLTSARGAALIAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPP
FT                   LRTRADRDGLREAVKSGVIQAISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLV
FT                   DDGLLDLPTLIARLSSGPAAALRLPAGKLSAGAPADIVLFDPAASTVAGETWLSKGENC
FT                   PFIGHCLPGSVRYTLVDGRISYSR"
FT   gene            complement(536837..537841)
FT                   /gene="pyrB"
FT                   /locus_tag="PSPPH_0473"
FT                   /note="PSPPH0473"
FT   CDS_pept        complement(536837..537841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="PSPPH_0473"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00670"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36973"
FT                   /db_xref="GOA:Q48P93"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P93"
FT                   /protein_id="AAZ36973.1"
FT                   /translation="MTPLDAKRPLQLNHQGQLRHFLSLDGLPRELLTEILDTADSFLEV
FT                   GARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSTSKGETLF
FT                   DTLRNLEAMAADMFVVRHADSGAAHFIAEHVCPDVAIINGGDGRHAHPTQGMLDMLTIR
FT                   RHKGGFENLSVAIVGDILHSRVARSNMLALQALGCPDIRVIGPKTLLPVGVEQYGVKVY
FT                   TDLNEGLKDVDVVIMLRLQRERMTGGLLPSEGEFYRLFGLTTARLAAAKPDAIVMHPGP
FT                   INRGVEIESAVADGAHSVILNQVTYGIAIRMAVLSMAMSGQNAQRQFEQENAQ"
FT   gene            complement(537854..538366)
FT                   /gene="pyrR"
FT                   /locus_tag="PSPPH_0474"
FT                   /note="PSPPH0474"
FT   CDS_pept        complement(537854..538366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="PSPPH_0474"
FT                   /product="pyrimidine operon regulatory protein PyrR"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36277"
FT                   /db_xref="GOA:Q48P92"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P92"
FT                   /protein_id="AAZ36277.1"
FT                   /translation="MSLPDPAELIRQMATDLNAHLSKRGISDPRFIGIRTGGVWVAQAL
FT                   LKALNNPAPLGTLDVSFYRDDFSQNGLHPQVRPSDLPFEIEGQHLVLIDDVLMSGRTVR
FT                   AALNELFDYGRPASVTLVCLLDLDAGELPIRPNVVGATLSLAPDERIKLSGPEPLALEL
FT                   QDLSTAL"
FT   gene            complement(538609..539049)
FT                   /locus_tag="PSPPH_0475"
FT                   /note="PSPPH0475"
FT   CDS_pept        complement(538609..539049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0475"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37404"
FT                   /db_xref="GOA:Q48P91"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P91"
FT                   /protein_id="AAZ37404.1"
FT                   /translation="MAALRLLLGIDYGTKQIGVAVGQAITGQARELCTLKAQNGVPDWD
FT                   KVQALINEWKPDAIVVGLPLNMDGTPSDMSARAEKFSRKLNGRFGVTVYTHDERLTTFE
FT                   AKGERMARGGQKGSYRNNPVDAIAAALLLQGWLDEHPELLNV"
FT   gene            complement(539049..539621)
FT                   /locus_tag="PSPPH_0476"
FT                   /note="PSPPH0476"
FT   CDS_pept        complement(539049..539621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0476"
FT                   /product="Uncharacterized ACR"
FT                   /note="COG1678; identified by match to protein family HMM
FT                   PF02622"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36834"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P90"
FT                   /protein_id="AAZ36834.1"
FT                   /translation="MKKVSPSYLKHQFLIAMPHMHDENFAQTLTYVVEHNANGAMGLVI
FT                   NRPQSLTLADVLEQLRPELPAPKRCQEIAIHSGGPVQTDRGFVLHPSGQTFQATVNLPG
FT                   GISLSTSQDVLFSIADGYGPDQNVITLGYAGWDAGQLDAEMADNAWLTCSFDPAILFDV
FT                   DSEQRLDAAARRLGINLNLISTQAGHA"
FT   gene            complement(539697..540590)
FT                   /locus_tag="PSPPH_0477"
FT                   /note="PSPPH0477"
FT   CDS_pept        complement(539697..540590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0477"
FT                   /product="tonB domain protein"
FT                   /note="identified by match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34563"
FT                   /db_xref="GOA:Q48P89"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P89"
FT                   /protein_id="AAZ34563.1"
FT                   /translation="MARNDLPLELANVGVRPADRLGFTMMIAALIHLAVILGVGFTYVK
FT                   PEQISQTLEITLATFKSEEKPKQADFLAQDDQQGSGTLDKAETLKTTELAPYQDTKVNK
FT                   VTPPPASKPVVKQEAPKTAVATTAPSQQKTVAKRDEVKPEPTTKAAPTFDSLELSNEIA
FT                   SLEAELSTEQQLYAKRPKIHRLNAASTMRDKGAWYKDDWRKKVERVGNLNYPEEARRKQ
FT                   IYGNLRLLVSINRDGSLYEVLVLESSGQPLLDQAAQRIVRLAAPFAPFTGDLADIDRLE
FT                   IIRTWKFARGDKLSSN"
FT   gene            complement(540756..541715)
FT                   /gene="gshB"
FT                   /locus_tag="PSPPH_0478"
FT                   /note="PSPPH0478"
FT   CDS_pept        complement(540756..541715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="PSPPH_0478"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="identified by match to protein family HMM PF02951;
FT                   match to protein family HMM PF02955; match to protein
FT                   family HMM TIGR01380"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34205"
FT                   /db_xref="GOA:Q48P88"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P88"
FT                   /protein_id="AAZ34205.1"
FT                   /translation="MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLY
FT                   QDAGQARARMKPLKVFADPAKWFEFEAEVDAGLDDLDVILMRKDLPFDMEFVYATYLLE
FT                   QAERAGVLVVNKPQSLRDCNEKLFATLFPQCTPPTLVSRRADIIREFAEKHGDVILKPL
FT                   DGMGGASIFRHRAGDPNLSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPY
FT                   CLARIPAAGETRGNLAAGGRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLT
FT                   EINVTSPGGIREIDNAFGTNIGGLLIDAIDKKLQARRG"
FT   gene            541960..542370
FT                   /gene="pilG"
FT                   /locus_tag="PSPPH_0479"
FT                   /note="PSPPH0479"
FT   CDS_pept        541960..542370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilG"
FT                   /locus_tag="PSPPH_0479"
FT                   /product="type IV pilus response regulator PilG"
FT                   /note="identified by similarity to SP:P46384; match to
FT                   protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35632"
FT                   /db_xref="GOA:Q48P87"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P87"
FT                   /protein_id="AAZ35632.1"
FT                   /translation="MEQHASALKVMVIDDSKTIRRTAETLLKNAGCEVITAIDGFDALA
FT                   KIADNHPRIIFVDIMMPRLDGYQTCALIKNNRAFKSTPVIMLSSKDGLFDKAKGRIVGS
FT                   DQFLTKPFSKEELLSAIKAHVPGFVAAEHHIS"
FT   gene            542417..542782
FT                   /gene="pilH"
FT                   /locus_tag="PSPPH_0480"
FT                   /note="PSPPH0480"
FT   CDS_pept        542417..542782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilH"
FT                   /locus_tag="PSPPH_0480"
FT                   /product="type IV pilus response regulator PilH"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35303"
FT                   /db_xref="GOA:Q48P86"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P86"
FT                   /protein_id="AAZ35303.1"
FT                   /translation="MARILIVDDSPTEMYKLTGMLEKHGHEVLKAENGADGVALARQEK
FT                   PDAVLMDIVMPGLNGFQATRQLTKDADTNMIPVIMITTKDQETDKVWGKRQGARDYLTK
FT                   PVDEETLMKTLNAVLAG"
FT   gene            542797..543336
FT                   /gene="pilI"
FT                   /locus_tag="PSPPH_0481"
FT                   /note="PSPPH0481"
FT   CDS_pept        542797..543336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilI"
FT                   /locus_tag="PSPPH_0481"
FT                   /product="type IV pilus biogenesis protein PilI"
FT                   /note="identified by similarity to SP:P43502; match to
FT                   protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35735"
FT                   /db_xref="GOA:Q48P85"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P85"
FT                   /protein_id="AAZ35735.1"
FT                   /translation="MAEPRTAFELLLDMDRRCRSLAAGLPLQEAHQQDWVGIGFRMGEQ
FT                   RFVAPIGEIAEILHEPHHAVMPGVKFWVAGIANLRGRLLPLMDLCGFFGHELTPARKQR
FT                   RVLVVEHNDVFAGLLVDEVFGMQRFSQLSLIPQTSQDINQGIAPFLRGQFIREQAWQIF
FT                   SPWALVQSADFMDLAS"
FT   gene            543385..545427
FT                   /gene="pilJ"
FT                   /locus_tag="PSPPH_0482"
FT                   /note="PSPPH0482"
FT   CDS_pept        543385..545427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilJ"
FT                   /locus_tag="PSPPH_0482"
FT                   /product="type IV pilus biogenesis protein PilJ"
FT                   /note="identified by similarity to SP:P42257; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35250"
FT                   /db_xref="GOA:Q48P84"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P84"
FT                   /protein_id="AAZ35250.1"
FT                   /translation="MSNTGRSREGARSRTQIILLFVALIVFIMLLFANFAYLNTQSNYD
FT                   KQYIGHAGELRVLSQRIAKNATEAAAGKTQAFKLLADARNDFDVRWGYLRKGDPATGLP
FT                   AAPDLIRDELRTVQRDWEGLRKSTDVILASEQTVLSLHQVAATLAETIPQLQAEYEKVV
FT                   ESLLQSRAPAAQVVVAQRQALLAERILGSVNTVLAGDETAVQAADAFGRDASQFGRVLN
FT                   GMLEGNATLRISQVEDRDARARLAEIAELFEFVSGSVDEILETSPELYQVREASGNIFN
FT                   TSQTLLDETSVLTNSLENMAKRRTVNTIGGYVLGLLALMSIILIGLVMVRETNRQLRET
FT                   AQKSERNQTAIMRLLDEIENLADGDLTVTASVTEDFTGAIADSINYSIDQLRELVVTIN
FT                   LTVEQVAAAVTETQATAMQLSAASEHQALQISAASTAINDMAASINQVSTNASESSAVA
FT                   ERSVAIANKGNEVVHNTIHGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLIDDIADQT
FT                   NILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSSATKQIETLVRAIQNDTNEAVIS
FT                   MEQTTSEVVRGARLAQDAGVALGEIEGVSRVLAELIESITDAAHQQAESAGQISQIMTV
FT                   IQQTISQTTSGTSATAESIGNLAKMASEMRRSVSGFALPSSKKAG"
FT   gene            545475..551435
FT                   /locus_tag="PSPPH_0483"
FT                   /note="PSPPH0483"
FT   CDS_pept        545475..551435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0483"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01584; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35414"
FT                   /db_xref="GOA:Q48P83"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P83"
FT                   /protein_id="AAZ35414.1"
FT                   /translation="MADRHDYVALEWLKGEIAETLRQARNELDAFIEDPANSAAMAECL
FT                   NLVHQVHGSLQMIEFYGAALLAEEIEQLALAVQQNRVSHPVESEQLLIQAMSQLPVYLE
FT                   RIHSARRDLPLVVLPLLNDLRSARGESLLSETSLFAPQLVVVPALDDQELARRNTPELP
FT                   NLLRKLRQTLQAALAGLMREQGVQTQLGYMAKVFARLEQLCEDAPLGPLWRIASALVET
FT                   MLNGNFTNSPALRSLLKDADKELKRLAEQGVTGINQPAPEELLKSLLFYIAKSDSLAPK
FT                   MLDLKDQYALADALPGNDVVNEERARMAGPDRDAMRSVIVALCEGLVRVKERLDVFVRG
FT                   DRQHVSELNALPPPLRQIADTLAVLGFGQPRKVIIDQLSVVLGLAQGQREPSDGALMDV
FT                   AGALLYVESTLAGMAGSNEQASREESRLPTTDLTQIHQLVIREARTVLQQAKDVILDYI
FT                   DGEWDRQRLDPLCALIVQVRGALAMIPLARAASLLAACNEYIQEHLLVDETRPSWVQLD
FT                   CLADTITGIEYYLERMLEDHEAPGDQVLDMAQQSLARLGYTPAADTLEVPLLEEIITQD
FT                   ELLELDDRKALVSPAQTIAQVLASPVSAVNPPARNVPTSLLPPSADEEAVDDELREVFL
FT                   EEADEVLDALREYLPRWFASLGSGGHWDSTALTEVRRAFHTLKGSGRMVRALILSELAW
FT                   SVENLLNRVLEGDVLAGLEVQQLMSEVLTLLPSVIRDFAEDAQRQRNDVDLLAARAHAL
FT                   ANGLELPALPATGESVPVEALDPQLLEIFRQEALGHLNTLGRFLDNAEQSASPSISDAV
FT                   LRALHTLKGSAHMAGVLPIAELASPLDQLVREYKANLIDIGAPELALLRSAEPLLHDGL
FT                   KQLDTTPLAAIAGAAELIEAALALLNERLTVVLRESDSGLRIKRNPTLLAGFLAEGMDI
FT                   VLDAENLLRRWRQHPGERQELSALLDELTTLGHGAHLADLPQVDELCEALLDLYGAVEE
FT                   SSLAVSERFFDAAENAHEALINMLDQVAAGQDVEPRPECVRALNQLLDQALDPSATGLV
FT                   KSDGHRTLSVTELNAATEQLASEAEHAETAGPDDEIVEIFLEEAVDILDSAGQALQRWL
FT                   ADPENSAPLASLQRDLHTLKGGARMAEVAEVGDLAHELENLYEGLIDRRFNHSPALAEL
FT                   LHESHDHLAILLEQLYRQEALSDPSALIEALGRCRSLESSGADVQAPPAASEDPPEHDT
FT                   ELREVFLEEGFDIIESSGAALARWQADPHNLLEVENLLRDLHTLKGGARMVEIAPIGDL
FT                   AHELETLYEGLSAGNLQPAPLTISLLQSGHDVLADMLDAVRNEKPLPDASLLIESIRRL
FT                   ASDEPVGEPVVAQTFETGPESVVAVAPAADGEVERSGPEMVKVPAEQLEDLVNLAGETS
FT                   IFRGRIEQQILDSQVALLEVETTIERMRDQLRRLDMETQGRILSREQVQAERLGYEEFD
FT                   PLEMDRHSQLQQLSRALFESASDLMDLKETLGARARDAETLLSQQARVNTQLQEGLMRT
FT                   RMVPFERLVPRLRRLVRQVASELHKKVHFEVGNADGEMDRNVLERMVAPLEHMLRNAVD
FT                   HGLESTEKRIAAGKPEQGHISLELMYEGGDMVIELSDDGSGVDLAAVRRKAIKRGMIHP
FT                   DADLSDHEVLPFILQAGFSTSEIITQISGRGVGMDVVHAEVKQLGGSMVIDSVPGKGTR
FT                   FRIRLPISVSVNRALMVTCGEEQYAVPLNTVDGIVRVMANELDGYYQTSPPRYQYGGRS
FT                   YELRYLGELLGSSPPRLAGQLQPLPVLLVHLQDQWVAVQVDALAGSREIVVKSLGTQFS
FT                   RVQGISGATILGDGRVVLILDLMAQIRTLQGLPFRGLAPVYHEAEHARPLLVMVVDDSV
FT                   TVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEVASQIRQD
FT                   EQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESIAYWSQVHV"
FT   gene            551428..551898
FT                   /locus_tag="PSPPH_0484"
FT                   /note="PSPPH0484"
FT   CDS_pept        551428..551898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0484"
FT                   /product="CheW domain protein"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34469"
FT                   /db_xref="GOA:Q48P82"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P82"
FT                   /protein_id="AAZ34469.1"
FT                   /translation="MSEGTFQTSRLTSLTGLLLPLSDRHLLLPNVAVAELIDYQDCSAE
FT                   PGAPEWYLGPISWRELTLPLLSFEAACGGRTRVGGRARIVVLNALGGRNDVRFIALLTQ
FT                   GIPRSCKVDSQLSYVDVPLAELELAAVQIGETVARIPDLEGLEQWLVDAGLS"
FT   gene            complement(552522..553985)
FT                   /locus_tag="PSPPH_0485"
FT                   /note="PSPPH0485"
FT   CDS_pept        complement(552522..553985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0485"
FT                   /product="SelO family protein"
FT                   /note="identified by similarity to SP:Q88CW2; match to
FT                   protein family HMM PF02696"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36115"
FT                   /db_xref="GOA:Q48P81"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P81"
FT                   /protein_id="AAZ36115.1"
FT                   /translation="MKALDELIFDNRFARLGDAFSTSVLSEPIETPRLVVASQSALALL
FT                   DLAPEQADLPLFAEIFSGHKLWSEAEPRAMVYSGHQFGSYNPRLGDGRGLLLGEAYNDA
FT                   GEHWDLHLKGAGRTPYSRMGDGRAVLRSSIREFLASEALHALGIPSSRAGCVVSSSTPV
FT                   WRETQEHAAMVLRLAQSHVRFGSLEYFFYTKQPEQLKTLAEHVLTMHYPHCQEQPEPYL
FT                   AMFREIVERNAELIAKWQAYGFCHGVMNTDNMSILGITFDFGPFAFLDDFDEHFICNHS
FT                   DHEGRYSFSNQVPIAQWNLSALAQALTPFISVEALRETIGLFLPLYQAHYLDLMRRRLG
FT                   LTIAQEQDEQLVSQLLKLMQNSGVDYTLFFRRLGDQPAAEALRTLRDDFVDIKGFDGWA
FT                   EAYLARIAGEGKGTEQERQTRMHAVNPLYILRNYLAQNAIAAAEKGDYAEVRRLHQVLC
FT                   TPFTEQPGMEGYAQRPPDWGKHLEISCSS"
FT   gene            complement(554124..554789)
FT                   /locus_tag="PSPPH_0486"
FT                   /note="PSPPH0486"
FT   CDS_pept        complement(554124..554789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0486"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36445"
FT                   /db_xref="GOA:Q48P80"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P80"
FT                   /protein_id="AAZ36445.1"
FT                   /translation="MNDAASLLPRTLGESITTELRRMLVEGELVPGQRLSEAALAESLQ
FT                   ISRNTLREAFRILTREGLLTHEPNRGVTVAKPDMASIIDIYRIRRFIECRAIAQAYPQH
FT                   PGVQNMRNAVEAGVRAREANDWMAVGTANMKFHKAIVELSDSPRLVAFYAQISAELRLA
FT                   FGLLNNPELLHSPYLDMNAAVLGRLDAGKTDEATHMLEEYLVQSERTILAAYERTRGR"
FT   gene            555043..556275
FT                   /locus_tag="PSPPH_0487"
FT                   /note="PSPPH0487"
FT   CDS_pept        555043..556275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0487"
FT                   /product="Na+/proline, Na+/panthothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35913"
FT                   /db_xref="GOA:Q48P79"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P79"
FT                   /protein_id="AAZ35913.1"
FT                   /translation="MTQTANEFTKARRASLIAAIFMMATSAIGPGFLTQTATFTATLGA
FT                   AFAFGILASILIDFVVQLNVWRIVTLTRMRAADLANAAIPGSGYLLAVLVIFGGLVFSL
FT                   GNIAGAGLGLNALTGLDPKWGGALSALIAIAIFSSHRAGIAMDRIMMVLGTLKVCLILF
FT                   AAFASHPPLGEALRQTVLPDMVDFAAITTIVGGTVGGYITYAGAHRLLDRGTVGVENID
FT                   VVSKAALTGILVTGVVRYILFLAILCVVASGVVIDVSGQGANPAAQAFTAAAGNFGLIM
FT                   FGLVLWAAGISSVIGASYTSMSFITVFSKRITERVRNLATVGFILITVVVYVMWGKPPA
FT                   ALLVFAGGFNGLILPLGLSIFMYVGWRRSDMMDGYHYPRWLLVLGVLTCLLSWYMAFKS
FT                   AGAIFAFINAA"
FT   gene            556291..557055
FT                   /locus_tag="PSPPH_0488"
FT                   /note="PSPPH0488"
FT   CDS_pept        556291..557055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0488"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF03746;
FT                   similar to lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37269"
FT                   /db_xref="GOA:Q48P78"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P78"
