(data stored in ACNUC7421 zone)

EMBL: CP000075

ID   CP000075; SV 1; circular; genomic DNA; STD; PRO; 6093698 BP.
XX
AC   CP000075; AABP02000000-AABP02000026;
XX
PR   Project:PRJNA323;
XX
DT   13-MAY-2005 (Rel. 83, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 23)
XX
DE   Pseudomonas syringae pv. syringae B728a, complete genome.
XX
KW   .
XX
OS   Pseudomonas syringae pv. syringae B728a
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
XX
RN   [1]
RP   1-6093698
RX   DOI; 10.1073/pnas.0504930102.
RX   PUBMED; 16043691.
RA   Feil H., Feil W.S., Chain P., Larimer F., DiBartolo G., Copeland A.,
RA   Lykidis A., Trong S., Nolan M., Goltsman E., Thiel J., Malfatti S.,
RA   Loper J.E., Lapidus A., Detter J.C., Land M., Richardson P.M.,
RA   Kyrpides N.C., Ivanova N., Lindow S.E.;
RT   "Comparison of the complete genome sequences of Pseudomonas syringae pv.
RT   syringae B728a and pv. tomato DC3000";
RL   Proc. Natl. Acad. Sci. U.S.A. 102(31):11064-11069(2005).
XX
RN   [2]
RP   1-6093698
RA   Loper J.;
RT   ;
RL   Submitted (04-MAY-2005) to the INSDC.
RL   Oregon State University, OR 97331, USA
XX
RN   [3]
RP   1-6093698
RA   Feil H., Feil W.S., Lindow S.E.;
RT   ;
RL   Submitted (05-MAY-2005) to the INSDC.
RL   Departments of Plant and Microbial Biology, University of California,
RL   Berkeley, CA 94720, USA
XX
RN   [4]
RC   Amino acid sequence updated by submitter
RP   1-6093698
RA   Feil H., Feil W.S., Lindow S.E.;
RT   ;
RL   Submitted (01-NOV-2005) to the INSDC.
RL   Departments of Plant and Microbial Biology, University of California,
RL   Berkeley, CA 94720, USA
XX
DR   MD5; 42284f3e9a1209edd9cc17b09dd8bde0.
DR   BioSample; SAMN02604347.
DR   EnsemblGenomes-Gn; EBG00001029970.
DR   EnsemblGenomes-Gn; EBG00001029971.
DR   EnsemblGenomes-Gn; EBG00001029972.
DR   EnsemblGenomes-Gn; EBG00001029973.
DR   EnsemblGenomes-Gn; EBG00001029974.
DR   EnsemblGenomes-Gn; EBG00001029975.
DR   EnsemblGenomes-Gn; EBG00001029976.
DR   EnsemblGenomes-Gn; EBG00001029977.
DR   EnsemblGenomes-Gn; EBG00001029978.
DR   EnsemblGenomes-Gn; EBG00001029979.
DR   EnsemblGenomes-Gn; EBG00001029980.
DR   EnsemblGenomes-Gn; EBG00001029981.
DR   EnsemblGenomes-Gn; EBG00001029982.
DR   EnsemblGenomes-Gn; EBG00001029983.
DR   EnsemblGenomes-Gn; EBG00001029984.
DR   EnsemblGenomes-Gn; EBG00001029985.
DR   EnsemblGenomes-Gn; EBG00001029986.
DR   EnsemblGenomes-Gn; EBG00001029987.
DR   EnsemblGenomes-Gn; EBG00001029988.
DR   EnsemblGenomes-Gn; EBG00001029989.
DR   EnsemblGenomes-Gn; EBG00001029990.
DR   EnsemblGenomes-Gn; EBG00001029991.
DR   EnsemblGenomes-Gn; EBG00001029992.
DR   EnsemblGenomes-Gn; EBG00001029993.
DR   EnsemblGenomes-Gn; EBG00001029994.
DR   EnsemblGenomes-Gn; EBG00001029995.
DR   EnsemblGenomes-Gn; EBG00001029996.
DR   EnsemblGenomes-Gn; EBG00001029997.
DR   EnsemblGenomes-Gn; EBG00001029998.
DR   EnsemblGenomes-Gn; EBG00001029999.
DR   EnsemblGenomes-Gn; EBG00001030000.
DR   EnsemblGenomes-Gn; EBG00001030001.
DR   EnsemblGenomes-Gn; EBG00001030002.
DR   EnsemblGenomes-Gn; EBG00001030003.
DR   EnsemblGenomes-Gn; EBG00001030004.
DR   EnsemblGenomes-Gn; EBG00001030005.
DR   EnsemblGenomes-Gn; EBG00001030006.
DR   EnsemblGenomes-Gn; EBG00001030007.
DR   EnsemblGenomes-Gn; EBG00001030008.
DR   EnsemblGenomes-Gn; EBG00001030009.
DR   EnsemblGenomes-Gn; EBG00001030010.
DR   EnsemblGenomes-Gn; EBG00001030011.
DR   EnsemblGenomes-Gn; EBG00001030012.
DR   EnsemblGenomes-Gn; EBG00001030013.
DR   EnsemblGenomes-Gn; EBG00001030014.
DR   EnsemblGenomes-Gn; EBG00001030015.
DR   EnsemblGenomes-Gn; EBG00001030016.
DR   EnsemblGenomes-Gn; EBG00001030017.
DR   EnsemblGenomes-Gn; EBG00001030018.
DR   EnsemblGenomes-Gn; EBG00001030019.
DR   EnsemblGenomes-Gn; EBG00001030020.
DR   EnsemblGenomes-Gn; EBG00001030021.
DR   EnsemblGenomes-Gn; EBG00001030022.
DR   EnsemblGenomes-Gn; EBG00001030023.
DR   EnsemblGenomes-Gn; EBG00001030024.
DR   EnsemblGenomes-Gn; EBG00001030025.
DR   EnsemblGenomes-Gn; EBG00001030026.
DR   EnsemblGenomes-Gn; EBG00001030027.
DR   EnsemblGenomes-Gn; EBG00001030028.
DR   EnsemblGenomes-Gn; EBG00001030029.
DR   EnsemblGenomes-Gn; EBG00001030030.
DR   EnsemblGenomes-Gn; EBG00001030031.
DR   EnsemblGenomes-Gn; EBG00001030032.
DR   EnsemblGenomes-Gn; EBG00001030033.
DR   EnsemblGenomes-Gn; EBG00001030034.
DR   EnsemblGenomes-Gn; EBG00001030035.
DR   EnsemblGenomes-Gn; EBG00001030036.
DR   EnsemblGenomes-Gn; EBG00001030037.
DR   EnsemblGenomes-Gn; EBG00001030038.
DR   EnsemblGenomes-Gn; EBG00001030039.
DR   EnsemblGenomes-Gn; EBG00001030040.
DR   EnsemblGenomes-Gn; EBG00001030041.
DR   EnsemblGenomes-Gn; EBG00001030042.
DR   EnsemblGenomes-Gn; EBG00001030043.
DR   EnsemblGenomes-Gn; EBG00001030044.
DR   EnsemblGenomes-Gn; EBG00001030045.
DR   EnsemblGenomes-Gn; EBG00001030046.
DR   EnsemblGenomes-Gn; EBG00001030047.
DR   EnsemblGenomes-Gn; EBG00001030048.
DR   EnsemblGenomes-Gn; EBG00001030049.
DR   EnsemblGenomes-Gn; EBG00001030050.
DR   EnsemblGenomes-Gn; EBG00001030051.
DR   EnsemblGenomes-Gn; EBG00001030052.
DR   EnsemblGenomes-Gn; EBG00001030053.
DR   EnsemblGenomes-Gn; EBG00001030054.
DR   EnsemblGenomes-Gn; EBG00001030055.
DR   EnsemblGenomes-Gn; EBG00001030056.
DR   EnsemblGenomes-Gn; EBG00001030057.
DR   EnsemblGenomes-Gn; EBG00001030058.
DR   EnsemblGenomes-Gn; EBG00001030059.
DR   EnsemblGenomes-Gn; EBG00001030060.
DR   EnsemblGenomes-Gn; EBG00001030061.
DR   EnsemblGenomes-Gn; EBG00001030062.
DR   EnsemblGenomes-Gn; EBG00001030063.
DR   EnsemblGenomes-Gn; EBG00001030064.
DR   EnsemblGenomes-Gn; EBG00001030065.
DR   EnsemblGenomes-Gn; EBG00001030066.
DR   EnsemblGenomes-Gn; EBG00001030067.
DR   EnsemblGenomes-Gn; EBG00001030068.
DR   EnsemblGenomes-Gn; EBG00001030069.
DR   EnsemblGenomes-Gn; EBG00001030070.
DR   EnsemblGenomes-Gn; EBG00001030071.
DR   EnsemblGenomes-Gn; EBG00001030072.
DR   EnsemblGenomes-Gn; EBG00001030073.
DR   EnsemblGenomes-Gn; EBG00001030074.
DR   EnsemblGenomes-Gn; EBG00001030075.
DR   EnsemblGenomes-Gn; EBG00001030076.
DR   EnsemblGenomes-Gn; EBG00001030077.
DR   EnsemblGenomes-Gn; EBG00001030078.
DR   EnsemblGenomes-Gn; EBG00001030079.
DR   EnsemblGenomes-Gn; EBG00001030080.
DR   EnsemblGenomes-Gn; EBG00001030081.
DR   EnsemblGenomes-Gn; EBG00001030082.
DR   EnsemblGenomes-Gn; EBG00001030083.
DR   EnsemblGenomes-Gn; EBG00001030084.
DR   EnsemblGenomes-Gn; EBG00001030085.
DR   EnsemblGenomes-Gn; EBG00001030086.
DR   EnsemblGenomes-Gn; EBG00001030087.
DR   EnsemblGenomes-Gn; EBG00001030088.
DR   EnsemblGenomes-Gn; EBG00001030089.
DR   EnsemblGenomes-Gn; EBG00001030090.
DR   EnsemblGenomes-Gn; EBG00001030091.
DR   EnsemblGenomes-Gn; EBG00001030092.
DR   EnsemblGenomes-Gn; EBG00001030093.
DR   EnsemblGenomes-Gn; EBG00001030094.
DR   EnsemblGenomes-Gn; EBG00001030095.
DR   EnsemblGenomes-Gn; EBG00001030096.
DR   EnsemblGenomes-Gn; EBG00001030097.
DR   EnsemblGenomes-Gn; EBG00001030098.
DR   EnsemblGenomes-Gn; EBG00001030099.
DR   EnsemblGenomes-Gn; Psyr_0119.
DR   EnsemblGenomes-Gn; Psyr_0311.
DR   EnsemblGenomes-Gn; Psyr_0372.
DR   EnsemblGenomes-Gn; Psyr_0373.
DR   EnsemblGenomes-Gn; Psyr_0698.
DR   EnsemblGenomes-Gn; Psyr_0699.
DR   EnsemblGenomes-Gn; Psyr_0729.
DR   EnsemblGenomes-Gn; Psyr_0730.
DR   EnsemblGenomes-Gn; Psyr_0731.
DR   EnsemblGenomes-Gn; Psyr_0732.
DR   EnsemblGenomes-Gn; Psyr_0739.
DR   EnsemblGenomes-Gn; Psyr_0740.
DR   EnsemblGenomes-Gn; Psyr_0743.
DR   EnsemblGenomes-Gn; Psyr_0744.
DR   EnsemblGenomes-Gn; Psyr_0745.
DR   EnsemblGenomes-Gn; Psyr_0747.
DR   EnsemblGenomes-Gn; Psyr_0939.
DR   EnsemblGenomes-Gn; Psyr_0940.
DR   EnsemblGenomes-Gn; Psyr_1087.
DR   EnsemblGenomes-Gn; Psyr_1088.
DR   EnsemblGenomes-Gn; Psyr_1221.
DR   EnsemblGenomes-Gn; Psyr_1222.
DR   EnsemblGenomes-Gn; Psyr_1223.
DR   EnsemblGenomes-Gn; Psyr_1438.
DR   EnsemblGenomes-Gn; Psyr_1535.
DR   EnsemblGenomes-Gn; Psyr_1552.
DR   EnsemblGenomes-Gn; Psyr_1783.
DR   EnsemblGenomes-Gn; Psyr_1884.
DR   EnsemblGenomes-Gn; Psyr_1887.
DR   EnsemblGenomes-Gn; Psyr_1888.
DR   EnsemblGenomes-Gn; Psyr_1932.
DR   EnsemblGenomes-Gn; Psyr_2317.
DR   EnsemblGenomes-Gn; Psyr_2318.
DR   EnsemblGenomes-Gn; Psyr_2319.
DR   EnsemblGenomes-Gn; Psyr_2344.
DR   EnsemblGenomes-Gn; Psyr_2833.
DR   EnsemblGenomes-Gn; Psyr_2849.
DR   EnsemblGenomes-Gn; Psyr_2853.
DR   EnsemblGenomes-Gn; Psyr_2870.
DR   EnsemblGenomes-Gn; Psyr_2871.
DR   EnsemblGenomes-Gn; Psyr_3079.
DR   EnsemblGenomes-Gn; Psyr_3080.
DR   EnsemblGenomes-Gn; Psyr_3723.
DR   EnsemblGenomes-Gn; Psyr_3812.
DR   EnsemblGenomes-Gn; Psyr_4650.
DR   EnsemblGenomes-Gn; Psyr_4657.
DR   EnsemblGenomes-Gn; Psyr_4658.
DR   EnsemblGenomes-Gn; Psyr_RNA1.
DR   EnsemblGenomes-Gn; Psyr_RNA10.
DR   EnsemblGenomes-Gn; Psyr_RNA11.
DR   EnsemblGenomes-Gn; Psyr_RNA12.
DR   EnsemblGenomes-Gn; Psyr_RNA13.
DR   EnsemblGenomes-Gn; Psyr_RNA14.
DR   EnsemblGenomes-Gn; Psyr_RNA15.
DR   EnsemblGenomes-Gn; Psyr_RNA16.
DR   EnsemblGenomes-Gn; Psyr_RNA17.
DR   EnsemblGenomes-Gn; Psyr_RNA18.
DR   EnsemblGenomes-Gn; Psyr_RNA19.
DR   EnsemblGenomes-Gn; Psyr_RNA2.
DR   EnsemblGenomes-Gn; Psyr_RNA20.
DR   EnsemblGenomes-Gn; Psyr_RNA21.
DR   EnsemblGenomes-Gn; Psyr_RNA22.
DR   EnsemblGenomes-Gn; Psyr_RNA23.
DR   EnsemblGenomes-Gn; Psyr_RNA24.
DR   EnsemblGenomes-Gn; Psyr_RNA25.
DR   EnsemblGenomes-Gn; Psyr_RNA26.
DR   EnsemblGenomes-Gn; Psyr_RNA27.
DR   EnsemblGenomes-Gn; Psyr_RNA28.
DR   EnsemblGenomes-Gn; Psyr_RNA29.
DR   EnsemblGenomes-Gn; Psyr_RNA3.
DR   EnsemblGenomes-Gn; Psyr_RNA30.
DR   EnsemblGenomes-Gn; Psyr_RNA31.
DR   EnsemblGenomes-Gn; Psyr_RNA32.
DR   EnsemblGenomes-Gn; Psyr_RNA33.
DR   EnsemblGenomes-Gn; Psyr_RNA34.
DR   EnsemblGenomes-Gn; Psyr_RNA35.
DR   EnsemblGenomes-Gn; Psyr_RNA36.
DR   EnsemblGenomes-Gn; Psyr_RNA37.
DR   EnsemblGenomes-Gn; Psyr_RNA38.
DR   EnsemblGenomes-Gn; Psyr_RNA39.
DR   EnsemblGenomes-Gn; Psyr_RNA4.
DR   EnsemblGenomes-Gn; Psyr_RNA40.
DR   EnsemblGenomes-Gn; Psyr_RNA41.
DR   EnsemblGenomes-Gn; Psyr_RNA42.
DR   EnsemblGenomes-Gn; Psyr_RNA43.
DR   EnsemblGenomes-Gn; Psyr_RNA44.
DR   EnsemblGenomes-Gn; Psyr_RNA45.
DR   EnsemblGenomes-Gn; Psyr_RNA46.
DR   EnsemblGenomes-Gn; Psyr_RNA47.
DR   EnsemblGenomes-Gn; Psyr_RNA48.
DR   EnsemblGenomes-Gn; Psyr_RNA49.
DR   EnsemblGenomes-Gn; Psyr_RNA5.
DR   EnsemblGenomes-Gn; Psyr_RNA50.
DR   EnsemblGenomes-Gn; Psyr_RNA51.
DR   EnsemblGenomes-Gn; Psyr_RNA52.
DR   EnsemblGenomes-Gn; Psyr_RNA53.
DR   EnsemblGenomes-Gn; Psyr_RNA54.
DR   EnsemblGenomes-Gn; Psyr_RNA55.
DR   EnsemblGenomes-Gn; Psyr_RNA56.
DR   EnsemblGenomes-Gn; Psyr_RNA57.
DR   EnsemblGenomes-Gn; Psyr_RNA58.
DR   EnsemblGenomes-Gn; Psyr_RNA59.
DR   EnsemblGenomes-Gn; Psyr_RNA6.
DR   EnsemblGenomes-Gn; Psyr_RNA60.
DR   EnsemblGenomes-Gn; Psyr_RNA61.
DR   EnsemblGenomes-Gn; Psyr_RNA62.
DR   EnsemblGenomes-Gn; Psyr_RNA63.
DR   EnsemblGenomes-Gn; Psyr_RNA64.
DR   EnsemblGenomes-Gn; Psyr_RNA65.
DR   EnsemblGenomes-Gn; Psyr_RNA66.
DR   EnsemblGenomes-Gn; Psyr_RNA67.
DR   EnsemblGenomes-Gn; Psyr_RNA68.
DR   EnsemblGenomes-Gn; Psyr_RNA69.
DR   EnsemblGenomes-Gn; Psyr_RNA7.
DR   EnsemblGenomes-Gn; Psyr_RNA70.
DR   EnsemblGenomes-Gn; Psyr_RNA71.
DR   EnsemblGenomes-Gn; Psyr_RNA72.
DR   EnsemblGenomes-Gn; Psyr_RNA73.
DR   EnsemblGenomes-Gn; Psyr_RNA74.
DR   EnsemblGenomes-Gn; Psyr_RNA75.
DR   EnsemblGenomes-Gn; Psyr_RNA76.
DR   EnsemblGenomes-Gn; Psyr_RNA77.
DR   EnsemblGenomes-Gn; Psyr_RNA78.
DR   EnsemblGenomes-Gn; Psyr_RNA79.
DR   EnsemblGenomes-Gn; Psyr_RNA8.
DR   EnsemblGenomes-Gn; Psyr_RNA80.
DR   EnsemblGenomes-Gn; Psyr_RNA81.
DR   EnsemblGenomes-Gn; Psyr_RNA82.
DR   EnsemblGenomes-Gn; Psyr_RNA83.
DR   EnsemblGenomes-Gn; Psyr_RNA9.
DR   EnsemblGenomes-Tr; EBT00001632310.
DR   EnsemblGenomes-Tr; EBT00001632311.
DR   EnsemblGenomes-Tr; EBT00001632312.
DR   EnsemblGenomes-Tr; EBT00001632313.
DR   EnsemblGenomes-Tr; EBT00001632314.
DR   EnsemblGenomes-Tr; EBT00001632315.
DR   EnsemblGenomes-Tr; EBT00001632316.
DR   EnsemblGenomes-Tr; EBT00001632317.
DR   EnsemblGenomes-Tr; EBT00001632318.
DR   EnsemblGenomes-Tr; EBT00001632319.
DR   EnsemblGenomes-Tr; EBT00001632320.
DR   EnsemblGenomes-Tr; EBT00001632321.
DR   EnsemblGenomes-Tr; EBT00001632322.
DR   EnsemblGenomes-Tr; EBT00001632323.
DR   EnsemblGenomes-Tr; EBT00001632324.
DR   EnsemblGenomes-Tr; EBT00001632325.
DR   EnsemblGenomes-Tr; EBT00001632326.
DR   EnsemblGenomes-Tr; EBT00001632327.
DR   EnsemblGenomes-Tr; EBT00001632328.
DR   EnsemblGenomes-Tr; EBT00001632329.
DR   EnsemblGenomes-Tr; EBT00001632330.
DR   EnsemblGenomes-Tr; EBT00001632331.
DR   EnsemblGenomes-Tr; EBT00001632332.
DR   EnsemblGenomes-Tr; EBT00001632333.
DR   EnsemblGenomes-Tr; EBT00001632334.
DR   EnsemblGenomes-Tr; EBT00001632335.
DR   EnsemblGenomes-Tr; EBT00001632336.
DR   EnsemblGenomes-Tr; EBT00001632337.
DR   EnsemblGenomes-Tr; EBT00001632338.
DR   EnsemblGenomes-Tr; EBT00001632339.
DR   EnsemblGenomes-Tr; EBT00001632340.
DR   EnsemblGenomes-Tr; EBT00001632341.
DR   EnsemblGenomes-Tr; EBT00001632342.
DR   EnsemblGenomes-Tr; EBT00001632343.
DR   EnsemblGenomes-Tr; EBT00001632344.
DR   EnsemblGenomes-Tr; EBT00001632345.
DR   EnsemblGenomes-Tr; EBT00001632346.
DR   EnsemblGenomes-Tr; EBT00001632347.
DR   EnsemblGenomes-Tr; EBT00001632348.
DR   EnsemblGenomes-Tr; EBT00001632349.
DR   EnsemblGenomes-Tr; EBT00001632350.
DR   EnsemblGenomes-Tr; EBT00001632351.
DR   EnsemblGenomes-Tr; EBT00001632352.
DR   EnsemblGenomes-Tr; EBT00001632353.
DR   EnsemblGenomes-Tr; EBT00001632354.
DR   EnsemblGenomes-Tr; EBT00001632355.
DR   EnsemblGenomes-Tr; EBT00001632356.
DR   EnsemblGenomes-Tr; EBT00001632357.
DR   EnsemblGenomes-Tr; EBT00001632358.
DR   EnsemblGenomes-Tr; EBT00001632359.
DR   EnsemblGenomes-Tr; EBT00001632360.
DR   EnsemblGenomes-Tr; EBT00001632361.
DR   EnsemblGenomes-Tr; EBT00001632362.
DR   EnsemblGenomes-Tr; EBT00001632363.
DR   EnsemblGenomes-Tr; EBT00001632364.
DR   EnsemblGenomes-Tr; EBT00001632365.
DR   EnsemblGenomes-Tr; EBT00001632366.
DR   EnsemblGenomes-Tr; EBT00001632367.
DR   EnsemblGenomes-Tr; EBT00001632368.
DR   EnsemblGenomes-Tr; EBT00001632369.
DR   EnsemblGenomes-Tr; EBT00001632370.
DR   EnsemblGenomes-Tr; EBT00001632371.
DR   EnsemblGenomes-Tr; EBT00001632372.
DR   EnsemblGenomes-Tr; EBT00001632374.
DR   EnsemblGenomes-Tr; EBT00001632376.
DR   EnsemblGenomes-Tr; EBT00001632378.
DR   EnsemblGenomes-Tr; EBT00001632380.
DR   EnsemblGenomes-Tr; EBT00001632381.
DR   EnsemblGenomes-Tr; EBT00001632383.
DR   EnsemblGenomes-Tr; EBT00001632384.
DR   EnsemblGenomes-Tr; EBT00001632387.