FT                   /protein_id="AAZ37269.1"
FT                   /translation="MPAIDLNSDLGESFGAWSMGDDEAILDVVSSANVACGFHAGDPAG
FT                   ILRTLEAAAARGVAIGAHVAYPDLVGFGRRNMDIPSDQLTADVIYQIGALQGLARSAGT
FT                   SVTYVKPHGALYNTIAGDQRQAAAVIQALLRIDPALKLVCLANSPLLGWAREAGLACVA
FT                   EAFADRAYTAEGTLVSRSRPGAVLHDAELIAERMLRLVRDGVIEAEDGREISLQADSIC
FT                   VHGDSPGAVNIARILKDRLHDAGVTVRAFNRG"
FT   gene            557058..557855
FT                   /pseudo
FT                   /locus_tag="PSPPH_0489"
FT                   /note="PSPPH0489; conserved hypothetical protein, authentic
FT                   point mutation; this gene contains a premature stop which
FT                   is not the result of sequencing error"
FT   gene            557865..559469
FT                   /locus_tag="PSPPH_0490"
FT                   /note="PSPPH0490"
FT   CDS_pept        557865..559469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0490"
FT                   /product="allophanate hydrolase/urea amidolyase-related
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02626;
FT                   match to protein family HMM PF02682; match to protein
FT                   family HMM TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34062"
FT                   /db_xref="GOA:Q48P77"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P77"
FT                   /protein_id="AAZ34062.1"
FT                   /translation="MRFYPANLDALLVELSNLDETLALFESLQQMPIFGVEEIVPAART
FT                   LLVHFRPSAIGFEALAAQIASRDIRGSAREPGKLIEIPVHYNGEDLADVARELDISVDE
FT                   VIKRHTGSDYNVAFCGFAPGFAYLSGGAGFVVPRRSTPRTRIPAGAVALAGGFSGIYPQ
FT                   ASPGGWQIIGVTHSKMWDLGRDEPALLQPGYRVRFQDAGPLPVTSVSVAAPVRQQASTI
FT                   TEDYLQVVTPGLQTLFQDLGRPGRAGQGVSASGALDRGALRAANRAVGNEPGTACLEIL
FT                   MGGLTFTCQGQAVVAVTGAQAPVEVLTADGQRMQPPLYAPFSLQSGDQVSIGSPTAGLR
FT                   SYLAVRGGFVHEPVLGSLSTDTLAQVGPAALAAGDRLGFRRRTGGAAVSTGEQPAFDMP
FT                   RNDQVITLDVVMGPRSDWFTAEAQALLAQQTWLVTPQSNRIGIRLAGEQSLARAVSGEL
FT                   PSEGTTVGAIQVPPSGQPVLFLADHPLTGGYPVIGAVATYHLDKAGQIPVNARIRFNPL
FT                   SAFEPVRPATSDETNNR"
FT   gene            559466..561199
FT                   /locus_tag="PSPPH_0491"
FT                   /note="PSPPH0491"
FT   CDS_pept        559466..561199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0491"
FT                   /product="biotin carboxylase/biotin carboxyl carrier
FT                   protein"
FT                   /EC_number="6.3.4.14"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02785; match to protein family HMM PF02786"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37384"
FT                   /db_xref="GOA:Q48P76"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P76"
FT                   /protein_id="AAZ37384.1"
FT                   /translation="MKKVLIANRGEIAVRIARACRDYGVASVAVYADADIDALHVLQAD
FT                   EAYGLQGERPTDTYLNIEKLLAVAARAGADAVHPGYGFLSERADFARAVIDAGLTWIGP
FT                   DPATIDALGDKVQARRIALKVGAPLVAGTENPVKDASEVLAFAEQHGLPIAIKAAFGGG
FT                   GRGLKVAWKLDEVSELYESAVREAVTAFGRGECFVERFLDRPRHIEAQIIADRHGRVIV
FT                   VGTRDCSLQRRNQKLIEEAPAPYLNDELRQRIHDSARAVCAEAGYVGAGTVEFLLSGDG
FT                   TLSFLEVNTRLQVEHPVTEETSGVDLVIEQLRVADGLPLSFDGTPVPRGHSFEFRINAE
FT                   DAGNGFLPTPGSIDVFQPPSGPGVRLDTGVTEGSRVSANFDSMIAKLIVTGATREQAIS
FT                   RARRALAEFKVEGVATVLPFHRAVMDHYDFTASNTFAVHTRWIETDFAEHVTIAPRNAA
FT                   PVDAGVLRTFVEIDGKRHELGLPAALLRGMSLNSAAPADASQPVADAPDPHAVLTPVAG
FT                   NLHAWAVEDGATVEKGQVIAIMEAMKMETSILAPCAGTVQISKEPGGYLEAKVVIGRVE
FT                   A"
FT   gene            complement(561269..564673)
FT                   /locus_tag="PSPPH_0492"
FT                   /note="PSPPH0492"
FT   CDS_pept        complement(561269..564673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0492"
FT                   /product="potassium efflux system protein KefA, putative"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36220"
FT                   /db_xref="GOA:Q48P75"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P75"
FT                   /protein_id="AAZ36220.1"
FT                   /translation="MRPVSMFSLRSICAAALFALCLSTFPALAADPPSSDAVQQSLDKI
FT                   ADRKLPDAEQKALQQVLEQTLAFLASKKDSEQKLEALKQQLAQAPKQTSENQRELARLK
FT                   ESKVVPVAQRYGGLDVPQLEQLLSQRSTQQSDLQSELNDANSLAITAQTRPERAQTEIS
FT                   ANQTRIQQINAILKSGKDNGKTLSADQRNLLNAELASINALNLLRRQELAGNSQLQDLG
FT                   NSQHDLLTEKVARQEQEIQDLQTLINDKRRAQSQKTVADLSLEAQKSGGSSLLATESAA
FT                   NLKLSDYLLRGTDRLNELTQQNLKTKQQLDNLTQTDQALSEQINVLSGSLLLSKILYKQ
FT                   KQALPHLELDKGLADEIANIRLYQFDINQQREQMSTPTAYVEKLLATQPPENITPQLRR
FT                   TLLDLAITRSDLLERLNRELSALLNESITLQLNQKQLTSTAQGLRATLDEQMFWIPSNK
FT                   PLDLEWFQNIWPRLQKQIATLPWTSSLSELSDGLTQRPLLFLPLLLLIGVLTWRRKALY
FT                   QKLNRLHADIGHFKRDSQWKTPLALLINVLLAMPVALGLALCGYALQIDARGQNANLGE
FT                   ALLQIALAWLVFYTAYRVLAPSGVAQLHFRWETAQVEFLRGWVRRLGLVVLALVAVVAV
FT                   AEHQPAALADDVLGIGVVLTCYALMTWLLARLLISSPTHHNASLFRKTVGVVFTALPVA
FT                   LFLAVCFGYYYTALKLSDRLIDTLYLMMIWLMVEATFVRGLSVAARRLAYQRALAKRQA
FT                   ARENGDSDIPVEEPKLDIEQVNQQSLRLIRLALLAGFVGALYLVWAELITVFAYLDNII
FT                   LYEYTSGTGANISMVPISLSDFLGAGVIIVITFVLAGNLPGLLEVLVLSRMNLAQGSAY
FT                   ATTTLLSYTIAGVGFVTTLSTLGVSWDKLQWLVAALSVGLGFGMQEIFANFISGIMILF
FT                   ERPVRIGDTITIGALSGTVSKIRIRATTITDFDRKDIIVPNKTFITGQLINWSLTDTVT
FT                   RVTLKLGVDYGSDLDLVRSLLLQAARENPRVLKEPEPIVYFLNFGESTLDHELRMHVRD
FT                   LGDRNPVLDEINRFINREFKKQHINISFRQMEIYLKNTQGLEYKLVPAEPSDKTGAPTG
FT                   QTTLQPVNTKVAPATKDAPEPPELRLD"
FT   gene            complement(564697..566493)
FT                   /locus_tag="PSPPH_0493"
FT                   /note="PSPPH0493"
FT   CDS_pept        complement(564697..566493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0493"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02080; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34274"
FT                   /db_xref="GOA:Q48P74"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR023729"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P74"
FT                   /protein_id="AAZ34274.1"
FT                   /translation="MVSFRPSRFNSVFYGVPPLDATTINSLFLVGALLVAASILVSSLS
FT                   SRLGIPILVIILAVGMVAGVDGGGIIFDNYATAYLVGNLALAVILLDGGLRTRVASFRV
FT                   ALWPALSLATVGVLITTVLTGMVAAWLFNLSVIQGLLIGAIVGSTDAAAVFSLLGGKGL
FT                   NERVTASLEIESGSNDPMAVFLTVTLIGMLASGQTGLHWGLLGHLIQEFGIGSFIGLGG
FT                   GWILLQLVNRINLAAGLYPILVIAGGLAIFALTNAIHGSGFLAVYLCGLVLGNRPIRSR
FT                   HGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIAIPALGLALWMILVARPLSVMVGLL
FT                   PFKAFHGREKAFIAWVGLRGAVPIILAVFPLMAGLPNAQLYFNLAFFIVLVSLLLQGTS
FT                   LPWVAKLLKVTVPPDPAPISRAALEVHVTSEWELFVYRLGAEKWCIGAALRELKMPEGT
FT                   RIAALFRGQQLLHPSGSTTLEVGDLLCVIGHEHDLPALGKLFSQAPQRGLDLRFFGDFV
FT                   LEGDARLGEVAALYGLKLDGIDPGMPLSQFIVQKNRGEPVVGDQIEWNGTIWTVAVMDG
FT                   NKIQKVGVKFPEGTRPGPGLFL"
FT   gene            566941..569586
FT                   /locus_tag="PSPPH_0494"
FT                   /note="PSPPH0494"
FT   CDS_pept        566941..569586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35207"
FT                   /db_xref="GOA:Q48P73"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P73"
FT                   /protein_id="AAZ35207.1"
FT                   /translation="MTSLIQEEVMTTQSLKIPKTDQQLLRERAKQFVFDYPDLHDLAYS
FT                   VVSKIMLQHTQKVFNPDKVYWHRFGSASSSPRTFTGWQHSGKPLQSMTLIELLMQNFNA
FT                   HDQEASDELSLYGGFYTDGPDHEVFDERNEVPMLPQTLLAEMWTLDFSSLYTRRMERFW
FT                   SSHSENFCILAKAHYLVAAGNCLRKGQLSPDDFKHVTRFVVTDPSQPATLKALRDSPLV
FT                   TPGLSVHTLDINGVKTYDMLRIVIADGREVIYRPDAEQPFQVFENERALYNWLKGQFAS
FT                   EQAGKALTGNFLRGEAARTQDGVRFARGVSELLAHDWRADVRLINQSRAPIVGDPFIHM
FT                   RDIARQVMTADAHQLLTSNADLRKQMWIGYLSAFMQAFGGLAALGWPIALTLVGAGLAN
FT                   TGLNIDQAVNGKTPAQRRAGVLGAIINTLYLLFNLPLLMSIRAMPERMPLVRADVVSLP
FT                   SEVVESGVIVDPLENMEGNLLLDSLTPSAEEGRFRGVYSLGNGETWIKLARLPYRVMFS
FT                   EQQHCWFIVDPDNPFAFVGSKPVRLGLDGEWTLIQSPGLQGGSPMDPQVPSTSSSVPPG
FT                   KPYATVHSTFWDRYLQTDIFNEQYYAERALTRQKEVMDIWEPTTDDVLESDSSPEGDEV
FT                   YRDPWHGKHRVFKLGEDDYYGANIMLYTQEDTVFNRFLRTGERRGPNQVRFIERLADDI
FT                   QVVGYSNDVELYRGGSGDRGTSGAVFRSGQIKVGDVLVNTDITSFSENPYVVSAFASSR
FT                   AGAPTNAVIGPITFDDTSVVFVLPKGRYLRATPIAPFSASPDEAESIFLPGCYFQIESI
FT                   EEVVGDFYRLMKVQMQEVDRPVQGRALYDMRTGEPFSREQYALKLGADAKVLFDRFFPQ
FT                   NPMTDLFSPH"
FT   gene            complement(569608..571620)
FT                   /locus_tag="PSPPH_0495"
FT                   /note="PSPPH0495"
FT   CDS_pept        complement(569608..571620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0495"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33147"
FT                   /db_xref="GOA:Q48P72"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P72"
FT                   /protein_id="AAZ33147.1"
FT                   /translation="MTQSVKKGIPTLERAEREVSERHRPFPCSGRFASALDTPRTRSTI
FT                   TRINLATLPTQPDLDLSHSKNRYAIMSESLLSSRNLAFELYEVLDAEGLTRRERFAEHS
FT                   RETFDAALGTARTIAEKYFAPHNRKADENEPRYENGEAILIPEVKPAVDAFLAAGFLNA
FT                   SRDFEAGGMQLPTLLSQACFAHFQAANVGTTAYSFLTMGAANLIESFGNDEQKQRFLQP
FT                   MIEGRFFGTMALTEPHAGSSLSDIRTRAEPAEDGTYRLRGNKIFISGGDHALSENIVHM
FT                   VLAKLPDAPGGVKGISLFIVPKFLVNDDGSLGKRNDVLLAGLFHKMGWKGTTSTALNFG
FT                   DNGECVGYLVGKPHHGLSYMFQMMNEARIGVGLGAVMLGYSGYLYSLDYARDRPQGRLP
FT                   DSKSPESTPVPIIQHADVRRMLLTQKAYVEGAFDLCLYASRLFDDTQTGETEDARKHAH
FT                   ELLDLLTPVVKSWPSEFCLKANELAIQVLGGHGYTREYPVEQYYRDNRLNPIHEGTHGI
FT                   QSLDLLGRKLAQNGGTGLKQLLRLISETCARAQGYDSLHELRQPLEQLATHVQAVTLGL
FT                   LTDLAQGRITSTLANSALYLKVFGHTIIGWRWLEQAIRAEEGLGKGHSADSDFYKGKLQ
FT                   AARYFLTWEVPGCHHELSILENRDDTCLAMRDDWF"
FT   gene            complement(571637..575590)
FT                   /gene="putA"
FT                   /locus_tag="PSPPH_0496"
FT                   /note="PSPPH0496"
FT   CDS_pept        complement(571637..575590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="PSPPH_0496"
FT                   /product="bifunctional putA protein"
FT                   /EC_number="1.2.1.88"
FT                   /EC_number="1.5.5.2"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM PF01619; match to protein
FT                   family HMM TIGR01238"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37117"
FT                   /db_xref="GOA:Q48P71"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR024090"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P71"
FT                   /protein_id="AAZ37117.1"
FT                   /translation="MATTTLGVKLDDPTRERLKAAAHSIDRTPHWLIKQAIFNYLEKLE
FT                   SGATLLELNGATGKDSEDRGEVAEDTGLQCFLDFAESIQPQSVLRAAITSVYRRPEQEV
FT                   VPMLLEQARLTAPVAEATNKMAASIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVAL
FT                   MCLAEALLRIPDKGTRDALIRDKISNGNWQPHLGNSPSLFVNAATWGLLLTGKLVATHN
FT                   EAGLTSSLSRIIGKSGEPMIRKGVDMAMRLMGEQFVTGETIGEALANASRFEAKGFRYS
FT                   YDMLGEAALTEHDAQKYLASYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQY
FT                   ERVMEELYPRLLSLTLLAKQYDIGLNIDAEEADRLELSLDLLERLCFEPQLTGWNGIGF
FT                   VIQAYQKRCPYVIDYVIDLARRSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKV
FT                   YTDVSYIACARKLLAAPEVIYPQFATHNAHTLAAIYQIAGQNYYPGQYEFQCLHGMGEP
FT                   LYEQVVGKVADGKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADHSISIQ
FT                   ELVADPVSQIERMATQEGGFGLPHPRIPLPRDLYGTERANSSGIDMANEHRLASLSSAL
FT                   LATAHNDWKAAPMLGCPASAGTLTAALNPSDLRDVVGHIQEASLQDVENAIQCALSAGP
FT                   IWQATPPAERAAILERAADLMESDIQPLMGLLVREAGKTFANAIAEVREAVDFLRYYAV
FT                   QARNDFTNDAHRPLGPVVCISPWNFPLAIFSGQVAAALAAGNPVLAKPAEQTPLIAAQA
FT                   VRLLLEAGIPEGVVQLLPGRGETVGAGLVGDERVKGVMFTGSTEVARLLQRNVAGRLDS
FT                   QGRPIPLIAETGGQNAMIVDSSALTEQVVIDVVSSAFDSAGQRCSALRVLCLQEDSADR
FT                   VIEMLKGAMAESRLGNPERLSVDIGPVIDAEAKAGIEKHIQAMRDKGRTVYQVAIADST
FT                   ELKRGTYVMPTLIELESFDELQREIFGPVLHVVRYKRKELGLLIDQINASGYGLTLGVH
FT                   TRIDETIAKVIDNVNAGNVYVNRNIVGAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLST
FT                   RPQDAIEKSFVRSDALSAPDTRLRDILNKPLQALKAWAASNQQSDLDALCSQYAEQSQS
FT                   GITRQLAGPTGERNSYAILPREHVLCLADDENDLLIQLAAVLAVGSSAVWPETDISKPL
FT                   RARLPKDVQARIKLIPDWTKDEVIFDAVLHHGDSDQLRAICQQIAQRSGAIVGVNGLSH
FT                   GETNVPLERLVIERALSVNTAAAGGNASLMTIG"
FT   gene            575967..577526
FT                   /gene="putP"
FT                   /locus_tag="PSPPH_0497"
FT                   /note="PSPPH0497"
FT   CDS_pept        575967..577526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="PSPPH_0497"
FT                   /product="sodium/proline symporter"
FT                   /note="identified by match to protein family HMM PF00474;
FT                   match to protein family HMM TIGR00813; match to protein
FT                   family HMM TIGR02121"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37706"
FT                   /db_xref="GOA:Q48P70"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P70"
FT                   /protein_id="AAZ37706.1"
FT                   /translation="MRRISVAIPFGIGCQHKNNAKAELMSVSNPTLITFVIYIAAMVLI
FT                   GLMAYRSTNNLSDYILGGRSLGSVVTALSAGASDMSGWLLMGLPGAIYMSGLSESWIAI
FT                   GLIIGAYLNWLFVAGRLRVQTEHNGDALTLPDYFSSRFEDNSGLLRIISAIVILVFFTI
FT                   YCASGIVAGARLFESTFGMSYETALWAGAAATIAYTFVGGFLAVSWTDTVQATLMIFAL
FT                   ILTPIIVLLATGGVDTTFLAIEAKDPTSFDMFKNTTFIGIISLLGWGLGYFGQPHILAR
FT                   FMAADSVKSIASARRISMAWMILCLGGTVAVGFFGIAYFSAHPDVAGPVTENPERVFIE
FT                   LAKLLFNPWIAGVLLLAILAAVMSTLSCQLLVCSSALTEDFYKAYLRKGASQLELVWVG
FT                   RAMVLLIAVIAILLAANPENRVLGLVSYAWAGFGAAFGPVVLISVLWKGMTRNGALAGV
FT                   IVGAATVVLWKQFSTLGLYEIIPGFILASIAIVVFSLIGKPASASMQTRFLAAEQEFKA
FT                   NR"
FT   gene            complement(577625..578296)
FT                   /locus_tag="PSPPH_0498"
FT                   /note="PSPPH0498"
FT   CDS_pept        complement(577625..578296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0498"
FT                   /product="alginate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36046"
FT                   /db_xref="GOA:Q48P69"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014895"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P69"
FT                   /protein_id="AAZ36046.1"
FT                   /translation="MIDLGSYQLSIPVGSPPKTITTAQLVKGYDGKYFKSKSDSIVFWS
FT                   PVTGTKTENAKYSRSELRETWSDGSLHNWVYPDADNYLNAKLEVDQVPSSGKIVIGQIH
FT                   AYESTEPLLKVEYQYKEDTKTGDIVAKVRNRFDDDESKVYKIVEGVKLNQTFSYVIHLS
FT                   KGGKLTVSVNDTDWSKRISETWRDKPLYFKAGVYTQDNTGYTSEGGKATFYNLDIDHNK
FT                   S"
FT   gene            578611..580749
FT                   /locus_tag="PSPPH_0499"
FT                   /note="PSPPH0499"
FT   CDS_pept        578611..580749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0499"
FT                   /product="response regulator/sensory box/GGDEF domain/EAL
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00563; match to protein
FT                   family HMM PF00989; match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00229; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36630"
FT                   /db_xref="GOA:Q48P68"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P68"
FT                   /protein_id="AAZ36630.1"
FT                   /translation="MERVPTQPHDGSSVLLVVDDYPENLVTMCAVLQRTDWHIVTASSG
FT                   IEALTVLLEQEVDLVLLDVQMPGMDGFEVARLMRGSQRTRLTPIIFLTANEQTQDAVQK
FT                   GYANGATDYLFKPFDPNVLKPKVQTLLEQQRNRRALQQLSLELESARAFNASVLANVAE
FT                   GILVVDEAGTISFANPAICQLLSASVDQLRGTQVLDYIIEPQVGEWLESGFYKHYRKAD
FT                   TYRVHDAVLRTAQGTQLPVALSCAALPAEQKAMVMTVLDMSVVRDLYQQLEKQAVTDAL
FT                   TGLLNRRGLYQAVEGMLLRKEQTDKYLVVLFMDLDGFKQINDALGHDAGDQVLLWVAEQ
FT                   FKDSMRPYDVLARIGGDEFTVVIDGLDYPEQAAKIAEKLIERVSGRRQVDGIDITLGAS
FT                   VGIATFPDCGSNLDGLLRAADIAMYEAKRAGRQQYRFYDQNMNGRARSRLMLEESVRTA
FT                   IDGKDFSVVYQPQVHVADGRLRGFEALLRWQHPAVGEVPPALFIPLLEETRLINRLGSW
FT                   IFDQGAEQRQAWSRVFAADVVLSVCVSPTQFYMPNLASELKRAMDRFELKPGQIEVEIT
FT                   ESSLVHNLTHSHKQLKLLHDVGVRIALDDFGTGECSLSHLRNLQLDTLKLDRRFVANIV
FT                   ESRREAAMASSIIDLSRNLDMLVIAEGVETPEQYQWLADNGCQVMQGFLIAHPMVPEDA
FT                   LRFPGHFEVAGLRSSGLL"
FT   gene            580783..581307
FT                   /locus_tag="PSPPH_0500"
FT                   /note="PSPPH0500"
FT   CDS_pept        580783..581307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37139"
FT                   /db_xref="GOA:Q48P67"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P67"
FT                   /protein_id="AAZ37139.1"
FT                   /translation="MTAASHAPLKYLQAYPQTLQDQVHQLIAQNRLAGYLEQRYPERHQ
FT                   IQSDKALYAYALALKQDHLRNAPAIRKVLFDSRLDLTHRALGLHTKISRVQGGKLKASN
FT                   EIRVAALFKEAPAQFLKMIVVHELAHFRESDHNKAFYQLCEHMLPGYHQLEFDLRVYLT
FT                   YNELQASNGKL"
FT   gene            complement(581324..581620)