DR   EnsemblGenomes-Tr; EBT00001632389.
DR   EnsemblGenomes-Tr; EBT00001632391.
DR   EnsemblGenomes-Tr; EBT00001632393.
DR   EnsemblGenomes-Tr; EBT00001632394.
DR   EnsemblGenomes-Tr; EBT00001632395.
DR   EnsemblGenomes-Tr; EBT00001632396.
DR   EnsemblGenomes-Tr; EBT00001632397.
DR   EnsemblGenomes-Tr; EBT00001632399.
DR   EnsemblGenomes-Tr; EBT00001632401.
DR   EnsemblGenomes-Tr; EBT00001632403.
DR   EnsemblGenomes-Tr; EBT00001632405.
DR   EnsemblGenomes-Tr; EBT00001632407.
DR   EnsemblGenomes-Tr; EBT00001632408.
DR   EnsemblGenomes-Tr; EBT00001632410.
DR   EnsemblGenomes-Tr; EBT00001632412.
DR   EnsemblGenomes-Tr; EBT00001632414.
DR   EnsemblGenomes-Tr; EBT00001632416.
DR   EnsemblGenomes-Tr; EBT00001632418.
DR   EnsemblGenomes-Tr; EBT00001632419.
DR   EnsemblGenomes-Tr; EBT00001632420.
DR   EnsemblGenomes-Tr; EBT00001632422.
DR   EnsemblGenomes-Tr; EBT00001632424.
DR   EnsemblGenomes-Tr; EBT00001632425.
DR   EnsemblGenomes-Tr; EBT00001632426.
DR   EnsemblGenomes-Tr; EBT00001632428.
DR   EnsemblGenomes-Tr; EBT00001632429.
DR   EnsemblGenomes-Tr; EBT00001632431.
DR   EnsemblGenomes-Tr; EBT00001632434.
DR   EnsemblGenomes-Tr; EBT00001632436.
DR   EnsemblGenomes-Tr; EBT00001632438.
DR   EnsemblGenomes-Tr; EBT00001632439.
DR   EnsemblGenomes-Tr; EBT00001632440.
DR   EnsemblGenomes-Tr; EBT00001632441.
DR   EnsemblGenomes-Tr; EBT00001632443.
DR   EnsemblGenomes-Tr; EBT00001632445.
DR   EnsemblGenomes-Tr; EBT00001632448.
DR   EnsemblGenomes-Tr; EBT00001632450.
DR   EnsemblGenomes-Tr; EBT00001632451.
DR   EnsemblGenomes-Tr; EBT00001632454.
DR   EnsemblGenomes-Tr; EBT00001632456.
DR   EnsemblGenomes-Tr; EBT00001632458.
DR   EnsemblGenomes-Tr; EBT00001632460.
DR   EnsemblGenomes-Tr; EBT00001632461.
DR   EnsemblGenomes-Tr; EBT00001632463.
DR   EnsemblGenomes-Tr; EBT00001632465.
DR   EnsemblGenomes-Tr; EBT00001632467.
DR   EnsemblGenomes-Tr; EBT00001632468.
DR   EnsemblGenomes-Tr; EBT00001632470.
DR   EnsemblGenomes-Tr; EBT00001632472.
DR   EnsemblGenomes-Tr; EBT00001632474.
DR   EnsemblGenomes-Tr; EBT00001632477.
DR   EnsemblGenomes-Tr; EBT00001632478.
DR   EnsemblGenomes-Tr; EBT00001632480.
DR   EnsemblGenomes-Tr; EBT00001632482.
DR   EnsemblGenomes-Tr; EBT00001632484.
DR   EnsemblGenomes-Tr; EBT00001632486.
DR   EnsemblGenomes-Tr; EBT00001632489.
DR   EnsemblGenomes-Tr; EBT00001632491.
DR   EnsemblGenomes-Tr; EBT00001632493.
DR   EnsemblGenomes-Tr; Psyr_0119.
DR   EnsemblGenomes-Tr; Psyr_0311.
DR   EnsemblGenomes-Tr; Psyr_0372.
DR   EnsemblGenomes-Tr; Psyr_0373.
DR   EnsemblGenomes-Tr; Psyr_0698.
DR   EnsemblGenomes-Tr; Psyr_0699.
DR   EnsemblGenomes-Tr; Psyr_0729.
DR   EnsemblGenomes-Tr; Psyr_0730.
DR   EnsemblGenomes-Tr; Psyr_0731.
DR   EnsemblGenomes-Tr; Psyr_0732.
DR   EnsemblGenomes-Tr; Psyr_0739.
DR   EnsemblGenomes-Tr; Psyr_0740.
DR   EnsemblGenomes-Tr; Psyr_0743.
DR   EnsemblGenomes-Tr; Psyr_0744.
DR   EnsemblGenomes-Tr; Psyr_0745.
DR   EnsemblGenomes-Tr; Psyr_0747.
DR   EnsemblGenomes-Tr; Psyr_0939.
DR   EnsemblGenomes-Tr; Psyr_0940.
DR   EnsemblGenomes-Tr; Psyr_1087.
DR   EnsemblGenomes-Tr; Psyr_1088.
DR   EnsemblGenomes-Tr; Psyr_1221.
DR   EnsemblGenomes-Tr; Psyr_1222.
DR   EnsemblGenomes-Tr; Psyr_1223.
DR   EnsemblGenomes-Tr; Psyr_1438.
DR   EnsemblGenomes-Tr; Psyr_1535.
DR   EnsemblGenomes-Tr; Psyr_1552.
DR   EnsemblGenomes-Tr; Psyr_1783.
DR   EnsemblGenomes-Tr; Psyr_1884.
DR   EnsemblGenomes-Tr; Psyr_1887.
DR   EnsemblGenomes-Tr; Psyr_1888.
DR   EnsemblGenomes-Tr; Psyr_1932.
DR   EnsemblGenomes-Tr; Psyr_2317.
DR   EnsemblGenomes-Tr; Psyr_2318.
DR   EnsemblGenomes-Tr; Psyr_2319.
DR   EnsemblGenomes-Tr; Psyr_2344.
DR   EnsemblGenomes-Tr; Psyr_2833.
DR   EnsemblGenomes-Tr; Psyr_2849.
DR   EnsemblGenomes-Tr; Psyr_2853.
DR   EnsemblGenomes-Tr; Psyr_2870.
DR   EnsemblGenomes-Tr; Psyr_2871.
DR   EnsemblGenomes-Tr; Psyr_3079.
DR   EnsemblGenomes-Tr; Psyr_3080.
DR   EnsemblGenomes-Tr; Psyr_3723.
DR   EnsemblGenomes-Tr; Psyr_3812.
DR   EnsemblGenomes-Tr; Psyr_4650.
DR   EnsemblGenomes-Tr; Psyr_4657.
DR   EnsemblGenomes-Tr; Psyr_4658.
DR   EnsemblGenomes-Tr; Psyr_RNA1-1.
DR   EnsemblGenomes-Tr; Psyr_RNA10-1.
DR   EnsemblGenomes-Tr; Psyr_RNA11-1.
DR   EnsemblGenomes-Tr; Psyr_RNA12-1.
DR   EnsemblGenomes-Tr; Psyr_RNA13-1.
DR   EnsemblGenomes-Tr; Psyr_RNA14-1.
DR   EnsemblGenomes-Tr; Psyr_RNA15-1.
DR   EnsemblGenomes-Tr; Psyr_RNA16-1.
DR   EnsemblGenomes-Tr; Psyr_RNA17-1.
DR   EnsemblGenomes-Tr; Psyr_RNA18-1.
DR   EnsemblGenomes-Tr; Psyr_RNA19-1.
DR   EnsemblGenomes-Tr; Psyr_RNA2-1.
DR   EnsemblGenomes-Tr; Psyr_RNA20-1.
DR   EnsemblGenomes-Tr; Psyr_RNA21-1.
DR   EnsemblGenomes-Tr; Psyr_RNA22-1.
DR   EnsemblGenomes-Tr; Psyr_RNA23-1.
DR   EnsemblGenomes-Tr; Psyr_RNA24-1.
DR   EnsemblGenomes-Tr; Psyr_RNA25-1.
DR   EnsemblGenomes-Tr; Psyr_RNA26-1.
DR   EnsemblGenomes-Tr; Psyr_RNA27-1.
DR   EnsemblGenomes-Tr; Psyr_RNA28-1.
DR   EnsemblGenomes-Tr; Psyr_RNA29-1.
DR   EnsemblGenomes-Tr; Psyr_RNA3-1.
DR   EnsemblGenomes-Tr; Psyr_RNA30-1.
DR   EnsemblGenomes-Tr; Psyr_RNA31-1.
DR   EnsemblGenomes-Tr; Psyr_RNA32-1.
DR   EnsemblGenomes-Tr; Psyr_RNA33-1.
DR   EnsemblGenomes-Tr; Psyr_RNA34-1.
DR   EnsemblGenomes-Tr; Psyr_RNA35-1.
DR   EnsemblGenomes-Tr; Psyr_RNA36-1.
DR   EnsemblGenomes-Tr; Psyr_RNA37-1.
DR   EnsemblGenomes-Tr; Psyr_RNA38-1.
DR   EnsemblGenomes-Tr; Psyr_RNA39-1.
DR   EnsemblGenomes-Tr; Psyr_RNA4-1.
DR   EnsemblGenomes-Tr; Psyr_RNA40-1.
DR   EnsemblGenomes-Tr; Psyr_RNA41-1.
DR   EnsemblGenomes-Tr; Psyr_RNA42-1.
DR   EnsemblGenomes-Tr; Psyr_RNA43-1.
DR   EnsemblGenomes-Tr; Psyr_RNA44-1.
DR   EnsemblGenomes-Tr; Psyr_RNA45-1.
DR   EnsemblGenomes-Tr; Psyr_RNA46-1.
DR   EnsemblGenomes-Tr; Psyr_RNA47-1.
DR   EnsemblGenomes-Tr; Psyr_RNA48-1.
DR   EnsemblGenomes-Tr; Psyr_RNA49-1.
DR   EnsemblGenomes-Tr; Psyr_RNA5-1.
DR   EnsemblGenomes-Tr; Psyr_RNA50-1.
DR   EnsemblGenomes-Tr; Psyr_RNA51-1.
DR   EnsemblGenomes-Tr; Psyr_RNA52-1.
DR   EnsemblGenomes-Tr; Psyr_RNA53-1.
DR   EnsemblGenomes-Tr; Psyr_RNA54-1.
DR   EnsemblGenomes-Tr; Psyr_RNA55-1.
DR   EnsemblGenomes-Tr; Psyr_RNA56-1.
DR   EnsemblGenomes-Tr; Psyr_RNA57-1.
DR   EnsemblGenomes-Tr; Psyr_RNA58-1.
DR   EnsemblGenomes-Tr; Psyr_RNA59-1.
DR   EnsemblGenomes-Tr; Psyr_RNA6-1.
DR   EnsemblGenomes-Tr; Psyr_RNA60-1.
DR   EnsemblGenomes-Tr; Psyr_RNA61-1.
DR   EnsemblGenomes-Tr; Psyr_RNA62-1.
DR   EnsemblGenomes-Tr; Psyr_RNA63-1.
DR   EnsemblGenomes-Tr; Psyr_RNA64-1.
DR   EnsemblGenomes-Tr; Psyr_RNA65-1.
DR   EnsemblGenomes-Tr; Psyr_RNA66-1.
DR   EnsemblGenomes-Tr; Psyr_RNA67-1.
DR   EnsemblGenomes-Tr; Psyr_RNA68-1.
DR   EnsemblGenomes-Tr; Psyr_RNA69-1.
DR   EnsemblGenomes-Tr; Psyr_RNA7-1.
DR   EnsemblGenomes-Tr; Psyr_RNA70-1.
DR   EnsemblGenomes-Tr; Psyr_RNA71-1.
DR   EnsemblGenomes-Tr; Psyr_RNA72-1.
DR   EnsemblGenomes-Tr; Psyr_RNA73-1.
DR   EnsemblGenomes-Tr; Psyr_RNA74-1.
DR   EnsemblGenomes-Tr; Psyr_RNA75-1.
DR   EnsemblGenomes-Tr; Psyr_RNA76-1.
DR   EnsemblGenomes-Tr; Psyr_RNA77-1.
DR   EnsemblGenomes-Tr; Psyr_RNA78-1.
DR   EnsemblGenomes-Tr; Psyr_RNA79-1.
DR   EnsemblGenomes-Tr; Psyr_RNA8-1.
DR   EnsemblGenomes-Tr; Psyr_RNA80-1.
DR   EnsemblGenomes-Tr; Psyr_RNA81-1.
DR   EnsemblGenomes-Tr; Psyr_RNA82-1.
DR   EnsemblGenomes-Tr; Psyr_RNA83-1.
DR   EnsemblGenomes-Tr; Psyr_RNA9-1.
DR   EuropePMC; PMC1182459; 16043691.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2897360; 20472799.
DR   EuropePMC; PMC2918963; 20562273.
DR   EuropePMC; PMC3189936; 22016774.
DR   EuropePMC; PMC3194850; 21856827.
DR   EuropePMC; PMC3298696; 22251433.
DR   EuropePMC; PMC3329529; 22529937.
DR   EuropePMC; PMC3807495; 23995634.
DR   EuropePMC; PMC3879358; 24391493.
DR   EuropePMC; PMC3911041; 24317082.
DR   EuropePMC; PMC3927611; 24710214.
DR   EuropePMC; PMC4448311; 25928324.
DR   EuropePMC; PMC4759546; 26891997.
DR   EuropePMC; PMC5512189; 28748209.
DR   EuropePMC; PMC6588701; 31227753.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01744; livK.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02144; rsmX.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000075.
DR   SILVA-SSU; CP000075.
XX
CC   On or before May 12, 2005 this sequence version replaced
CC   gi:28876540, gi:28876539, gi:28876538, gi:28876537, gi:28876536,
CC   gi:28876535, gi:28876534, gi:28876533, gi:28876532, gi:28876531,
CC   gi:28876530, gi:28876529, gi:28876528, gi:28876527, gi:28876526,
CC   gi:28876525, gi:28876524, gi:28876523, gi:28876522, gi:28876521,
CC   gi:28876520, gi:28876519, gi:28876518, gi:28876517, gi:28876516,
CC   gi:28876515.
CC   URL -- http://www.jgi.doe.gov
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Steven E. Lindow (icelab@socrates.berkeley.edu)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minumum q (quality) value of 30 and the total error
CC   rate is less than one per 50,000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6093698
FT                   /organism="Pseudomonas syringae pv. syringae B728a"
FT                   /strain="B728a"
FT                   /mol_type="genomic DNA"
FT                   /note="pathovar: syringae"
FT                   /db_xref="taxon:205918"
FT   gene            1..1536
FT                   /locus_tag="Psyr_0001"
FT   CDS_pept        1..1536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35075"
FT                   /db_xref="GOA:Q500U7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500U7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35075.1"
FT                   /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGEHGQGMAPALSLLIGSKRSSAPRAAPNAPLAAAASQALSA
FT                   NSVSSVSAPAPATAAPAAAVATPAPVQNVATHDEPSRDSFDPMAGASSQQAPARAEQRT
FT                   VQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGK
FT                   THLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDI
FT                   QFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEP
FT                   PELETRVAILMKKADQAKVDLPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDIT
FT                   IELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALS
FT                   KELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
FT   gene            1575..2678
FT                   /locus_tag="Psyr_0002"
FT   CDS_pept        1575..2678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35076"
FT                   /db_xref="GOA:Q500U6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35076.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLSNDALIDIKLDDSKLIVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTFTLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   AGILRAVATDGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGTVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRG
FT                   IRLQLASGQLKIQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDSNSSALVQESDNDDSAYVVMPMRL"
FT   gene            2701..3804
FT                   /locus_tag="Psyr_0003"
FT   CDS_pept        2701..3804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35077"
FT                   /db_xref="GOA:Q500U5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500U5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35077.1"
FT                   /translation="MSLSRVSVTGVRNLHPVTLSPSPRINILYGANGSGKTSVLEAIHL
FT                   LGIARSFRSSRLLPVIQYEQPSCTVFGQVDLAQGGHSNLGVSRDRQGEFQIRIDGQNAR
FT                   SAAQLAEILPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFMATWQRLQKALKQRN
FT                   SWLRHGTLDAASQAAWDRELCSASDEIDEFRRAYIKALKPVFEQTLSELVELEGLTLSY
FT                   YRGWDKEKELSTVLASSIHRDQQMGHTQAGPQRADLRLRLGAHNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQVRRGQCIYLVDDLPSELDDNHRRALCRLLEELRCQVFITCVDQEFLR
FT                   EGWQTETPVALFHVEQGRITQTHDHRE"
FT   gene            3809..6226
FT                   /locus_tag="Psyr_0004"
FT   CDS_pept        3809..6226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35078"
FT                   /db_xref="GOA:Q500U4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35078.1"
FT                   /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDISIIIHPDESITVRDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSELLLLTVRRSGKIWEQTYVHGVPQEPMKIVGESD
FT                   STGTQIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGIVLKDERSGKEELFKYEGG
FT                   LRAFVEYLNTNKTPVNEVFHFNIQRDDGIGVEIALQWNDSFNENLLCFTNNIPQRDGGT
FT                   HLVGFRSALTRNLNNYIEQEGLAKKHKVATTGDDAREGLTAIISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQEMGKYFSDFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QLPELIERGYIYIAQPPLYKVKKGKQEQYIKDDEAMEEYMTQSALEDASLHLSESAPGI
FT                   SGTALEKLVNDFRMVMKTLKRLSRLYPQELTEHFVYLPPITLEQLSDHEGMQAWLALFD
FT                   ARLRTGEKSGLVYKASLREDRERNVWLPEVELISHGLSNYVTFNRDFFGSNDYKTVTAL
FT                   GAQISTLLEEGAYVQRGERKKPVNEFKEALAWLMAESTKRHTIQRYKGLGEMNPDQLWE
FT                   TTMDPSVRRMLKVTIEDAIGADQIFNTLMGDAVEPRRDFIESNALAVSNLDF"
FT   regulatory      complement(6244..6273)
FT                   /note="4-><-5, 99% conf. Stem=13 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      6250..6267
FT                   /note="4-><-5, 100% conf. Stem=7 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(6282..7169)
FT                   /locus_tag="Psyr_0005"
FT   CDS_pept        complement(6282..7169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35079"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35079.1"
FT                   /translation="MQRLNLVARSVLASSTMLCWSTVTHALEITAGDYEPLPVGMNALL
FT                   VYAQHAESSDFYSNGQKVSDDFRLKTDVSLLRYIHSFALSNNAVIEPQFILPYGHLKAG
FT                   GEASALGQTTGAGDLILGAPVKWTLATANKDVFSVAPYLYLPTGSYENDDTLNLGENRW
FT                   RLLLQAAYIHHFNARWALDTAADVSWFSDNDDYGSGSDTLAQKTRYEYQAYLSYNVSPQ
FT                   TRFAVGGGHIDGGENRVGGVNQDDQLSTTYLRVSATHMLTPSIQVQAVLGRDVEVEEGF
FT                   REKSRLNLRLAKLF"
FT   sig_peptide     complement(7089..7169)
FT                   /locus_tag="Psyr_0005"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(7197..8231)
FT                   /locus_tag="Psyr_0006"
FT   CDS_pept        complement(7197..8231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0006"
FT                   /product="putative phenylacetaldoxime dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35080"
FT                   /db_xref="InterPro:IPR025702"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35080.1"
FT                   /translation="MHSAIPEHLRKPRELNSNLPEGYQPPFPAWSARFDPLAGQVVMAY
FT                   FGVQSLHPVGLPELAAITAWFDSDSGPRYWDSACCVDADGFHTCIAIAYWHDVDAFNRW
FT                   RNSSGFLRWWQDPARETGPLGWFLEVVCPSTERFETLFSAPDVPEGVTHLATHMSEPIQ
FT                   EHAYWGSSRDRIPFAQTDALAGSSNPSSADVLRAGRVRMSGRDNLCLIRSGQDWSSTTG
FT                   QERDLYLNDIQPVLQTGMTFLRDEGATVGCLSCRFMQALDNESGEPLEKSFGLAWFDDL
FT                   SNLERWAKTHPTHVAIFGGFMQYVQTLNFQVQLRLYHEIAVIPREAQYFEYLNCHPGSG
FT                   LLSR"
FT   gene            complement(8233..9243)
FT                   /locus_tag="Psyr_0007"
FT   CDS_pept        complement(8233..9243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0007"
FT                   /product="Aliphatic nitrilase"
FT                   /EC_number="3.5.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35081"
FT                   /db_xref="GOA:Q500U1"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500U1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35081.1"
FT                   /translation="MKEPLKVACVQAAPVFLDLDATVDKTITLMEQAAAAGAGLIAFPE
FT                   TWIPGYPWFLWLDAPAWNMPLVQRYHQQSLVLDSVQARRISDAARHLGLYVVLGYSERN
FT                   KASLYIGQWIIDDHGETVGVRRKLKATHVERTMFGEGDGASLRTFETPVGVLGALCCWE
FT                   HLQPLSKYAMYAQNEQIHVAAWPSFSLYRNATSALGPEVNTAASRVYAAEGQCFVLAPC
FT                   AIVSPEMIEMLCDSDAKRSLLQAGGGHARIFGPDGSDLATPLGEHEEGLLYATLDPAAL
FT                   TLAKVAADPAGHYSRPDVTRLMFNPNPTPCVVDLPDLPISSESIELLRPDIALEV"
FT   gene            9410..10384
FT                   /locus_tag="Psyr_0008"
FT   CDS_pept        9410..10384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0008"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35082"
FT                   /db_xref="GOA:Q500U0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35082.1"
FT                   /translation="MSIYFDTNSIVVRERAEFWQEVVCSTFVPLECAFPDRQNFQGRLR
FT                   SHSVAGLGLVEVQACEQTVVRDTSSISRSDDEFVLVSLALEGRAQVSQEGREAILEVGD
FT                   FAIYDTRRPYRLHFDSAFSQTVVQIPRNSLQQRLCNLEYLTALSMSRDNPLNGLVFDFF
FT                   TGLAALENRVGESQQARITEQGLDLLAMALSERVKGQAQGSRRSGLLLRIKDHIQANLA
FT                   DTKLSLASVSVRFGVSTRYVSSLFQDEQTSFGRYLLGSRLQRCASDLREPLLANRQISE
FT                   IAWRWGFSDVAYFSRVFRQRFGVPAREYRLETSPTPGHKKPTS"
FT   regulatory      complement(10373..10391)
FT                   /note="8-><-9, 100% conf. Stem=7 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(10525..11295)
FT                   /locus_tag="Psyr_0009"
FT   CDS_pept        complement(10525..11295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0009"
FT                   /product="Phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35083"
FT                   /db_xref="GOA:Q500T9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35083.1"
FT                   /translation="MSIMQAIRTFFFYLLLGTSSLLWCTLSFFIAPFLPFKARYRFINV
FT                   YWCRCAIWLTKVFLNIKVEVTGAENVPKTPCVIISNHQSTWETFFLSAYFEPMSQVLKR
FT                   ELLYVPFFGWAMAMLRPIAIDRENPKAALREIAKKGDELLKDGVWVLIFPEGTRVPYGQ
FT                   VGKFSRGGTALAVNADLPVLPVAHNAGKYWPRDGWAKKPGTIQVVIGEPMYAEGTGPRA
FT                   IAALNERVQAWNEDTQRAMGSPVEPAATPEKVPA"
FT   misc_feature    complement(11194..11259)
FT                   /locus_tag="Psyr_0009"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(11361..11903)
FT                   /locus_tag="Psyr_0010"
FT   CDS_pept        complement(11361..11903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0010"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35084"
FT                   /db_xref="GOA:Q500T8"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35084.1"
FT                   /translation="MKLLILDRDGVINHDSDTYIKSVAEWLPIPGSIEAIAALSKAGWT
FT                   VAVATNQSGIARGYYDLATLDAMHVRLRKLVAEQGGELGLIVYCPHGPDDGCTCRKPKP
FT                   GMLRAIARHYAADLKGLWFVGDSKGDLQAALAVDSQPVLVMTGKGRKTMEGGVPAGTLI
FT                   FDDLAAVAAELIHNSTH"
FT   gene            complement(11916..13970)
FT                   /locus_tag="Psyr_0011"
FT   CDS_pept        complement(11916..13970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0011"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35085"
FT                   /db_xref="GOA:Q500T7"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500T7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35085.1"
FT                   /translation="MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLAGAGLTYSAK
FT                   QVYAAPRRLAVLITALATQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLSE
FT                   IDQSGPKLRYSQTILGKPTTSLLPTIVEDSLNDLPIAKRMRWGARKEEFVRPTQWLVML
FT                   FGDQVVDCTILAQSAGRHSRGHRFHHPQDVRISSPAGYLSDLRAAHVLADFNERRQIIS
FT                   KRVDELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLEVPQEALITTMQDNQK
FT                   YFCLLDVDGKLLPRFITVANIESKDPAQIIAGNEKVVRPRLTDAEFFFKQDKKQKLETF
FT                   NDRLKNVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRAARAGLLSKCDLSSEMVGE
FT                   FPEMQGIAGYYYAKADGEPEDVALALNEQYMPRGAGAELPTTLTGAAVAIADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKFAVAQFGAKIKPAGLAE
FT                   QVLDFIFDRLRARYEDEGVDVAVYLSVRALQPASALDFDQRVQAVQAFRKLPQAAALAA
FT                   VNKRVSNLLSKAEGSIAQTVEPKYFDNANEFSLYSAIQQADHAIQPMAAERQYSESLAR
FT                   LAMLREPVDAFFEAVMVNAEDANVRANRYALLSRLRGLFLGVADISLLG"
FT   gene            complement(13967..14974)
FT                   /locus_tag="Psyr_0012"
FT   CDS_pept        complement(13967..14974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0012"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35086"
FT                   /db_xref="GOA:Q500T6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35086.1"
FT                   /translation="MRPNRVYSRSLNRSPAQVKFVSQPTPAVRTFQDLILALQQYWAEQ
FT                   GCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQ
FT                   FQVILKPNPDNFQELYLGSLKHIGLDPLVHDVRFVEDNWESPTLGAWGLGWEIWLNGME
FT                   VSQFTYFQQVGGLECYPVTGEITYGLERLAMYQQGVDSVYDLVWADGPFGKVTYGDVFH
FT                   QNEVEQSTYNFEHANVDKLFELFDFYESEAARLIELELPLPGYEMVLKASHTFNLLDAR
FT                   RAISVTARQQYILRVRTLARSVAQAYLQARARLGFPMAPPDLRDEVLAKLEAAQ"
FT   gene            14995..15546
FT                   /locus_tag="Psyr_0013"
FT   CDS_pept        14995..15546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0013"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35087"
FT                   /db_xref="GOA:Q500T5"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35087.1"
FT                   /translation="MTRCFWCNEDPLYIAYHDQEWGVPLRDAQKLFELLLLEGFQAGLS
FT                   WITILKRRARYREVLHGFDVERLAQLSDAEIEALMLDPSIIRNRLKLKAVRTNARAWLA
FT                   LEDPVALLWSFVGGTPKINHFKDRSEVPAMTAEAEAMSKALKKAGFTFVGPTICYAYMQ