FT                   /locus_tag="PSPPH_0501"
FT                   /note="PSPPH0501"
FT   CDS_pept        complement(581324..581620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35985"
FT                   /db_xref="GOA:Q48P66"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P66"
FT                   /protein_id="AAZ35985.1"
FT                   /translation="MEVSKTKSSFYRRLYVAYLIDSKLASSVPELTAATGMPRRTAQDT
FT                   ISALSDLDIVCEFEQQEGARNHAGNYRIRNWGAIDKTWIARNLNSIKAVLGYP"
FT   gene            complement(581682..582140)
FT                   /locus_tag="PSPPH_0502"
FT                   /note="PSPPH0502"
FT   CDS_pept        complement(581682..582140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0502"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36674"
FT                   /db_xref="GOA:Q48P65"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P65"
FT                   /protein_id="AAZ36674.1"
FT                   /translation="MSIKWICKHHTELSIQQLYAVLQLRAEVFVVEQQCVYLDVDGQDL
FT                   TGDTCHLMAWQEDKLVAYLRLLDPIQQGGDVTIGRVVTAPSIRSRGIGHELMEQALENA
FT                   ERKWPDQPIYLSAQAHLQGYYSRYGFNPVGEVYLEDDIPHIGMRRDLD"
FT   gene            582368..583123
FT                   /locus_tag="PSPPH_0503"
FT                   /note="PSPPH0503"
FT   CDS_pept        582368..583123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0503"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37789"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P64"
FT                   /protein_id="AAZ37789.1"
FT                   /translation="MSQWLRAVGLLVFLLMAHASAAEKLRLVADPWPPFTDALLLNGGL
FT                   ATDIVNTALRRAGYTTLYEQVPWARAMLGLSEGRHDVLINAWFSEDRTKIGQFSAEYLL
FT                   NRVRFIKRKESPIEVRTHEQLHNYRIAVVRGYAYSPAFDGDSLLKKVPVQNFSTAVRML
FT                   AAERVDLTLEDEYVARYNLAMEAEAVRDRVEFLPGSLSENSLHILVSLKNPQHAKIVAD
FT                   FDREITAMKADGTYDELFRLHGLQQPPEL"
FT   gene            complement(583086..585284)
FT                   /gene="yccS"
FT                   /locus_tag="PSPPH_0504"
FT                   /note="PSPPH0504"
FT   CDS_pept        complement(583086..585284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccS"
FT                   /locus_tag="PSPPH_0504"
FT                   /product="hypothetical membrane protein, TIGR01666"
FT                   /note="identified by match to protein family HMM PF05976;
FT                   match to protein family HMM TIGR01666; match to protein
FT                   family HMM TIGR01667"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37051"
FT                   /db_xref="GOA:Q48P63"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P63"
FT                   /protein_id="AAZ37051.1"
FT                   /translation="MASKSLRHTFRRLWALDKFSYSVRVFIALTGSMALCWYQNEMALL
FT                   IPLFLGIIACALAETDDSWQGRLNALAVTLVCFSVAALAVELLFPYPWLFVCSLALASF
FT                   CLTMLGALGERYGAIAYGTLILSVYTMIGVDQRGGEVLDFWHEPMLLVAGAAWYGLLSV
FT                   LWQMLFSNQPVQQALARLFRELGQYLKLKSTLFEPIRTLNVEARRLELAQQNGKVVAAL
FT                   NSTKEIILHRVGSGRPGSKVSRYLKLYFIAQDIHERASSSHYPYNSLADAFFHSDVLFR
FT                   CQRLLRQQGVACQALSESIQLRQPFVYDPSFAEAMEDLHASLEHLRIQSNPAWRGLLRS
FT                   LRALAANLGTLDRLISDASNPDAVADATDSSLLDRSPRNLKDVWTRLRLQMTPTSLLFR
FT                   HALRLPLALTIGYAMVHLIHPSQGYWIILTTVFVCQPSYGATRRKLGQRIIGTAIGLTV
FT                   GWVLFDLVTSPILQSMCAVLAGVVFFVNRTTRYTLSTAAITVMVLFCFNQVGDGYGLFL
FT                   PRLFDTLLGSLIAGLAVFLFLPDWQGRRLNKVLANTLTCNSIYLRQIMQQYAKGKSDDL
FT                   AYRLARRNAHNADAALSTTLANMLMEPGHFRKEADVGFRFLVLSHTLLSYLSGLGAHRD
FT                   TQLPGDVREHLIDNVGATLAASIDEIAAGLAEKKPVAVQSDAEEALAAQLEQLPEEMDE
FT                   SQRLVQAQLALICRQLAPLRTLAAHLIKAPEAVAAHAV"
FT   gene            complement(585421..586638)
FT                   /locus_tag="PSPPH_0505"
FT                   /note="PSPPH0505"
FT   CDS_pept        complement(585421..586638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0505"
FT                   /product="conserved hypothetical protein TIGR00275"
FT                   /note="identified by match to protein family HMM PF03486;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33784"
FT                   /db_xref="GOA:Q48P62"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P62"
FT                   /protein_id="AAZ33784.1"
FT                   /translation="MGTIVTYRLRKHAVPVTDVVIIGAGAAGLMCAFTAAARGRRVILI
FT                   DHANKPGKKILMSGGGRCNFTNMYIEPANFLSQNPHFCKSALARYTQWDFIAMVAKHGV
FT                   PYHEKKLGQLFCDNKSSDILEMLLEECRQAGVSLHMDTSVQQIDKTESGYSLQTTLGTL
FT                   SCEALVIATGGLSIPTLGATGFGYQVGKQFGHTLLPTRAGLVPFTITDQLKELCTELSG
FT                   TSVDCLVSCNDTSFRENILFTHRGLSGPAILQISSFWQPGDTVEINLLPDHDVPAWLSQ
FT                   QQAERPNSELKTLLGEVFTKNMANLITEHWFVSKPMKQYTHAELADIADKLASWKVVPG
FT                   GTEGYRTAEVTLGGIDTREVSSKTMESLKSPGLYFVGEVLDVSGHLGGFNFQWAWASAY
FT                   AAAQYV"
FT   gene            complement(586776..588215)
FT                   /gene="dbpA"
FT                   /locus_tag="PSPPH_0506"
FT                   /note="PSPPH0506"
FT   CDS_pept        complement(586776..588215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="PSPPH_0506"
FT                   /product="ATP-independent RNA helicase DbpA"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF03880"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34481"
FT                   /db_xref="GOA:Q48P61"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P61"
FT                   /protein_id="AAZ34481.1"
FT                   /translation="MRSGWRVIHYATFLFCRSTVVTNTAFNSLPLSAAMLANLESLGYA
FT                   EMTPIQAQSLPVILKGMDLIAQAKTGSGKTAAFGIGLLNPINPRFFGCQALVMCPTREL
FT                   ADQVAKEIRRLARSEDNIKVLTLCGGVSFGPQIGSLEHGAHIIVGTPGRIQQHLRKGSL
FT                   VLDGLNTLILDEADRMLDMGFYDAIADIIEQTPQRRQTLLFSATYPVGIKQLSSKFMRD
FT                   PQTVKVEALHADSQIDQIFYEISPEQRLEAVVKVLGHFRPASCVAFCFTKQQVQEVVDH
FT                   LTAKGMSAVGLHGDLEQRDRDQVLAMFANRSTSVLVATDVAARGLDIDALDMVINVELA
FT                   RDSEIHIHRVGRTGRAGEKGIAVSLVAPSESQRARAIEELQKAPLNWQQYDQLSIKEGG
FT                   KLLPTMTTLCIGSGRKDKLRPGDILGALTGEAGIAGTQVGKIAIFDFQAYVAVERSMAK
FT                   QALERLNNGKIKGKSLRVRIL"
FT   gene            complement(588454..590091)
FT                   /gene="aceF"
FT                   /locus_tag="PSPPH_0507"
FT                   /note="PSPPH0507"
FT   CDS_pept        complement(588454..590091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="PSPPH_0507"
FT                   /product="pyruvate dehydrogenase complex, E2 component,
FT                   dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="identified by similarity to SP:P10802; match to
FT                   protein family HMM PF00198; match to protein family HMM
FT                   PF00364; match to protein family HMM PF02817; match to
FT                   protein family HMM TIGR01348"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34971"
FT                   /db_xref="GOA:Q48P60"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P60"
FT                   /protein_id="AAZ34971.1"
FT                   /translation="MSELIRVPDIGNGEGEVIELMVKVGDRIEADQSILTLESDKASME
FT                   IPAPKAGVIKAMKVKLGDRLKEGDELFELEVEGEAAAAPAPAAESAAAPAAAEKPAEAA
FT                   PAPAAAAPAPAASASVQDIHVPDIGSSGKAKIIELMVKVGDSIQADQSLITLESDKASM
FT                   EIPSPAAGVVESIEVKLDQEVGTGDLILKLKVEGAAPAAAPAPAASAPAAAPAKAEAAA
FT                   PAAAPAPKAEAAPAPAKDGAKVHAGPAVRQLAREFGVELSAVSATGPHGRVLKEDVQVY
FT                   VKTMMQKAKEAPAGGASGGSGIPPIPEVDFSRFGEIEEVPMTRLMQLGASGLHRSWLNI
FT                   PHVTQFDQADITDLEAFRVAQKGAAEKAGVKLTVLPLLLKSCAHLLKELPDFNASLAPS
FT                   GKAVIRKKYVHIGFAVDTPDGLLVPVIRDVDQKSLLQLAAEAAALAEKARNKKLTANDM
FT                   QGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYD
FT                   HRVINGAAAARFTKRLSELLADIRTILL"
FT   gene            complement(590234..592879)
FT                   /gene="aceE1"
FT                   /locus_tag="PSPPH_0508"
FT                   /note="PSPPH0508"
FT   CDS_pept        complement(590234..592879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE1"
FT                   /locus_tag="PSPPH_0508"
FT                   /product="pyruvate dehydrogenase, E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by similarity to SP:P06958; match to
FT                   protein family HMM TIGR00759"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35563"
FT                   /db_xref="GOA:Q48P59"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P59"
FT                   /protein_id="AAZ35563.1"
FT                   /translation="MQDLDPVETQEWLDALESVLDKEGEDRAHYLMTRLGELATRSGSQ
FT                   LPYAITTPYRNTIPVTHEARMPGDLFMERRIRSLVRWNALAMVVKTNLNDPDLGGHISS
FT                   FASSATLYDIGFNYFFQAPTDEHGGDLIYFQGHASPGVYARAFLEGRITEDQMNNFRQE
FT                   VDGNGLSSYPHPWLMKDFWQFPTVSMGLGPIQAIYQARFMKYLEHRGYIPEGKQKVWCF
FT                   LGDGETDEPESLGAIALAGRENLDNLIFVVNCNLQRLDGPVRGNAKIIQELEGVFRGAQ
FT                   WNVTKVIWGRFWDPLLAKDVDGILQRRMDEVIDGEYQNYKAKDGAFVREHFFNSPELKA
FT                   MVADLSDDEIWKLNRGGHDPYKVYAAYHEAVNHKGQPTVVLAKTIKGYGTGAGEAKNTA
FT                   HNTKKVDVDSLRHFRDRFDIPVKDSELEALPFYKPEEGSAEARYLSERRAALGGFVPQR
FT                   RAQSFSLPTPPLDTLKAILDGSGDREISTTMAFVRILAQLVKDKEVGQRIVPIIPDEAR
FT                   TFGMEGMFRQLGIYSSVGQLYEPVDKEQVMFYREDKKGQILEEGINEAGAMSSFIAAGT
FT                   SYSSHNQPMIPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRTTLNGEGLQHED
FT                   GHSHILASTIPNCRTFDPTYGYELAVIIQDGMRRMFEEQQDVFYYLTVMNESYTQPAMP
FT                   VGAEEGIVKGMYLLEEDTREAAHHVQLLGSGTILREVREAAKILRDEFNIGADVWSVTS
FT                   FNELRRDGLAVEHNNRLHPGQKPELSYVQQCLNGRKGPVIASTDYMKLFADQIRQWVPT
FT                   KEYKVLGTDGFGRSDSRKKLRHFFEVDRHFVVLAALEALADRGDIEPKVVAEAIAKFGI
FT                   DPEKRNPLDC"
FT   gene            593264..596221
FT                   /gene="glnE"
FT                   /locus_tag="PSPPH_0509"
FT                   /note="PSPPH0509"
FT   CDS_pept        593264..596221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="PSPPH_0509"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="identified by match to protein family HMM PF03710"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36678"
FT                   /db_xref="GOA:Q48P58"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P58"
FT                   /protein_id="AAZ36678.1"
FT                   /translation="MSLPLLAEFPAILLPLITRARQTFQAALTALSADALASFEAWPEA
FT                   RRKAFDRVCAASDFVTEQICRDPQMLLQLADSGELERSFSAGQLRGQIADALSSAASDD
FT                   ELGRNLRRQRARQQVRIIWRDLTRQADLIETCRDLSEMADASIDLAYQWLYPRHCEQFG
FT                   TPTGRHSGQPQHMVILGMGKLGAVELNLSSDIDLIFAYPEGGETQGTKRALDNQEFFIR
FT                   LGQRLIKALDPVTVDGFVFRVDMRLRPYGSSGALVLSFNALEQYYQDQGRDWERYAMIK
FT                   ARVVGGDQTAGAELLDMLRPFVYRRYLDFSAIEALRTMKQLIQQEVKRKGMAENIKLGA
FT                   GGIREVEFIAQAFQLIHGGRDLSLQQRPLFKVLKTLEGQGYLPSAVTEELREGYEFLRY
FT                   TEHAIQAIADRQTQMLPDNDQDQARIALIMGFADWVSFHERLMYWRSRVSWHFRQVIAD
FT                   PDSDPDDEQQDDSEVAVGGEWLPLWEESQDEDAAGRQLLQAGFVDAEKALKNLASLRSS
FT                   PNLRSMQRLSRERLDAFIPRLLAQAVEHEKPDLVLERVLPLVEAVARRSAYLVLLTENP
FT                   DALRQLLTLCAASPWIAEQIARFPLLLDELLNEGRLFNPPLAPELAAELRERLIRIPED
FT                   DLEQQMEALRHFKLAHSLRVAASEISGSLPLMKVSDYLTWLAEAILDQVLALAWRYSVA
FT                   RHGTPLRPDGTLCDPGFVIVGYGKVGGIELGHGSDLDLVFIHDGDLEAETDGAKPIDTA
FT                   QFFTRLGQRVIHLLTTQTNSGQLYDVDMRLRPSGASGLLVSSLGAFARYQANEAWTWEH
FT                   QALVRARVMTGSRDVGEQFEKVRADVLGRERDLGKLRAEVSEMRGKMRDNLGTRVTAAG
FT                   RAANAFEASVPFDLKQDAGGIVDIEFMVQYAALAWSREHPALLQYTDNIRILEGLEDAG
FT                   LLPDTDAGLLREAYKAYRSAAHRQALQKQAGVVSGDQFHAQRREVMRIWTQMGLS"
FT   gene            596351..597385
FT                   /gene="rfaF"
FT                   /locus_tag="PSPPH_0510"
FT                   /note="PSPPH0510"
FT   CDS_pept        596351..597385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="PSPPH_0510"
FT                   /product="ADP-heptose--LPS heptosyltransferase II"
FT                   /note="identified by similarity to SP:P37692; match to
FT                   protein family HMM PF01075; match to protein family HMM
FT                   TIGR02195"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34263"
FT                   /db_xref="GOA:Q48P57"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P57"
FT                   /protein_id="AAZ34263.1"
FT                   /translation="MKILIVGPSWVGDMVMAQTLFQCLKQRHPECEIDVLAPEWSRPIL
FT                   ERMPQVRAALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIPKR
FT                   TGWRGEFRYGLLNDVRTLDKQRYPLMIERFMALAFDKSTELPRPYPKPSLRIDTATRDA
FT                   ALSKFGLTLDRPVLALCPGAEFGESKRWPAEHYAQVADASIREGWQVWLFGSKKDHPVG
FT                   ESIRQELIPGLREESVNLSGETSLAEAIDLLSCADAVVSNDSGLMHVAAALNRPLVAVY
FT                   GSTSPGFTPPLADAVEVVRLGIECSPCFERTCRFGHYNCMRLLEPDAVIQALSRLNSTP
FT                   VEVA"
FT   gene            597388..598452
FT                   /gene="rfaC"
FT                   /locus_tag="PSPPH_0511"
FT                   /note="PSPPH0511"
FT   CDS_pept        597388..598452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /locus_tag="PSPPH_0511"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by similarity to SP:P24173; match to
FT                   protein family HMM PF01075; match to protein family HMM
FT                   TIGR02193"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35053"
FT                   /db_xref="GOA:Q48P56"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P56"
FT                   /protein_id="AAZ35053.1"
FT                   /translation="MRVLLIKTSSLGDVIHALPALTDAQRALPGIRFDWVVEEGFAEIP
FT                   AWHPAVDRVIPVAIRRWRKRLWQTFRSGEWRRFKQQVREQRYDLVIDAQGLFKSAWLTR
FT                   YVDAPVAGLDRDSAREPVASRFYDRAFAVPRGQHAVERLRQLFAQALGYPQPSGMGDYG
FT                   LKPLATLDDTLQAPFVLFLHGTTWDTKHWPELYWRQLAELMAARGLQVQLPWGNPAEKA
FT                   RAERIADGLDSAHVLPKLNLAGVARVLASAQACVAVDTGIGHLAAALDVPTISLFGPTN
FT                   PGLTGAYGKSQVHLASDYPGCTPCLQKKCTYQPTADDQRRFDLKREWPMCFTRLNPERV
FT                   ASQLGALLLAKEPG"
FT   gene            598452..599573
FT                   /gene="rfaG"
FT                   /locus_tag="PSPPH_0512"
FT                   /note="PSPPH0512"
FT   CDS_pept        598452..599573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="PSPPH_0512"
FT                   /product="lipopolysaccharide core biosynthesis protein
FT                   RfaG"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34248"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P55"
FT                   /protein_id="AAZ34248.1"
FT                   /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQQRGHQIRVYTLIWEGDV
FT                   PPGFEVLVAPVKAFFNHRRNEKLTAWMEADLARRPVDRLIGFNKMPGLDVYYAADGCFE
FT                   DKAQNLRSPLYRKWGRYRHFADYERAVFAKDSKTQVLMISEVQQPLFIKHYHTPASRFH
FT                   LLPPGISQDRRAPPDAPDIRAGFRKEFGLADNDLLLVQIGSGFKTKGVDRSLKALAALP
FT                   AELKKRTRLFVIGQDDPKVFQLQSAALGLGEQVTFMKGRSDIPRFLLGADLLIHPAYNE
FT                   NTGTVLLEALVAGLPVLVSAVCGYAHYIAEADCGRVLDEPFDQVQLNRYLSDMLEDDGA
FT                   RSAWGRNGLAFADTADLYSMPQHAADVILAEHY"
FT   gene            599573..600379
FT                   /gene="rfaP"
FT                   /locus_tag="PSPPH_0513"
FT                   /note="PSPPH0513"
FT   CDS_pept        599573..600379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaP"
FT                   /locus_tag="PSPPH_0513"
FT                   /product="lipopolysaccharide kinase RfaP"
FT                   /note="identified by similarity to SP:Q06995; match to
FT                   protein family HMM PF06293"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34771"
FT                   /db_xref="GOA:Q48P54"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P54"
FT                   /protein_id="AAZ34771.1"
FT                   /translation="MKLFLAEPFKSLWAGRDAFVEVEGLSGEVYRELEGRRTLRTEVNG
FT                   RGYFVKIHRGIGWGEIAKNLATAKLPVLGAGKEWEAIERLHEVGVPTMTAVAYGERGSN
FT                   PAAQHSFIVTEELAPTTSLEDVSLNWRTQPPEPRLKRAFIAEVARLVGMMHRAGVNHRD
FT                   CYICHFLLHIDTPVTADDFRLSVIDLHRAQTRRAITPRWRNKDLAALYFSALDIGLTRR
FT                   DKLRFLKGYFQKPLREILRKEAPLLSWLEKKADKLYQRKVRYGDAL"
FT   gene            600379..601113
FT                   /locus_tag="PSPPH_0514"
FT                   /note="PSPPH0514"
FT   CDS_pept        600379..601113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0514"
FT                   /product="lipopolysaccharide core biosynthesis protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF06293"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34058"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P53"
FT                   /protein_id="AAZ34058.1"
FT                   /translation="MAGWKLEPEYAFLEQDFGSLDAVFALQGQQLTRDPLSDVIRVERA
FT                   GVYYYVKRYVGAGKGLRRYIGKPRVKSEWQNLKRFAKWGIPTAEVVAWGLERNGAAYDR
FT                   GALITRGLPNTEDLSALAQRKDPRLTDRHWVDAVSRQLAACTRTMHDNHFTHNDLKWRN
FT                   LLVDDEGKLFFIDCPNGAFWWSFMLRYRITKDLACLDKVAKYHLSATQRLRFYLQYRHR
FT                   TRLNASDKKRIRHIVSFFEGRE"
FT   gene            601110..601889
FT                   /locus_tag="PSPPH_0515"
FT                   /note="PSPPH0515"
FT   CDS_pept        601110..601889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0515"
FT                   /product="lipopolysaccharide biosynthesis protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF06293"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33288"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027023"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P52"
FT                   /protein_id="AAZ33288.1"
FT                   /translation="MSVFIASADQPLLARHNLADFESLWNIRLDAVDEPNTGRGGWSSV
FT                   FRLDLDGQGFYLKRQSNYLTHTLHHPFGEPSFSREFRNISRYRKLGIPALQAVFYGERK
FT                   VDGEYRAILMTRALDGWTDLDELLQQWNQMESVQRLAVLHACGQLVRTLHGAGQVHGCF
FT                   YPKHIFLQAVGKGYQAQLIDLEKTRPVIFGKRDLARDLEPLLRRAPMWNEADRRELLAA
FT                   YLQATPNSLLVDAWNARLGKRGAHKRDLQHRDDKETR"
FT   gene            601889..603334
FT                   /locus_tag="PSPPH_0516"
FT                   /note="PSPPH0516"
FT   CDS_pept        601889..603334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37565"
FT                   /db_xref="GOA:Q48P51"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P51"
FT                   /protein_id="AAZ37565.1"
FT                   /translation="MRLSELKTAGRTPELPMSLTLADAAGSAELQLLTLLRVLPGQRYV
FT                   GAGVWRGRTVLAKLLVGDKAARHFQRELAGVRLLAEQGLTTPLLLADGLQDGEGGWLLF
FT                   EFLEQASSLGDAWNTVQDLPPLADEQQAVLGEALSAIARQHAKGLWQEDLHLDNLLRDN
FT                   GQLYLIDGAGIRAEQAGTPLSRQKVLENLGVFFAQLPRSFEPFTEELLVHYLLSNAEHG
FT                   LPMEALQKQIDKVRSWRLKDFMSKTVRDCSLFSVEDRASMFRAVRREEESAMLPVLDQA
FT                   DALLDKGHLYKTGGAASVGRVEISGRTLVIKRYNIKNFSHWLKRFWRPSRAWHSWREGN
FT                   RLMFLGIATPKPLAVQEKRFLGLRSKAWLVTEFIEGPDIIEHFAPHVETGDAPEAELLA
FT                   LDTLFAQLIQARISHGDFKGHNLFWHTDRWAMIDLDAMQQHSSHSSFAAAYARDRARFM
FT                   RNWPVQSALHQMLEQRLPKITPD"
FT   gene            complement(603345..608687)
FT                   /locus_tag="PSPPH_0517"
FT                   /note="PSPPH0517"
FT   CDS_pept        complement(603345..608687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0517"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36921"
FT                   /db_xref="InterPro:IPR020972"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P50"
FT                   /protein_id="AAZ36921.1"
FT                   /translation="MTFAMRANDPDSEDRVTRQALIQAAIDMRGLLGPACMLELRELTN
FT                   RQRQYHRNLPDWMKIASEADLQTYARHLQHYDEAHAALLSVLGSAASPEHFAEARLRIR
FT                   LADDLGHDLDPRALTIDTRRTLPSTSEIYRVTCSLVELALYGLHPDDESAGSDFIDHTV
FT                   ITLDGKPLDAACSALNPAYLAGVIDELDLRAEFGECQRKAYQQEHNREMLCALARTRLT
FT                   AQGWAAKMQGHIQPGDFAMVAALTGPAARASDPALRVQQIKLNDCYVMARLLVFRKQDA
FT                   EGRTQRLIMIATDAPGQQHFKAFDTETQLLHEVVGWAASPSMVNYLLDQVEVDARAALA
FT                   EQLTALALKPQPSKNFIQFIDHADCESALRHFTDEQTGVLLSEQARHTPDWYLRASRAQ
FT                   RRELLALEQAIGGALDNYQAQPHTGVQPFKAYVHQRASQQIGKLLNVPAGTVDPDLIVI
FT                   TTERETLTYTNMLLNGYDDSIDPLRASAATNATFSGPEGIDVSALSAAAVAGSVRGQWL
FT                   ADEYIALIRNTLLNSESEGYAYRRHFSVMITQLQMQAAALRSALKGHIEAAHHVWLKQS
FT                   LDNAHLDDTTSRERYPLYPLQVHVDKPLIASGLTGVDQLVIPSTLLTHVETVQGCLVNL
FT                   PTQTRHAALLYTPQAPDGIEFRLFSDFVRSLASDGMIDYYKDRCRIKARRTLSFLLRDM
FT                   QQGKANKPPVIPKAFISDFADTCFNRPLERRLRDVEETTTGRNDMLARLIRVSVEIIAT
FT                   ALTLPFPPASFAVGSLLSLHDSGQAVAALTEGDQQRAATYMLSALFNGIGAGSDLLVGI
FT                   KGFGGVLHRLERGHQSPPVLRSFQRQSSLPRYEDLYPVELQEQVFLIGKPNAHGHAAVF
FT                   HAPHVASAPPMATGQFALREAAGAWQPLLPPPNAVARVPSGLRTDLAVDVSLDNVPRIT
FT                   DGHAKGVYALSGKNYIRLSDRTFEVQYDAHLRCWQIIDPANPFAFFGKQPVRLNDQDQW
FT                   LVVDRRLRGGGLDAPGSYRPLPEGAAAGSLDMLIDYEMPSTMRAHLDIVISKEVFDPTG
FT                   AGLEVYFETYFTEIRQTFTAFREKLYQDAQAFFARFSAPPRPALPAYGLPGKVETLIEH
FT                   IFTHSNGLVFSEAPRSVASKRLLLLNMPLLAEQRVEVLYIEHLLTDKHLRKLARYRQLG
FT                   KKSRSGSHELKYYLHDVNRGALNNSSSEYDYYHLIKEAHRHGIEVRPFSSSISYPFFGH
FT                   PVLAAADDPAAASKMSNFFGHRLISQDIAPGSSKRWVALLDQKLATTHDQVPGIAEMQG
FT                   VVSVHVQDIPAGRPTRISEGTNGSHQNTPTRCDFTIAFADPALPGVPLPPATPVDDMLI
FT                   RELRGSVAEGEHWAGQYGFVHGENTTWLRVPPEEWNADSPMTAIQQSLADATYEMPLDT
FT                   RTTLHTLANFERKGLDMEYFFEDINLDTVRNTFAQRRKNLQKDAATIRSAQLPPRPTLP
FT                   AIEPQTSPAGLLETLYRHTEGVVIGESHFSVSSKKLIIDNLPLLARQNVKTLYMEHLLT
FT                   DLHQADLDRFFETGQMSKTLLHDLKILDRGHHTDPDKVYNFEQLIIKARQYGLEVRAID
FT                   CASSYHLKGIAREESITRQQMMNYFASRTIRRHQDVMGSHKWIALVGNSHSNTYQGVVP
FT                   GIAELQGGIGLRVIDVAPGKSTGVVPDPGELVTGGITNEQVYIKGDYRVAMEVSRPESA
FT                   RLLSIDQRLFKPGMFLVQQGEGDLQTIVHRARDTWIHRTPVQRNAEGKLYLERVRWPRI
FT                   HLKPFDDMDALVAALEAMNLTHIA"
FT   gene            complement(608656..609282)
FT                   /locus_tag="PSPPH_0518"
FT                   /note="PSPPH0518"
FT   CDS_pept        complement(608656..609282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36218"
FT                   /db_xref="GOA:Q48P49"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P49"
FT                   /protein_id="AAZ36218.1"
FT                   /translation="MTALGGSDVSERELEIFSLLQQTDDYWTDPGKNAESRRDRLVPAL
FT                   QRALRDEASVRIHERDLESGYLVCLPDSPDQSPALTYASLHMQLHDDEHVEMAGALAIS
FT                   EEQGRTLLMLPGLGIMGFATQALMLATLARWLNTATLQDALLNTMEKRHQDLLFKISQD
FT                   ADLYLEPFTTEDLQLQPVTTAPFVHALDRLLNKQRNDIRHACERP"
FT   gene            609740..611497
FT                   /locus_tag="PSPPH_0519"
FT                   /note="PSPPH0519"
FT   CDS_pept        609740..611497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0519"
FT                   /product="carbamoyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF02543"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35489"
FT                   /db_xref="GOA:Q48P48"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P48"
FT                   /protein_id="AAZ35489.1"
FT                   /translation="MALTILGLSGALSHDPSAALYIDGKLIAAAEEERFVRDKHAKNRM
FT                   PYESAKFCLEQAGIKPSDVDVVAIPFAPISLFGKARWHYAKRYWYAPDRALDALLMGNR
FT                   RYKRYRNKIVWCLEQLGFDPKKIKIEPVEHHLAHASSAYHCSGFTEKTAIMGIDGKGEY
FT                   ATTFFGYGENGKIHKIKEFFDPDSLGGLYGAITEFLGFEMLDGEFKVMGMAPYGDASKY
FT                   DFSRLATFENGELIINTELANVIGLRRYKENGKGFYFSPKLIEWLGPKRVGDVADEPYI
FT                   HYAASMQALFEKLALQMMDHYLGDILKETGKIAFAGGCALNVKLNQRIIARPEVKELFV
FT                   QPASGDAGTAVGAAAYVSHARGVPVEKMEHVYLGPAYSNEDVIAACARHPSKPVWRQID
FT                   NTPQRIAEIMVKGNPVAWFQGRMEFGPRALGGRSIIGCPSVTGVADRINHQIKFRERWR
FT                   PFCPSMLDTVAPQMIKIDHPAPFMTFTFEVAEEWKTRVPEVVHEDGTSRAQVLKREYNP
FT                   RYYDMMKALEELTGNGVSLNTSLNRRGEPMICSPTDALNMFFGSDLEYLIMEDILVVKE
FT                   GVEAYDTLG"
FT   gene            611481..612611
FT                   /locus_tag="PSPPH_0520"
FT                   /note="PSPPH0520"
FT   CDS_pept        611481..612611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0520"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37054"
FT                   /db_xref="GOA:Q48P47"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P47"
FT                   /protein_id="AAZ37054.1"
FT                   /translation="MTRSVERHVLQFCHGYDGPFLDCARQYASLFAGKGYRVTTVFLTG
FT                   AADPDVVADCGSDEVLFMEYSSSAIRGLKLGAIRDLRKIAATRSFSFCIAHRFKPVYIA
FT                   LLATKLPVIGVHHAFGDYHRRSRKLFANLFRKRLSLLGVSDAVRDDMRSSLPKWPAERI
FT                   QTLYNRIDVEQLQGSQFSAEDARAELGLSASAWIVANVGRLHPDKDQATLLRGFAEALP
FT                   NLPENSQLVILGKGRLEENLKALALELGIGPQVLFLGQVPDARRYFKAFDVFALSSDHE
FT                   PFGMVLLEAMVAGVPLVATSCGGAKEVVEDVGLLFPLGDVHSLAHGLVHMAGLDAEQRQ
FT                   DCAERMLLRLRERFSDHAVRDVFWRLPQVSSLTAGA"
FT   gene            612611..613507
FT                   /locus_tag="PSPPH_0521"
FT                   /note="PSPPH0521"
FT   CDS_pept        612611..613507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0521"
FT                   /product="Mig-14 family protein"
FT                   /note="identified by match to protein family HMM PF07395"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33193"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P46"
FT                   /protein_id="AAZ33193.1"
FT                   /translation="MLNRFKGWRERGWVQIDAAAYEQAWQRLGGSVATHPLVVARLSEF
FT                   SGIAVRYLAWEQGGEVKAAIATWGRSLALSKDELKRHGKKGLFDLGNAELILPVADDIQ
FT                   VPVRHRARYVSALNEGRISTFRPQTESLAMARTPEELSKKFRYNQRRELRLLEEAGGTV
FT                   RPVSEFSSAELASMYCDLFQRRWGFEATGARHKADVIELLRELLIGSVVCLNDAPIAIQ
FT                   LVYRVEAPQWVSIEYVNGGVDPETRDFSPGSVLSFVNTQSAWENARALGKSLRFSFGRA
FT                   DREYKDRWCNPVPVFQI"
FT   gene            613474..614913
FT                   /locus_tag="PSPPH_0522"
FT                   /note="PSPPH0522"
FT   CDS_pept        613474..614913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34870"
FT                   /db_xref="GOA:Q48P45"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P45"
FT                   /protein_id="AAZ34870.1"
FT                   /translation="MVQPRSGVPDLSRKQQLLKRHRRNKRLALLGGLLLLIAVGVLVAW
FT                   WLAPLLAVCAWVAHEAWFADHLFYSPSDDYQYNFAADSEVPGVRLDGGTLLIDPAVQLT
FT                   GDETLILALTVKSTWLGRFLDPVVELQGQALSDRQAFERGVCGVRYLNLTGLGEPLAAG
FT                   ALQLRGRFCRFAGTPRLWLFRQADARKQRVMVIAPHADDAELAAFGLYSQAEEAWIVTL
FT                   TAGEIEAEHYRQMGMQRAEAARMKGRLRAWDSIAVARWGGVPESQCVQLGYFCLQLPAM
FT                   QAAPDTPVASREADLTDTRLFRQFNTLPLPGDDGLPTWNNLLADLRALVLKARPQVIVM
FT                   PHPAIDPHPDHICAQAAVREALAGLEWQPDVVLGYANHLHDNDRWPMGDAYSGISLPPV
FT                   FDASLPLVPYSLHLSVAAQRDKAMALGMMHDLLPPMPFKRRVRRTLQRVLAGRHWPAEG
FT                   ENEFFRKAVRRHELFWRSRDI"
FT   gene            614944..615900
FT                   /locus_tag="PSPPH_0523"
FT                   /note="PSPPH0523"
FT   CDS_pept        614944..615900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34317"
FT                   /db_xref="GOA:Q48P44"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P44"
FT                   /protein_id="AAZ34317.1"
FT                   /translation="MKVLLLVQKEQRAILDRLYDGIAAHCECDVRWLSSAEQRNLRGYF
FT                   RREVDVSRYDRIVFFLRFKQEVRQVGFIRTIPNLVILEHDAYQNYIPCKYTGKFSAHYR
FT                   KLPWARVICSGFMVSERLRQEGFDAVFVPKGYDQSLLQLQARERDIELAFVGSTNSVAY
FT                   SGRKALLDELGQVENLLVTRTKSGEEYCDTLNRIRFFVSADVGMGEYMIKNFEAMACGC
FT                   VLLAFDQGAEENRALGFVDMHNIVLYRDIPQLREKLAMLRENTVLASEISCNGQTLVEE
FT                   RFTFHALGKAIVDAMHSPLRSMPAMSWLDRLRSRLGW"
FT   gene            615935..616705
FT                   /locus_tag="PSPPH_0524"
FT                   /note="PSPPH0524"
FT   CDS_pept        615935..616705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33732"
FT                   /db_xref="GOA:Q48P43"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P43"
FT                   /protein_id="AAZ33732.1"
FT                   /translation="MVFSENSDITLVVTSCGRFDLLKRTLETFDHFNTAPIRHVLITED
FT                   SGDARVQACIPEHWHPHTRFIINNPKLGQMRSVDAAYSLIETSWVFHCEDDWDFYRPHF
FT                   IEESMTLLEHDPQALQVWLRSYNHDLRIHSPYVYLNEREVFEGIPFYKLGSHKPEWQGF
FT                   SFNPGLRRLADYQQHAPYAEHGGEKKLSQLFASQNRYALILENDAVLHTGFGEHVVVPQ
FT                   ERLDKQRRKRRDRVKLIIAVLAGLVTGWLLNNVS"
FT   gene            616695..617864
FT                   /locus_tag="PSPPH_0525"
FT                   /note="PSPPH0525"
FT   CDS_pept        616695..617864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0525"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33185"
FT                   /db_xref="GOA:Q48P42"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P42"
FT                   /protein_id="AAZ33185.1"
FT                   /translation="MSVDRITIPSNKVQTYFTVAIVVFLLSFILNPSAKITNNLFYAFT
FT                   ALPGLFFLIKYRGTGVFAEPLGIAWAVFMACFLVPALQAQEFQYYKHIVYVSLFVFVVA
FT                   GITENGFFRRGLFVRGMFWAICLYILLSSIYSWVTGKFEFGQRVAILPGRMENVIYTSA
FT                   WLVCSLALALPLWARERRWIEAVSAVLVTLVLTAFVVQTRTALVGAAFLFAICTAYSLY
FT                   RFTLRTAVALLVAGVLAAIGFWLVKDEQWVALLMVRGDSYRVELFEIMTGEWRRCGWVQ
FT                   GCGVDFYTTQTLTGGMPIQHPHNIFVSLGLYTGAASLVMFLVVMAMTLWNALRNGDAWG
FT                   LYLACALLMLNFDGGQLVGNPDELWVLVLLPATMVLGRIVQAHRLRQQQ"
FT   gene            complement(617912..618592)
FT                   /locus_tag="PSPPH_0526"
FT                   /note="PSPPH0526"
FT   CDS_pept        complement(617912..618592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0526"
FT                   /product="toluene tolerance protein, putative"
FT                   /note="identified by similarity to GB:AAD17955.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37078"
FT                   /db_xref="GOA:Q48P41"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P41"
FT                   /protein_id="AAZ37078.1"
FT                   /translation="MTTSSPWGIKTGVSMQAFDHAHYLDLVQGAEVLEADGTGDKVLRL
FT                   RDGSMLKLFRRKRLVSSAAWYPYAQRFADNCETLIKRGIPCPRIRSVSRIAEIERDAVH
FT                   YDPLAGFTLRQLLGSAVADDKLRRQLGSFIAHLHEKGIYFRSAHLGNVILTPEGTLGLI
FT                   DIADMKTYRRALRKSLRLRNFKHMLRYQEDRQWLLDNGNPAFLDGYMSAQSLCDTSELV
FT                   QAIQ"
FT   gene            618657..620531
FT                   /gene="msbA"
FT                   /locus_tag="PSPPH_0527"
FT                   /note="PSPPH0527"
FT   CDS_pept        618657..620531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="PSPPH_0527"
FT                   /product="lipid A export ATP-binding/permease protein MsbA"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM TIGR02203"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36650"
FT                   /db_xref="GOA:Q48P40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P40"
FT                   /protein_id="AAZ36650.1"
FT                   /translation="MLPQQAAAKTAVIQFGLFLIRRILMTTSESSSTSSVKIYFRLLSY
FT                   VRPHVGIFLLSIIGFVIFASTQPMLAGILKYFVDGLTNPEAVLFPNVPYLRELQLLQAV
FT                   PLLIVLIAAWQGLGSFLGNYFLAKVSLGLVHDLRVELFNKLLVLPNRYFDTTNSGHLIS
FT                   RITFNVTMVTGAATDAIKVVIREGLTVVFLFIYLLMMNWKLTLVMLAILPLIAVMVGSA
FT                   SKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGESYEQNRFAQASDSNTRKQLRM
FT                   TKTGAIYTPMLQLVIYSAMAVLMFLVLFLRGDATAGDLVAYITAAGLLPKPIRQLSEVS
FT                   STIQKGVAGAESIFEQLDVEEEVDTGTIERDRVTGHLEVKNLSFFYPQTERQVLNDISF
FT                   SAAPGQMIALVGRSGSGKSTLANLIPRFYGHEMGNILLDGVEINDYRLRNLRKHIAQVN
FT                   QNVTLFNDTIANNIAYGDLAGAPRADIEAAAADAYAKEFIDQLPQGFDTQVGENGVLLS
FT                   GGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDHVMKGRTTLVIAHRLST
FT                   IEKADMILVMDAGQIVERGTHTELLAQNGYYARLHAMGLDEPSPVGAV"
FT   gene            620659..622083
FT                   /gene="rfaE"
FT                   /locus_tag="PSPPH_0528"
FT                   /note="PSPPH0528"
FT   CDS_pept        620659..622083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="PSPPH_0528"
FT                   /product="rfaE bifunctional protein"
FT                   /EC_number="2.7.-.-"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM PF01467; match to protein
FT                   family HMM TIGR00125; match to protein family HMM
FT                   TIGR02198; match to protein family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35956"
FT                   /db_xref="GOA:Q48P39"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P39"
FT                   /protein_id="AAZ35956.1"
FT                   /translation="MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQ
FT                   IEDRPGGAANVALNIAALGAPASLVGVTGDDEAAESLANSLKAAGVLARFQRIANQPTI
FT                   VKLRVISRHQQLLRIDFEEAFNTDPLALSAEVYSLLDGIKVLVLSDYGKGALRNHQALI
FT                   QAARKRGIPVLADPKGKDFTIYRGASLITPNLSEFEAIVGHCEDEAQLVTKGAQLMQEL
FT                   DLGALLVTRGEHGMTLLRPDQQALHLPARAREVFDVTGAGDTVISTLAAAIAAGEELPH
FT                   AVALANLAAGIVVGKLGTAAISAPELRRAIQREEGSERGVLGLEQLLLAVDDARAHKEK
FT                   IVFTNGCFDILHAGHVTYLEQARALGDRLIVAVNDDASVSRLKGPGRPINSVDRRMAVL
FT                   AGLGAVDWVISFPEGTPENLLSHVKPDVLVKGGDYGVDQVVGADIVQAYGGDVRVLGLV
FT                   ENSSTTAIVEKIRGQG"
FT   gene            complement(622131..623087)
FT                   /locus_tag="PSPPH_0529"
FT                   /note="PSPPH0529"
FT   CDS_pept        complement(622131..623087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34949"
FT                   /db_xref="GOA:Q48P38"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P38"
FT                   /protein_id="AAZ34949.1"
FT                   /translation="MPRTLIRKNPSNFKTLPLFVEATPEGLSYQSIGMPMNFAQTLQRR
FT                   RKIDVPDTERFSTELANLGVSVRLTVSWQNRDYWVLVRQRRQDRGDVVLKLISGYVPAH
FT                   ELTLPLHTAIQEVAEECMIETPQGWLSGLFKETWLPAPYAAALHYREAMPFRLSPLSGA
FT                   ARPVRSGSLTLLERPRAYVHLPTASLQLIYDMRLEIPKEARPVSLFHVDEVLENDQLVA
FT                   RLNRSKPDLYLMPLENGVPLPELYTLKRDKLIPAGTRGLYLAESFAAQDGWIVREERIR
FT                   WKDWLRQQGMAPPAKKSGLKRLTGKARELLHAMSGKL"
FT   gene            complement(623124..623933)
FT                   /locus_tag="PSPPH_0530"
FT                   /note="PSPPH0530"
FT   CDS_pept        complement(623124..623933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0530"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34221"
FT                   /db_xref="GOA:Q48P37"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P37"
FT                   /protein_id="AAZ34221.1"
FT                   /translation="MKTLHDLHRPLGNSGLSVSPLGLGTVKLGRDQGVKYPSGFKIPDD
FT                   QQAQMLLRMARDMGINLIDTAPAYGTSEERLGPLLRGQRQDWVIVSKVGEEFDNGQSSH
FT                   DFSAEHTRKSVERSLKRLETDFLDLVLVHSDGNDLAILNEAEVYQTLADLKREGKIRGF
FT                   GFSGKTVEGGLLALREGDCAMVTYNLNEQGEKPVLDYAAAHGKGILVKKALASGHVCLT
FT                   PGMDPVQASFQLLFEHPAVASAIVGTINPLHLAHNVATAAAVICRQA"