FT                   ASGMVMDHTVDCDRYAILSR"
FT   gene            15585..16472
FT                   /locus_tag="Psyr_0014"
FT   CDS_pept        15585..16472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0014"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35088"
FT                   /db_xref="GOA:Q500T4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35088.1"
FT                   /translation="MDKFKGAVMVGALRLFALLPWRAVQWTGTAIGWLMWKLPNRSREV
FT                   ARINLSKCFPELSEPELEKLVGRSLMDIGKTLTESACAWIWPAQKSIDLVREVEGLDVL
FT                   KDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDDLLRKQRVQLGNR
FT                   VAASTKEGILSVIKEVRKGGSVGIPADPEPAESAGIFVPFCGTMALTSKFVPNMLAGGK
FT                   AVGVFLHAMRLPDGSGYKVVLEAAPEAMYSTDTETSAAAMSKVVEKYVRAYPSQYMWTM
FT                   KRFKKRPPGEARWY"
FT   gene            complement(16812..19175)
FT                   /locus_tag="Psyr_0015"
FT   CDS_pept        complement(16812..19175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0015"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35089"
FT                   /db_xref="GOA:Q500T3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35089.1"
FT                   /translation="MSESENSQAPLQGSQTDGTPAGGWAALSAVNKHLLHQHVLIKGNR
FT                   TLMSMNKPGGFDCPSCSWPDPKKPHTFEYCENGAKALAWESTKKRVTPEFFARHTVSEL
FT                   ATWSDHELEAEGRITEPMRYDAATDKYLPVTWDEAFAEIGEELRNLSDPWKLELYTSGR
FT                   TSNEAAFLYQLFGRMYGMANFPDCSNMCHETTTAALPESIGVGKGTTTLEDFESADAIF
FT                   IIGQNPGTNSPRMMSELHAAARRGASIISFNPLRERALVRFAAPQDPRDMLSLHGVEIS
FT                   SQYHQVRIGGDMIALQGVCKAVIEADDVAQREHLPRVLDVAFIEEHTHGFEQYADYCRQ
FT                   LPWDIIERHSGLTRQAIEEVAAVYKRSKGVICCWGMGITQHKRGGDAMQQIINLLLLRG
FT                   NIGKLGAGACPVRGHSNVQGDRTMGIYEKAGEPFLASMSKVFGFEASRKKGHAVAETCE
FT                   ALLRGEVEALISMGGNFFRAIPDTDVICPTVSRLKMTVLVNTKLNRSATVHGQKAFLLP
FT                   CVARSERDLQNGVAQTITVEDSMSMVHGSTGMLEPASKHLISEVAIIAGIAKATLAPNP
FT                   KVDWDSYVGDYSRIRDKIEEVLPEQFYDFNQRILEPGGFRLPNAASERKWDTESGKANF
FT                   LFPEGIYDEDDTPPGAEHLQLMTIRSHDQFNTTVYSNDDRYRDIFGDRMVVMLNPQDIE
FT                   RLGLKAGDYIEFQTALDPTTARRAAGFKVIPYDVPQGCCAAYYPETNGLLPLANRDKHG
FT                   NTPAAKSIPVNLVRMSSEGTQVALERRGLIAAAS"
FT   gene            complement(19329..20702)
FT                   /locus_tag="Psyr_0016"
FT   CDS_pept        complement(19329..20702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0016"
FT                   /product="TrkA-N:TrkA-C"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35090"
FT                   /db_xref="GOA:Q500T2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35090.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLAGEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKGSYPAVLRQAGADDADMLVAVTSSDEANMIACQVAHTLFHTPTKIARIREAAY
FT                   LTRAGLFDKNAIPVDVLISPEQVVTNYIKRLIEYPGALQVIDFAEGKAQLVAVKAYYGG
FT                   ALVGQPLRQLRAHMPNVETRIAAIYRRDRAILPHGDTVIEADDEVFFIAAKADIRAVMG
FT                   ELRRLDENYKRIVIAGGGNIGERLAEAIESRYQVKIIEVSPARCRYLSEHLDSTVVLQG
FT                   SSSDRDLLLEENIGNTDLFLALTNDDEANIMSSLLAKRLGARKVMTLINNPAYVDLVQG
FT                   GEIDVAVSPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEIVAHGDSKSSKVVSRAIK
FT                   DINLPTGTAIGAVIRDEQVLIAHDITVIESGDHVIMFLVDKKCIREVERLFQVGLSFF"
FT   gene            complement(20699..22045)
FT                   /locus_tag="Psyr_0017"
FT   CDS_pept        complement(20699..22045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0017"
FT                   /product="16S rRNA m(5)C-967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35091"
FT                   /db_xref="GOA:Q500T1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35091.1"
FT                   /translation="MNPRLAAAKALAAVLSGKASLNSSLPTQLDKVEVRDRGLTQDLAF
FT                   GTARWQPRLSALAAKLLQKPFKAADADVEALLLVGLYQLFYSRIPAHAAIGETVGCADK
FT                   LKKPWAKGLLNAVLRNAQRDGEALLIELEHDPVVRTAHPRWLQKALKAAWPEQWEAICA
FT                   ANNAHPPMILRVNRRHHRRDQYLELLDTAGLQASACTFSQDGIVLAEPCDVRSLPGFAE
FT                   GWISVQDEAAQLAADLLELAPGQRVLDACCAPGGKTCHLLEVQPQLDGVVAVDLEAKRL
FT                   VRVRENLDRLGLDAELIAADARETAQWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQ
FT                   ADDIAALAALQGELLDALWPTLQVGGMLVYATCSTLPTENTDVIEAFLARTSGARELDI
FT                   AGQAGQPPAGIKQAHGRQLLAQQGGHDGFYYAKLIKIADQDRGGAGVSA"
FT   gene            complement(22042..22986)
FT                   /locus_tag="Psyr_0018"
FT   CDS_pept        complement(22042..22986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0018"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35092"
FT                   /db_xref="GOA:Q500T0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500T0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35092.1"
FT                   /translation="MTEPLRIVFAGTPEFAAEHLKALLDSPHQIVAVYTQPDRPAGRGQ
FT                   KLMPSPVKQLALQHDVPVMQPPTLRDPAAQAELAALQPDLMVVVAYGLILPQVVLDIPR
FT                   LGCINSHASLLPRWRGAAPIQRAVQAGDAESGVTVMRMEAGLDTGPMLLKAVTPITAQD
FT                   TGGTLHDRLAELGPPAVLQAIAGLADGTLVGEVQDDSLANYAHKLNKDEARLDWTRPAD
FT                   ELERLVRAFNPWPICHSTLNEETLKVLAADLAEGQGAPGTILGASKDGLIVACGQNALR
FT                   LTRLQLPGGKPLNFTDLFNSRREKFAIGTVLGQ"
FT   regulatory      complement(23008..23021)
FT                   /note="18<--19, 100% conf. Stem=5 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(23040..23546)
FT                   /locus_tag="Psyr_0019"
FT   CDS_pept        complement(23040..23546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0019"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35093"
FT                   /db_xref="GOA:Q500S9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35093.1"
FT                   /translation="MAILNILEFPDSRLRTIAKPVAMVDDGIRQLVDDMFETMYEAPGI
FT                   GLAATQVNVHKRVVVMDLSEDRSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDR
FT                   PQKVRVKALDRDGKPYELVAEGLLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEKQ
FT                   HKLNA"
FT   gene            23672..24697
FT                   /locus_tag="Psyr_0020"
FT   CDS_pept        23672..24697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0020"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35094"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35094.1"
FT                   /translation="MRKSLLALLLLTASGLAQAQVQLREGYPQSYTVVAGDTLWDISGK
FT                   FLREPWKWREIWRANPQVHDPDLIYPGDTLALTWVNGQPRVTLNRGQSRGTIKLSPRVR
FT                   STPMVEAIPSIPLGAINAFLINNRIVDSAEQFEKAPYIVAGNAERVLSGNGDRAYARGA
FT                   LDPAHSVYGIFRQGKTYVDPKTQEVLGINADDVGSAEVVATEGDVSTLILQRSTQEVRL
FT                   GDRLFSSEERAINSTFLPSAPQAPIDGLILDVPRGVTQVSVLDVVTLDKGKRDGLTEGN
FT                   VLAIYKTSETVRDRITGEQVKIPDERAGLLMVFRTYDKLSYALVLQANRSLAIMDKVRN
FT                   P"
FT   sig_peptide     23672..23731
FT                   /locus_tag="Psyr_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            24821..25939
FT                   /locus_tag="Psyr_0021"
FT   CDS_pept        24821..25939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0021"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35095"
FT                   /db_xref="GOA:Q500S7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35095.1"
FT                   /translation="MPLFENAPSSPAELEARLRMHRLPEIGPKRFSRLIEAFGSASSAL
FT                   SAPASAWRALGIPGACAEARRDPSVRDGASAALAWLERPAQHLLMWDDPGYPALLAQIA
FT                   DPPPLIFIAGDPSILERPQLGMVGSRRASRPGLDTASAFARSLAAAGFVITSGLARGID
FT                   GAAHQGALDVGGLTIGVLGTGLEKLYPQQHRALAAQIAAQGGAVISEFPLDAAAQASNF
FT                   PRRNRIISGLSLGILVVEASVASGSLITARLAAEHGREVYAIPGSIHHPGAKGCHQLIR
FT                   DGATLVETVEHILEGLQHWKRVTPDIDPVTPAKPVPCDHPLLALLHAAPHTSEGLSVSC
FT                   GWPLPKVLAGLTELELDGRISCEAGRWFARAP"
FT   gene            25978..26535
FT                   /locus_tag="Psyr_0022"
FT   CDS_pept        25978..26535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0022"
FT                   /product="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35096"
FT                   /db_xref="GOA:Q500S6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500S6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35096.1"
FT                   /translation="MVSSWRVQQAAQDIRAGAVIAYPTEAVWGLGCDPWDEEAVYRLLA
FT                   IKSRPVEKGLILIADNIRQFDFLFEDFPELWLDRMASTWPGPNTWLVPHQNLLPEWITG
FT                   IHETVALRVTDHPTVRELCALVGPLISTSANPAGRPAARSRLRVEQYFRGQIDGVLGGS
FT                   LGGRRNPSVIRDIATAQIVRAG"
FT   gene            complement(26572..27549)
FT                   /locus_tag="Psyr_0023"
FT   CDS_pept        complement(26572..27549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0023"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35097"
FT                   /db_xref="GOA:Q500S5"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35097.1"
FT                   /translation="MAKRIQFNTVGGPEVLEYVDFEPQAPGPQAVVVRNKAIGLNFIDT
FT                   YYRSGLYPAPSLPSGLGAEGAGVVEAVGAEVTRFKVGDRVAYGTGPLGAYSEVHVLPEA
FT                   NLVKLADSISFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWVKA
FT                   LGGKLIGTVSSPEKAAHAKALGAWETIDYSHEDVASRVLELTDGKKCPVVYDGVGQDTW
FT                   LTSLDCVAPRGLVVSFGNASGPVSGVNLGILAQKGSVYVTRPTLGSYANTAQNLQAMAD
FT                   ELFDMLASGKLKVDGIQQYALKDAARAQTELSARRTTGSTILIP"
FT   gene            27721..28635
FT                   /locus_tag="Psyr_0024"
FT   CDS_pept        27721..28635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0024"
FT                   /product="coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35098"
FT                   /db_xref="GOA:Q500S4"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500S4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35098.1"
FT                   /translation="MSTRTEAVKAYLLDLQDRICTALEQEDGSAHFMEDAWTRPAGGGG
FT                   RTRVIENGTVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVP
FT                   TSHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGVEEDCVHWHRVAERACAPFGEDVYPR
FT                   YKAWCDSYFHLKHRDEPRGIGGLFFDDVNQWDFDTSFAFIRAIGDAFINAYLPIVRRRK
FT                   AAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKA
FT                   APGSEEARLTEYFLTDRDWLAEN"
FT   gene            28635..29459
FT                   /locus_tag="Psyr_0025"
FT   CDS_pept        28635..29459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0025"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35099"
FT                   /db_xref="GOA:Q500S3"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35099.1"
FT                   /translation="MDRYVVFGNPIGHSKSPLIHRLFAEQTGQTLDYQTSLAPLDDFTA
FT                   FAQAFFQAGRGANVTVPFKEQAWRLADSLTQRAQRAGAVNTLSKLDDGTLLGDNTDGAG
FT                   LVRDLTVNCGRSLRGQRILLLGAGGAVRGALEPLLGQQPAALVIANRTVEKAERLAQEF
FT                   ADLGPVFASSFDWLEESVDVIINATSASLAGELPPIAPSLIQPGVTFCYDMMYSNEPTA
FT                   FCRWATEHGAAQAVDGLGMLVEQAAEAFLLWRGVRPDSAPVLAELRRLLAAG"
FT   gene            complement(29644..31212)
FT                   /locus_tag="Psyr_0026"
FT   CDS_pept        complement(29644..31212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0026"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS:Sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35100"
FT                   /db_xref="GOA:Q500S2"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35100.1"
FT                   /translation="MRWLNRHKFLPFLAWLPQQNRASVGRDALVGLSGAILALPQSIAY
FT                   ALIAGLPPEYGLYAAIVPVLVACLWGSSWHLICGPTAAISIVLYASVSPLAVPASQDYI
FT                   MLILLLTFIAGVFQLLLGMMRFGALVNFVSHSVVLGFTLGAAVVIALGQMPNLLGIDLP
FT                   SQTTALKSLSAVLEHWREVDLSSLMLGLLTLALGIGLKLLVPRWPTLLIALVSSSLLVW
FT                   LWPAMFGHVRVVSAFVGHLPPFSPLPLDLELILKLLPTAVAVGMLGLVNSLSIARSLSA
FT                   RSQQMLNANQEVRAQGLSNMVGSLFSGYLSAGSFTRAALSYEAGARSPLAGVFSALWVA
FT                   LFAVAGASLISHIPIPAMAASILLICWGLVDRRGIRALFRVSRAEFFVMALTCLATLLL
FT                   ELQTAIYAGVLASLFFYLKRTSQPRVQQWREGDEEVLRVGGSIFFGASHYLQTRLQRTE
FT                   GVRVVIDAQQINFIDYSGVEMLHQEARRLGRQGRVLVLRNARPQVIEELHKLEGAEKCP
FT                   ILFED"
FT   misc_feature    complement(29989..30054)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(30118..30210)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(30256..30321)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(30385..30450)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(30511..30576)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(30598..30654)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(30760..30825)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(30847..30903)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(30919..30984)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(30991..31047)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(31060..31125)
FT                   /locus_tag="Psyr_0026"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(31284..31601)
FT                   /locus_tag="Psyr_0027"
FT   CDS_pept        complement(31284..31601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35101"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35101.1"
FT                   /translation="MKRSLIPLSLALILSASFASAGSWPPETSAKVPGNALEYPTKLEA
FT                   VNVSMEEMLNAGATVVSSYVADIGPVVTLKNKKHYVICMLRGAGTGSDTNVATSKCYAM
FT                   N"
FT   sig_peptide     complement(31536..31601)
FT                   /locus_tag="Psyr_0027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.884 at
FT                   residue 22"
FT   gene            complement(31768..32694)
FT                   /locus_tag="Psyr_0028"
FT   CDS_pept        complement(31768..32694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0028"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35102"
FT                   /db_xref="GOA:Q500S0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35102.1"
FT                   /translation="MKKLSTAVAVAVMTLGSLAAQAEDASCSTVKMADPGWSDIAATNA
FT                   ITSVVLEGLGYTPKVDTLAVPIAYGGLKDGKLDVFLGNWMPAQQGFYDKFVATGDVTQL
FT                   AKNLEGTEFTLAVPDYVWDAGVHDFADLSKFADKFDKKIYGIGSGAPANLSLQEIIKKN
FT                   EFDLGKWKLVESSETAMLAEVNRNVKKKAFVVFLGWTPHPMNVQIKGMHYLKGGEKYFG
FT                   DTGSVFTLTRKGYAQACPNVGKLLTNLSFTLDMENSIMAEVVNKKVSNSEAAKSWIKAN
FT                   PTVLDKWLEGVKTVDGKDGLAAVKAKL"
FT   sig_peptide     complement(32626..32694)
FT                   /locus_tag="Psyr_0028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(32731..34236)
FT                   /locus_tag="Psyr_0029"
FT   CDS_pept        complement(32731..34236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0029"
FT                   /product="Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35103"
FT                   /db_xref="GOA:Q500R9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35103.1"
FT                   /translation="MKRKNILFIMADQMAAPMLPFYARSPILMPNLSRLAADGVVFDSA
FT                   YCNSPLCAPSRFTLVSGQLPSRIGAYDNAADFPADIPTYAHYLRALGYKTALAGKMHFC
FT                   GPDQLHGYEERLTSDIYPADYGWSVNWDEPDVRPSWYHNMSSVLQAGPCIRTNQLDFDE
FT                   EVLFKSQQYLYDHVRQDGDAPFCLTVSMTHPHDPYTIPLPFWDLYADDEIPMPTPHANQ
FT                   AALDPHSQRLLKVYDLWDKPMPTDKIRDARRAYFGACSYIDLNVGKLMQTLDEVGLAED
FT                   TIVVFSGDHGDMLGEKGLWYKMHWFEMAARVPLVVYAPGQFKPGRVSASVSTADLLPTF
FT                   VEMAKGKLDAGLPMDGRSLMPHLKRKGGHDEVFGEYMAEGTTSPLMMIRRGAYKFIYSE
FT                   QDPCLLFDVKKDPKEQKDLSQSPTHEKLFNDFLAEARAKWDIPAIHQQVLASQRRRRFV
FT                   AKSLATGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARFPQP"
FT   gene            34350..35300
FT                   /locus_tag="Psyr_0030"
FT   CDS_pept        34350..35300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0030"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35104"
FT                   /db_xref="GOA:Q500R8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35104.1"
FT                   /translation="MFESFGDVSLDLLRAFEVAARLRSFTAAALELGTTQPAVSQQIKR
FT                   LEEQLATRLFDRIYRGIELTDAGEVLFSHVQAGLQSIDSGVIAITEHHQHEVLQVATDF
FT                   AFAAYWLMPRLHRFHKVNPDVDVSLVTSERTHSMLRADIDVAVLFGDGRFKQGESHWLF
FT                   SEEVFPVCSPQLLAGRQTPLPTDALRDFPLLHLRGESINNWFDWAGVFRALDIPQAPAP
FT                   GQLRFDNYTLLIQAAIGGQGIAIGWKHLVDDLLDQGLLCRPIAGAAISGQGYYVVLPQR
FT                   KRRVQIVQQFVDWLASEQALSGVSLTGRPLPSIAV"
FT   gene            35445..36269
FT                   /locus_tag="Psyr_0031"
FT   CDS_pept        35445..36269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0031"
FT                   /product="Alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35105"
FT                   /db_xref="GOA:Q500R7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35105.1"
FT                   /translation="MPDLLIDGKTLHYSDQGTGPVVLLGHSYLWDKAMWSAQIDTLASQ
FT                   YRVIVPDLWGHGDSSGFPEGTRNLDDLARHALALLDHLNIERCNIVGLSVGGMWGAIAA
FT                   LLAPERITGLVLMDTYLGKETEAKKAYYFSLLDKLEEVGTFPEPLLDIVVPIFFRPGID
FT                   PQLPVYRSFRAALAGMNAEQLRQSVVPLGRMIFGRDDRLGLIEQLNADTTLVMCGDADI
FT                   PRPPEETREMASLIGCPYVLVPEAGHIANLENPAFVSGALMTFLARVNQKQG"
FT   gene            complement(36536..37066)
FT                   /locus_tag="Psyr_0032"
FT   CDS_pept        complement(36536..37066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35106"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35106.1"
FT                   /translation="MKLPNRFITGLGILMISASPLLQAAPPDQRGDGPDDNRGAQQPGP
FT                   QNDGGHNQRGNDRGPGNDNGRGPDKGPASQPGRQAHQDNRGGNRPPQDFGPVRETFQQH
FT                   RDVIGRGQPLPPGVHIAKGRPLPPGYGKRLDSRSLQYLPQYDGYEWRRLGTDVVLIAVG
FT                   SGIVYAILDGVLN"
FT   sig_peptide     complement(36992..37066)
FT                   /locus_tag="Psyr_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   regulatory      complement(37101..37128)
FT                   /note="32<--33, 100% conf. Stem=12 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(37192..38001)
FT                   /locus_tag="Psyr_0033"
FT   CDS_pept        complement(37192..38001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0033"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35107"
FT                   /db_xref="GOA:Q500R5"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500R5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35107.1"
FT                   /translation="MSRLEHRFAQLKTEGRAALVTFITAGDPGYDTSLKVLKGLPAAGA
FT                   DVIELGMPFTDPMADGVAIQLATLRALDAGQTLQKTLQMVSEFRVDDQTTPIVLMGYYN
FT                   PIHRFGVEAFVAQAKEAGVDGLIIVDLPPEHDAELATPAQASGIDFIRLTTPTTDDARL
FT                   PRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAA
FT                   IARLADGVVVGSAFVDKIASAESPEHAIDGVLTLCAALAEGVRSARR"
FT   gene            complement(37998..39227)
FT                   /locus_tag="Psyr_0034"
FT   CDS_pept        complement(37998..39227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0034"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35108"
FT                   /db_xref="GOA:Q500R4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500R4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35108.1"
FT                   /translation="MTQTNFRSGPDANGLFGSFGGRYVAETLMPLVLDLNREYEAAKAD
FT                   PEFIKEMAYFQRDYVGRPNPLYFAERLTEFCGGAKIYFKREELNHTGAHKINNCIGQVL
FT                   LAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMRLLGAE
FT                   IVPVTSGTGTLKDAMNEALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKE
FT                   QMLEKEGRLPDSLVACVGGGSNAMGLFHPFLDDASVEIIGVEAGGHGVSTDKHAASLNG
FT                   GVPGVLHGNRTYLLQDGDGQITDAHSISAGLDYPGIGPEHAFLHEVKRVEYVSITDDEA
FT                   LDAFHQCCLLEGIIPALETAHALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMA
FT                   AAEHTQEQLV"
FT   gene            39307..40263
FT                   /locus_tag="Psyr_0035"
FT   CDS_pept        39307..40263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0035"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35109"
FT                   /db_xref="GOA:Q500R3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35109.1"
FT                   /translation="MKTDKIAATCQENSQIMSRDLPPLNALRAFESTARLGSVSQAAEQ
FT                   LNVTHGAVSRQLKVLEEHLGTSLFSKDGRGLKLTDAGIRLRDVSGDAFDRLRGVCAELS
FT                   RGSADAPFVLGCSGSLLARWFIPRLSRLNAELPDLRLHLSAGEGDLDPRRPGLDALLIF
FT                   AEPPWPADMQVFELASERIGPVLSPRFARFERLCDAPAEALLEESLLQTTSRPQAWPSW
FT                   AQQNGIDPQSLRYGQGFEHLYYLLEAAVAGLGIAIAPEPLVIDDLKAGRLAAPWGFSET
FT                   PAQLALWVPRRAADGRAQQLAQWLKNELKRSGEPIRN"
FT   gene            complement(40264..40590)
FT                   /locus_tag="Psyr_0036"
FT   CDS_pept        complement(40264..40590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0036"
FT                   /product="protein of unknown function DUF883"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35110"
FT                   /db_xref="GOA:Q500R2"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35110.1"
FT                   /translation="MATTSLRKASLQSMEAEIESLLKSLEGLKADATDESRKTLKNLKA
FT                   NAESALSHSRSLLSDVYEDVKEKTRENALATRDYAQEHPWTTAGVAVGAIGLIAAYMLF
FT                   KRGN"
FT   misc_feature    complement(40279..40335)
FT                   /locus_tag="Psyr_0036"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            40756..40971
FT                   /locus_tag="Psyr_0037"
FT   CDS_pept        40756..40971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0037"
FT                   /product="Protein of unknown function DUF1458"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35111"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35111.1"
FT                   /translation="MSDHHTYKKVEIVGSSTTTIEDAINNALAEASKSLDLMEWFEVTE
FT                   TRGHIENGKVAHFQVTLKVGFRITNS"
FT   gene            41122..41346
FT                   /locus_tag="Psyr_0038"
FT   CDS_pept        41122..41346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0038"
FT                   /product="Protein of unknown function DUF1161"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35112"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35112.1"
FT                   /translation="MKKFLLAVGLLSIAGTALAAGKPCEELKSELDARLQAKGVTSYTL
FT                   EVVEKGSAADKQVVGTCEGGTKEIVYQRG"
FT   sig_peptide     41122..41181
FT                   /locus_tag="Psyr_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   regulatory      41409..41449
FT                   /note="38-><-39, 100% conf. Stem=18 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(41484..42485)
FT                   /locus_tag="Psyr_0039"
FT   CDS_pept        complement(41484..42485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0039"
FT                   /product="luciferase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35113"
FT                   /db_xref="GOA:Q500Q9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35113.1"
FT                   /translation="MKRLADVKISTLDLVPVRHDKGPAESLRNSLNLAQHVEKLGYNRF
FT                   WVAEHHNMDGIASSATAVLLAYLAGGTSTIRVGAGGIMLPNHAPLVIAEQFGTLASLYP
FT                   DRIDLGLGRAPGSDQMTARALRRERSGSADDFPDDVTELMEYLGPRTPDQKVIAVPGSN
FT                   TNVPIWLLGSSLFSAQLAGMRGLPYAFASHFAPRYMHEAIRVYRNHFQPSEVLDKPYVM
FT                   LGVPLSAADTDEHAEYLATSVYQRILALMRGHSLMQRPPVESMDGLWLPHEREAVASFL
FT                   GLAMVGGPEKIRAKLDVLLEQTDADELLFTCDMYEHQDRLRSYEILAQVAHG"
FT   gene            42698..43129
FT                   /locus_tag="Psyr_0040"
FT   CDS_pept        42698..43129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0040"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35114"
FT                   /db_xref="GOA:Q500Q8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35114.1"
FT                   /translation="MSIVKKASAHWEGDLKSGIGSISTETGVLREAPYGFKARFEGGKG
FT                   TNPEELIGAAHAGCFSMALSMILGGAGLTAESIDTQAEVSLDQVEGGFAISAVHLTLKA
FT                   KVPGATQEKFDELTKQAKEGCPVSKVLNAKITLDATLLS"
FT   gene            43248..43481
FT                   /locus_tag="Psyr_0041"
FT   CDS_pept        43248..43481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0041"
FT                   /product="Protein of unknown function DUF1161"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35115"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35115.1"
FT                   /translation="MKRFILAATCTLLATSALAAPKSCEELKAEIEAKIQANNVTSYTL
FT                   EIVSNEEATDPSMIVGSCDNGTKKIIYQLNGR"
FT   sig_peptide     43248..43307
FT                   /locus_tag="Psyr_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(43482..43970)
FT                   /locus_tag="Psyr_0042"
FT   CDS_pept        complement(43482..43970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0042"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35116"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35116.1"
FT                   /translation="MLCRTDVAGYAQFTQSGTAHMRFTTLPIALVLATLAGCAGPLPAV
FT                   NPDMAWVDMRTITGQLIMGDKLDGRNTYDGRYFQVTPGSHELQVRYDYEYRSGGMGMIG
FT                   DEYTEITCYVSVRYDHFAAGQRYVLEVRSLANSVDAWLYDAERKVVAEEEEEGGVHCI"
FT   misc_feature    complement(43836..43901)
FT                   /locus_tag="Psyr_0042"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            44004..45059
FT                   /locus_tag="Psyr_0043"
FT   CDS_pept        44004..45059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35117"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35117.1"
FT                   /translation="MATFALPRLRHLLALTAVTLLTGCSSVSYYSQLAQGQWQLLQARE
FT                   PVEKIIADPTRDAGLRRHLAQSQLARAFASEHLHLPDNKSYRLYADLGRPYVVWNVFAT
FT                   DEFSLEPVTHCFPIAGCVAYRGYYSPGGARGEAALQRQAGKDVYLSGVEAYSTLGWFND
FT                   PILSSMMGWGDERLATLIFHELAHQRFYVKDDTEFNESYASFVEQEGTRQWRAARGLPP
FT                   ESVSQSARRDQFTRLVLDTRERLKALYRQPLSAEVMRARKAEEFERMRRDYRALRDEQW
FT                   AGDKRFDAWINSPMNNAKLLPFGLYDQWVPAFETLFRQENGDWQAFYRAVEKLGGMPAE
FT                   ARKAALQALMP"
FT   sig_peptide     44004..44114
FT                   /locus_tag="Psyr_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.713 at
FT                   residue 37"
FT   gene            complement(45231..45776)
FT                   /locus_tag="Psyr_0044"
FT   CDS_pept        complement(45231..45776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0044"
FT                   /product="transferase hexapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35118"
FT                   /db_xref="GOA:Q500Q4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35118.1"
FT                   /translation="MAIRKFQEHTPALGERAFVDHSAVVIGDVEIGADSSVWPLTVVRG
FT                   DMHRIRIGARTSVQDGSVLHITHAGPFNPDGFPLLIGDEVTIGHKAMLHGCTIGNRILV
FT                   GMGTTIMDGAVVEDEVIIGAGSLVPPGKVLESGFLYVGRPVKQVRALTEKEIAFFPYSA
FT                   TNYVKLKDQHLAEGFDKG"
FT   gene            45889..47940
FT                   /locus_tag="Psyr_0045"
FT   CDS_pept        45889..47940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0045"
FT                   /product="oligopeptidase A, Metallo peptidase, MEROPS
FT                   family M03A"
FT                   /EC_number="3.4.24.70"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35119"
FT                   /db_xref="GOA:Q500Q3"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35119.1"
FT                   /translation="MSANNPLLQSYDLPPFSAIRAEHVKPAIEQILADNRAAIADILAK
FT                   QGSTPTWAGLVLTMDELNDRLGAAWSPVSHLNAVCNSAELREAYESCLPALSAYSTEMG
FT                   QNRALFQAYEALANGPEAASFDVGQKTILEQSLRDFRLSGIDLPPEQQKRYAEVQSKLS
FT                   ELGSQFSNQLLDATQAWTKLVADESALAGLTDSAKQQMAAAAKAKDLEGYLITLEFPNY
FT                   YAVMTYAEDRALREEVYAAYATRASDQGPNAGKNDNTPVMEQILDLRQELAQLLGYANY
FT                   AELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLEQLKAYAAEQGCPDLQSWDSGFYG
FT                   EKLREQRYSVSQEILRAYFPVDKVLDGLFTIVQRLYGIEIAEQKGFDTWHPDVRLFEIK
FT                   ENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAQGTLQSPVANLVCNFTPAVAGKPA
FT                   LLTHDEVTTLFHEFGHGLHHLLTRVEHAGVSGINGVAWDAVELPSQFMENWCWEPEGLA
FT                   LISGHYETGEPLPQDLLEKMLAAKNFQSGLMMVRQLEFSLFDFELHATHGDGRSVLEVL
FT                   EGIRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADAFSKFEEDGVLNA
FT                   ETGRAFREAILARGGSQAPMVLFVDFRGREPSIDALLRHSGLSEDAAA"
FT   gene            47937..48227
FT                   /locus_tag="Psyr_0046"
FT   CDS_pept        47937..48227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35120"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35120.1"
FT                   /translation="MTDTPVVITRKRFIAGAVCPACSEPDKLMMWNENDVPHRECVSCG
FT                   YSDTLNEQGISIPKELGTRVNKVVVKPADPKVQGVQFFPNPKLKKPVDLSD"
FT   gene            complement(48272..48574)
FT                   /locus_tag="Psyr_0047"
FT   CDS_pept        complement(48272..48574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35121"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35121.1"
FT                   /translation="MANYEIRLSMEDFEGDGIPEILVQHWNGDEMDGMAYVTASDKYKG
FT                   FDTVKSGADINEDGVTNTQDITAILALAQAYAVMNLSIKPKEEKTNDTGTEEPVN"
FT   gene            complement(48668..48898)
FT                   /locus_tag="Psyr_0048"
FT   CDS_pept        complement(48668..48898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35122"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35122.1"
FT                   /translation="MMAKYEIRLWAEDIEEHDHPEIAIEFYENDDLQEHAWVRLHPHGK
FT                   HKIRGELGRDEEVLTDLALAFRKKVAELVDW"
FT   gene            complement(49110..51008)
FT                   /locus_tag="Psyr_0049"
FT   CDS_pept        complement(49110..51008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0049"
FT                   /product="Cytochrome c, class I:Iron permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35123"
FT                   /db_xref="GOA:Q500P9"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35123.1"
FT                   /translation="MPVHSRFLAWLLLPLLALGSCVALADPVEGAAQALHLLDYLGADY
FT                   PATVADGKVVDTVKYQQQVDNLAALQGLVVALPQRAGRDALEQAVTQLKSAVAGRQDAA
FT                   QVTRQARQLSARLALAYEVSQAPAITPDPARGAPLYAQHCSVCHGDSGAGDGPAGIGLE
FT                   PPPSNLRDTARLDRLSLYDLYNATGLGIAGTDMPAFADQLDDRQRWDVATYIASFSAQP
FT                   VAQPAKTFNLADLARQTPAEIQAAEGPDATATFRAQRAQPPQVQRGPAQLLDYTSVTLD
FT                   KSLAAYKAGDREQAYDLSVAAYLEGFELVESSLDNVDANVRKDTEKSLMAYRQSLQDSM
FT                   PLPQVAQKLEAAKGKLKESADLLGSDGLSLSLSYISGLLILLREGLEAILVLAAILAFL
FT                   RNTGQQSAVRSVNIGWGLALLAGLATWALAAYVIDVSGAQRELLEGATALFASVMVLWL
FT                   GVWMHDRRHAAAWQDYVKSSLVGGGGRFGFAVLAFFSVYRELFEVILFYETLWLQAGPA
FT                   GHDAVLAGGATALVLLVGLAWIILRGSAKLPLSLFFGINAALLCALSVVFAGHGVKALQ
FT                   EAGIFGTRPVPFFEFDWLGIHADLYSLGAQAIALIAIAVLYGRSRLAEKRRLQTAD"
FT   misc_feature    complement(49155..49220)
FT                   /locus_tag="Psyr_0049"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(49302..49367)
FT                   /locus_tag="Psyr_0049"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(49389..49445)
FT                   /locus_tag="Psyr_0049"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(49521..49586)
FT                   /locus_tag="Psyr_0049"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(49626..49679)
FT                   /locus_tag="Psyr_0049"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(49710..49775)
FT                   /locus_tag="Psyr_0049"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(49812..49877)
FT                   /locus_tag="Psyr_0049"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(50922..50987)
FT                   /locus_tag="Psyr_0049"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(50931..51008)
FT                   /locus_tag="Psyr_0049"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(51165..51797)
FT                   /locus_tag="Psyr_0050"
FT   CDS_pept        complement(51165..51797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0050"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35124"
FT                   /db_xref="GOA:Q500P8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35124.1"
FT                   /translation="MALETWLGFFAACWIISLSPGAGAIASMSCGLQYGFWRGYWNALG
FT                   LQIALVAQIAIVAAGLGAVLAASDMAFTLIKWFGVAYLVYLGIKQWRALPADLADESAV
FT                   RPVGKPMTLVLRGFLVNISNPKALIFILAILPQFIDPAAPLLIQYAIIAATMVVVDLIV
FT                   MAGYTGLASKVLRLLKTPRQQRRMNRTFASLFVGAAGFLATLHRGTA"
FT   misc_feature    complement(51174..51224)
FT                   /locus_tag="Psyr_0050"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(51285..51350)
FT                   /locus_tag="Psyr_0050"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(51381..51446)
FT                   /locus_tag="Psyr_0050"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(51600..51665)
FT                   /locus_tag="Psyr_0050"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(51711..51776)
FT                   /locus_tag="Psyr_0050"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(51723..51797)
FT                   /locus_tag="Psyr_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.515 at
FT                   residue 25"
FT   gene            complement(51865..52458)
FT                   /locus_tag="Psyr_0051"
FT   CDS_pept        complement(51865..52458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35125"
FT                   /db_xref="GOA:Q500P7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35125.1"
FT                   /translation="MDMLGLPVSAYWLEPLLVGAQILLILLAGYVLQRIVGGFLTGLGE
FT                   RYPLPPELLVPVRGGLRWLIMGSAFVLVLGRLGVSATVLWTALSGFVAVAAVAFFAMWS
FT                   VLSNLLCAILIFTIGPFRIGDMVELVDTLDKPGVKGRVVAINLMFTTLIETPEAGGALV
FT                   QVPNSQFFQKSVRRWRGSDLFPQMVVAKQPDEQD"
FT   misc_feature    complement(52108..52173)
FT                   /locus_tag="Psyr_0051"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(52204..52269)
FT                   /locus_tag="Psyr_0051"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(52363..52428)
FT                   /locus_tag="Psyr_0051"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(52475..54385)
FT                   /locus_tag="Psyr_0052"
FT   CDS_pept        complement(52475..54385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0052"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35126"
FT                   /db_xref="GOA:Q500P6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35126.1"
FT                   /translation="MIRLQSLTLQRGPQRLLEDAELTLHAGHKAGLIGANGAGKSSLFA
FT                   LLRGELTPDAGDCLLPADWRIAHMRQEVDTLERLAVDYVLDGDERLREVQSSLAEAEAA
FT                   QDGAAQARLHSELDSADGYTADARARKLLAGLGFTNEQMERQVGSFSGGWRMRLNLAQA
FT                   LMCPSDLLLLDEPTNHLDLDAILWLEDWLKSYPGTLLLISHDRDFLDAVVDHIAHVEQR
FT                   RITLYRGGYSAFERARAERLAQQQQAYEKQQAQRAHMEKYIARFKAQATKARQAQSRIK
FT                   ALERMEELSAAHVDSPFNFVFRESDKISSPLLDLSDARLGYGDKTILEKVKLQLTPGAR
FT                   IGLLGPNGAGKSTLIKNLAGELEPQSGRLVRGENLTVGYFAQHQLDSLDAKATPLLHLQ
FT                   RLAPTEREQTLRDFLGGFDFRGARLDEPVLNFSGGEKARLALALIAWEKPNLLLLDEPT
FT                   NHLDLEMRLALTMALQEFGGAVLVVSHDRHLLKSTTDDFLLVADGRVQAFDGDLDDYTR
FT                   WLADYRLRNAPVSNTPVNADKTDKKAQRQQAAALRQQLAPHKREADKLERDLGLVNEKL
FT                   AKVEEALADSTNYEAANKDKLRDLLAEQAKLKVREAELEDAWMQALELLESMQAELEAL
FT                   S"
FT   gene            54432..54908
FT                   /locus_tag="Psyr_0053"
FT   CDS_pept        54432..54908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35127"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35127.1"
FT                   /translation="MPSALWSFTLDFYARPGVEQACLTLQANGANVCMVLCGVWLGTRD
FT                   VACDAQRVAQIKQLATPWHDDVVRPLRDLRNQWRHAALEDAQLSALRMKVKALELEAEQ
FT                   GLMMKLEALTGDWPAGEARNAEEWLLELAEVDAEKNRDALHVLRIAVGLAVDQT"
FT   gene            complement(54905..55921)
FT                   /locus_tag="Psyr_0054"
FT   CDS_pept        complement(54905..55921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0054"
FT                   /product="alginate regulatory protein AlgR3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35128"
FT                   /db_xref="GOA:Q500P4"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35128.1"
FT                   /translation="MSAKKKPVNTPLHLLQQLSGSLLEHLEDACSQALADAEKLLAKLE
FT                   KQRGKAQEKLHNSRIKLQDAATAGKSKAQAKAKGAVSELEELLDALKDRQTETRTYILH
FT                   LKRDAQESLKLAQGIGRVKEAVGKILTTRDAKPVAPKAVAKTPAAKAPAKTAAKAPVKT
FT                   AAAKPVAKAAAKPSAAAKPAAKTAVAKAPVKAAAKPAPRATAAAKPVAAKTTAAKPAAA
FT                   RTTAAKPAAAKPAATKAPVAKTTASNAAKPAAAKAAAAKAPVKAPVKAPAKAPAKAPVK
FT                   AAAKPVAKPAAKPAVKPAAAKPATPAPAAAKPTTPAPAAPAAAPATPANGATPTSAS"
FT   gene            56138..56815
FT                   /locus_tag="Psyr_0055"
FT   CDS_pept        56138..56815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0055"
FT                   /product="FKBP-type peptidyl-prolyl isomerase,
FT                   N-terminal:Peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35129"
FT                   /db_xref="GOA:Q500P3"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35129.1"
FT                   /translation="MSRYLLTSLFLLLPLAQAAEAPPASSDGHDLAYSLGASLGERLHQ
FT                   EVPDLDLKALVEGLQQAYQGKPLALKQERIDQILREHDAAIAQAETAGTDAPTEAALKA
FT                   ERTFMDSEKAKPGVKVLADGILMTELTPGTGPKPSADGRVEVRYVGRLPDGTIFDQSTQ
FT                   PQWFRLDSVISGWTSALQNMPTGAKWRLVIPSDQAYGAEGAGDLIDPFTPLVFEIELVA
FT                   VSQ"
FT   sig_peptide     56138..56194
FT                   /locus_tag="Psyr_0055"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 19"
FT   gene            complement(56893..57393)
FT                   /locus_tag="Psyr_0056"
FT   CDS_pept        complement(56893..57393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0056"
FT                   /product="Regulator of RNA polymerase sigma(70) subunit,
FT                   Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35130"
FT                   /db_xref="GOA:Q500P2"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35130.1"
FT                   /translation="MPLKGREKTMLESCQNAQERWGGVNKLIDRWLQSRLKLVEAYDAL
FT                   GDTPAALAADREGLQNFCGILVDYVSAGHFEVYEQLGDEARAFNDKRGLELADTIYPRL
FT                   DFITKFALTFNDRCDKGDCSDATAVAREFNQLGQLLHERFELEDCLIEVLHNSHKEEIA
FT                   AQV"
FT   gene            complement(57384..57536)
FT                   /locus_tag="Psyr_0057"
FT   CDS_pept        complement(57384..57536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35131"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35131.1"
FT                   /translation="MYELYLLRTLMALSSGHNLGRTRHWKYAVLTHLSGQVPANYQDRP
FT                   RTACP"
FT   gene            complement(57541..58068)
FT                   /locus_tag="Psyr_0058"
FT   CDS_pept        complement(57541..58068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0058"
FT                   /product="Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35132"
FT                   /db_xref="GOA:Q500P0"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500P0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35132.1"
FT                   /translation="MYLARTRFLFFLASLACASIIGVAFYLQQAVGLDPCTLCMVQRAA
FT                   FIACGVLALCAACHAPGPTGTRRYSLGLLLVALAGLAGAGTQVWLQTASADQLIPFITR
FT                   LEQILSLLSLDMCIDRLRSDALFCAEITWTLFGISLPEWSLLAFTGLALLPLYPLFSEL
FT                   SHWLATRDRGGY"
FT   misc_feature    complement(57568..57633)
FT                   /locus_tag="Psyr_0058"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(57796..57861)
FT                   /locus_tag="Psyr_0058"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(57883..57936)
FT                   /locus_tag="Psyr_0058"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(57979..58068)
FT                   /locus_tag="Psyr_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.679 at
FT                   residue 30"
FT   misc_feature    complement(57982..58047)
FT                   /locus_tag="Psyr_0058"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(58285..59529)
FT                   /locus_tag="Psyr_0059"
FT   CDS_pept        complement(58285..59529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0059"
FT                   /product="HemY, N-terminal:HemY, N-terminal:HemY,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35133"
FT                   /db_xref="GOA:Q500N9"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35133.1"
FT                   /translation="MKRFYVLLFIAIAAAALIGVAIAEHSGYVLIAYQNFRYESSLWAT
FT                   LALLVVALLVIALLRLLITLLTTSGRVVNPWSRRNRRRRVQIAIEQGQMDLAEGRWSSA
FT                   QRHLQRAAEADTHPLLYYIGAARAANEQGRYEDCDALLERALERQPQAELAIALNHAQL
FT                   QQDRGDTEGALTTLLAMKERHPHNPQVLRQLQRLYQQRGDWSDVVRLMPELRKDKVLPA
FT                   KELAELERRAWGENLSLAAYREGIEGAPTGLPSLESAWQGLGSAQRQEPQLVLAYADQL
FT                   RRLGAEAQAEEVLRSALKREYNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLLL
FT                   SLGRICLQGRLWGKARDYLESSLRLERNPETCAELARLLGQLGETDRSNQLFQEGLGLL
FT                   DERLLSRPLPVLTKA"
FT   misc_feature    complement(59338..59403)
FT                   /locus_tag="Psyr_0059"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(59449..59514)
FT                   /locus_tag="Psyr_0059"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(59458..59529)
FT                   /locus_tag="Psyr_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 24"
FT   gene            complement(59526..60701)
FT                   /locus_tag="Psyr_0060"
FT   CDS_pept        complement(59526..60701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0060"
FT                   /product="Protein of unknown function DUF513"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35134"