FT   gene            complement(623936..625111)
FT                   /locus_tag="PSPPH_0531"
FT                   /note="PSPPH0531"
FT   CDS_pept        complement(623936..625111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0531"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36698"
FT                   /db_xref="GOA:Q48P36"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P36"
FT                   /protein_id="AAZ36698.1"
FT                   /translation="MTSVISTDVLIVGAGVAGLWLNARLRRQGFSTVLVESASLGGGQS
FT                   LKSQGIIHGGAKYALHGALSGASEAIADMPRRWREALDGKGELDLSGVRLLSEAHYLWS
FT                   PGTIAGNLTSFFASKAVRGRVDQVKGEQLPPALQNPKFKGKVYRLAELVVDVPSLIERL
FT                   AELAGDSLLAGQSIEPLYEGDELIGLRVDGRDIHAQRIVLSAGGGNADLLNALGVSQPQ
FT                   MQRRPLHMVLVKGPTLKPLFAHCLGGGPKPRITVTTHPAADGQCVWYLGGDLAEAEGVS
FT                   REPDAQIAVARKELEALLPWVDLSQAQWATLRVDRAEPAQSGLVRPDNAFLDSQRRLMV
FT                   GWPTKLALAPDFADRVLSQLSRDGIHPTPQLPLVDVPRPPMAIPVWDELLP"
FT   gene            complement(625160..625492)
FT                   /locus_tag="PSPPH_0532"
FT                   /note="PSPPH0532"
FT   CDS_pept        complement(625160..625492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0532"
FT                   /product="transporter, small multidrug resistance (SMR)
FT                   family"
FT                   /note="identified by similarity to SP:Q57225; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36127"
FT                   /db_xref="GOA:Q48P35"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P35"
FT                   /protein_id="AAZ36127.1"
FT                   /translation="MNAYYLLAIAVCAEVIATTSMKAVKGFSTPLPLLLLITGYAIAFW
FT                   MLILVMRTIPVGITYAIWSGMGIVMVSIAAFFIYGQKLDLPALLGMGMIVAGVAVIQLF
FT                   SKTAGH"
FT   gene            625562..626842
FT                   /gene="kdtA"
FT                   /locus_tag="PSPPH_0533"
FT                   /note="PSPPH0533"
FT   CDS_pept        625562..626842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="PSPPH_0533"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="identified by match to protein family HMM PF04413"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34296"
FT                   /db_xref="GOA:Q48P34"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P34"
FT                   /protein_id="AAZ34296.1"
FT                   /translation="MNRTLYTLLFHLGLPLVALRLWLRARKAPAYRQRIGERFASGLPA
FT                   MQRGGIWVHAVSVGESIAAAPMIRALLLQYPQRPITVTCMTPTGSERIKALFASEPRIQ
FT                   HCYLPYDLPWAAGRFLDYVQPRLGIIMETELWPNHIHQCALRGIPVVLANARLSERSAR
FT                   GYARFARLARPMLAQMAWFAVQTEVEAQRFRDLGARPECVAVTGSIKFDLSIDPQLLER
FT                   AAHLREQWQATQRPVWIAASTHAGEDESVLSAHRTLLTSHPDALLILVPRHPERFDSVH
FT                   ALCQQQGFATVRRSSAQAVTPEVSVLMGDTMGELLFLYALADIAFVGGSLVPNGGHNLL
FT                   EPAALAKPVLSGPHLFNFLEIAAMLRTAGALQEISDATTLATAVQGLFDQPQQARGMAD
FT                   AGLAVMKANQGALQRLLDGIGRLMGKR"
FT   gene            complement(626965..628380)
FT                   /locus_tag="PSPPH_0534"
FT                   /note="PSPPH0534"
FT   CDS_pept        complement(626965..628380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0534"
FT                   /product="outer membrane efflux protein TolC, putative"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01844"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34719"
FT                   /db_xref="GOA:Q48P33"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P33"
FT                   /protein_id="AAZ34719.1"
FT                   /translation="MAVSFASSGLTWAADMPLPTQTGLLNVYQQAVDNNADLAASRADY
FT                   DARKEAVPQARAGLLPNISGSAQSNNTRTSIDQPRTVATRSGNVYQATLSQPIFRADRW
FT                   FQLQAAEASNEQAALELSATEQNLILQAAQSYFSVLRAQDNLASTKAEEAAFKRQLDQA
FT                   NERFDVGLSDKTDVLQAQASYDTSRASRILAKRQVDDAFQALVTLTNREYNSIEGIVHT
FT                   LPVLAPTPNDAKAWVDTAAQQNLNLLASNYAVSAAEETLRQRKAGHAPTLDAVATYQRG
FT                   DNDALGFSNPNYTGRNYGGDVEQRSIGVQLNIPIYSGGLTSSQVREAYARLSQSEQRRE
FT                   SLRRQVVENTRNLHRAVNTDVEQVQARKQSIISNQSALEATEIGYQVGTRNIVDVLDAQ
FT                   RQLYASVRDYNNTRYDYILDNLRLKQAAGTLNPGDLQDLSRYLKADYNPDKDFLPPDLA
FT                   TAAQKNFERPAKR"
FT   gene            628826..630715
FT                   /gene="thiC"
FT                   /locus_tag="PSPPH_0535"
FT                   /note="PSPPH0535"
FT   CDS_pept        628826..630715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="PSPPH_0535"
FT                   /product="thiamin biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35394"
FT                   /db_xref="GOA:Q48P32"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P32"
FT                   /protein_id="AAZ35394.1"
FT                   /translation="MSTTLKNAAHLSESAQVDSGSVQPFTRSQKIYVQGSRPDIRVPMR
FT                   EITLDVTPTDFGGEINAPVTVYDTSGPYTDPNVIIDVRKGLADVRSPWIDSRNDTERLA
FT                   GLSSNFGQQRLSDAELTALRFAHVRNPRRANAGANVSQMHYARQGIITAEMEYVAIREN
FT                   MKLQEARAAGLRTQQNAGHSFGASIPKEITAEFVREEIARGRAIIPANINHVELEPMII
FT                   GRNFLVKINGNIGNSALGSSIEEEVAKLTWGIRWGSDTVMDLSTGKHIHETREWIIRNS
FT                   PVPIGTVPIYQALEKVGGAAEDLTWELFRDTLIEQAEQGVDYFTIHAGVLLRYVPLTAK
FT                   RVTGIVSRGGSIMAKWCLAHHQENFLYTHFEDICEIMKAYDVSFSLGDGLRPGSIADAN
FT                   DAAQFGELETLGELTKIAWKHDVQTMIEGPGHVPMQLIKENMDKQLECCDEAPFYTLGP
FT                   LTTDIAPGYDHITSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKDDVKTGIITYKIAAHA
FT                   ADLAKGHPGAQIRDNALSKARFEFRWEDQFNLGLDPDTARSYHDETLPKDSAKVAHFCS
FT                   MCGPKFCSMKITQEVREYAANQRIEAVDVDVAKGLAEQAERFKQEGSQLYKKV"
FT   gene            630951..632069
FT                   /gene="cytX"
FT                   /locus_tag="PSPPH_0536"
FT                   /note="PSPPH0536"
FT   CDS_pept        630951..632069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cytX"
FT                   /locus_tag="PSPPH_0536"
FT                   /product="probable hydroxymethylpyrimidine transporter
FT                   CytX"
FT                   /note="identified by match to protein family HMM TIGR02358"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33999"
FT                   /db_xref="GOA:Q48P31"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012732"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P31"
FT                   /protein_id="AAZ33999.1"
FT                   /translation="MQVSTLCVVKRTRSVQNGMRRRAPHDNCDDPTLCVVALFWKLRVR
FT                   SRITDQHPTRDTNVNTPGTYSPDTPIPASQRVFGGRDLFSLWFSLGIGLMVLQTGALLA
FT                   PGLGMSGSMLAIFLGTLVGVLLLASVGVIGSDTGLSSMAALKLSLGSKGASLPAVLNLL
FT                   QLMGWGSFEIIVMRDAASLLSDRAFSQGSLWTSPLLWTLFFGALATLLAVSGPLTFVRR
FT                   FLRKWGIWILLAACSWLTWNLLSKADLAALRATSGDGSLPFASGFDIAIAMPLSWLPLI
FT                   ADYSRFGQRAKSVFGGTAAGFFIGNFWLMSLGVAYTLAFAPSGEVNALLLALAGAGLGI
FT                   PLLLILLDETENAFADIHSAAVSSALLSRIKV"
FT   gene            632079..632414
FT                   /locus_tag="PSPPH_0537"
FT                   /note="PSPPH0537"
FT   CDS_pept        632079..632414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0537"
FT                   /product="cytosine/purine/uracil/thiamine/allantoin
FT                   permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37814"
FT                   /db_xref="GOA:Q48P30"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P30"
FT                   /protein_id="AAZ37814.1"
FT                   /translation="MTIGVICTLIACLAPLAQYQNFLLLIGSVFAPLFGVVLVDHFILR
FT                   RRSGQVVEGGLRWMSLLAWLGGLSTYHLLAGFYPNVGATLPALVVAGVLQLLIGGAINR
FT                   DRGTVPA"
FT   gene            complement(632383..633129)
FT                   /locus_tag="PSPPH_0538"
FT                   /note="PSPPH0538"
FT   CDS_pept        complement(632383..633129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0538"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37008"
FT                   /db_xref="GOA:Q48P29"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P29"
FT                   /protein_id="AAZ37008.1"
FT                   /translation="MSLLRITSLACLALLLGACQSLFTPNMRTPLQVQRDASELIKPGC
FT                   TTADCPLVNIDTVHFPDEPRLDAIVQKTLLQLTVADSSASPPASIKAYQEQFLSQAQGS
FT                   NSSYLQAKVREQHDGIVVVELSSYLDTGGAHGNPGRAFINYSRQQQKVLTLADMIIPGK
FT                   ESEFWQKAQLAHQGWLVSTKMNEDSEFMKTWPFKRTPHIALTYGAVILKYSVDTIAPYS
FT                   MGHIELKIPYPQLNGILKPELFPGRG"
FT   gene            633307..633954
FT                   /locus_tag="PSPPH_0539"
FT                   /note="PSPPH0539"
FT   CDS_pept        633307..633954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0539"
FT                   /product="conserved hypothetical protein TIGR00052"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00052"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35878"
FT                   /db_xref="GOA:Q48P28"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P28"
FT                   /protein_id="AAZ35878.1"
FT                   /translation="MSKTAASEKPMTQTTRSAPSAFETIQRENCFKGFYRLDKLHVRHE
FT                   LFAGGMSKEISRELFVRHDAVCVLPYDAKRDEVVLIEQFRVGAMEKTSNPWLIELVAGL
FT                   IDKDEQPEEVAHREAEEEAGLVFRSLWPITKYFPSPGGSNEFVHLYLGQCSSEGAGGIH
FT                   GLESEGEDIRVTVWSFDDAMQAMKDGTIKNASTIIALQWLALNRAEIRGLWS"
FT   gene            633945..634397
FT                   /locus_tag="PSPPH_0540"
FT                   /note="PSPPH0540"
FT   CDS_pept        633945..634397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN70485.1; match to
FT                   protein family HMM PF06853"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34340"
FT                   /db_xref="GOA:Q48P27"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P27"
FT                   /protein_id="AAZ34340.1"
FT                   /translation="MVVNLLRERYRVDLAGLQAACEANYARLMRLLPDMRNEQRSRRVA
FT                   VTQGDQMLGVLAVEVLLDCPYTTTLQVRQEHSLPWLPVPVLEVQVYHDARMAEVIGAEH
FT                   ARRFRGIYPYPNADMHQPDEKAQLNLFLGEWLSHCLACGHEFEAVR"
FT   gene            634595..634969
FT                   /locus_tag="PSPPH_0541"
FT                   /note="PSPPH0541"
FT   CDS_pept        634595..634969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35401"
FT                   /db_xref="GOA:Q48P26"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P26"
FT                   /protein_id="AAZ35401.1"
FT                   /translation="MSDLGTPRCLLACFSGVTLSLFSYLGLITLAGSALRWEHFLYTAI
FT                   TGVVIGILSLRLMPWIVHLAGLAGMILGVVLELLLAGYLWPGMPYERVLSYLLGAGLAG
FT                   MMSAGLIALIVLKHRANQQM"
FT   gene            635057..635863
FT                   /locus_tag="PSPPH_0542"
FT                   /note="PSPPH0542"
FT   CDS_pept        635057..635863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0542"
FT                   /product="Ser/Thr protein phosphatase"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37702"
FT                   /db_xref="GOA:Q48P25"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P25"
FT                   /protein_id="AAZ37702.1"
FT                   /translation="MPSAAPSSSVLLVQISDSHLFAEADGALLGMSTRDSLEKVVDLVL
FT                   AEQPQVDLVVASGDISQDGSVESYEAFRRISTQIAAPARWFAGNHDELPQMEHVAQAEG
FT                   LLEPIINIGRWRVTLLDSAVPGSVPGFLAAGQLQLLEQSLSEAPDRHHLVCLHHHPVAI
FT                   GCEWMTPIGLRNADALFAVLDRFPQVRAVLWGHVHQEFDQMRNGVRLLASPSTCIQFAP
FT                   GSADFKVDTTAPGYRWLRLHDDGRLETAVSRVVGMQFEVDYGGTGY"
FT   gene            635952..636569
FT                   /locus_tag="PSPPH_0543"
FT                   /note="PSPPH0543"
FT   CDS_pept        635952..636569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P36653; match to
FT                   protein family HMM PF05728"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37399"
FT                   /db_xref="GOA:Q48P24"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P24"
FT                   /protein_id="AAZ37399.1"
FT                   /translation="MTSDTPSLLYIHGLNSSALSRKACQLAALMKSLGLADRLQVPELH
FT                   HHPRQAVGQLETVIKELGRPLLVGSSLGGYYATHLAQQHGLKAVLINPAVNPHQLFDGF
FT                   LGVQQNLYTGEQWQLTEDHIQALAELEVPAPQDPQQFQVWLQTGDETLDYRRAEKFYRA
FT                   CALRIQAGGDHSFQGFAEQMPALLSFAGFAPDLLQKIDLSAL"
FT   gene            636646..638550
FT                   /gene="parE"
FT                   /locus_tag="PSPPH_0544"
FT                   /note="PSPPH0544"
FT   CDS_pept        636646..638550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="PSPPH_0544"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by similarity to SP:P20083; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF02518; match to
FT                   protein family HMM TIGR01055"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36866"
FT                   /db_xref="GOA:Q48P23"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P23"
FT                   /protein_id="AAZ36866.1"
FT                   /translation="MANPSASSYNADAIEVLSGLDPVRKRPGMYTDTSRPNHLAQEVID
FT                   NSVDEALAGHARSVQVILHADNSLEVSDDGRGMPVDIHPEEGVSGVELILTKLHAGGKF
FT                   SNKNYQFSGGLHGVGISVVNALSTQVRVRVKRDGNEYEMTFADGYKATELAVIGTVGKR
FT                   NTGTSVYFAPDPKYFDTPKFSVSRLKHVLKAKAVLCPGLLVSFEDKSTNEKVEWHYEDG
FT                   LRSYLQDSVSDFLRLPDEPFCGSFAGNKEAVDWALLWLPEGGDSVQESYVNLIPTAQGG
FT                   THVNGLRQGLLDAMREFCEFRNLLPRGVKLAPEDVWERIAFVLSMKMQEPQFSGQTKER
FT                   LSSREAAAFVSGVVKDAFSLWLNTHSELGLQLADLAINNAGRRLKASKKVERKRITQGP
FT                   ALPGKLADCAGQDPARSELFLVEGDSAGGSAKQARDKEFQAILPLRGKILNTWEVDGGE
FT                   VLASQEVHNIAVAIGVDPGAADISQLRYGKICILADADSDGLHIATLLCALFVQHFRPL
FT                   VDAGHVYVAMPPLYRIDLGKEIYYALDESERDGILDRLVAEKKRGKPQVTRFKGLGEMN
FT                   PPQLRETTMDPNTRRLVQLTLDDFAATSEMMDMLLAKKRAGDRKSWLESKGNLAEVLT"
FT   gene            638547..639524
FT                   /locus_tag="PSPPH_0545"
FT                   /note="PSPPH0545"
FT   CDS_pept        638547..639524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO58390.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36263"
FT                   /db_xref="GOA:Q48P22"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P22"
FT                   /protein_id="AAZ36263.1"
FT                   /translation="MIRAWLAALTLVAAPVFAAPLEVLKLQSEHPVDDMVGGNLSGLAM
FT                   CNGQLWTVSDRDDNVLYSLDVSQNTWKAEAHRIDAPAPHSYLPLKLRSLAGLSALVRGG
FT                   DLDFEGVSCDAAGNRYLVSEAYGTVLKVPVSGAPFWLDLPQALIEQARGQGMLQHFNAI
FT                   FEGIAVNASGDRIWLAAEREKRGLLAVQRDKEQWSCGQSCVLLSEDGKDLLPAEQGHKT
FT                   VSTDFSDLSLYNGKLFTLERAAYRICRRGLETGQIERCWSFAKEAMVPSRRYDQPYGLT
FT                   EALVVDEKGAWIGIDNNFGARADGEKRPIVWRFAAPEAGWSAGQ"
FT   gene            639521..640054
FT                   /locus_tag="PSPPH_0546"
FT                   /note="PSPPH0546"
FT   CDS_pept        639521..640054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0546"
FT                   /product="transporter BMEI1102"
FT                   /note="identified by match to protein family HMM TIGR02281"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33203"
FT                   /db_xref="GOA:Q48P21"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P21"
FT                   /protein_id="AAZ33203.1"
FT                   /translation="MSQPANQPQPGKRAGKILMIVAWAAGLFLATRFFGSWEDKQQNPN
FT                   TVVASQHGDGYIEVQLAGNRQGHFVSTGQINGRTVEFMIDTGATDVAVPGDMADSLGLK
FT                   RGFAVTVSTANGNSQGFRTTLDRLQLGDIVLTNVRALVAPGLDGEQVLLGMSAMKQLEF
FT                   TQRGGNLLLRQSTK"
FT   gene            640065..642320
FT                   /gene="parC"
FT                   /locus_tag="PSPPH_0547"
FT                   /note="PSPPH0547"
FT   CDS_pept        640065..642320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="PSPPH_0547"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by similarity to SP:P20082; match to
FT                   protein family HMM PF00521; match to protein family HMM
FT                   PF03989; match to protein family HMM TIGR01062"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34556"
FT                   /db_xref="GOA:Q48P20"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P20"
FT                   /protein_id="AAZ34556.1"
FT                   /translation="MSDSLDLSLDGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGL
FT                   KPVQRRIIYAMSELGLGADAKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRY
FT                   TLVDGQGNWGAPDDPKSFAAMRYTEARLSRYSEVLLSELGQGTADWVPNFDGTLDEPAV
FT                   LPARLPNILLNGTTGIAVGMATDVPPHNLREVASACVHLLDDPKATVPELCEHILGPDY
FT                   PTEAEIITPRADLLKIYETGRGSVRMRAVYRIEDGDIVVTSLPHQVSGAKVLEQIAAQM
FT                   QAKKLPMVADLRDESDHENPCRIVIIPRSNRVELDELMQHLFATTELESSYRVNINIIG
FT                   LDGKPQLKNLKTLLGEWLTFRIGTVRRRLQFRLDKVEHRLHLLDGLLTAYLNLDEVIHI
FT                   IRTAEHPKAELIARFGLSEIQADYILDTRLRQLARLEEMKLRSEQEALRKEQAKLLALL
FT                   GSESKLRKLVRAELIADAETYGDDRRSPIVARAEAKALSENELMPTEPVTVVLSEKGWV
FT                   RCAKGHDIDATGLSYKAGDGFKTSSIGRSNQFAVFIDSTGRSYSVAAHTLPSARGQGEP
FT                   LTGKLQPPPGAAFECVLMPEDDALYVIASDAGYGFVVKGEDLQAKNKAGKALLSLPNGA
FT                   KVILPRPVPDREQNWLAAVTTEGRLLVFKISDLPQLGKGKGNKIIGIPGERVASREEYV
FT                   TDLAVIAQGATLVLQAGKRTLSLKPEDLEHYKGERGRRGNKLPRGFQRVDALLVENS"
FT   gene            642501..643199
FT                   /locus_tag="PSPPH_0548"
FT                   /note="PSPPH0548"
FT   CDS_pept        642501..643199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0548"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM PF03886"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34042"