FT                   /db_xref="GOA:Q500N8"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35134.1"
FT                   /translation="MIDTCRLRYYAKMQRMGYVSETALPKDEESVLKTPASKPEPVRTE
FT                   RTGSRNSGLVFLALLLAIAGIAVAGWGVWQLRMLQAGHQQQRGQVEDIAEQTLVLAQND
FT                   QQLSARIAQFPPANQLEDSRRLVAQLQGDQQRLSQRLETVLGASRKDWRLAEAEHLLRL
FT                   ASLRLSALQDINSAQALVQGADEILREQDDPGSFAAREQLAKSLAALRSVEQPDRTGLF
FT                   LQLAALREQAVQLNKLAPEYADKGESLMGLTADKTETSRWSQWWDEISHYFRIDFNADK
FT                   DIRPVLAGQSLSQVRLALSLALEQAQWAALNGEPEVYSKAITEAQSVLKANFDQDDPQG
FT                   KALGQGLDAVASQPVSVKTPDLAPTLSAVQAYLERRHAAGQPAEAQQGTSR"
FT   misc_feature    complement(60480..60545)
FT                   /locus_tag="Psyr_0060"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(60701..61474)
FT                   /locus_tag="Psyr_0061"
FT   CDS_pept        complement(60701..61474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0061"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35135"
FT                   /db_xref="GOA:Q500N7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35135.1"
FT                   /translation="MSGWRLLLTRPAEESAALARVLAEAGIFSSSLPLLETEPLPLTPA
FT                   QRSIIFELLNYCAVIVVSKPAARLAIELIDEVWPQPPLQPWFSVGSATGQILVDYGLDA
FT                   SWPEQGDDSEALLELPRLKQAIAVPGSRVLIMRGDEGRELLAEQLRALGVGVDYLPLYR
FT                   RYLPQHAPGALAQRVAVERLNGLVVSSGQGFEHLLQLAGDSWPDLADLPLFVPSPRVAS
FT                   IARAAGARTVIDCRGASATALLAALREQPQPAVKA"
FT   gene            complement(61471..62412)
FT                   /locus_tag="Psyr_0062"
FT   CDS_pept        complement(61471..62412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0062"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35136"
FT                   /db_xref="GOA:Q500N6"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500N6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35136.1"
FT                   /translation="MSSREIRIATRKSALALWQAEYVKARLEQAHPGLLVTLVPMVSRG
FT                   DKLLDSPLSKIGGKGLFVKELETALLENNADIAVHSMKDVPMDFPQGLGLFCICEREDP
FT                   RDAFVSNTFASLDQLPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGE
FT                   YDAIILAAAGLIRLGFEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHE
FT                   DTAVRVIAERSLNKHLNGGCQVPIACYAVLEGDDVWLRGLVGDPSGSVLLHADARAPQT
FT                   SAQALGVQVAEALLEQGAADILKAVYGEANNE"
FT   gene            complement(62645..63391)
FT                   /locus_tag="Psyr_0063"
FT   CDS_pept        complement(62645..63391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0063"
FT                   /product="Two-component response regulator AlgR"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35137"
FT                   /db_xref="GOA:Q500N5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35137.1"
FT                   /translation="MNVLIVDDEPLARERLSRMVNEIEGYRVLEPSASNGEEALALIEA
FT                   HKPDVVLLDIRMPGLDGLQVAARLCEREAPPAVVFCTAHDEFALEAFQVSAVGYLVKPV
FT                   RSEHLVEALRKAERPNRVQLAALTRPAAESGSGPRSHISARTRKGIELIPLDQVIYFIA
FT                   DHKYVTLRHEGGEVLLDEPLKALEDEFGDRFVRIHRNALVARERIERLQRTPLGHFQLF
FT                   LRGLNGDALIVSRRHVAGVRKMMQQL"
FT   gene            complement(63388..64470)
FT                   /locus_tag="Psyr_0064"
FT   CDS_pept        complement(63388..64470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0064"
FT                   /product="Sensory transduction protein kinase AlgZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35138"
FT                   /db_xref="GOA:Q500N4"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35138.1"
FT                   /translation="MRIEPVKHDARPAPGKDFFLPELCLPQALLVLVVLAELLVLVLVL
FT                   VEPMRSGFDWVRLALMSLFVQWIVLLSAALLCGLRPWLARLTPGLAGMLSCLLVVGLTL
FT                   LCTAVTDVCQLTGRISVSGMVERYLRYSTIALIMSALMLRYFYLQSQWRKQQQGELRAR
FT                   IESLQARIRPHFLFNTLNSIASLVASNPVKAEQAVLDLSDLFRASLAKPGSLVTWGEEL
FT                   ALAKRYLSIEQYRLGERLQLDWRVSAIPDDLPIPQLTLQPLLENALIYGIAPRVEGGVV
FT                   TVEANYEGGEFILSVSNPYEEVANRQTSNGTQQALTNIGARIAALFGPHASLSVERRDG
FT                   RHYTCLRYPCARLTQEARAI"
FT   misc_feature    complement(64027..64083)
FT                   /locus_tag="Psyr_0064"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(64144..64209)
FT                   /locus_tag="Psyr_0064"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(64240..64305)
FT                   /locus_tag="Psyr_0064"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(64333..64398)
FT                   /locus_tag="Psyr_0064"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            64605..65999
FT                   /locus_tag="Psyr_0065"
FT   CDS_pept        64605..65999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0065"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35139"
FT                   /db_xref="GOA:Q500N3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500N3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35139.1"
FT                   /translation="MSTDKTNQSWGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIA
FT                   HATMLAKVGVLTDAERDTIVDGLNTIQAEIEAGQFDWRVDLEDVHMNIEARLTDRIGIT
FT                   GKKLHTGRSRNDQVATDIRLWLRDEIDLILSEITRLQQGLLGQAEREAETIMPGFTHLQ
FT                   TAQPVTFGHHMLAWFEMLSRDYERLVDCRKRLNRMPLGSAALAGTTYPIDRELTCTLLG
FT                   FEVVGGNSLDGVSDRDFAIEFCSAASIAMMHLSRFSEELVLWTSAQFQFIDLPDRFCTG
FT                   SSIMPQKKNPDVPELVRGKSGRVFGALMGLLTLMKGQPLAYNKDNQEDKEPLFDAADTL
FT                   RDSLRAFADMIPAIKPRHAMMREAALRGFSTATDLADYLVRRGLPFRDCHEIVGHAVKY
FT                   GVETGKDLAEMSLEELRQFSNQIEQDVFAVLTLEGSVNARNHIGGTAPEQVRAAVIRGQ
FT                   ELLAGR"
FT   gene            66405..67646
FT                   /locus_tag="Psyr_0066"
FT   CDS_pept        66405..67646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0066"
FT                   /product="bifunctional spore maturation protein, fused
FT                   SpmA/SpmB"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35140"
FT                   /db_xref="GOA:Q500N2"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35140.1"
FT                   /translation="MLNGLWLGFFVVATISALVQWLVGGNAGIFAAMVESIFAMAKLSV
FT                   EVMVLLFGTLTLWLGFLRIAEKAGIVDWLAKVLGPLFLRLMPEVPPGHPALGLITLNFA
FT                   ANALGLDNAATPIGLKAMRSLQELNPSKTAASNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAPDPTLVFLPILLATSVSTIVGLLSVAFMQRLRLWDPVVLAYLIPGALLLGTFMAFL
FT                   GTLSAAALAGLSSILGNLTLFGLIMMFLIIGTLRKVLVYEAFVEGAKEGFDVAKSLLPY
FT                   LVAMLCAVGVLRASGALDFGLEGIRHLVQWLGLDTRFVDALPTAMVKPFSGSAARALLI
FT                   ETMQTQGVDSFAALAAATIQGSTETTFYVLAVYFGAVGIQRARHAVGCALLAEFSGVVA
FT                   AIFVCYWFFGATAS"
FT   misc_feature    66408..66476
FT                   /locus_tag="Psyr_0066"
FT                   /note="1 of 9 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    66519..66587
FT                   /locus_tag="Psyr_0066"
FT                   /note="1 of 9 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    66822..66890
FT                   /locus_tag="Psyr_0066"
FT                   /note="1 of 9 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    66918..66986
FT                   /locus_tag="Psyr_0066"
FT                   /note="1 of 9 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    67011..67079
FT                   /locus_tag="Psyr_0066"
FT                   /note="1 of 9 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    67092..67160
FT                   /locus_tag="Psyr_0066"
FT                   /note="1 of 9 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    67236..67295
FT                   /locus_tag="Psyr_0066"
FT                   /note="1 of 9 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    67458..67526
FT                   /locus_tag="Psyr_0066"
FT                   /note="1 of 9 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    67563..67631
FT                   /locus_tag="Psyr_0066"
FT                   /note="1 of 9 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(67651..68844)
FT                   /locus_tag="Psyr_0067"
FT   CDS_pept        complement(67651..68844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0067"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35141"
FT                   /db_xref="GOA:Q500N1"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35141.1"
FT                   /translation="MLDVNRYVTPVLNLMQRYPGLIAAFGFVSGIASFILVDRQAGLAT
FT                   WIAVVMLISWLWLMVENTMVGLLNKALGREIPQGLLRYGTQMIHQESLFFVLPFFFITT
FT                   TWNSGQAVFTAVLGAAGLISIIDPLYYKWLAPRRWLFMTLHTLTLFAALLTALPIILHL
FT                   TTAESYKLALGVAMLLSAPSLMSNFPLNTWRSALAVISIILAIGAAGWLLRSWVPPATL
FT                   WLTEVAVSPDFDNKNRTPGDSISLISARQLRNGGLYAYTAINAPRGLDERIYHVWWHEG
FT                   EEMDRIALDIHGGRKEGYRAWTRKQNFPEDVTGRWQVRVLTEDGQMIGVLRFVVTDDDQ
FT                   PAVKRPTGRIIKLKPGGDSAEEATPESAPATEPKQEKQEAAPAEPAPAESAPQVPAQ"
FT   misc_feature    complement(68194..68259)
FT                   /locus_tag="Psyr_0067"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(68275..68331)
FT                   /locus_tag="Psyr_0067"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(68362..68427)
FT                   /locus_tag="Psyr_0067"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(68467..68532)
FT                   /locus_tag="Psyr_0067"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(68668..68718)
FT                   /locus_tag="Psyr_0067"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(68734..68799)
FT                   /locus_tag="Psyr_0067"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   regulatory      complement(68880..68904)
FT                   /note="64<--65, 100% conf. Stem=10 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(68941..70317)
FT                   /locus_tag="Psyr_0068"
FT   CDS_pept        complement(68941..70317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0068"
FT                   /product="Insulinase-like:Peptidase M16, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35142"
FT                   /db_xref="GOA:Q500N0"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35142.1"
FT                   /translation="MRCLLFACLLLGSLPSFALDRLQVEGYLLPNGLQVLLKPGDDKGH
FT                   VAIRLVVGIGFDDFPCQDKELPHLLEHLLFSGVDDSGEGGLEERMQALGGEWNAFTSNA
FT                   DTTFVIEAPARNQRKVLDLLLEIMTKTELSQARLDGVKRVVEREDGGHFSHLQRLLDRR
FT                   DSGRSASSQLAVELGLKCAERPEVDGIKLEHIEDVFANWYAPNNMTLIVVGDLDKLLPA
FT                   YLERTYGKLAPTDPIDHPPLAQGNGSAEPRRELERGGLGESAKLHLIYPEPQLDDQHDE
FT                   TWDLVKAYLDWTLYTELRLKHSLSYGPSAEREVFGDVGFLSLNADVERDDADEAERDIR
FT                   ALVERLQKEGMQPATFARLQQLAIDRQSWATQGNSALADYYWSALNDYENGRFEDPAKR
FT                   IKAVKLETANQALRQLLAQPGYMRIEKPLFSYDGLYWLIGGVLGFIALLALWRWRVRST
FT                   "
FT   misc_feature    complement(68965..69030)
FT                   /locus_tag="Psyr_0068"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(70261..70317)
FT                   /locus_tag="Psyr_0068"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(70375..72027)
FT                   /locus_tag="Psyr_0069"
FT   CDS_pept        complement(70375..72027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0069"
FT                   /product="Na+/Pi-cotransporter:Na/Pi cotransporter
FT                   II-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35143"
FT                   /db_xref="GOA:Q500M9"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35143.1"
FT                   /translation="MLTLLDLLSAVALLIWGTHIVRTGILRVYGTQLRRVLSQNMSKRP
FT                   LAFIAGILVTALVQSSNATAMLVTSFVGQGLMTLTPALVIMLGADVGTALMSRVLTFDL
FT                   SWLSPLLIFLGVVFFLSRKQTRAGQLGRVGIGLGLIVLALQLIVEAAAPITQAAGVKVL
FT                   FASLTGDLLLDALVGAMFALISYSSLAAVLLTATLAGTEVIGLPVAIGLVIGANIGSGL
FT                   LAFLSTSMQNVAGRQVALGSLLYKLFGLLLIFPVLDPLVAWIDTLGFSPQELVIGFHLL
FT                   YNTVRCLIMLPTVAPMARLCSYLLPQQNEVGGLAKPRHLDLTALSTPSLALANAVRETL
FT                   RMGDLIESMLASMLAVLRGTQTAVTQEVRRLNDDVEALYSAIKLYLAQMPREDLGEHDN
FT                   RRWAEIIELTINLELASGLIERMLRKIQQQKTAHRRSFSEVGLEELADLQIQLQSNLRL
FT                   GLSVFLSGDHESARQLLREKRQFRAEERRLAHAHVSRLRNKVVQSIETSSLHLELIADM
FT                   KRLNSLFCSSAYVVLETADTGALSSEVEADRSL"
FT   misc_feature    complement(71137..71202)
FT                   /locus_tag="Psyr_0069"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(71239..71304)
FT                   /locus_tag="Psyr_0069"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(71350..71415)
FT                   /locus_tag="Psyr_0069"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(71437..71502)
FT                   /locus_tag="Psyr_0069"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(71563..71628)
FT                   /locus_tag="Psyr_0069"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(71665..71730)
FT                   /locus_tag="Psyr_0069"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(71824..71889)
FT                   /locus_tag="Psyr_0069"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(71950..72015)
FT                   /locus_tag="Psyr_0069"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            72227..73060
FT                   /locus_tag="Psyr_0070"
FT   CDS_pept        72227..73060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35144"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35144.1"
FT                   /translation="MGMRFVALRATLHAQNRTQSVQNGIPTRSMGTMMSLSTYRSSRSS
FT                   VGLLFVTLRVITLRHATHSGPDAERPERHTHAEHGYDDVLESTYRSSRSSVGMLFVTLR
FT                   VITLRHATHSGPDAERPERHTHAEHGYDGVLESTYRSSRSSVGMLFVMLRVITLRHATH
FT                   SGPDAERPERHTHAEHGYDGVLESAYRSSHSSVGLLFVTLRVITLRHATHSGSDAERPE
FT                   RHTHAEHGYDGVLESRYRSPTQSVGAIIVRPSAAINGTGQPRDAVLSPGHSAPGR"
FT   gene            complement(72996..74972)
FT                   /locus_tag="Psyr_0071"
FT   CDS_pept        complement(72996..74972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0071"
FT                   /product="Histidine kinase, HAMP region:Bacterial
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35145"
FT                   /db_xref="GOA:Q500M7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35145.1"
FT                   /translation="MSKPRTRIASQLGIALAVILAVVISGSTLFALRSLDASNLVIREE
FT                   HMSSEARLLADQLNTFHSTLRDSTQRLSGLFEKRFAAGLSLQADKPVTVAGTSTPGLFL
FT                   RDAALNNDFTEVDEFRSMTAGVATIFVRSGDDFIRISTSLSKQDGTRAIGTVLDRKGAA
FT                   YERLIAGQSYVGKAVLFDRYYMTQYSPVRDSSGKIIAALFVGFDYTDAQKTQFDNLKSF
FT                   RIGSTGSLALLDDKGTWLVPPAGVKSLEGAAKSVAELASKPGKAQFWDDGDDNYYSVGQ
FT                   PFAGGPWTVIASMPRKEISEVTWHVGTQLAIGSLLAMLIAVISAIWLLRSKLRPLSELV
FT                   RQADALGAGDLSVRLNVTSNDEIGQLSGSFNKMSEALSSMVSHIRTAAQEVSTRANVLS
FT                   GLSGGAFEGMEQQSGEITSMAGAVEEFSATSMNIADNMGNTERLAQENAQQTRIGRTSM
FT                   EEASSSLQQIATSLSSTAKVIDTLGQRSQEIGSIVGVITSIADQTNLLALNAAIEAARA
FT                   GEQGRGFAVVADEVRSLASRTREATDEISGMIASIQQETGNAISTMQQGNTLMQEGLSL
FT                   NAKVASALAQIDEQSRSAGHQFAAITTATQEQSSTATMLSSNLQSIAMANSEQRQVMSN
FT                   LAITAQELNGLATELRHEVDRFR"
FT   sig_peptide     complement(74877..74972)
FT                   /locus_tag="Psyr_0071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.703 at
FT                   residue 32"
FT   misc_feature    complement(74880..74936)
FT                   /locus_tag="Psyr_0071"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(75159..76079)
FT                   /locus_tag="Psyr_0072"
FT   CDS_pept        complement(75159..76079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0072"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35146"
FT                   /db_xref="GOA:Q500M6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35146.1"
FT                   /translation="MPRSLPPLYALRAFEAAARHTSFTRAAEELSITQSAVSRHIRTLE
FT                   EHFACRLFQRNGRNLQLTESARALLPGVRDGFLALERACSTLQTEEGILRMKAPSTLTM
FT                   RWLLARLSRFRHLQVGNEVQLTSAWMEIDAVDFTQEPFDCAILLSQGHFPSDWEATLLF
FT                   PELLIPVGAPTLLQDPPWDVERLAKAELLHPTPDRRDWRTWLNRMGLADQVSLKGGQVF
FT                   DTLELGMIAAARGYGVSMGDLLMVAEDVAQARLSLPWRTAVFSGENYYLVWPRTRPGAE
FT                   RLRRLSDFLQAEVGAMKLPLVEVLY"
FT   gene            76238..77620
FT                   /locus_tag="Psyr_0073"
FT   CDS_pept        76238..77620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0073"
FT                   /product="Multi antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35147"
FT                   /db_xref="GOA:Q500M5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35147.1"
FT                   /translation="MQHSALKELWIILRLAGPLIASQMAHMLMVFTDTVMMGKIGPEAL
FT                   AGGGLGAATYSFVSFFCVGVMAAVGTLVSIRHGAGDTEGATRLTQAGLWLAWGMALVAA
FT                   LLLWNLEPILLQFGQAEANVHMAAQFLITLPFALPGLLSFMALRGFTSALGRAGPVMTI
FT                   SLAGAAANFVLNYALIHQWLGLPNLGLMGIGLVTAIVTNCMALALALHIRLHPAYAAYP
FT                   IRKGLSKLSRSHLGELWRLGLPIGGTYAVEVGLFTFAAFCMGAMGSTQMAAHQIALQTV
FT                   SMAFMVPVGMSYAVTMRIGQHYGAGNLLMVRMAGRLGIGFGGCVMLMFGLLFWLAPHLV
FT                   IGLFLDINDPAFAEIVVLATKLLAIAALFEFFDGTQTIAMGAIRGLKDARTTFLIGLGC
FT                   YWLIAAPAAWLLGFSTDAGASGVWWGLALGLFCSAVALTYAFEWKTARLLRQDAAGLPV
FT                   PG"
FT   misc_feature    76262..76330
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    76388..76456
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    76514..76582
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    76610..76678
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    76715..76774
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    76802..76870
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    76949..77017
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    77060..77128
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    77189..77257
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    77285..77353
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    77414..77473
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    77501..77560
FT                   /locus_tag="Psyr_0073"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(77633..79297)
FT                   /locus_tag="Psyr_0074"
FT   CDS_pept        complement(77633..79297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0074"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35148"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35148.1"
FT                   /translation="MPTPVEPLRLLLLAHEPFWQALLSGCLTAPGSNVILLHGANWDVF
FT                   SARYANERNTVLLTTPDLQPRTGACLLPTVVLLEAEPLVGPTGVSDWLVRDALTGDTLR
FT                   RCLRYVHERSRLEDSLRRLVGQDPLTGIANRQGFQALLSARLSEGGSVALGHLDLDNFR
FT                   RANDSLGHQAGDRLILQVVARLKNQLDAGDQIARLGGDEFALLIDTRTAPERALQMAER
FT                   ITDVLAEPYWVDGESLLLGCSLGIAHSQAQPEADPLMWHAHIAMRQAKSMQGCTYHLFD
FT                   ERINRNARSLADLEGELRRALRRDELELHYQPRLCLDSGRIVGLEALVRWRHQERGLLP
FT                   PSKFVPLAEQSGLIVPLGYWVIFRALRDMQALREQGFAPLHMAINLSFRQFQDSQLLPT
FT                   LTRLIAEHDVDARWLEFELTETAVMRRSDQVRQTMDALRQLGVRFSLDDFGTGYSSFMH
FT                   LNSLPIALLKIDMTFVGQMELREENRKLVNAMINLAHNLNLEVVAEGVETAGQLELLRS
FT                   YGCNQVQGYLISRPLPVEELVTYLRSEVAHADTSRSG"
FT   gene            79502..81511
FT                   /locus_tag="Psyr_0075"
FT   CDS_pept        79502..81511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0075"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35149"
FT                   /db_xref="GOA:Q500M3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35149.1"
FT                   /translation="MSRLNPRQQEAVNYVGGPLLVLAGAGSGKTSVITRKIAHLIQNCG
FT                   IRAQYIVAMTFTNKAAREMKERVGTLLRGGEGRGLTVSTFHNLGLNIIRKEHTRLGYKP
FT                   GFSIFDETDVKALMTDIMQKEYSGDDGVDEIKNMIGSWKNDLILPAEALENARNPKEQT
FT                   AAIVYTHYQRTLKAYNAVDFDDLILLPVKLFQEHADILEKWQNKVRYLLVDEYQDTNAS
FT                   QYLLVKLLIGTRHQFTVVGDDDQSIYAWRGARPENLMLLKDDYPSLKVVMLEQNYRSTS
FT                   RILRCANVLISNNPHAFEKQLWSEMGHGDEIRVIRCRNEDAEAERVAMEILTLHLRTDR
FT                   PYSDFAILYRGNYQAKLIELKLQHHQVPYRLSGGNSFFGRQEVKDLMAYFRLLVNPDDD
FT                   NAFLRVINVPRREIGSTTLEKLGNYATERKVSMYAATDEIGLGEHLDSRFTDRLQRFKR
FT                   WMDGVRQQCAQNDPIAALRSMVMDIDYENWLRQNSSSEKAADYRMSNVWFLIEALKNTL
FT                   EKDEEGGMTIEEAIGKLVLRDMLERQQEEEDGAEGVQMMTLHASKGLEFPYVFIMGMEE
FT                   EILPHRSSIEADTIEEERRLAYVGITRARQTLAFTFAAKRKQYGEIIDCAPSRFLDELP
FT                   PDDLAWEGNDDTPTEVKAVRGNTALADIRAMLKR"
FT   gene            81563..82132
FT                   /locus_tag="Psyr_0076"
FT   CDS_pept        81563..82132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0076"
FT                   /product="Xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35150"
FT                   /db_xref="GOA:Q500M2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500M2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35150.1"
FT                   /translation="MEALHKKIREEGIVLSDQVLKVDAFLNHQIDPALMKEIGDEFARL
FT                   FADAGVTKIVTIEASGIAPAVMAGLNMGVPVIFARKHQSLTLTENLLTASVYSFTKQVE
FT                   STVAISPRHLSSDDNVLIIDDFLANGKASQALISIIKQAGATVAGLGIVIEKSFQGGRA
FT                   ELDAQGYRVESLARVESLAGGVVTFK"
FT   gene            complement(82724..84043)
FT                   /locus_tag="Psyr_0077"
FT   CDS_pept        complement(82724..84043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0077"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35151"
FT                   /db_xref="GOA:Q500M1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35151.1"
FT                   /translation="MNLIATDFPGSRMQSLVSYLEHDLRPTIVLDTDYNIIAANTAYQR
FT                   QFGVEGTPHVGEKCYRVSHQFAVPCDQAGEHCPMRKAHETRLPERLLHIHHTPRGPEHV
FT                   DVELRPILDDQGEVIAYVERLSSVAVASVQPQQHGLVGRSAAFKEVLSALQRAAPAQIP
FT                   VLLQGESGTGKELFARALHASSARSAGPLVVVDCTGLTETLLESELFGYEKGAFTGALQ
FT                   RKTGLAEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHSDFRLVVATH
FT                   KPLREMVADGSFRQDLFYRISAFPIRLPALRERSDDLPLLIDSLLQRIAPGAAPRVDAE
FT                   AMKLLSLYSYPGNIRELRNILERARLFTDDGVIRVQDLPAEVRGQGEAVGVTYRQQDDG
FT                   LEKLAHALRVFNGSRSELARELGLSERTLYRRLRALGIPR"
FT   gene            84310..85194
FT                   /locus_tag="Psyr_0078"
FT   CDS_pept        84310..85194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0078"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35152"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35152.1"
FT                   /translation="MIIGEKLHVEALFDTHTWTISYLVMDLHSKQCALIDSVLDYDPKS
FT                   GRTRTESADRMIERAQALGASVQWIFETHVHADHLSAAPYLKQRLGGQIVIGSHITAVQ
FT                   ETFGTLFNAPPDFARNGSQFDVLLEDNASFALGALEVKAMHTPGHTPACMSYLVQVGDA
FT                   TVAFVGDTLFMPDYGTARCDFPGADARTLYRSIKKLLALPPETLLFMCHDYLPNGRELK
FT                   YMTTVAEQRASNIHVHDGVDEDAFVGMREARDATLDMPVLMLPAVQVNMRCGHFPEPED
FT                   NGVVYLKIPLNAL"
FT   gene            85222..86475
FT                   /locus_tag="Psyr_0079"
FT   CDS_pept        85222..86475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35153"
FT                   /db_xref="GOA:Q500L9"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35153.1"
FT                   /translation="MNASTTTCQILIVGAGAAGIATAASLLARDATLQITLVDPADTHY
FT                   YQPGWTMVGAGIFTPQSTARSMASLIPEGVQWIKAAVATFEPQHNTLTLADGRVLGYQQ
FT                   LVVCPGLKLDWSAIDGLVDTLGANGVTSNYRYDLAPYTWKLVQNLQQGRALFTQPPMPI
FT                   KCAGAPQKAMYLSCDHWLKSGRLAQINTQFYNAGGVLFGVADYVPALMKYVERYAIDLK
FT                   FSHRLVAVDGPGKRATFIRTQADGSSETVEQSFEMLHVVPPQIAPDFIRSSPLADAAGW
FT                   VDVDPATLKHRQFANVHGLGDATNTSNAKTAAAARKQAPVVANNVLVALGRRSESAVYD
FT                   GYGSCPLTVEKGRIVLAEFTYGGKVAPSFPRWLLDGRQPTRLAWWLKARVLPALYWHGM
FT                   LKGREWLAKPQKADTRHG"
FT   sig_peptide     85222..85308
FT                   /locus_tag="Psyr_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.740 at
FT                   residue 29"
FT   misc_feature    85240..85308
FT                   /locus_tag="Psyr_0079"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            86468..87280
FT                   /locus_tag="Psyr_0080"
FT   CDS_pept        86468..87280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0080"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35154"
FT                   /db_xref="GOA:Q500L8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35154.1"
FT                   /translation="MDEHQLLGVGLGTVIGMVLALTGAGGGILAVPLLVFGLGLSIVEA
FT                   APVGLLAVGLAAGIGAVLGLRQGIVRYRAAGYIASIGVLMAPLGLWLAHRLPNTPLALV
FT                   FSAVLLYACGRMFIRASRELRHEKPAPRAEILPCVLNPLQGRLRWTMPCLRALTLTGVG
FT                   SGLLSGLLGVGGGFVIIPALTRYSDLDMKSVVATSLAVIALVSMGSVITASLSGVMHWA
FT                   VGAPFALGAVIGLIIGRQVARYLAGPRLQQLFAVCGIVAAFMLALSVR"
FT   misc_feature    86483..86551
FT                   /locus_tag="Psyr_0080"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    86594..86662
FT                   /locus_tag="Psyr_0080"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    86681..86749
FT                   /locus_tag="Psyr_0080"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    86762..86821
FT                   /locus_tag="Psyr_0080"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    86948..87016
FT                   /locus_tag="Psyr_0080"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    87044..87112
FT                   /locus_tag="Psyr_0080"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    87125..87193
FT                   /locus_tag="Psyr_0080"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    87221..87274
FT                   /locus_tag="Psyr_0080"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(87481..88461)
FT                   /locus_tag="Psyr_0081"
FT   CDS_pept        complement(87481..88461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0081"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35155"
FT                   /db_xref="GOA:Q500L7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35155.1"
FT                   /translation="MSIEVRNVSKNFNAFKALNNISLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDDGSIVFHGEDVSGHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   RERPNETRIAEKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPSNDFVYHFLGDSNRLSLGAEGHLLFRPHEVSLSRQEIEDHHAAEVRDIRPLGA
FT                   TTRVTLKVEGQDELIEAEVVKDHDSLVGLAKGETLFFKPKVWQKL"
FT   gene            complement(88464..89336)
FT                   /locus_tag="Psyr_0082"
FT   CDS_pept        complement(88464..89336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0082"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35156"
FT                   /db_xref="GOA:Q500L6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35156.1"
FT                   /translation="MSYSSVSAAASANAARRGSAVSRRILIGLCWLVFVLFLGLPLFIV
FT                   VSQGLKNGLGAFFIAILEPDALSALKLTVIAVLISVPLNLVFGVSAAWCVSKYSFRGKS
FT                   ILVTLIDLPFSVSPVIAGLVYVLMFGAQGLFGPWLQDHDIQIVFALPGIVLATIFVTVP
FT                   FVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTVPNIKWGLIYGVVLCTARAMGEF
FT                   GAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFAVASLLLILALFILLLKQWSESRIN
FT                   RLRHNAAEE"
FT   misc_feature    complement(88521..88586)
FT                   /locus_tag="Psyr_0082"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(88656..88721)
FT                   /locus_tag="Psyr_0082"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(88839..88904)
FT                   /locus_tag="Psyr_0082"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(88950..89015)
FT                   /locus_tag="Psyr_0082"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(89055..89120)
FT                   /locus_tag="Psyr_0082"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(89196..89261)
FT                   /locus_tag="Psyr_0082"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(89350..90171)
FT                   /locus_tag="Psyr_0083"
FT   CDS_pept        complement(89350..90171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0083"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35157"
FT                   /db_xref="GOA:Q500L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35157.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLIVLIPLAAMFVHAAQLTWDQ
FT                   FWTIITAPRVIAALKLSFGTAFYAALINGVIGTLLAWVLVRYTFPGRKVIDAMIDLPFA
FT                   LPTAVAGIALTALYAPNGWVGQFAADLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPREVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVMMLVVSFILLLLINLLQRRIETPS"
FT   misc_feature    complement(89377..89442)
FT                   /locus_tag="Psyr_0083"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(89557..89622)
FT                   /locus_tag="Psyr_0083"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(89701..89766)
FT                   /locus_tag="Psyr_0083"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(89812..89877)
FT                   /locus_tag="Psyr_0083"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(89917..89982)
FT                   /locus_tag="Psyr_0083"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(90055..90171)
FT                   /locus_tag="Psyr_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.991 at
FT                   residue 39"
FT   misc_feature    complement(90070..90135)
FT                   /locus_tag="Psyr_0083"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(90266..91276)
FT                   /locus_tag="Psyr_0084"
FT   CDS_pept        complement(90266..91276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0084"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35158"
FT                   /db_xref="GOA:Q500L4"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35158.1"
FT                   /translation="MSIRRFALAALASAVFAGSAVAKDYELLNVSYDPTRELYQDYNAE
FT                   FVNFWKKSHPDDKVEIKQSHGGSGKQARGVIDGLRADVVTLALAGDIDEIARLGKTLPE
FT                   NWQTRLPDASTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVSVITPNPKTSGGARWNFLA
FT                   AWAYGLKAGGGDEAKAKEYVQTLFKHVPILDTGARGSTITFVNNGQGDVLLAWENEAFL
FT                   ALKEDGGKDKFDIVVPSLSILAEPPVAVVDKNAERKGNSEIATEYLKHLYSKEGQEIAA
FT                   KNFYRPRDAEVAAKYEKQFPKLDLVTIDKDFGGWKTAQPKFFNDGGVFDQIYQAQ"
FT   sig_peptide     complement(91208..91276)
FT                   /locus_tag="Psyr_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(91428..91607)
FT                   /locus_tag="Psyr_0085"
FT   CDS_pept        complement(91428..91607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35159"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35159.1"
FT                   /translation="MSASLRSVDGQDEAAILREIQSALRDLRFGAVEITVHNAQVVQIE
FT                   RKEKFRLQNPAKQN"
FT   gene            complement(91808..93727)
FT                   /locus_tag="Psyr_0086"
FT   CDS_pept        complement(91808..93727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0086"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35160"
FT                   /db_xref="GOA:Q500L2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35160.1"
FT                   /translation="MSDYSRNALRTAVLYGLLSILWFATGSALLSFFVKDPARLAVGQQ
FT                   MIGYGWALLSTVMIFIARDRLKAIVGGEALFERQQQDYDRLLLAAVVFDSTREGVLVSD
FT                   AEGRIVHVNRAFVDITGYQADEVLGFNPSKFKSGRHGPEFYRQMYHSLQSAGQWSGEIW
FT                   NRRKSGEIYPQWQTIRSIKGEDGQPRHFVAVFSDITAIKRSEQELAQLAHYDALTELPN
FT                   RLLLTDRISQALTSARSSRRGCALLVVDLDNFRNINDSLGHNIGDEVLKAAAERLNALA
FT                   DSGMTVSRLGGDEFALLVKNCTHMVHAAALAQQVINAFKAPYPIAGHQLFVTASIGISL
FT                   FPGDALTAEQLLRNADSALFKAKTDGREGFALYTEELTAQAQQRVQLASELRQAIEQDE
FT                   LRVFYQPVYDLVTGRICAVEALVRWQHPTRGMVSPGDFIPIAEQNGLIADIDAWVLNTA
FT                   CRQMQAWLAEGVSIASVAVNVSSRLFSRGDVDRQVAEVLNETGLDPAFLELEVTESAVM
FT                   EDPEQAIEQLHRLRELGLSLAIDDFGTGYSSLLRLKSMPVQKLKIDQGFVAGLPGDVDD
FT                   IAIVRAVIALASSLGMRVLAEGIEHANQASFLLSNGCELGQGYWFARPMAAQSIDWTHA
FT                   PAFN"
FT   misc_feature    complement(93542..93607)
FT                   /locus_tag="Psyr_0086"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(93629..93694)
FT                   /locus_tag="Psyr_0086"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            93880..95064
FT                   /locus_tag="Psyr_0087"
FT   CDS_pept        93880..95064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0087"
FT                   /product="Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35161"
FT                   /db_xref="GOA:Q500L1"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35161.1"
FT                   /translation="MLYNGLLDLSVWQLIAVTLVMTHITIIGVTVYLHRYSAHRSLELN
FT                   AGLKHFFRFWLWLTTAQNTREWTAIHRKHHAKCETVDDPHSPVVKGLSTVLRKGAELYR
FT                   EEAQNQDTLRIYGKNCPEDWIERNLYSRYKLLGIALMAVIDVALFGVLGITVWAVQMMW
FT                   IPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGIVIGGEELHNNHHTYPNSAKLSVKP
FT                   WEFDMGWAWIKVFSFLRLAKVQRVAPIAHRVEGKGHMDMDTAMAILNNRFQIMAQYRKL
FT                   VIAPLVAQELAKADESVRHQFRRAKRLLSRETSLLDDKHHLRIQTMLEHSHALKVIYEK
FT                   RLALQQIWVKTSSNGHDMLSAMKEWIHEAEASGIQSLREFADQLKTYSLRPAHA"
FT   misc_feature    93907..93975
FT                   /locus_tag="Psyr_0087"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    94282..94350
FT                   /locus_tag="Psyr_0087"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            95185..96192
FT                   /locus_tag="Psyr_0088"
FT   CDS_pept        95185..96192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0088"
FT                   /product="PAS:GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35162"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35162.1"
FT                   /translation="MVLMEKQPPTSLPGTPITDMPAAAETLLALMHAQAEVARLSEREQ
FT                   LFSSLLVSVNAVLWAFDWETQHMIYVSPAYERIFGRSAGLLLADYSEWRDSIYPDDLNY
FT                   AERSLNEVIEKGSIEDREYRIIRADGEVRWLSDKCFVSHRADASQRLIVVGIAEDITEK
FT                   KQLENELQRLATTDVLTQSSNRRHFFECAQREFELARLNGTPLAFLLLDIDDFKLVNDT
FT                   YGHQEGDTVLQRIAESGRSALRRGDLFGRIGGEEFAAVFPGCAPDMAMQIAERLQREIQ
FT                   RQNFQSAGTTFSITASQGLTNLGPDDPSLETLYGRADAAMYQAKRQGKNQIVLV"
FT   gene            complement(96943..98331)
FT                   /locus_tag="Psyr_0089"
FT   CDS_pept        complement(96943..98331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0089"
FT                   /product="Response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35163"
FT                   /db_xref="GOA:Q500K9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35163.1"
FT                   /translation="MMTAVVLPAVPRVLIAESDPWVRETLSDLVLGVRADIELEMCTDG
FT                   KQAVEWMKKHLPDLIIAARELPGIDGLSLLRGVRNLRRQPAIPFILISNRNDSASVREV
FT                   VPLAPTAYLTKPLNTEGLRQRLEGLLLERSAPVAGAVPALTPGLTLTKFLDKRRDIADG
FT                   APLFVDVATAVTLSQTASGIDAALLEQELRNDPHITAVLIAAANTAAQHLGKPIQTMGG
FT                   ALAILGPVQVANIASGLGKKRMAVLTNDALLAKAHELWTLSQRTADYARILGGMLELDA
FT                   ERCFSAGLLQSLGDLAVLGCLQEWLLAGGQLDEQVIGQSLEQYSAAFGSALRTRWRLPL
FT                   ELRELIAAVYQYNTGIYTREVLAMNLAGQMARLGEEESVTTLIKTKSAKLLKLSVGDLQ
FT                   RLRKKLTGVTDPSLLRPLSSETEVAAEAVDDEPDLLDLAPEAPAEAPAAIEDPADAVQG
FT                   PPEK"
FT   gene            complement(98488..99768)
FT                   /locus_tag="Psyr_0090"
FT   CDS_pept        complement(98488..99768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0090"
FT                   /product="4-aminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35164"
FT                   /db_xref="GOA:Q500K8"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35164.1"
FT                   /translation="MSKTNESLMQRRHAAVPRGVGQIHPIFAASAKNATVTDVEGREFI
FT                   DFAGGIAVLNTGHLHPKIIAAVQEQLTKLSHTCFQVLAYEPYVELCEKINAKVPGDFDK
FT                   KTLLVTTGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALYPCELHGVSVDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKAF
FT                   MLRLRELCDKHGILLIADEVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVC
FT                   GKAEYMDAIAPGGLGGTYAGSPVACAAALAVLDIFEEEHLLERCKAVGEQLVTSLKAMQ
FT                   AKYPVIGEVRALGAMIAVELFEDGDSHKPNAAAVAQVVAKARDKGLILLSCGTYGNVLR
FT                   VLVPLTAEDELLKRGLAILDECFAEIA"
FT   regulatory      complement(99896..99928)
FT                   /note="86<--87, 99% conf. Stem=14 Gap=-12"
FT                   /regulatory_class="terminator"
FT   gene            complement(99948..101390)
FT                   /locus_tag="Psyr_0091"
FT   CDS_pept        complement(99948..101390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0091"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35165"
FT                   /db_xref="GOA:Q500K7"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35165.1"
FT                   /translation="MQLKDSTLFRQQAYINGQWLDADGGQSIKVNNPANNEILGTVPKM
FT                   GAAETRRAIEAADKALPAWRALTAKERGNKLRRWFELMIENQDDLGLLMTLEQGKPLAE
FT                   AKGEITYAASFIEWFAEEAKRVYGDVIPGHQPDKRLIVLKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVLKPASQTPFSALALAELAERAGIPAGVFSVVTGSAGDIGAELTG
FT                   NPIVRKLSFTGSTDIGRQLMAECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAMISK
FT                   YRNNGQTCVCANRIYVQDAVYDAFAEKLKAAVGKLKIGNGLEEGVTTGPLIDDKAVAKV
FT                   KEHIADAVSKGATVLTGGNSLEGSFFEPTILVNVSKDAAVAREETFGPLAPLFRFKDEA
FT                   EVIAMANDTEFGLASYFYAQNMSRVFRVAEALEYGMVGINTGLISNELAPFGGIKSSGL
FT                   GREGSKYGIEDYLEIKYLCLSV"
FT   gene            complement(101677..102312)
FT                   /locus_tag="Psyr_0092"
FT   CDS_pept        complement(101677..102312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0092"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35166"
FT                   /db_xref="GOA:Q500K6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35166.1"
FT                   /translation="MESLQQWLSFAMIALFVTLTPGPAVIMALSNSITHGPARAMVGSL
FT                   GNALGLIVVATAVTAGLGAILVASASAFLVLKIAGAGYLVYLGIKQWRSARSAFDALAN
FT                   VPKAVSTGGLFIKGISVALTNPKAILFFIAFLPQFIQPGTFQVEQTGVLIVTFAGCSVV
FT                   AHIFYVLLAQTLKRHLNSARRRQNVNRVFGASFIGLGLSLFTLKGRAA"
FT   misc_feature    complement(101695..101748)
FT                   /locus_tag="Psyr_0092"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(101797..101862)
FT                   /locus_tag="Psyr_0092"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(101908..101973)
FT                   /locus_tag="Psyr_0092"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(102046..102096)
FT                   /locus_tag="Psyr_0092"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(102112..102177)
FT                   /locus_tag="Psyr_0092"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(102217..102282)
FT                   /locus_tag="Psyr_0092"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(102358..103761)
FT                   /locus_tag="Psyr_0093"
FT   CDS_pept        complement(102358..103761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0093"
FT                   /product="Flavoprotein monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35167"
FT                   /db_xref="GOA:Q500K5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35167.1"
FT                   /translation="MILTWVRGVQLRAVCNTNHPATAFHHPTPTSTHKGTAHRYRHNRQ
FT                   LVHDAPHTTPSDRSHRGPLINQFKSIERSPCRVLITGASIAGCAAAWWLTQRDCDVTVV
FT                   EQAPAFRDGGQNVDVRGAAREVLRLMGLEQAVKDLNTGETGLAWVDEDNHTAARIDLAG
FT                   LDGDGPTAELEVLRGDLARLLYEASSADAFYRFGDRIVSVEHDAEGVSVTFEGGGQERF
FT                   DLLIIAEGVGSRTRELVFPGENQPRRMDLACAFFTVPRAPTDSQTARWYNAVGGRSAGV
FT                   RPDNRGTTRAFFNVQGRSHLTVGNSVAEQKAFLRASFAGAGWEVPRLLEGMEAAEDFWF
FT                   DDLRQVKIDRWSNGPVVLLGDAAWCVTPLGGVGASLSLIGAYVLAGELTRTDTIAEALA
FT                   SYEYVLRPVVKKSQSVPKLVPRLVHPRSQTGVKILRAVQRLVATPFISKRAARALTPAV
FT                   QSFTLPDYR"
FT   gene            103774..103850
FT                   /locus_tag="Psyr_RNA1"
FT   tRNA            103774..103850
FT                   /locus_tag="Psyr_RNA1"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg1"
FT   gene            103896..104600
FT                   /locus_tag="Psyr_0094"
FT   CDS_pept        103896..104600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35168"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35168.1"
FT                   /translation="MPEARLVRAFFVFGFSNSQDMLASIIREQSVDAQEHELRDKYNEL
FT                   KRRFDSRKHNADLLDKQINRREPLIISHSLMAGYIEAMSNWKADEQELNEKRQSHSTRL
FT                   EQIKQQVVEDMAKARQAGTGAATAYAQAVAWGDTEGEKTANADAQKAAKSLATAAEHNR
FT                   RQGLIISVLEQELITVDRYVAEAQEKHKGIERNALWLSQTVRKRNGTRPLRHSSMWAEG
FT                   YGRITTFSALIK"
FT   regulatory      104889..104917
FT                   /note="90-><-91, 100% conf. Stem=12 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(104893..104913)
FT                   /note="90-><-91, 99% conf. Stem=8 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(104951..106369)
FT                   /locus_tag="Psyr_0095"
FT   CDS_pept        complement(104951..106369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0095"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35169"
FT                   /db_xref="GOA:Q500K3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35169.1"
FT                   /translation="MAYIQGESRSQTSLFPVSLEELIPEDHLVRVIDLYVAKLDLVQLG
FT                   FDKALPKNTGRPSYDPADQLKLYLYGYFQRIRSSRRLEAECQRNIEVIWLINRLKPDFK
FT                   TIADFRKNNKLAFVATCRAFVRFCRMAGLIAGDLVAIDGSKFQAVASSRRHMNLKQLKR
FT                   QEEKLDKRIAQYLAELDEADKAEAGEVIDRGAIKTALAQLEVRQHDNQSCQALMSSMGL