FT                   /db_xref="GOA:Q48P19"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P19"
FT                   /protein_id="AAZ34042.1"
FT                   /translation="MMNFLRLPLILLMTGVLGLAGCSVRQPTALYQLDSGEPGQPKQSS
FT                   GLAVLLGPVSVADYLQRETLLQRQPDGTLTASPDGRWAGNLSSDIDQLLLRQLAWKLDS
FT                   QRVVMAPAVANFTPDVQVVLSITRLDSGAKQPAVLDAQWRLLDRKGHVRDSRLVHLEQV
FT                   HAGSSADQVKAQGMLLQRLADQVSTAIKPISWQPIEEPKKPPVAKAKEPDKPRIPMASP
FT                   IRTDLEVFRF"
FT   gene            complement(643647..645185)
FT                   /locus_tag="PSPPH_0549"
FT                   /note="PSPPH0549"
FT   CDS_pept        complement(643647..645185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0549"
FT                   /product="HAMP domain protein"
FT                   /note="identified by match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33408"
FT                   /db_xref="GOA:Q48P18"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P18"
FT                   /protein_id="AAZ33408.1"
FT                   /translation="MNRPTPVKTDNFFLLIFRALRHRRVPIALRIASHNVILVALALVI
FT                   YAGVMGLQFKQAMHEQADALGQALTTQTATSATELLVSNDILSLNVLLGNLVKNPLVAH
FT                   AAIYSVDNRILAEAGQRPKNGLLGEAQGLYEIKITFQDVMAGHLRISLDMSQFQQPMTI
FT                   SLQSMGILAGILLALALALSLRLGRHISTPLMQMRIWLRDIDPYTPATDRQDEIGDLAR
FT                   QLRTSFAPPVPEPEPLPEPEYDGDEDDGDDPYLEPEERPAPPVSARSSEPKPRLPAPPV
FT                   QRRIVAEEDEDDEDPFADLRDSSNTAPAARPVAAPVAPVEPHNSAVLAVQLGAQDQLRR
FT                   LPRARLTELLQRYRDCLDQAASLYESELHTLNDGSTLMLFHSHESGDDYLTNAICCGEL
FT                   LRALSHALQIEVADSGITLQLQLGLTLGEGLSGLSQIDLLLTETAQDALALSQHSRNLL
FT                   LVERRINDDPLIRQRARIRPIASPEGACCVERLMEPYPSMLERQLARMHESNKA"
FT   gene            645315..646529
FT                   /locus_tag="PSPPH_0550"
FT                   /note="PSPPH0550"
FT   CDS_pept        645315..646529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0550"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00338; match to protein family HMM
FT                   TIGR01488"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36069"
FT                   /db_xref="GOA:Q48P17"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P17"
FT                   /protein_id="AAZ36069.1"
FT                   /translation="MREIVLINITGVDRPGLTAAITGVLAQGGVNILDIGQAVIHDTLS
FT                   FGILVEIPDTVQGSSVLKDILFTAYKLDQQVRFTAVSEADYQHWVEGQGKARHIVTLLT
FT                   RKVTAEQLQCVSAITAKYGLNIDQIDRLSGRMPLDTPADKGKGCIEFTVRGEPADPKAM
FT                   QAEFLAVAQDLNVDIAFQQDSLFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGEQVSE
FT                   ITERAMRGELDFSESFKERLALLKGLDISVLDEIGASLRLTEGAETLFSELKRLGYKTA
FT                   ILSGGFTYFAKQLQAKLGIDYVYANELEVVDGKVTGVAVEPIVNAQRKADLLRELAHKE
FT                   GLSLEQTIAVGDGANDLPMLAIAGLGVAFRAKPLVKQSAKQAISTLGLDGVLYLLGFRD
FT                   REGKR"
FT   gene            complement(646596..648248)
FT                   /locus_tag="PSPPH_0551"
FT                   /note="PSPPH0551"
FT   CDS_pept        complement(646596..648248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36473"
FT                   /db_xref="GOA:Q48P16"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P16"
FT                   /protein_id="AAZ36473.1"
FT                   /translation="MARQLYQGLTELNQLITPSENRLQLLELLRPEVYFVCKHLERHFL
FT                   NQAIVLDERPRKVANLCQALQNHLATGYKQIIQQVAPRYARDQAGLFSTALQRALHGLN
FT                   GPLIRANQLYCPVQDGLWLELHQIYQIARQYQLHNTPVEEPLAHHTKALSVEQTYIIAL
FT                   LMGCSRCNQMRQLNIGKLADALEAWSPLVKLQLPAGDNSLFALDPTADKPPLYRTLFSD
FT                   EQSPRLLGIDTQSLAEAINQYLALPDDQRSPSRLLIPTGINTDLLQHLAAAWGDVAERT
FT                   FQRTAGQGTLKLCIGMSALHFYVAGQKSFSELLQLNSAGSAASFSLKIANDDEDDPWAS
FT                   AFDTQRGKTSSHLLPYEEIEYPKNDGDNDSLSNGQHTFPTFDLNIVNHSPGGYCLAWQK
FT                   EVPQQLQAGELVGIQDDSGQGWSIAIVRWIRQVRSGGTQMGIELIAPFAQPCGMQLIRE
FT                   QQNSQYLRTLMLPEVRAMEKPPTVLAPRLPFQEGNKVMINVAGEERRASLSNRQVSSAS
FT                   YNQFEYQMYDAPKATETEKARPDQEFDSLWGTL"
FT   gene            complement(648639..650471)
FT                   /locus_tag="PSPPH_0552"
FT                   /note="PSPPH0552"
FT   CDS_pept        complement(648639..650471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0552"
FT                   /product="rhodanese domain protein/phosphatidylserine
FT                   decarboxylase"
FT                   /note="identified by match to protein family HMM PF00581;
FT                   match to protein family HMM PF02666; match to protein
FT                   family HMM TIGR00163"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34364"
FT                   /db_xref="GOA:Q48P15"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P15"
FT                   /protein_id="AAZ34364.1"
FT                   /translation="MSAFNGLSLVIEPNDLLERLDAPELILVDLTSSARYEAGHIRGAR
FT                   FVDPKRTQLGKPPAPGLLPDTADLQQLFGELGHNPDAVYVVYDDEGGGWAGRFIWLLDV
FT                   IGHHHYHYLDGGVLAWEAQSLPLSTDVAPVAGGPVTLTLHDEPTATREYLQSRLGAADL
FT                   AIWDARGPTEYSGEKVVAAKGGHIPGAVNFEWTAGMDKARNLRIRQDMPEILRDLGITP
FT                   DKEVITHCQTHHRSGFTYLVAKALGYPRVKAYAGSWSEWGNHPETPVELPEVAAAPAEA
FT                   VEVAQPVAPAQPAPAETVEPVRSSEPRQASQKYSGHSSSGPSMKDRLFIISQYLLPHHL
FT                   LSRLAGCVAECRVRWFKNAFTAWFARRYQVDMSQALVEDMTSYEHFNAFFTRALKADAR
FT                   PLDTTPGAILSPADGAISQLGPIDHGRIFQAKGHSFSVLELLGGDPKLSAPFMGGEFAT
FT                   VYLSPKDYHRVHMPLAGTLREMVYVPGRIFSVNQTTAENVPELFARNERVVCLFDTERG
FT                   PMAVVLVGAMIVASVETVWAGLVTPPKRELKTFSYDEAARAPIHLEKGAEMGRFKLGST
FT                   AIVLFGPNQVKWAEQLTAGSKVQMGQALAVPTQA"
FT   gene            complement(650517..652052)
FT                   /locus_tag="PSPPH_0553"
FT                   /note="PSPPH0553"
FT   CDS_pept        complement(650517..652052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34611"
FT                   /db_xref="GOA:Q48P14"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P14"
FT                   /protein_id="AAZ34611.1"
FT                   /translation="MSTAHAAHHLVPKTLDAWVKLLDGIALPVPAVNHGHVRAALNDSR
FT                   RSLREIAEMMQESPALVLSVMREANHHTHGLTEQAESLEIAINRLGLARTEILLGRLPA
FT                   KPPEEIPAVYRQLILVSQHATQQANGLFASRLARLWQDIHMGSLLFLSPLWPMALAYPK
FT                   LLEELELRVIHKGHSSLAVEKELFGVNLLELCLALAEFWRLPIWVTRGYKLLINERRDL
FT                   AKVLRIAREEHSPLQQQQLMDADPNLRRWLNQPANTVLLGNGLALAAQHAWNSPHCLRW
FT                   ERLTSLYLQQSISEVQQQAHQNAASSARIHAEKDLWYPAESLLWPWDARRVRRDNEPAP
FT                   PPSADALQLWRKHCAELLQDPSPFINAMHLTTSARDAFMSCGMERVMLLMLDKTSTVLR
FT                   VNQMAGLPPETASLQLFIKESTVLQRLLTQPTQLRMTPANNAQFAALLPAPLKTLFSGQ
FT                   HWLIRSLSNNGKVMLLVVADQGGGALSEISVQAFGKTAQCIEKALGIFSHRKA"
FT   gene            652260..653111
FT                   /locus_tag="PSPPH_0554"
FT                   /note="PSPPH0554"
FT   CDS_pept        652260..653111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0554"
FT                   /product="motility protein, MotA family"
FT                   /note="identified by similarity to SP:P55891"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35993"
FT                   /db_xref="GOA:Q48P13"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P13"
FT                   /protein_id="AAZ35993.1"
FT                   /translation="MAKIIGIIVVIASVLGGYVLSHGKIMALFQPYEVLIIGGAALGAF
FT                   LQANPGYMTMHVFKKSLKMFGSRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAA
FT                   SSPIFAKYPGVLKDERMTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEELEHPSHA
FT                   ITGIADGMPGFGIVAAVLGIVVTMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGP
FT                   LATCLAHDAKEEMNVYESIKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVR
FT                   GR"
FT   gene            653115..654140
FT                   /locus_tag="PSPPH_0555"
FT                   /note="PSPPH0555"
FT   CDS_pept        653115..654140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0555"
FT                   /product="motility protein, MotA family"
FT                   /note="identified by similarity to SP:P55892; match to
FT                   protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37234"
FT                   /db_xref="GOA:Q48P12"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P12"
FT                   /protein_id="AAZ37234.1"
FT                   /translation="MENNQPIIIKRVKRFGGGHHGGAWKIAFADFATAMMAFFLVLWLM
FT                   SSATPEQLLAVAGYFKDPVGFSDSGSPYVIDLGGSPEMSPNQTLNPEVKTTPSPDTVPL
FT                   EAETSETKAEEVEQERLEMLLQELQNKVEENPQLQKFKDQILFEITQDGLRIQIMDADN
FT                   RPMFDSGSARLKPYFEDILLAMADTIKSVPNKISISGHTDATPFVGNGGFGNWELSANR
FT                   ANAARRALVAGTYPDSQVARVVGYASSALYDHENPTNPVNRRIDIVVLTKKAQQRIEGD
FT                   QNSGGAPQSKPAPAAPATPAAPGASTAAPPDPQAYAQPHEIRQKLNIFDDGKLRVEPAQ
FT                   N"
FT   gene            complement(654202..655233)
FT                   /gene="rsgA"
FT                   /locus_tag="PSPPH_0556"
FT                   /note="PSPPH0556"
FT   CDS_pept        complement(654202..655233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="PSPPH_0556"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37916"
FT                   /db_xref="GOA:Q48P11"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P11"
FT                   /protein_id="AAZ37916.1"
FT                   /translation="MAKRQLNRRQNWRIEKIQGERAARAAKRESATLETLEGGDLGPEQ
FT                   TGLVIAHFGVQVEVEAQEGEASGQVFRCHLRANLPALVTGDRVVWRAGNQGIGVIVAQL
FT                   PRTTELRRPDSRGQLKPVAANVDLIVIVFAPMPEPHANLIDRYLVAAEHAGIRPLLLLN
FT                   KADLIDEQNAPALNALLAVYRTLGYPVLEVSAHHGDGMQTLQSQLDGHISVFVGQSGVG
FT                   KSSLVNSLLPETDTRVGPLSEVSGQGTHTTTTARLFHFPRGGDLIDSPGIREFGLGHVS
FT                   RADVEAGFIEFNDLIGTCRFRDCKHDREPGCALLKGLEDGRVQQQRMNSYRSIIASLPQ
FT                   DSY"
FT   gene            655342..655878
FT                   /gene="orn"
FT                   /locus_tag="PSPPH_0557"
FT                   /note="PSPPH0557"
FT   CDS_pept        655342..655878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="PSPPH_0557"
FT                   /product="oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33057"
FT                   /db_xref="GOA:Q48P10"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P10"
FT                   /protein_id="AAZ33057.1"
FT                   /translation="MQNKQNLIWIDLEMTGLDPDTDVIIEMATIITDSELNTLAEGPVI
FT                   AVHQSDETLAKMDEWNTRQHGGSGLTQRVRESTISMAEAEAQTLEFIKLWVPERSSPIC
FT                   GNSICQDRRFLYRHMPTLENWFHYRNLDVSTLKELAARWSPELKFKKGSTHLALDDIRE
FT                   SIAELRFYREHFIKP"
FT   gene            655975..656586
FT                   /locus_tag="PSPPH_0558"
FT                   /note="PSPPH0558"
FT   CDS_pept        655975..656586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0558"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33759"
FT                   /db_xref="GOA:Q48P09"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P09"
FT                   /protein_id="AAZ33759.1"
FT                   /translation="MLLMLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSV
FT                   RDVLIGHYPLTWVKHPEYLILTSVAALVTIFIAPLMRHLRSLFLVLDALGLVAFTLIGC
FT                   MTALEAGHGLVIASVCGVITGVFGGILRDIFCNDIPLIFPRELYASVSFLAAWCFLLCQ
FT                   YLQLPDEQAVLITLFGGLLLRLLAIRFRWEMPKFVYKDEP"
FT   gene            complement(656858..657952)
FT                   /locus_tag="PSPPH_0559"
FT                   /note="PSPPH0559"
FT   CDS_pept        complement(656858..657952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0559"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36266"
FT                   /db_xref="GOA:Q48P08"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P08"
FT                   /protein_id="AAZ36266.1"
FT                   /translation="MSAITAVLPTSDDLAALAVSIKAWGRELGFQEVGISGLDLAEHEQ
FT                   HLQRWLDAGYHGEMDYMAAHGSKRSHPDELVPGTLRVVSLRMDYLPGDTKMAQRLTEPE
FT                   KAYVSRYALGRDYHKLIRKRLQQLAERILQAIGPFGFRAFVDSAPVLEKAIAEQAGLGW
FT                   IGKNTLVLNRKAGSFFFLGELFVDIPLPVDAPHATEHCGRCTACLDICPTAAFVGPYVL
FT                   DARRCISYLTIELKTAIPEELRPLIGNRVFGCDDCQIVCPWNRFARPTDQSDFQPRHNL
FT                   DNAGLAELFLWDEDKFLTSTEGSPLRRAGYERWLRNLAVGLGNAPSTIPVIEALHARRD
FT                   YPSELVREHVEWALQRHGVADAEG"
FT   gene            658016..659506
FT                   /locus_tag="PSPPH_0560"
FT                   /note="PSPPH0560"
FT   CDS_pept        658016..659506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0560"
FT                   /product="YjeF family protein"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM PF03853; match to protein
FT                   family HMM TIGR00196; match to protein family HMM
FT                   TIGR00197"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35803"
FT                   /db_xref="GOA:Q48P07"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P07"
FT                   /protein_id="AAZ35803.1"
FT                   /translation="MFDTKPHLPDALYSAAQVRDLDARLIAAGTPGLELMLRAAQALWR
FT                   TILRRWPQANELTVLAGRGNNAGDGYLVAALAHKAGWQVRVLAVGDPAALSGDAASAHA
FT                   AASGIDTQVWAGQPLTGVVLDALLGTGLNGEVREPYVSAIKAINASGLPVAAVDIPSGL
FT                   SADTGQALGVAVRADVTVTFIGLKLGLLTGDAADLVGELVFDDLRADPALVAQVPVSAK
FT                   RLSASSLPTLASRPRTAHKGMFGRVLVIGGDHGFGGAALLSAESALRSGAGMLTLATRA
FT                   EHIPAALTRMPEIMSAAIRSANQLMALIEPASVLVVGPGLGQAAWGRSLLSAAANAERP
FT                   QVWDADALNMLAAGAVSLPKGCVITPHPGEAARLLGVGIKDIQADRAAAVRALARKFDT
FT                   VCVLKGSGSLIADASGQLALCDRGHPAMATAGLGDVLAGLIGALLAQHLTPFDAACLAV
FT                   WLHASAGQKVGEYGRGLAASDIILAIRQLLEELQPCLI"
FT   gene            659515..659964
FT                   /locus_tag="PSPPH_0561"
FT                   /note="PSPPH0561"
FT   CDS_pept        659515..659964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0561"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33586"
FT                   /db_xref="GOA:Q48P06"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P06"
FT                   /protein_id="AAZ33586.1"
FT                   /translation="MVGEEAMMNFGARLAAVTEGVGVIFLDGDLGAGKTTLSRGMIRGF
FT                   GHAGAVKSPTFTLVEPYEIGAIRVFHFDLYRLVDPEELEYMGVRDYFDGDALCLIEWPQ
FT                   RGAGFLPKPDLTITIGPHGEGRSVILSPLGSRGERWCATLALEFK"
FT   gene            659979..661397
FT                   /locus_tag="PSPPH_0562"
FT                   /note="PSPPH0562"
FT   CDS_pept        659979..661397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0562"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 3"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33091"
FT                   /db_xref="GOA:Q48P05"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P05"
FT                   /protein_id="AAZ33091.1"
FT                   /translation="MRMRALVTVVGLLLMALAVEAVAATQVKSVRLWRAPDNTRLVFDL
FT                   SGPVQHSVFTLTSPDRLVIDINGATLGGPLNVSTANTPINSMRSAQRTPTDLRVVIDLK
FT                   KAVTPKSFTLAPNQQYGNRLVVDLFDNAADANPTPVIPDTAANTAPAVPVSPAKPEIKL
FT                   TPVPNGKRDIVVVIDAGHGGEDPGASGGAGQKEKNVVLSIAKELQRQVNAEKGYRAELT
FT                   RTGDYFIPLRKRTEIARAKGADLFVSIHADAAPSTAAFGASVFALSDRGATSETARWLA
FT                   DSENRSDLIGGAGAVSLDDKDRMLAGVLLDLSMTASLSSSLNVGQKVLSNIGRVTSLHK
FT                   SRVEQAGFMVLKSPDIPSILVETGFISNANEANKLSSASHQQALARSINSGVKQFFQQN
FT                   PPQGTYIAWLRDNGKLAQGPRNHVVRSGETLAMLAARYDMNIATLRSANNLKSDELKIG
FT                   QDLRIPSSEVATQQ"
FT   gene            661394..663340
FT                   /gene="mutL"
FT                   /locus_tag="PSPPH_0563"
FT                   /note="PSPPH0563"
FT   CDS_pept        661394..663340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="PSPPH_0563"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="identified by similarity to SP:P23367; match to
FT                   protein family HMM PF01119; match to protein family HMM
FT                   PF02518; match to protein family HMM TIGR00585"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37829"
FT                   /db_xref="GOA:Q48P04"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P04"
FT                   /protein_id="AAZ37829.1"
FT                   /translation="MTDLLLDGTEADNAQTVLNAARIELLSPRLANQIAAGEVVERPAS
FT                   VIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGGGISSDDLPLALARHATSKIRDLE
FT                   DLERVMSLGFRGEALASISSVARLTLTSRTRDADQAWQVETEGRDMAPRVQPAAHPVGT
FT                   SVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALARFDVAFHLRHNGKTMLSLHEA
FT                   HDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVGLPTFSRSQADLQYFFVNGRA
FT                   VRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVNVHPTKHEVRFRDGRMVHDF
FT                   LYGTLHRALGDVRPENQLGGSVPVAAEPRPTGPEAGEFGPQGEMRLANNVLEQPQGEPF
FT                   ARPAAGGGAGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLPSAASSSLPESPGDIPPL
FT                   GYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANEGLSGQPLLVPESLAV
FT                   SQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEANRLVSDVLADLMEYG
FT                   TSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERSGQCNHGRPTWTQM
FT                   GLNDLDKLFLRGQ"
FT   gene            663341..664312
FT                   /gene="miaA"
FT                   /locus_tag="PSPPH_0564"
FT                   /note="PSPPH0564"
FT   CDS_pept        663341..664312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="PSPPH_0564"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by match to protein family HMM PF01715;