FT                   EQFNTHESDARMMRTPKGPRVAYNVQTAVDAAHCLILHHEVTQDGDDRKQLEPMAKAAK
FT                   EHLEQDALSVTADAGYSNGQQFQACEEAGITVYVPPNRTVNPGGEELFERKDFTYEAEH
FT                   DRYQCPAGKWLTLKQRNRGDRIYQAHVSDCAACPLKSRCTGAQRRYVSRHAHEAAFERM
FT                   EQRMLAHPQMMASRRSIVEHPFGNLKQWLLGNGRFLLRQLEGAKAEMALAVNAYNLKRA
FT                   ISVLGARQLMALMG"
FT   regulatory      105930..105962
FT                   /note="hrp box; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and or weight matrix
FT                   scans; (PMID 17073298)"
FT                   /regulatory_class="promoter"
FT   gene            complement(106580..107563)
FT                   /locus_tag="Psyr_0096"
FT   CDS_pept        complement(106580..107563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0096"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35170"
FT                   /db_xref="GOA:Q500K2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35170.1"
FT                   /translation="MMKQMTFADAEYAGKRKRTRKELFLIEMDQVVPWKGLIALIEPYY
FT                   PKGEGGRPAYPLMAMLRVHLMQNWFGYSDPAMEEALYETTILRQFSGLSLERIPDETTI
FT                   LNFRRLLEKHELATGILGVINGYLGDRGLSLRQGTIVDATLIHAPSSTKNKDGKRDPEM
FT                   HQTKKGNQYYFGAKAHIGADDESGLVHSVVVTAANVADVTQVAKLLHGEENVVCADAGY
FT                   TGVEKREEHTGRKVIWQIAARRSTYKKHGKRNVLYKAIRKIEKAKAQVRAKVEHPFRVI
FT                   KRQFGYEKVRFRGLAKNTAQMVTLFALSNLWMARRHLLASAGEVRV"
FT   gene            108211..109452
FT                   /locus_tag="Psyr_0097"
FT   CDS_pept        108211..109452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35171"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35171.1"
FT                   /translation="MSEENGYMEGFHDPIRHLKYLRQSLSQDNESIGFFLSAGCPLSVN
FT                   MPTDEWPLIPDVANLTKFINSQLVENVQYKTLLAELVKAERNSENIEDTLSFLRSLLTV
FT                   SKGGDVRGLSEANLLDLEKKICKIIVKKIDVLLPSQDTPYHQLCKWIRSIDRKTPVEIF
FT                   TTNYDLLMEQSLEDLEVEYFDGFVGARRSFFDLRALEDNLIPVHWSRLWKIHGSINWYK
FT                   EEVSGQKKVYRSSEIKEDASHLIYPSHLKYEESRKMPYLALIDQLNRFIRKKSSLLIMS
FT                   GYSFNDGHLNDTIINALKANPTAMVLALMYGNFEDQLPDGLAKEKYPEAYRLAKNQHNL
FT                   NIWTFNKAIIGTNPGRWSIFPENDDTDLDIRTFITSIKIDDTSGKTENIIKLGDFAVFT
FT                   SFLKRIIGSASGAN"
FT   gene            109452..111323
FT                   /locus_tag="Psyr_0098"
FT   CDS_pept        109452..111323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0098"
FT                   /product="Protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35172"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35172.1"
FT                   /translation="MASKETYLGDVQDVNGTAVSISLSKQSLTGFIYIDGQGYRVGQIG
FT                   SFVRIPIGFSDLFGIVSQVGASAVPENKNIIKDQSNRWMRIQLVGEGQRNGSFQRGLSQ
FT                   YPTIGDEVHLVSEKELKTIYGRPDRPYFVKLGHISNAESIPALIDINKLVTRHSAIVGT
FT                   TGSGKSTTVASIMNALSDTEKYPSSRIIMLDLHGEYGSALKDKADIFKINSFKLSKLAE
FT                   SELQIPFWALNFDELCEISFGEFSNEKEKNVVMERVHKLKAESIAKYPRTGASLDSVSV
FT                   DSPIPFSIHHLWYDLFIETFATYYKGRPGKPMDNLAFELDPAGNELRGNPAAGIPPIFK
FT                   NIVTEANEEKINYLPGSLNIGKNVLLLGTKLRIPRYDFIFRPGDWMPEADGSVVTDLDK
FT                   LLESWIGRKSISILDLSGVPPDILQTTIGAVLRILYEALFWARNLSQGGRHRPLLIVME
FT                   EAHIYLNDSFKGMASKIVQRIVKEGRKYGIGAMIVSQRPSEIDPTILSQCGTFFALRLT
FT                   NSTDRAHITSALSDNLDGLTSMLPILRTGEAIILGEAVKLPMRTSILAPPKNRRPDSQD
FT                   PIVYDEFPFDESLSPGGWGIKMEGSPNYEELVETWRAQNPRIDKIKP"
FT   gene            111332..111541
FT                   /locus_tag="Psyr_0099"
FT   CDS_pept        111332..111541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0099"
FT                   /product="Conserved hypothetical protein"
FT                   /note="similar to BCE2369 and YPTB2343"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35173"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J9"
FT                   /protein_id="AAY35173.1"
FT                   /translation="MERSPVSSSNVESVGYDEDSETLEVEFKNGTLYQYFDVPQSAFDG
FT                   LVNADSPGGYLAENIKGVYRYSRV"
FT   gene            complement(112435..112968)
FT                   /locus_tag="Psyr_0100"
FT   CDS_pept        complement(112435..112968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35174"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35174.1"
FT                   /translation="MPMDPQSIDTNKVAHCTFELTGQPMSLLKCSNNESYEAFSGITGY
FT                   ANDPAQVSSAKNGPLPPGRYYILNRESGGRLGWLRDPITDLIARTDRSDWFSLYRDDGE
FT                   IDDRTIIDNVERENFRLHPVGPLGLSEGCVTMTSKLGFEQLSIYLHNMEGDRLPGSGQK
FT                   YFGILDVIDPRNTK"
FT   gene            complement(112987..113487)
FT                   /locus_tag="Psyr_0101"
FT   CDS_pept        complement(112987..113487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0101"
FT                   /product="Protein of unknown function DUF796"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35175"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35175.1"
FT                   /translation="MAFDAYLKIDGIPGEALDAQFKDWIEMENFDLGASQSASVTATSA
FT                   GGATSGRARMSDLFFRKTVDKATPKLHEACCSGKHFKEVTLAVNRAGTDKLKYLEIVLE
FT                   EVIISSVSLNGNGGVEGGFPTETVRLNYGRIKMTYTQQKRADGQGGGQVVGGWDAISNK
FT                   VYA"
FT   gene            complement(113906..114502)
FT                   /locus_tag="Psyr_0102"
FT   CDS_pept        complement(113906..114502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35176"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35176.1"
FT                   /translation="MTKSTTAHSPLAAHNQFKEIIVPTTVIEVIDTSIKIGLGGLIGFA
FT                   STYVVTKLNHGHDAKKDVIKRRYDALEQVAAHIEEFSHVALKYWALVVECVRIENANKE
FT                   WPKERAEQLELVKAEYFSEAKNITIAESKLLLLGLEPASAQLRKYTNFLKTLRRTYYVG
FT                   KPGLTEEKMDSAREELLRLRQEFFSELSLAYKKGL"
FT   gene            complement(114514..114891)
FT                   /locus_tag="Psyr_0103"
FT   CDS_pept        complement(114514..114891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35177"
FT                   /db_xref="InterPro:IPR019650"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35177.1"
FT                   /translation="MKLDKDLVREILLAIEASDKTPDSWIDLTIENHSKDEASYHVMLL
FT                   HEAGFIVAQDLCSMSDFDWRPKRLTIRGHEFLDTIRDREVWRLTKAGAEKAGGVSLTVM
FT                   LEIGKAYGKQVLKDRLGIDLP"
FT   gene            115713..116873
FT                   /locus_tag="Psyr_0104"
FT   CDS_pept        115713..116873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35178"
FT                   /db_xref="GOA:Q500J4"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35178.1"
FT                   /translation="MSLKIFVSYAKEDRLQALKYYDLLVHDGMVPWIDVKHILPGQNWE
FT                   AEIDKAFLEANVVMLLLSNKSVNKRGFVQREANDAIERLRYKQPTDIYVLPLLLEQCEV
FT                   PTHISGRLQYIDLTTTGAWIQVQASLQLAAEQQSIEIKHGSNAGPFKVFSEQLKDYWEG
FT                   APGHDIKIEYPRFESASLKSAAEELSLYFGGRATLGLIKSRQKPWDQQKDLFPETGGYI
FT                   SLNGRWDGFGVVHATDEILSLIYEVSWYGAGAAHPNSHFETYNFSLHERLLLLSLDDFF
FT                   CDHTAALQRISELCIAELCREYWRRTGEKPGEDQVEWFTNGAAGTEENLSAFTVGANHF
FT                   TFLFAPYQVSSYADGRWSVEISFYDLLEFLKPDGPHTYAAVRLGLE"
FT   gene            complement(116991..117812)
FT                   /locus_tag="Psyr_0105"
FT   CDS_pept        complement(116991..117812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0105"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35179"
FT                   /db_xref="GOA:Q4ZPT1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZPT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35179.1"
FT                   /translation="MLGVSATGFHCHQARCAVNCPQRGLSDAALLVHIRAAHARSRGSY
FT                   GWPRIWHGLLADGVRVGKERVQKLMQLHGICGKGKRRFKVTTDSAHDLPISENLLDRQF
FT                   AVMEPDRAWVGDITYIPTDEGWLFLAVVVDLFSRQIVGWSMDERMKSSLVIDALRMAWF
FT                   KRHPHKASGLLFHSDRGSQYASFDFRHVLQGYGIVSSMSRRGNCWDNACSETVFGSLKV
FT                   ERLHGLKFKTRRAAKDEVINWLLWYNQERLHSTLHYVSPMQYEQNWQRQQP"
FT   gene            complement(117869..118168)
FT                   /locus_tag="Psyr_0106"
FT   CDS_pept        complement(117869..118168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0106"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35180"
FT                   /db_xref="GOA:Q4ZPT0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZPT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35180.1"
FT                   /translation="MTKPKTDRVKYTLEFKLEAVRLVDTGLTLAAAARSLGISDQTLFN
FT                   WVKAHRQGRLTGADIKSVTPEQMEISRLRAELARVKMERDILEKATAYFAKASS"
FT   gene            118370..118735
FT                   /locus_tag="Psyr_0107"
FT   CDS_pept        118370..118735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35181"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35181.1"
FT                   /translation="MVPDEIVMCAPHVIGEKMLAQQMAQANKELKAGIEVRMLATPTDA
FT                   SKGLGMFDALNGFEDAAALAHRSPPFSQPQEKDVFIFIHNSKHLIPLNPNPSDNTTGHI
FT                   VAPKKMACGCDESFHLA"
FT   gene            118946..120304
FT                   /locus_tag="Psyr_0108"
FT   CDS_pept        118946..120304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0108"
FT                   /product="Major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35182"
FT                   /db_xref="GOA:Q500J0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35182.1"
FT                   /translation="MSDQSTPNTPLVRFCDKVGIPYPMFWGFVGLLIFMIGDGVELGYL
FT                   SPFLSERGMPGDEVAMIFTLYGVTVGISSWLAGALSNIWGPKRVMFLGLIIWSVFEVLF
FT                   LVYGLQELSYSMILLTYGLRGFGYPLFAYGFLVWIAASTPSRKMGMAVGWFWVAYAAGL
FT                   PMLGSLVASIAIPLIGALLTFWLSFALVVIGGVIGLVGMREAHGMRRLAPEGERPLVSM
FT                   AKNITIMWTRPKVSLAGIVRVINTSSMFGFLVVMPGFFMQTVGFTLEEWLRLLTIVFVF
FT                   NIIGNLGSSVISTKIGYRNTILWFGAVGSTISTPLFFFMPQAFPNDFLIASIFGAFYGL
FT                   TLACFVPLSALAPALAPNNKAAALSVLSLGAGASTWVGPAVVAIFNESYGIEGVVWAFS
FT                   GLYALSAVLTVFLKDPEPVHDPILIKIKRRIKVFAPRLDYRWAHAEDPKQGQS"
FT   misc_feature    119003..119071
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    119129..119197
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    119210..119266
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    119294..119362
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    119399..119467
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    119477..119545
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    119660..119728
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    119756..119824
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    119849..119917
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    119930..119998
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    120032..120100
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    120113..120181
FT                   /locus_tag="Psyr_0108"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   regulatory      120333..120366
FT                   /note="97-->98, 100% conf. Stem=15 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            120719..121144
FT                   /locus_tag="Psyr_0109"
FT   CDS_pept        120719..121144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35183"
FT                   /db_xref="InterPro:IPR010862"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35183.1"
FT                   /translation="MNKESVDYELLNDIVKCIQEVFEFSKDAFETLSLATDINRELGIE
FT                   GDDANELMPEFFERFSINIDNYDPYRYFVPEGYDFFSFRRSKDRRGKIPITLGMLYMAA
FT                   REKVWNTQELESVKFSPAPLYNCTSEIPLEDYKNNDK"
FT   gene            121508..122362
FT                   /locus_tag="Psyr_0110"
FT   CDS_pept        121508..122362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35184"
FT                   /db_xref="GOA:Q500I8"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35184.1"
FT                   /translation="MLQMLRTGPKRKFIYAASGYIYVVGGLLSSAIMWLMDVKKDDKWI
FT                   EQKPILWLLTERFQEVSIWLLLTVALIIFATALMKQMADPWVVEKLQFILDEYQDRVFK
FT                   NLNVPIDHNRVTLFKYKRSLFFRRHWLESGVSIWGLLKTRRFCGDYLVPYMRSGHMTLN
FT                   TKTIFYVDSENSAKSQGVAGMAWSKRGVVILPDLPELTSTSRPRTKESYASVTKSSVRF
FT                   LERYLAEGRTPSRAMAAMPVECNGKLWGVIVLDSLDPLGVTAQSVEHYTLTVALIGHLL
FT                   ERA"
FT   misc_feature    121544..121612
FT                   /locus_tag="Psyr_0110"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    121688..121741
FT                   /locus_tag="Psyr_0110"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            122362..122793
FT                   /locus_tag="Psyr_0111"
FT   CDS_pept        122362..122793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35185"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35185.1"
FT                   /translation="MNTSSEEWISVSQHELNEVESKEQRGIKLQFMLSPADLPTAWRGY
FT                   NLNETTVVVEFKYLSSNESRLIESPSDVVSIEVGKNSKRIYRIMLDVLRNPPSGAIMIS
FT                   RATDALEHSHGLNKSNSEVILRFLTSKKSRPELLHMMGA"
FT   gene            complement(122810..123193)
FT                   /locus_tag="Psyr_0112"
FT   CDS_pept        complement(122810..123193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35186"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35186.1"
FT                   /translation="MNIEHSAASPAWGMHSGVKPPLSFCRNALCRPERIRMSHSELCLK
FT                   PIHELLADENGKPTQFWIPAYQRGCRWKPLQVTQLLEDIREFSQRRNPQPEEFYCLQPL
FT                   EIKATEQRKKCQIGVATQLDNNF"
FT   gene            complement(123930..124664)
FT                   /locus_tag="Psyr_0113"
FT   CDS_pept        complement(123930..124664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35187"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35187.1"
FT                   /translation="MDVVREILQNKVMRIKVYVWHHKAINHAPRLKMELISQEKIMQVL
FT                   DWAYERSVNGFSGLDSAEELAASYAGKDSSAYDQANSLIRWQNTKSATSGFITGLGGLI
FT                   TLPIALPANITSVLFVQIRMIAAIAHLGGYDVRDDKVKTLVFACLTANSAKEVLKDIGI
FT                   AVGNKLAMNAVKSISGKTLIEINKKVGFKLFTKFGEKGVINLGKAVPLLGGLIGGSFDA
FT                   YTTNTIGNVARDTFTPKEVAAV"
FT   misc_feature    complement(124314..124379)
FT                   /locus_tag="Psyr_0113"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            125003..125455
FT                   /locus_tag="Psyr_0114"
FT   CDS_pept        125003..125455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35188"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35188.1"
FT                   /translation="MLGRERAVRQFQKITSSMNPTSKVPPPETWVRVFPWSFTLKSFSK
FT                   VVAAAVCGLVLAGCTGTPMKTPHYDSSQYTVVGHSEASATGLMLFGLIPIRQNDRFVRA
FT                   QNSAIQAKGGDALINTQVQEKWFWAWVLNGYTTTVSGDVIKLKTAK"
FT   regulatory      125470..125498
FT                   /note="100-->101, 98% conf. Stem=12 Gap=3"
FT                   /regulatory_class="terminator"
FT   gene            125598..126362
FT                   /locus_tag="Psyr_0115"
FT   CDS_pept        125598..126362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0115"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35189"
FT                   /db_xref="GOA:Q500I3"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35189.1"
FT                   /translation="MTAFYLKLLITPALMLAISLAARRWGTGVAGLLSGLPMTSALVML
FT                   FLSLEQGTQFASMAVPGALAGLAAIQATYLFYFLITRHVSALTGCVLALAVYGATAFLM
FT                   NLSGLLALSIIFTLLMVALIIVATSKQTPPDVASYVALPRWVIPMRMLTATLLLLAITA
FT                   SATWLGPVVSGLLAPIPVIAWPLAVFVHVQGGRYELAAIICGNAIGAVGVVSFYLTLRY
FT                   SILQWGALLSIAAAVLLAVVVTAGLARLLARR"
FT   sig_peptide     125598..125678
FT                   /locus_tag="Psyr_0115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.352 at
FT                   residue 27"
FT   misc_feature    125670..125738
FT                   /locus_tag="Psyr_0115"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    125766..125834
FT                   /locus_tag="Psyr_0115"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    125847..125906
FT                   /locus_tag="Psyr_0115"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    125916..125984
FT                   /locus_tag="Psyr_0115"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    126018..126086
FT                   /locus_tag="Psyr_0115"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    126099..126167
FT                   /locus_tag="Psyr_0115"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    126186..126254
FT                   /locus_tag="Psyr_0115"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    126282..126350
FT                   /locus_tag="Psyr_0115"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(126577..127209)
FT                   /locus_tag="Psyr_0116"
FT   CDS_pept        complement(126577..127209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0116"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35190"
FT                   /db_xref="GOA:Q500I2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35190.1"
FT                   /translation="MNVHLYLSFILTSLIVLVVPGPSFAYAIAVGMRSSRQVILRNALG
FT                   MALGGLTITMALAFGVAQLFAAYPTAFVALKFIGCTYLVALGIRTFFTRPEPKHACKIE
FT                   TSATPLLQGFIVETANPKAILFYVSLVPQFADPELGHMEAQLLILGATFVALQVTWDIA
FT                   LMLGVHRLGAIAGGLMSTKSQRIINRISGTTFIVLGLALLTQERPVS"
FT   misc_feature    complement(126598..126648)
FT                   /locus_tag="Psyr_0116"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(126706..126771)
FT                   /locus_tag="Psyr_0116"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(126817..126882)
FT                   /locus_tag="Psyr_0116"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(126946..127011)
FT                   /locus_tag="Psyr_0116"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(127027..127092)
FT                   /locus_tag="Psyr_0116"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(127114..127179)
FT                   /locus_tag="Psyr_0116"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(127132..127209)
FT                   /locus_tag="Psyr_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.940 at
FT                   residue 26"
FT   gene            complement(127274..128437)
FT                   /locus_tag="Psyr_0117"
FT   CDS_pept        complement(127274..128437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0117"
FT                   /product="Aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35191"
FT                   /db_xref="GOA:Q500I1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR030898"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35191.1"
FT                   /translation="MTLAYNKRHQIVRPDSCLSMLQQRLKYARSELRDSACYFVENVPV
FT                   WPGAASPTPFSASNDIFQYADCNGAPPLINTLCDRDNALYGLDLSGENFLVTNGGMHGL
FT                   SLVFRQIKRRSVEAGSAVCLAPVFGAVPALLEATGYDLIYYRMRAAFPTVEEVLAVCRA
FT                   DTNLVYLNFPHNPLGGIYSDAFMEELVPSLAERGISLVLDMVYDSFIFDDQKIRSPFAC
FT                   TSDLSSLYTVNSVSKNYGSPGLRIGWVTSSPDNVEAMAGMLEIECVAVCSPAQTKAASL
FT                   ISMGNAPLHQQVVNSRAIVREFLGSHLSKYASLPPAGTQVFVNLPVHDIEGFADQMLGE
FT                   YGLVLATASNYSGAQGAHIRIPTGYPESVTHNALDLLRQGIERYADA"
FT   gene            complement(128434..129486)
FT                   /locus_tag="Psyr_0118"
FT   CDS_pept        complement(128434..129486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35192"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030899"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35192.1"
FT                   /translation="MTLLDAIQRENTGFETTLIKGIEPIRQFVLAISIYHLFDTKLFSL
FT                   LIKHPVASLDVACHELGMDKEKLLGLFRYLKNEGILLETIDGFSLSKEGHALAPFEGWY
FT                   VMLVGGYATTFLQMGERLQEGAGWATRDATKVGVGSCGISHFDAIPLTRSLMAKAPGTC
FT                   TKLLDLGCGNGRYLAEFCKALPQIQAWGAEPDRGGFEEAVDLIEKEGLSHRVHISHSGA
FT                   VEFLDSDFNFEPDFIVLGFVLHEILGQAGRPAVINFLKKIVHRFPAINLIIIEVDNQFD
FT                   NAGAMRHGLALAYYNPYYLLHCFTNQLLVQDADWLDIFAEAGLSLITRETTSDQVDSTG
FT                   LEIGYLLRRA"
FT   gene            complement(129571..129822)
FT                   /pseudo
FT                   /locus_tag="Psyr_0119"
FT   CDS_pept        complement(129571..129822)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0119"
FT                   /note="ISPs1, transposase OrfB"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            130166..130936
FT                   /locus_tag="Psyr_0120"
FT   CDS_pept        130166..130936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0120"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35193"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35193.1"
FT                   /translation="MSLIPELNSDANVLICGASRGIGLALCAALLARDDVAQVWAVARK
FT                   ASTSTELATLAEQYGQRIKRVDCDARNEQSLEALVSETLDGCDHLHLVISTLGILHQDG
FT                   AKAEKGLAQLTLASLQASFATNTFAPILLLKHLLPLLRKQPSTFAALSARVGSIGDNRL
FT                   GGWYSYRASKAALNQLLHTASIELKRLNPASTVLAIHPGTTDTELSQPFQANVPEGQLF
FT                   EPAFSAERIIEVVGAHGPADSGTFWAWDDKPIVW"