FT                   match to protein family HMM TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37300"
FT                   /db_xref="GOA:Q48P03"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P03"
FT                   /protein_id="AAZ37300.1"
FT                   /translation="MNALPPAIFLMGPTAAGKTDLAIELSKVLPCELISVDSALVYRGM
FT                   DIGTAKPSKAQLAEYPHRLIDILDPAQSYSAADFRSDALAAMAEITARGNIPLLVGGTM
FT                   LYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQLAVVDPVSAARIHPNDPQRL
FT                   IRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKVLHQRIAL
FT                   RFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQERGIIAT
FT                   RQLAKRQFTWLRSWEDLHWLDSLASDNLSRALKYLGSVSILS"
FT   gene            664404..664664
FT                   /locus_tag="PSPPH_0565"
FT                   /note="PSPPH0565"
FT   CDS_pept        664404..664664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0565"
FT                   /product="Hfq protein"
FT                   /note="identified by match to protein family HMM PF01423;
FT                   match to protein family HMM TIGR02383"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36074"
FT                   /db_xref="GOA:Q48P02"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48P02"
FT                   /protein_id="AAZ36074.1"
FT                   /translation="MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPVRPIRLPSATDADGADAEPGNA"
FT   gene            664677..665978
FT                   /locus_tag="PSPPH_0566"
FT                   /note="PSPPH0566"
FT   CDS_pept        664677..665978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0566"
FT                   /product="GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37685"
FT                   /db_xref="GOA:Q48P01"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P01"
FT                   /protein_id="AAZ37685.1"
FT                   /translation="MFFERHSGGERAILVHLDGQDPEAREDPQEFQELAISAGADTVAF
FT                   INVPRHRPSAKYLIGSGKVEELRDQVKAEQADLVIFNHTLTPSQERNLERVFECRVLDR
FT                   TGLILDIFAQRARTHEGKLQVELAQLEHMSTRLVRGWTHLERQKGGIGLRGPGETQLET
FT                   DRRLLRVRLRQIKGRLEKVRSQRDQARRGRRRADIPSVSLVGYTNAGKSTLFNSVTDSD
FT                   VFAADQLFATLDPTLRRLQLDDLGPIVLADTVGFIRHLPHKLVEAFRATLEESSNSDLL
FT                   LHVIDSHEPDRMSQIEQVMAVLGEIGAEGLPILEVYNKLDLLEGVEPQIQRDADGKPQR
FT                   VWVSARDGRGLDLLKQAIAELLGDDLFVGTLLLPQSLARLRAQFFELGAVQSETHDEEG
FT                   ASVLAVRLPRVELNRLVSREGLQPLEFIEQHTLQ"
FT   gene            666075..667274
FT                   /gene="hflK"
FT                   /locus_tag="PSPPH_0567"
FT                   /note="PSPPH0567"
FT   CDS_pept        666075..667274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="PSPPH_0567"
FT                   /product="HflK protein"
FT                   /note="identified by similarity to SP:P25662; match to
FT                   protein family HMM PF01145; match to protein family HMM
FT                   TIGR01933"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35034"
FT                   /db_xref="GOA:Q48P00"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q48P00"
FT                   /protein_id="AAZ35034.1"
FT                   /translation="MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGL
FT                   FGGGNKRGSDGGGSGGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQ
FT                   YHETVGPGLNIYFPPFDRKYMENVTRERAYSKQGQMLTEDENIVEVPLTVQYKISNLQD
FT                   FVLNVDQPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGI
FT                   TVTQVNVQSAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDA
FT                   NGYRDEVVSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQ
FT                   NNLLYLPLDKMIESSRSSNGNGSNSGTPSQSANDAAAAAAAARANEAQQRGEVRTRETR
FT                   "
FT   gene            667274..668143
FT                   /gene="hflC"
FT                   /locus_tag="PSPPH_0568"
FT                   /note="PSPPH0568"
FT   CDS_pept        667274..668143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="PSPPH_0568"
FT                   /product="HflC protein"
FT                   /note="identified by match to protein family HMM PF01145;
FT                   match to protein family HMM TIGR01932"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34464"
FT                   /db_xref="GOA:Q48NZ9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NZ9"
FT                   /protein_id="AAZ34464.1"
FT                   /translation="MSNKSLITLIVGVVLAVIAWNSFYIVSQTERAVLLQFGRVVQADV
FT                   QPGLHVKVPYVNQVRKFDGRLLTLDAPTQRFLTLEKKAVMVDAYAKWRVKDAERFYTAT
FT                   SGLKQIADERLSRRLESGLRDQFGKRTLHEVVSGERDALMADITGSLNRMAEKELGIEV
FT                   VDVRVKAIDLPKEVNRSVFERMSTEREREAREHRAKGNELAEGIRADADRQRRVLLAEA
FT                   YRESEEARGDGDAQAAAIYSKAYGQDQEFYAFYRSLRAYRESFANKSDVMVLDPNSEFF
FT                   RYLEKAKP"
FT   gene            668414..669601
FT                   /locus_tag="PSPPH_0569"
FT                   /note="PSPPH0569"
FT   CDS_pept        668414..669601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0569"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36596"
FT                   /db_xref="GOA:Q48NZ8"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48NZ8"
FT                   /protein_id="AAZ36596.1"
FT                   /translation="MATVDRWLLPDGIEEVLPPEAACIEVARRQVLDLFQSWGYEFVVT
FT                   PHIEYLESLLTGAGSDLDLRTFKVIDPQSGRQMGFRADITPQVARIDAHTLKREGPSRL
FT                   CYAGSVLHAQPRALSSSRSPIQLGAELYGDASPSSDVEVISLMLAMLQLADVPDVHMDL
FT                   GHVGIYRGLARAAGLSGEVEQQLFDALQRKAIDEVVALTADLPQELASMLRALVDLCGG
FT                   REVLDAARDRLAGAPAPVLAALNDLLAIAERLAARFPQLPLYFDLGELRGYHYHTGVVF
FT                   AVFVPGVGQSIAQGGRYDDIGADFGRARPATGFSTDLKTLVTLGQAEIVLPSGGIWVPD
FT                   STDAALWQQVCQLRSEGQRVVQALPGQQASAAREADCDRQLIQHGEHWQVMPLAS"
FT   gene            669656..670948
FT                   /gene="purA"
FT                   /locus_tag="PSPPH_0570"
FT                   /note="PSPPH0570"
FT   CDS_pept        669656..670948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="PSPPH_0570"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35654"
FT                   /db_xref="GOA:Q48NZ7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48NZ7"
FT                   /protein_id="AAZ35654.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLV
FT                   IDGEKTVLHLIPSGVLREGVQCLIGNGVVVAPDALLREIIKLEEKGIPVRERLRISPSC
FT                   PLILSYHVALDQAREKARGEFKIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLG
FT                   ELLDYHNFVLVNYYKEPAIDFQKTLDECMEYADLLKPLMLDVTAALHEMRRDGKDIMFE
FT                   GAQGSLLDIDHGTYPYVTSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPT
FT                   ELFDDVGAFLAKRGHEFGATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLE
FT                   TINICVGYENEEGAVIDAPTDADSYLGLRPVYEQMPGWSESTLGAKTLEELPAAARAYI
FT                   KRVEELVGAPIDIISTGPDRNETIVLRHPFG"
FT   gene            671120..673054
FT                   /locus_tag="PSPPH_0571"
FT                   /note="PSPPH0571"
FT   CDS_pept        671120..673054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0571"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33634"
FT                   /db_xref="GOA:Q48NZ6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NZ6"
FT                   /protein_id="AAZ33634.1"
FT                   /translation="MSAVLSLLQSRLLRPVFIALGIALLVQVIVAVALTRSTVTALEAD
FT                   LANRLGVDSQHLSSELELASSEVTSSLDSLSASTRQRLSVGLSTRLKEEQAQLRATLEK
FT                   DLRESATDMAGLLAAVAPRAMWDNDTPTLSEFARRAQRNPNVLFVVYDDAAGEHLTRYM
FT                   NRDNPLVKALLAKGEGERAMDKILNAAKNDPSVYYVEASISPNGVEIGKVRMGVSTATV
FT                   EENLAALDKRFATLITSGEQLVSDSLASASKDSSTALRTRLQSAQTAGAAMTTNTRVAV
FT                   QGAAETLRWRIGMGLALVGLGVLLLLAVVLGRRVVSKLHLLIAALNDLAAGEGDLTKRV
FT                   KLDSNDEIGDMSAAVNRFIDKLQPIVREAGEVAQRTGQEIGVMSQRNAGADAAAELQRD
FT                   EVAASLKALEQMADEAQSESQAMQAALRQVVDIKQATDENTRTSNQVGGLIEALAGQVE
FT                   TGAQVIERLAQQSQQIEVVLEVIHGIAEQTNLLALNAAIEAARAGETGRGFAVVADEVR
FT                   ALASKTQSSTGDIQEHIIALQRGAKEAVAAIGIAGRQAKEGLEVLRDSAKRQQTVQASV
FT                   EQVHAAIGLATKAAVHQAEGAQAVRGRVEVIHAQAERAAEAVVETAASGKVLSGLAAQL
FT                   KASLGQFRA"
FT   gene            complement(673159..673245)
FT                   /locus_tag="PSPPH_0572"
FT                   /note="PSPPH0572"
FT   tRNA            complement(673159..673245)
FT                   /locus_tag="PSPPH_0572"
FT                   /product="tRNA-Leu"
FT   gene            complement(673406..673492)
FT                   /locus_tag="PSPPH_0573"
FT                   /note="PSPPH0573"
FT   tRNA            complement(673406..673492)
FT                   /locus_tag="PSPPH_0573"
FT                   /product="tRNA-Leu"
FT   gene            673718..676351
FT                   /gene="rnr"
FT                   /locus_tag="PSPPH_0574"
FT                   /note="PSPPH0574"
FT   CDS_pept        673718..676351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="PSPPH_0574"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF00773; match to protein
FT                   family HMM TIGR00358; match to protein family HMM
FT                   TIGR02063"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33054"
FT                   /db_xref="GOA:Q48NZ5"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NZ5"
FT                   /protein_id="AAZ33054.1"
FT                   /translation="MADWQSLDPEAAREAEKYENPIPSRELILQHLAERGSPASREQLV
FT                   EEFGLTTEDQFEALRRRLRAMERDAQLIYTRRGTYAPVDKLDLILGRISGHRDGFGFLV
FT                   PDDGSDDLFMSPAQMRLVFDGDRALARVSGLDRRGRREGVIVEVISRAHETIVGRYFEE
FT                   SGIGFVVPDNPKIQQEVLVTPGRNNNAKIGQFVEVKITHWPTPRFQPQGDVVEVVGNYM
FT                   APGMEIDVALRTYDIPHVWPEAVLKEAAKLKPEVEEKDKENRVDLRHLPFVTIDGEDAR
FT                   DFDDAVYCEAKPGKLRLFSGGWKLYVAIADVSSYVKIGSALDAESQVRGNSVYFPERVV
FT                   PMLPEQLSNGLCSLNPHVDRLAMVCEMTISKTGEMTDYVFYEGIIHSHARLTYNKVSTI
FT                   LEQPKTAEAKSLRGEYGDVVPHLKQLYAMYKVLLGARHVRGAIDFETQETRIIFGSERK
FT                   IAEIRPTTRNDAHKLIEECMLAANVATAQFLKKHEIPALYRVHDGPPPERLEKLRAFLG
FT                   ELGLTLHKGKEGPTPKDYQALLETVRDRPDYHLIQTVMLRSLSQAVYSSDNNGHFGLNY
FT                   EAYTHFTSPIRRYPDLLTHRAIRSVIRSKQDTPHVRRAGAATIPKARIYPYDDALLDQL
FT                   GEQCSMSERRADEATRDVVNWLKCEYMKDRVGESFPGVITAVTGFGLFVELTDIYVEGL
FT                   VHVTALPGDYYHFDPLHHRLAGERTGRNFRLGDSVEVRVMRVDLDERKIDFEISETAAA
FT                   ATPAGRKRRGHDTAPPAATTTTEKEKAPAKSGRRSASAKESSTEAYRPSDAAAKNAEVR
FT                   KSRELKKALLADAKGGSKASSGKSDRSGSAPSSSKPASKHRKGPSKSGSAPTAKSGGAR
FT                   KPKAKS"
FT   regulatory      complement(674946..674978)
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans (PMID: 17073302)"
FT                   /regulatory_class="promoter"
FT   gene            676348..677109
FT                   /locus_tag="PSPPH_0575"
FT                   /note="PSPPH0575"
FT   CDS_pept        676348..677109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0575"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35082"
FT                   /db_xref="GOA:Q48NZ4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NZ4"
FT                   /protein_id="AAZ35082.1"
FT                   /translation="MSQLEKIYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALA
FT                   GENRVTIGQAERREMDAWVEGVHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDG
FT                   VTDPHNLGACLRTADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTL
FT                   EKLQQRGLWVVGTAGEAEVELYQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAG
FT                   SVSSLNVSVATGVCLFEALRQRSVKAAGKKA"
FT   gene            677323..677748
FT                   /gene="rpsF"
FT                   /locus_tag="PSPPH_0576"
FT                   /note="PSPPH0576"
FT   CDS_pept        677323..677748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="PSPPH_0576"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by similarity to SP:P02358; match to
FT                   protein family HMM PF01250; match to protein family HMM
FT                   TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36416"
FT                   /db_xref="GOA:Q48NZ3"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48NZ3"
FT                   /protein_id="AAZ36416.1"
FT                   /translation="MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRR
FT                   QLAYAINNVHKAHYVMLNVECTGKALAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK
FT                   AEENRSERRERRDRPEHSDSADGDDGDNSDVSDNADE"
FT   gene            677777..678007
FT                   /gene="rpsR"
FT                   /locus_tag="PSPPH_0577"
FT                   /note="PSPPH0577"
FT   CDS_pept        677777..678007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="PSPPH_0577"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35081"
FT                   /db_xref="GOA:Q48NZ2"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48NZ2"
FT                   /protein_id="AAZ35081.1"
FT                   /translation="MARFFRRRKFCRFTAEDVKEIDYKDLNTLKAYVSETGKIVPSRIT
FT                   GTKARYQRQLATAIKRARFLALLAYTDSHGR"
FT   gene            678047..678943
FT                   /locus_tag="PSPPH_0578"
FT                   /note="PSPPH0578"
FT   CDS_pept        678047..678943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0578"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37818"
FT                   /db_xref="GOA:Q48NZ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NZ1"
FT                   /protein_id="AAZ37818.1"
FT                   /translation="MRALAEFIMRGRMQATLVVAGCAALPLLFWLSAAAGCLVLLRRGF
FT                   SDAVGVLSWALLPALVWWYFGEPRTAMVLAGSLSLAMVLRASESWVRVLLVSVALGVVY
FT                   AVILGTVFREPLEAMSQELQKHLPTMLAGLYEQLNVEERARLGALIAPVLNGLIAAVLQ
FT                   IVSVLCLILGRYWQAMLYNPGGFGREFRAVKLPLVSALALLVCMLVGPNFGPQIAMLTP
FT                   LCSVPLVFAGLALIHGLAAEKQLSRFWLVGMYITLLVFMQLIYPLLVVIAIVDSLIDFR
FT                   GRRSSKDSGNGPANGEG"
FT   gene            678963..679409
FT                   /gene="rplI"
FT                   /locus_tag="PSPPH_0579"
FT                   /note="PSPPH0579"
FT   CDS_pept        678963..679409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="PSPPH_0579"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37261"
FT                   /db_xref="GOA:Q48NZ0"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48NZ0"
FT                   /protein_id="AAZ37261.1"
FT                   /translation="MQLILLEKVANLGNLGDKVNVKAGYGRNYLLPYGKATAATAANVA
FT                   AFEERRAELEKLAADKKASAETRAAQLAELEVTITATAGDEGKLFGSIGTHDIADALTA
FT                   SGVEVAKSEVRLPNGTIRNVGEYDVAVHLHSDVEATVRVVVVAA"
FT   gene            679533..680927
FT                   /gene="dnaB"
FT                   /locus_tag="PSPPH_0580"
FT                   /note="PSPPH0580"
FT   CDS_pept        679533..680927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="PSPPH_0580"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P03005; match to
FT                   protein family HMM PF00772; match to protein family HMM
FT                   PF03796; match to protein family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37180"
FT                   /db_xref="GOA:Q48NY9"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NY9"
FT                   /protein_id="AAZ37180.1"
FT                   /translation="MNDISTPEQYDLQTAALKVPPHSIEAEQAVLGGLMLDNNAWERVL
FT                   DQVSDGDFYRHDHRLIFRAIARLADQNSPIDVVTLAEQLDKEGQTSQVGGLGYLSELAK
FT                   NTPSVANIKAYAQIVRARATLRQLIGISTEIADSAFNPEGRTAEEILDEAERQIFQIAE
FT                   ARPKTGGPVSVNDLLTKAIDRIDTLFNSDNAITGLSTGYTDLDEKTSGMQPADLIIVAG
FT                   RPSMGKTTFAMNLVENAVLRSDKVVLVYSLEMPGESLIMRMLSSLGRIDQTKVRAGQLD
FT                   DDDWPRLTSAVNLLNDRKLFIDDTAGISPSEMRARTRRIVREHGDIAMIMIDYLQLMQI
FT                   PGSSGDNRTNEISEISRSLKALAKEFNCPVIALSQLNRSLEQRPNKRPINSDLRESGAI
FT                   EQDADVIMFVYRDEVYHPETEHKGIAEIIIGKQRNGPIGTTRLAFIGKYTRFENLAPGS
FT                   YNFDDD"
FT   gene            681035..683350
FT                   /locus_tag="PSPPH_0581"
FT                   /note="PSPPH0581"
FT   CDS_pept        681035..683350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0581"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34249"
FT                   /db_xref="GOA:Q48NY8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NY8"
FT                   /protein_id="AAZ34249.1"
FT                   /translation="MQAAKPLFDYPKYWAECFGPAPFLPMSREEMDLLGWDSCDIIIVT
FT                   GDAYVDHPSFGMAIIGRLLESQGFRVGIIAQPNWQSKDDFMKLGEPNLFFGVAAGNMDS
FT                   MINRYTADKKIRSDDAYTPGGMAGKRPDRASLVYSQRCKEAYKHVPIVLGGIEASLRRI
FT                   AHYDYWQDKVRNSILIDACADILLYGNAERAIVEVAQRLSYGHKIEDITDVRGTAFIRR
FT                   DTPQGWYEVDSTRIDRPGKVDKIINPYVNTQDTQACAIEQEKGNVEDPNEAKVVQILAS
FT                   PRMTRDKTVIRLPSVEKVRNDAVLYAHANRVLHLETNPGNARALVQKHGEVDVWFNPPP
FT                   IPMTTEEMDYVFGMPYARVPHPAYGKEKIPAYDMIRFSVNIMRGCFGGCTFCSITEHEG
FT                   RIIQNRSEESIIREIEEIRDKVPGFTGVISDLGGPTANMYRIACKSPEIESACRKPSCV
FT                   FPGICPNLNTDHSSLIQLYRSARALPGVKKILIASGLRYDLAVESPEYVKELVTHHVGG
FT                   YLKIAPEHTEEGPLNQMMKPGIGSYDKFKRMFEKYTKEAGKEQYLIPYFIAAHPGTTDE
FT                   DMMNLALWLKGNGFRADQVQAFYPSPMATATAMYHSGKNPLRKVTYKSDAVTIVKSEAQ
FT                   RRLHKAFLRYHDPKGWPMLREALERMGRADLIGPGKDQLIPLHQPATDSYQSARRKNST
FT                   PAGSHKVAKNAKTTLIQTQHTGLPPRGSDGSKPWDKREEAKAAAMARNKQAAKERMDAA
FT                   KGGKGKGGKPARKPVVPR"
FT   gene            complement(683402..686146)
FT                   /locus_tag="PSPPH_0582"
FT                   /note="PSPPH0582"
FT   CDS_pept        complement(683402..686146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36606"
FT                   /db_xref="GOA:Q48NY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NY7"
FT                   /protein_id="AAZ36606.1"
FT                   /translation="MTQLNPAQQPLSEPTPAVDAHIDLMDPAESADYETTRKALLAVMQ
FT                   SSNAPISLEDIRIKPDPASGFGEYCAEKAALPAPLQAEKQELPFQIDSDGSVSLALMLS
FT                   YNYGLSLPPSPDKTAIKTLLNTLAELRASQELGLIDQFDIKAILTPKNLQDLKRARTEY
FT                   LGNEGGTLLSKLGAEIIASCPLADVQDSPVAVMAQVLRSGPARALGQTLLAQLDRPEGE
FT                   TSASLMTLMDRILWHAISSDLQQPEDRKPGEIAGYTFSRTENLGRSHADILNDMHSHLI
FT                   NTGKAASINEAILARFVLALENCPEWLVNGVPDDLPYGCTEVWVNFQHGVTLAEAIEFG
FT                   SSRWMSFDDLIELPVIFNKKMDTEEQQAAYLTTRLPILLAWAQANGYIRIQGNLPYSEQ
FT                   EIAQAVSAFEESETESLEAVNALVRTAPERKAMAIVTMTEARRTPAIQQILEQEDYPFP
FT                   PIDLRPRLAVLRKSHTPVYRDHKGTLSASNLPYNAYGIKHDSSSLLEVYMAGENIDDWR
FT                   LPGRDSTEGLLPINREMQLLYKALPDINQQFEHEFQAYLADARKAYATIIKKLLTQLPF
FT                   KHRLAIENGAVSLYSLRLPTQDLMAVAESEKHREPLRGLAGFIIEAVYEGKTRFYEVFP
FT                   LLMRVRYRPDLKALIENGVPGIEFWTITSTIPTPVIVNKGRTLPFDQNAYLRGDEPRDG
FT                   ATATMIAEIVGEPFGPSNTETALHMPITTFSKRCTGIASIVCSQLFYVNEDDLYAQCKG
FT                   ITKIEKDKSAPGAIEEITNILISLTPWPEFKSLLSGEKNRMRAGALGLSVYMIPYGGFA
FT                   GKLLAGTAKVATRLGKKLIARVGKVHVSKLLMKTRITLRGTTSINIRPAPDVTGKVLTG
FT                   VSQFVVKHVTWKFLAINVGKGYSRRLIASMGTQEPQAEEQKAT"
FT   gene            686420..689698
FT                   /locus_tag="PSPPH_0583"
FT                   /note="PSPPH0583"
FT   CDS_pept        686420..689698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0583"
FT                   /product="transglutaminase-like superfamily domain protein"
FT                   /note="identified by match to protein family HMM PF01841"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33939"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NY6"
FT                   /protein_id="AAZ33939.1"
FT                   /translation="MSIHIALHHVTHYRYERAVELGPQIVRLRPAAHSRTRVLSYSLKV
FT                   LPENHFINWQQDPQGNYLARLVFPEKTREFRVEVDLVAEMAVFNPFDFFLEPYAENIPF
FT                   NYASEEQRELAPYLEKLPLTPRFQAYLDSISREPIPAIDFLVGLNQRLSQDVAYLIRME
FT                   PGVQTPEFTLENASGSCRDSAWLLVQLLRHLGMAARFVSGYLIQLKADVEALDGPSGTD
FT                   VDFTDLHAWCEVYLPGAGWVGLDATSGLFAGEGHIPLACSPEPSSAAPISGLVEPCETD
FT                   FSHEMSVERIWEAPRVTKPYTEEQWQDIQSLGRQIDADLTRDDVRLTMGGEPTFVSLDD
FT                   RDGAEWNTAALGPRKRELSAELFQRMRAHYAPLGIVHFGQGKWYPGEQLPRWSLNCFWR
FT                   KDGKPVWRNNALIADETQDYGATGELAGRFLASVAERLKLPARFVFPAYEDNFYYLWRE
FT                   GALPVNVTAEDSRLGDELERARLRKVFAQGLDKMIGQVLPLARNAGGDSWQSGRWYLRD
FT                   EHCRLVPGDSALGYRLPLASQPWVKAAEYPFIHPTDHNQDFPELADSDSLTSALKSTDI
FT                   DAERSPKIDESADWLTRTALCAEARDGRLYLFMPPLQKLEEYLELVAVIEAIAEELQCP
FT                   ILLEGYEPPSDPRLCNFRITPDPGVIEVNVQPSASWDELVERTEFLYEQARLTRLTTEK
FT                   FMINGRHTGTGGGNHFVLGGATPADSPFLRRPDLLRSLISYWHNHPSLSYLFSGLFIGP
FT                   TSQAPRIDEARNDSLYEMGIAFAQMPEPGEEVAPWIVDRLLRNLLIDVTGNTHRAEFCI
FT                   DKLYSPDGATGRLGLLELRAFEMPPHARMSLAQQLLLRALVARFWREPYAPAKLARWGT
FT                   QLHDRFMLPHFIEQDFADVVADLNAAGYPVQADWFSAHLEFRFPKVGDYAVNGIELELR
FT                   QALEPWHVLGEEGSAGGAVRYVDSSLERLQVHLSGLPPQRYVLTCNGVAVPLQSTGRAG
FT                   EFVAGVRYRAWQPANCLQPTIGVHAPLVFDLVDTWMHRSLGGCAYHVAHPGGRNYETLP
FT                   VNANEAESRRLSRFFRIGHTPGKLDVPSLNINDELPMTLDMRLH"
FT   gene            689770..692283
FT                   /locus_tag="PSPPH_0584"
FT                   /note="PSPPH0584"
FT   CDS_pept        689770..692283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0584"
FT                   /product="DUF404"
FT                   /note="identified by match to protein family HMM PF04168;
FT                   match to protein family HMM PF04169; match to protein
FT                   family HMM PF04174"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33846"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NY5"
FT                   /protein_id="AAZ33846.1"
FT                   /translation="MPAEPSMPDLLDHYPLSEGTYHEMLDADGAVRPHWRRLYEHMQRS
FT                   TSAQLIQRQALLTRQIQENGVTYNVYADPKGADRPWELDLLPHIIAADEWQHVAAGIAQ
FT                   RARLLNAVLADLYGPQTLIANGLLPAELVFGHNNFLWPCQGVKPPEGTFLHMYAVDLAR
FT                   TPDGRWWVTADRTQAPSGAGYALENRQSVARALPETYRDLQVRHLSGFFDALQQTLARQ
FT                   APTSSEAPLVVLLTPGRFNESYFEHLYLARQLGYPLVEGGDLTVRDATVYLKTLSGLRR
FT                   VHAIMRRLDDDFCDPLELRTDSALGVPGLLEAVRQGNVLVANALGSGVLESPGLLGFLP
FT                   KISQYLFGEDLILPSVATWWCGEPPVLAQALEKLPDLLIKPAFPSQHFAPVFGRDLNEE
FT                   QRNALALRMQSRPYAYVAQELAQLSHAPLLQADGTGLQPRAIGMRVYAVASLDGYRVLP
FT                   GGLTRVAAEADADVVSMQRGGASKDTWVLGERSHLGEPWKGQRTLGVYDLIRRDPYLPS
FT                   RVVENLFWFGRYCERCDDSARLLRIMLTRYVDDDDPLALQVAVALAESLGMLPEAEEGE
FT                   ELKDRLLVALLGDEWPFSLRANLQRLQWAASQVRGKLSRENWQALVELQREASSLETEE
FT                   PDFGELLDFLNRLVMSLAALSGFALDDMTRDEGWSFLMIGRRIERLKFLSTSLAAFLRG
FT                   SAVSEKAGLEWLLELGNSSITYRSRYMAVPHLIPVLDLLLLDEQNPHAVLFQLKLVQRS
FT                   LRRLNDEFDAPRDSSLAVLVQRLAAFDLGSLENPLFGQSSIDAVLDGLADLLQSIGDSS
FT                   GQASDRLALRHFAHVDDVSQRTVSV"
FT   gene            692283..693176
FT                   /locus_tag="PSPPH_0585"
FT                   /note="PSPPH0585"
FT   CDS_pept        692283..693176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0585"
FT                   /product="transglutaminase-like domain protein"
FT                   /note="identified by match to protein family HMM PF01841"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35892"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NY4"
FT                   /protein_id="AAZ35892.1"
FT                   /translation="MSAFYQIFHDTHYKYDSPVSLAQQLAHLWPRSSPWQRCTEQALEI
FT                   FPEPTTRRDELDVFGNPLTRLAFERPHDELQVNARLRIEVMEKPFLDFNLSPEWEVTRS
FT                   ALTYSAKPMTADILEACRYRFESPYVHLKRSFVEFSQVCFPPGRPLLLCVQALMEKIFE
FT                   EFTFDEEATQVATPLVEVLERRRGVCQDFAHLMLACLRSRGLAARYVSGYLLTQPPPGQ
FT                   PRLIGADASHAWVSVFCPASGWVDFDPTNNVQPALEHISLAWGRDFSDVSPLRGVILGG
FT                   GTHDPDVRVTVMPVSA"
FT   gene            693330..693776
FT                   /gene="azu"
FT                   /locus_tag="PSPPH_0586"
FT                   /note="PSPPH0586"
FT   CDS_pept        693330..693776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azu"
FT                   /locus_tag="PSPPH_0586"
FT                   /product="azurin"
FT                   /note="identified by similarity to SP:P00282; match to
FT                   protein family HMM PF00127"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37861"
FT                   /db_xref="GOA:Q48NY3"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014068"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NY3"
FT                   /protein_id="AAZ37861.1"
FT                   /translation="MIRKLVAISLLSLASSQLLAAECSATVDSTDQMMYDTKAIEIDKS
FT                   CKEFTVNLTHSGSLPKNVMGHNWVLSKKSDTQAIVTDGMAVGIDKDYLKPDDSRIIAHT
FT                   KVIGAGEKDSVTFDVSKLDPAQEYQFFCTFPGHISMMKGAVTLK"
FT   gene            complement(694136..694963)
FT                   /gene="nadE"
FT                   /locus_tag="PSPPH_0587"
FT                   /note="PSPPH0587"
FT   CDS_pept        complement(694136..694963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="PSPPH_0587"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="identified by match to protein family HMM PF02540;
FT                   match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36163"
FT                   /db_xref="GOA:Q48NY2"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48NY2"
FT                   /protein_id="AAZ36163.1"
FT                   /translation="MHAVQRQIAEQLKVQPPFADQNALQAEVARRVSFIKECLQNARLK
FT                   TLVLGISGGVDSLTAGLLAQRAVKELRASTGDNSYRFIAVRLPYVVQADEHEAQASVDF
FT                   IEPDERHTINIGSSVKALAAEVKAFDGLPASSVDFVLGNTKARMRMVAQYTVAGAYQGL
FT                   VIGTDHAAEAVMGFFTKFGDGACDLAPLSGLVKNQVRAIARHFGAPESLVEKVPTADLE
FT                   DLSPGKPDEASHGVTYAEIDAFLHGEPVREEAFKIICETYAKTQHKRELPYAP"
FT   gene            complement(694990..696213)
FT                   /gene="pncB"
FT                   /locus_tag="PSPPH_0588"
FT                   /note="PSPPH0588"
FT   CDS_pept        complement(694990..696213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="PSPPH_0588"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01514"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35602"
FT                   /db_xref="GOA:Q48NY1"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48NY1"
FT                   /protein_id="AAZ35602.1"
FT                   /translation="MSESAFSNRIVQSLLDTDFYKLTMMQAVLHNYPNVDVEWEFRCRN
FT                   GEDLRPYLDEIRHQIELLCELSLSPEHLAFLERITFIKPDFLRFLGLFRFNTRYVKTSI
FT                   ENDELCIRLHGPWLHVILFEVPLLAIVSEVRNRHRYPDTLLSQARDRLYDKFEWLTTHA
FT                   TADELAELKVADFGTRRRFSYRVQEEMLGVLKNDFPGQFVGTSNVHLARQLDLKPLGTM
FT                   AHEWIMAHQQLGPRLIDSQIAALDCWVREYRGLLGIALTDCITTDAFLNDFDLYFAKLF
FT                   DGLRHDSGDPVKWAEKCISHYQKLGIDPMSKTLVFSDGLNLPKALDIFRALRGRINVSF
FT                   GIGTNLTADIPGIAPMNMVLKMTACAGQAVAKISDEPGKTQCKDPNFVAYLRHVFKVPD
FT                   LPSPEKPA"
FT   gene            complement(696313..697218)
FT                   /locus_tag="PSPPH_0589"
FT                   /note="PSPPH0589"
FT   CDS_pept        complement(696313..697218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0589"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by similarity to SP:P32064; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ35355"
FT                   /db_xref="GOA:Q48NY0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NY0"
FT                   /protein_id="AAZ35355.1"
FT                   /translation="MLNKRHLPSIAALQCFEAVTRHLSFTRAAEELNLTQSAVSKQVAQ
FT                   LEELVQHPLFQRVRRRLQLTPAGALYLAEVRKILTQIEMSTHFLRSYGGETEVLRVSTP
FT                   STFGARWLVPRLKGWRLRHPHIHLDLINEQESDDLIKGRCDVSFYFGQAAIPGAESVKL
FT                   FGEELVAVCSPESLPVEPLSDPTQLSELVLLQNAFRPEAWHEWFESQGYHTDHSYHGPR
FT                   FETFYMCIRAAQVGCGVALLPRFLVEEELAEGKLVITWDYALPSTNSAYYLSYPEHTAD
FT                   VPKIRVFLQWMLEQLDQPAR"
FT   gene            697724..698860
FT                   /locus_tag="PSPPH_0590"
FT                   /note="PSPPH0590"
FT   CDS_pept        697724..698860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0590"
FT                   /product="high affinity branched-chain amino acid ABC
FT                   transporter, periplasmic amino acid-binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ34802"
FT                   /db_xref="GOA:Q48NX9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NX9"
FT                   /protein_id="AAZ34802.1"
FT                   /translation="MSHTFYRKGFLAIAVATALGVSSFAQADVKIGVAGPMTGANASFG
FT                   QQYMKGAQAAADAINAAGGVNGEKIVLVSGDDACEPKQAVAVANRLVDNDKVIGVVGHF
FT                   CSSSTIPASEVYSDAGVIAITPGSTNPTVTERGLKEMFRMCGRDDQQGVVAGDYIVDVL
FT                   KGKKVAVINDKDTYGKGLADATAKQLVARGVKPVLEEGLTRGEKDFSALVTKIRSTGAD
FT                   VVYFGGLHPEAGPLVRQMREQGLKDVKFMSDDGIVTDELVTTAGGAQYVDGVYMTFGAD
FT                   PRVLPDSKAVVDQFRKSGYEPEGYTLYAYASIQALAAGFNGAKSNKGDKAAEWLKAHPV
FT                   KTVMGEKAWDAKGDLKVSDYVVYQWDAAGKYKQLEKQK"
FT   regulatory      complement(698397..698429)
FT                   /note="hrp; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and/or weight matrix
FT                   scans (PMID: 17073302)"
FT                   /regulatory_class="promoter"
FT   gene            699022..699936
FT                   /gene="braD"
FT                   /locus_tag="PSPPH_0591"
FT                   /note="PSPPH0591"
FT   CDS_pept        699022..699936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braD"
FT                   /locus_tag="PSPPH_0591"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, permease protein BraD"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33764"
FT                   /db_xref="GOA:Q48NX8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NX8"
FT                   /protein_id="AAZ33764.1"
FT                   /translation="MDGIFLQQMVNGLTLGSVYGLIAIGYTMVYGIIGMINFAHGDVYM
FT                   ISAYLAAIGLAVLSFFGLDSFPFLILGTLVFTIVVTGVYGFVIERVAYKPLRNSTRLAP
FT                   LISAIGISLILQNYAQISQGARQQGVPTLLEGAWRFEIGSGFVQITYTKIFILIAAFVG
FT                   MGVLTYIIKYTKLGRMCRATQQDRKMASILGINTDRVISYVFIIGAAMAALAGVLITMN
FT                   YGTFDFYAGFIIGIKAFTAAVLGGIGSLPGAMLGGLILGVAESQFSGLINSDYKDVFSF
FT                   GLLVLILIFRPQGLLGRPLVAKV"
FT   gene            699939..701252
FT                   /gene="braE"
FT                   /locus_tag="PSPPH_0592"
FT                   /note="PSPPH0592"
FT   CDS_pept        699939..701252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braE"
FT                   /locus_tag="PSPPH_0592"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, permease protein BraE"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33061"
FT                   /db_xref="GOA:Q48NX7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NX7"
FT                   /protein_id="AAZ33061.1"
FT                   /translation="MSAPVAAPVVKPVEIKKSLIDAVVAGLLALIVFGPIVGIVLDGYS
FT                   FNLQPTRVAWLVAVVMVGRFLISLFLQTPKGIRVSQSFESSDSGVHVLKPDHKSRLYWI
FT                   IPLLIVIAIVFPIFANKYILTVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAY
FT                   GLALGYQYLGLGFWSALPLAAIAAALAGCILGFPVLRMHGDYLAIVTLGFGEIIRLVLN
FT                   NWLSFTGGPNGVPVPSPTFFGLEFGRRAKDGGIPIHEYFGFDYNPDLKFLFIYTVLFLV
FT                   VLAVLFIKHRLTRMPIGRAWEALREDEIACRSMGLNHVLVKLSAFTIGASTAGLAGVFF
FT                   ASYQGFVNPTSFTFFESALILAIVVLGGMGSTVGVVIAAFVLTVAPELLRSFSEYRVLL
FT                   FGILMVLMMIWRPRGLIRISRTGVKPRKGALVTEGGAR"
FT   gene            701249..702124
FT                   /locus_tag="PSPPH_0593"
FT                   /note="PSPPH0593"
FT   CDS_pept        701249..702124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0593"
FT                   /product="high affinity branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ37341"
FT                   /db_xref="GOA:Q48NX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NX6"
FT                   /protein_id="AAZ37341.1"
FT                   /translation="MSNEVILSVEHLMMHFGGIKALSDVSLKVRRNSIFALIGPNGAGK
FT                   TTVFNCLTGFYKATGGRIELHTRDKTTNVIRLLGEPFKATDFVSPKSFFSRVYYKMFGG
FT                   THLVNRAGLARTFQNIRLLKEMSVVENLLVAQHMWVNRSLISGILNTKGYRKAEEDALN
FT                   TAFYWLEVVDLVDCANRLAGELSYGQQRRLEIARAMCTRPQVICLDEPAAGLNPQETEA
FT                   LSGMIRLLRDEHDMTIVLIEHDMGMVMGISDDIVVLDHGNVIAAGGPEQIRNDPKVIAA
FT                   YLGADEEELV"
FT   gene            702121..702837
FT                   /locus_tag="PSPPH_0594"
FT                   /note="PSPPH0594"
FT   CDS_pept        702121..702837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0594"
FT                   /product="high affinity branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36792"
FT                   /db_xref="GOA:Q48NX5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NX5"
FT                   /protein_id="AAZ36792.1"
FT                   /translation="MSKPILELKEIDVFYGPIQALKKVSLHINEGETVSLIGSNGAGKS
FT                   TLLMSIFGQPRAASGQIIYQGTDITQKSSHYIASNGIAQSPEGRRVFPDMSVEENLMMG
FT                   TIPIGDKHSAEDMQRMFELFPRLKERRNQRAMTMSGGEQQMLAIARALMSRPRLLLLDE
FT                   PSLGLAPIIVKQIFSTLRELAATGMTIFLVEQNANHALKLSDRAYVMVNGEIRLSGTGK
FT                   ELLVNEEVRNAYLGGH"
FT   gene            complement(703194..704162)
FT                   /locus_tag="PSPPH_0595"
FT                   /note="PSPPH0595"
FT   CDS_pept        complement(703194..704162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ36241"
FT                   /db_xref="GOA:Q48NX4"
FT                   /db_xref="InterPro:IPR040684"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NX4"
FT                   /protein_id="AAZ36241.1"
FT                   /translation="MRTTPIKKLSKSVAYDDYWRFSSLRQQSFYDMLNGSKTQCNPIIE
FT                   KYKFTNCYRVLDRTTQYLVKNISSSQTDSPGDVFLRTILFKNFNKIETWQAIEDRFGKI
FT                   GLNNFNSIEIAKFLSELRAEKSKIYSAAYIMPSGKSQWGSSIKHENNLKMISHMLKLEL
FT                   HHSIWDHNHLGDIYNAFLKMPSIGKFLAFQYSVDIAYSTYSQATESQFVIAGPGAVRGI
FT                   KKCFPDAVEKEFTYIIEKMADQQESEFERLGLQFQPLQNRALQLIDCQNIFCEVDKYLR
FT                   VKRPELNISTSRIKQNYTPHKERIHYQLPEKWKAAIPRTTI"
FT   gene            complement(704165..704878)
FT                   /locus_tag="PSPPH_0596"
FT                   /note="PSPPH0596"
FT   CDS_pept        complement(704165..704878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPPH_0596"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPPH_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ33581"
FT                   /db_xref="GOA:Q48NX3"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q48NX3"
FT                   /protein_id="AAZ33581.1"
FT                   /translation="MFWSGNKLTSELKNLIETPNGIVNSESVDCAAITLTVGNEVYITP
FT                   NSDKDSNVKQILTDEKPQFIIPTGQFALLLTAETVKVPDTALAFISFKAKYKFKGLINV
FT                   SGFHVDPGWKGKLTFSVYNAGPTSIVLERGAPFALIWYADLDNTATSRYAKTKSNSTNH
FT                   LDHEKVSDMTGELYSPFKLKKDIDDLKKELSTLESKIVTRYSAIIFAVFSTVIAFALRE
FT                   KII