FT   gene            complement(131018..131647)
FT                   /locus_tag="Psyr_0121"
FT   CDS_pept        complement(131018..131647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0121"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35194"
FT                   /db_xref="GOA:Q500H8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35194.1"
FT                   /translation="MSTSNRNQADPTRRQRMIREDRLRQLLDVAWRLVGERGSDALTLG
FT                   RLAEQAGVTKPVVYDHFATRAALFAALYEDFDQRQTARMDIAIAASEATLDGVASVVAS
FT                   SYVDCVLLQGHEIAGVIAVLSSTPELEKIKREYEAKFLIKCRTWFSPFLKAGELGLSSL
FT                   HAIVGCAESLSAAAAREEISSDDAKKELMAVIVAVVQKAGRGGLEK"
FT   gene            131737..132393
FT                   /locus_tag="Psyr_0122"
FT   CDS_pept        131737..132393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0122"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35195"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35195.1"
FT                   /translation="MHVLIVTAHPESQSLTHSIAARVAKGIVLGDSASVVEVANLAQEA
FT                   FNPCFTEADLQVHRHKASPPLDVQREQARIERADTLILVYPTYWWSMPALLKGWIDRVF
FT                   SNGWAFDFDPEGSLTKKLGKLSVHLIGIGGADPLTYERHGYGTAMKTQMDQGIFGYCGA
FT                   EVHISKLLLNSENSGAVHALEMAEQLGRIISSEASPSTADTESLYYREHAGPNLK"
FT   gene            132718..133539
FT                   /locus_tag="Psyr_0123"
FT   CDS_pept        132718..133539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0123"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35196"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35196.1"
FT                   /translation="MDNKLTSRIAIITGAAQGIGAAIARRFLQEGCFVYVTDINDVLGR
FT                   ETARALGDRACYLHLDVRCEEDWQRVTAHVVKAHGRLDVLVNNAGITGFEQGAVQHDPE
FT                   HARLEDWQAVHHTNLDGVFLGCKYAIRAMRHTETGSIINISSRSGLVGIPGAAAYASSK
FT                   AAVRNHTKTVALYCAEQGLKVRCNSIHPAAILTPIWEPMLGADAGREERMAALVRDTPL
FT                   RRFGMPEEVAAVALLLATDEATYITGSEFNIDGGLLAGSAATPVVLDDSET"
FT   gene            133779..135326
FT                   /locus_tag="Psyr_0124"
FT   CDS_pept        133779..135326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0124"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35197"
FT                   /db_xref="GOA:Q500H5"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35197.1"
FT                   /translation="MTQTVDIKDVTNPTALANLQVARATSQVSNNPIELIVQGTPGNDS
FT                   LRGGLANELLMGGDGNDYIVSGGGNDVMVPGAGADSLSGGAGNDVFRFERISDSYINGA
FT                   GESTDSISYFDPAHDILDVSALGYSHLGNGYGDTLHIRSEPLRGIYFLESYERDQNGHR
FT                   FAVQFLANSGVITDANLQPLINGTSQSNLLVGTDGSETLKAGAGRDTVEAGADNDRLFG
FT                   GAGGDTLSGGAGADTFVYTRLSDSYRNDASGSYSSRDLITDFSGNGHDMIDVSALGFTG
FT                   LGNGYNGTLKAVLNLAGDATALKSLEADANGNRFEILLSGNHVNELNASTVLFAPPSDA
FT                   TVVTSPQPITPVNLAGGDKSEKLYGYWGNDTLAGGAGNDILEGNAGDDVLTGGLGADKL
FT                   TGGTGNDRFVFTSSADSHAGSSDLITDFIWGQDKLDVAALGVTGFGNGRDGTLSMTYDE
FT                   NTDRTYLRSREPGADGHAFQVTLVGFDYTRELTNADLVVADTADVALVGQTAVDLAS"
FT   gene            135597..135953
FT                   /locus_tag="Psyr_0125"
FT   CDS_pept        135597..135953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35198"
FT                   /db_xref="GOA:Q500H4"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35198.1"
FT                   /translation="MAMVFCRGCAKEIHETALNCPQCGASQVSATPAKQLQQTGSPWMA
FT                   IVSLVLGILCSLALFDDGEWDLDTVVGLGMCSIAGLVLGVISINKKLPGNGIAIAGTVL
FT                   SAVSLLIFFGLIAN"
FT   misc_feature    135723..135776
FT                   /locus_tag="Psyr_0125"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    135804..135860
FT                   /locus_tag="Psyr_0125"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    135879..135947
FT                   /locus_tag="Psyr_0125"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            135970..136410
FT                   /locus_tag="Psyr_0126"
FT   CDS_pept        135970..136410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0126"
FT                   /product="Protein of unknown function DUF805"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35199"
FT                   /db_xref="GOA:Q500H3"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35199.1"
FT                   /translation="MVFCRGCAKEISDDAGTCPHCGAPQLVISPASASTDNPPAWSWYT
FT                   DVLKKYAVFTGRARRKEYWMFFLFNILISIVLGFIGGLIGDGGIIANLYSLAVLVPGVA
FT                   VGVRRLHDTDRSGWWLLVPIANLVFLIQEGHPGPNRFGPSPK"
FT   misc_feature    136156..136224
FT                   /locus_tag="Psyr_0126"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    136234..136290
FT                   /locus_tag="Psyr_0126"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            136494..136931
FT                   /locus_tag="Psyr_0127"
FT   CDS_pept        136494..136931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0127"
FT                   /product="Glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35200"
FT                   /db_xref="GOA:Q500H2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35200.1"
FT                   /translation="MDTSDGMLQGTCHCGAVRFQVRLTDGFKTVRRCNCSYCRMRGAIA
FT                   VSAALEDIQITSGEAMLKLYQFNTLQAKHYFCSQCGIYTHHQRRSNPAQYGVNVACLEG
FT                   ISPFDFELVPVNEGRIHPADKAAGSGSDIAGYLRYIPDTTS"
FT   gene            137161..137526
FT                   /locus_tag="Psyr_0128"
FT   CDS_pept        137161..137526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0128"
FT                   /product="H-NS family protein MvaT"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35201"
FT                   /db_xref="InterPro:IPR035616"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35201.1"
FT                   /translation="MSKLAEYRQLEKHLAEQLQALETMKGDQGLKKEIEFETKLRKLLE
FT                   HYGFSLKHIINLLDPQTSSRGQTVEKPAGKRKPRELKVYKNPKTGEVIETKGGNHKILK
FT                   EWKAEHGSDVVEGWLKK"
FT   gene            137656..137955
FT                   /locus_tag="Psyr_0129"
FT   CDS_pept        137656..137955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35202"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35202.1"
FT                   /translation="MDKTITVDQLASTDLRSVNEIWLGGTHTALCLWRGKQVPTHDMLS
FT                   EGTHDQNARRLCLQLVDPDDKAALASVEALVRDRLERMGSKGEFYPAENVDTHQ"
FT   gene            complement(138083..138991)
FT                   /locus_tag="Psyr_0130"
FT   CDS_pept        complement(138083..138991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35203"
FT                   /db_xref="GOA:Q500G9"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35203.1"
FT                   /translation="MQGKQTMSIHQLRKDVEEHFQRFERAPFKEAWRRRDARICLIWMI
FT                   AWILALSATLIFLPWTKLADYMPALVPVLLISMICAVRLAEVYELVRADQMGAGPLTTP
FT                   LERSQLRQQWFCTRYSCSSAELVDKARVMRHLWEERQELKRLASNDTMGPRIAAFFRLP
FT                   DPARFIGTLFAIAAIFTTMITLGSNIDAIFAAVQDWRTIGFNILLGTFLCAEIVWLWIM
FT                   VTGMISEIGPSLLEQLGLLPMSSRRVYRYLLAVHGASEPVTPVPNATRGLLKMSSLFFM
FT                   PVGEVWAKVRTRFTARSAAMA"
FT   misc_feature    complement(138320..138385)
FT                   /locus_tag="Psyr_0130"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(138425..138490)
FT                   /locus_tag="Psyr_0130"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(138809..138874)
FT                   /locus_tag="Psyr_0130"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            139587..140261
FT                   /locus_tag="Psyr_0131"
FT   CDS_pept        139587..140261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0131"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3:HAD-superfamily hydrolase, subfamily IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35204"
FT                   /db_xref="GOA:Q500G8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35204.1"
FT                   /translation="MRPQTSFIFDLDGTLTDSVYQNVAAWKEALDAEDIPLAMWRIHRK
FT                   IGMSGGLMLKSLSRETGVNISEAQAERLSEKHAQAYERLQGQIIALPGAVELLETLDKE
FT                   NLKWCIATSGGIDTATINLKALKLDINKINIVTRDDVSYGKPDPDLFLAAAKKINAPID
FT                   ECLVIGDAIWDMLAARRCKATGVGLLSGGYDIGELERAGALRVYEDPLDLLNHLDEIAS
FT                   RP"
FT   gene            complement(140362..140610)
FT                   /locus_tag="Psyr_0132"
FT   CDS_pept        complement(140362..140610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35205"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35205.1"
FT                   /translation="MTTDHILTDSVPKEDPASPQLGQYDREADPVLAMNANRPGVGPKK
FT                   GDELKKRTEHDETYDEGEPEVDDADSVSDEGGGALPG"
FT   gene            complement(140694..141164)
FT                   /locus_tag="Psyr_0133"
FT   CDS_pept        complement(140694..141164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0133"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35206"
FT                   /db_xref="GOA:Q500G6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35206.1"
FT                   /translation="MDKFDRAILDILQTDCTRSVADIAERIGLGSTACWRRIQKLEEAG
FT                   IIDRRVALLNPQRLNVSVSVFAAIRTNQHNAAWLEQFHAAVGELPEVVECYRMAGDTDY
FT                   MLRIVVAAIAGYDAVYKQLISIPGISDVSSSFAMEQIKFTTGLPLQYASFGG"
FT   gene            142016..143203
FT                   /locus_tag="Psyr_0134"
FT   CDS_pept        142016..143203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0134"
FT                   /product="Aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35207"
FT                   /db_xref="GOA:Q500G5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35207.1"
FT                   /translation="MILTRLQSELPMTTSALYLDYAATTPVDGQVIEAMVACMGREGHF
FT                   GNPASSGHGYGQVARQAVEQARAQVADAVGAPVDTIVWTSGATESNNLAIKGIAHDASA
FT                   PRRHIITSVLEHKAVLDTVSTLERQGFPVTWLKPDAQGLIQPHAVQAALREDTLLVSLM
FT                   LVNNELGTLTDIASIGALVREHGALFHVDAAQGVGKVKVDLASLAVDLMSFSAHKAYGP
FT                   KGIGALYVGPRAHSLLKAQIHGGGHEGGFRSGTLATHQIVGMGTAFALAISQAETENRR
FT                   IEELSRHLREGLLSLPDVQLNGCPQQRIPHTLNLCITRSGFTSSQLSHSLALSSTSACN
FT                   SASNAPSHVLLALGMDSAKALASVRVSLGRYTTQADVERAIEVFSKALSAPAAFW"
FT   gene            144401..145225
FT                   /locus_tag="Psyr_0135"
FT   CDS_pept        144401..145225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0135"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35208"
FT                   /db_xref="GOA:Q500G4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35208.1"
FT                   /translation="MNDAVIMKAVPSPSPDDTSTAWQGIPFSANTSRPGGLNKPQVMVL
FT                   IAASVLIHGVIWWYMQTAQPDVPEVAPQVPEMTIELTSPTPPAPEPPPPEPPPPPPPPP
FT                   PPPEPEQPVEDPDAVEPPPKPVEKPKVEKPKPVKKVEPVKKPTPPAPTPAAAPSPPAPP
FT                   TPAPAPPAPAAPPAPVKESAAVSGLASLGNPPPEYPGLALRRSWEGRVILRIKVLPNGR
FT                   AGAVEVTKSSGKPVLDEAAVEAVRNWKFIPAKRGDTPIEGFATQTIDFKLPE"
FT   gene            145279..145986
FT                   /locus_tag="Psyr_0136"
FT   CDS_pept        145279..145986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0136"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35209"
FT                   /db_xref="GOA:Q500G3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35209.1"
FT                   /translation="MNASLSSMIVPAVLWALILFSVLSWALLLIKSAQYVRQKSQNKQF
FT                   TKAFWSAPDLLTAAEHSAQYPGALARIANSGFEAMAVDESPRTTQQLAHTINRSDRLER
FT                   NLRQQIQKERRALESGQAILASIGSTAPFIGLFGTVWGIMEALQSIGVTGSASLEAVAG
FT                   PIGHALVATGVGIAVAVPAVLIYNFFLRRLKLAVADMDDFAHDFDALAQRSAFAVTRQP
FT                   IASKNGHAVREAS"
FT   sig_peptide     145279..145359
FT                   /locus_tag="Psyr_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.966 at
FT                   residue 27"
FT   misc_feature    145306..145365
FT                   /locus_tag="Psyr_0136"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    145642..145710
FT                   /locus_tag="Psyr_0136"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    145780..145848
FT                   /locus_tag="Psyr_0136"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            145986..146387
FT                   /locus_tag="Psyr_0137"
FT   CDS_pept        145986..146387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0137"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35210"
FT                   /db_xref="GOA:Q500G2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35210.1"
FT                   /translation="MSFSTQDSDEVLSEMNVTPLVDVMLVLLVVFIVTTPLMTNAIKVN
FT                   LPKTDAVAPAEKKNPVVVSVDQDGKFYLAKSEIAPELLEKSLQDEKAKDPEIRVQLQAD
FT                   TAVNYGQVAKAMASIERSGITKISVMTAK"
FT   misc_feature    146043..146111
FT                   /locus_tag="Psyr_0137"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            146598..149312
FT                   /locus_tag="Psyr_0138"
FT   CDS_pept        146598..149312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0138"
FT                   /product="TonB-dependent receptor:TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35211"
FT                   /db_xref="GOA:Q500G1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35211.1"
FT                   /translation="MNLPGCTLKPLALAVRRHPRALLCALAMGMSGAQAADAVDADTSG
FT                   SAVSTSAAVVPATTQLQRVEVTGSAIRRVDAETAVPITILRADDLKKQGVTTTQEMVQR
FT                   ITGSQSINNSAGSVGAGTGGASFADMRGIGANKTLVLLNGRRLANNALSGVGTPNGSAI
FT                   DLNMIPFAAIDRVEVLRDGASALYGTDAIGGVINFITKKSLTDGSLTLGGETPTASGGG
FT                   ATNDMSASWGFGDLEEDRFNVMGVFNYNKQQNLDANDRSFAKDYVPGRGLNQTSGTAYP
FT                   GNYFQGDNSANPLGRNCSGPNLIASNGICRFSTREYIDLIPQTEKTSFFGKATGKLADD
FT                   HNVSLEYFWARNNNHTDIGPAPLTGLSLDSSSPFYPGNGITPAPTDFTLDPTQPVSTAW
FT                   RETAAGPRGSSDQNTSQRFLLNFDGLVGGWDYNVGASYNQNKVLSSLTDGYISDAAMLN
FT                   GLANGTLNPFGPQTAAGQALIDANQYHGQYSSAVGRVAGLDARISREIGDWFGAGPAGI
FT                   ALGGEYRKEKMHQEYEAFVNDVSSLGADAAGSVEGDRSVKAEYAELNVPVLDSLELTAA
FT                   VRHDKYSDFGSTTNPKYSFRYQPFKQLVVRGAYSEGFRAPSLYELYAPRSTTFTQGYYN
FT                   DPVLCAGGVVQPGGNAGRDCQQQFLNNGGGNTELAPEKARNMTLGFVYQPVNNLSMGLD
FT                   FWWIHISNQIQAFPESTVFDDPNTYADRYVRAADGSIANIVTGNANLGIVKTSGVDVTL
FT                   DYRFPNTPYGQFGLGMTGTYVTRYDFQNIIDGPYTDKVGDFQGDGVISRWKHVLTGTWA
FT                   LGDTRASITNRFTSGYNDYDRTTNARVASYALWDMSVGHTFDKVLDIDAGVRNMFDRNP
FT                   PFSNQAYNFQSGYDPRYADPLGRTLFARATYHF"
FT   gene            149457..151340
FT                   /locus_tag="Psyr_0139"
FT   CDS_pept        149457..151340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0139"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35212"
FT                   /db_xref="GOA:Q500G0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35212.1"
FT                   /translation="MSRLNRFLRRLLLGVALCSGWQTVLATPTHALTVYGEAAKYPAGF
FT                   QHFDYVNPNAPKGGSLTRSAEEIGQFNYLNPYVDQGINVREVDSWVYSPLAYRSLDEPY
FT                   TVYGLIAEKMEMDPDGLWIRFFLNPKARFEDGKPVTAEDVRYTFELMTTKGSFSYRPMF
FT                   ADVKEVTIEGPLQIRFDFKNNLNRMLALDIASLHILPEHWWKTRDFANGGGFEPPLGNG
FT                   PYRVAKVDAGRSVTFERVKDWWGKDLPVSRGLYNFDMLTVNYYGDTEIARQLLQAGTFD
FT                   YNREFSSSGFVVGYSGPAIDDGRLQKRILARQRPVAAQGFVFNLDKPMFKDRRVREALS
FT                   LLWDFDWINRRVMRNFYVREQSYFPKSDMAATELPTPAELKILEPLRGQVPDEVFSKVY
FT                   QPPKTDGSGYIRDKQLQALKLLAEAGWHPKDNKLVNAAGEPMVFSFLDGQGGFDRLILP
FT                   FKRTLAQIGITLDFLRIDSAQYINRLNARDYDMIVVSLPKNGNPIISPGRELYNLYGSQ
FT                   SATEVGSSNAMVLRNPAVDTLIDGLVSANTRNDMVLYARALDRVLQWGYYMIPNYYSKG
FT                   TPLVFANRFGMPDVAPIYDVGLETWWQISPTPLTNAQATALTGKPAAAKEY"
FT   sig_peptide     149457..149537
FT                   /locus_tag="Psyr_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.728 at
FT                   residue 27"
FT   gene            151342..152409
FT                   /locus_tag="Psyr_0140"
FT   CDS_pept        151342..152409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0140"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35213"
FT                   /db_xref="GOA:Q500F9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35213.1"
FT                   /translation="MLAYVIRRLLLIIPTLLAILIVNFLIVQAAPGGPVEQAIARIQGF
FT                   SPNGVGGGGGEVAASGTASRSTRGLDPALIEQIKQHYGFDKPMHERLWLMLKNYAQLDF
FT                   GTSFFRGAPVTELIAQKLPVSLSLGLWATLITYLISIPLGIRKAVRHGSAFDVWSSTLV
FT                   IIGYATPAFLFAILLIVVFAGGSYLSWFPAQGLFSDNFDSLSTWGKVKDYLWHLVLPVS
FT                   SLVIGGFATLTILTKNSFLNEISRQYVVTARAKGLTEHRVLYGHVFRNAMLLVIAGIPQ
FT                   ALIEVFFAGSLLIETIFGLDGLGRMSYEAAVSRDYPIVFGTLFLFTLFGLLIKLIGDLC
FT                   YTLVDARIDFSARSA"
FT   sig_peptide     151342..151431
FT                   /locus_tag="Psyr_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.982 at
FT                   residue 30"
FT   misc_feature    151366..151434
FT                   /locus_tag="Psyr_0140"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    151708..151776
FT                   /locus_tag="Psyr_0140"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    151852..151920
FT                   /locus_tag="Psyr_0140"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    151978..152046
FT                   /locus_tag="Psyr_0140"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    152155..152223
FT                   /locus_tag="Psyr_0140"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    152293..152352
FT                   /locus_tag="Psyr_0140"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            152409..153431
FT                   /locus_tag="Psyr_0141"
FT   CDS_pept        152409..153431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0141"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35214"
FT                   /db_xref="GOA:Q500F8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35214.1"
FT                   /translation="MFEFSPQTRRRFDLFKANRRGWWSLWIFIGLLLVCLCGELIANDK
FT                   PLLIRYDGQLYYPVLHTYMETDFGGELPFEPDYASDYVRKLIAAKNGWMLFAPIPFSYD
FT                   TINYDLDAPSPSPPDHINWLGTDEQARDVLARVLFGARISILFALLLTAISTVIGVCAG
FT                   AIQGYYGGMTDLIGQRIQEIWSGLPVLYLLIILSGFVSPSFWWLLGIMALFSWLSLVDV
FT                   VRAEFLRGRNLEYVKAARALGLTDAALMWRHILPNAMTSTLTYLPFIITGAIATLTALD
FT                   FLGFGMPAGSASLGELIGEAKRNLQAPWLGLTAFVVLALILSLLVFIGEACRDAFDPRS
FT                   "
FT   sig_peptide     152409..152537
FT                   /locus_tag="Psyr_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.672) with cleavage site probability 0.671 at
FT                   residue 43"
FT   misc_feature    152469..152537
FT                   /locus_tag="Psyr_0141"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    152835..152903
FT                   /locus_tag="Psyr_0141"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    152964..153032
FT                   /locus_tag="Psyr_0141"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    153198..153266
FT                   /locus_tag="Psyr_0141"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    153327..153395
FT                   /locus_tag="Psyr_0141"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            153433..155016
FT                   /locus_tag="Psyr_0142"
FT   CDS_pept        153433..155016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0142"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35215"
FT                   /db_xref="GOA:Q500F7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35215.1"
FT                   /translation="MHDNLIEIRDLRVAFNGHEVVHGVSLDIRRGECLALVGESGSGKS
FT                   VTAHSILRLLPAKTVSTQGSIHYDGLDLVTASDKQLRSLRGNRVAMIFQEPMSSLNPLH
FT                   TVEKQIVEILVTHKGLKGKAALSRTLELLELVGIRDPLSRLKAYPHQLSGGQRQRIMIA
FT                   MALANEPDLLIADEPTTALDVTVQVKILELLKSLQQRLNMSLLLISHDLNLVRRIAQRV
FT                   CVMREGEIVEQADCQTLFDSPQHPYSRLLINAEPDGEPVPSTHSNTLLSVQDLKVWFPL
FT                   GKAWFKREPQYVKAVDGVSFELLKGKTLGIVGESGSGKSTLGQAILRLVDSEGSIRFGT
FT                   KELSLHSQHLMRPLRRQLQVVFQDPFGSLSPRMTVEQIIAEGLVTHNIGTPKEREQTVI
FT                   RVLQEVGLDPATRHRYPHEFSGGQRQRVSIARALVLEPDLILLDEPTSALDRTVQKQIV
FT                   ALLRDLQIRHGLTYLFISHDLAVVHALAHDLIVIKDGKVVEQGPSREIFAAPQQAYTQE
FT                   LLRSSGLVFA"
FT   gene            complement(155026..156546)
FT                   /locus_tag="Psyr_0143"
FT   CDS_pept        complement(155026..156546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0143"
FT                   /product="chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35216"
FT                   /db_xref="GOA:Q500F6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35216.1"
FT                   /translation="MDFKRMCSMPVAPRFLDHYRKADRIMLGLIWLLFIYALGLAFWFD
FT                   TFTQAVVVGGGTAVVLTGLYRAIGGTRLMRCCFGVGLMVMTALHINQTHGQVEIHFGIF
FT                   VLLAVLTFYRDWLPILVAAVTIALHHIGFHALQHSGFPVYVMHHGFGWSMVLVHAVYVV
FT                   VESAILVYLAVQNQAEAVENQDMLDRMLATTNQFSTDGQSSQQSGKHVSLAQRFEQFLA
FT                   QITGLVDGVVRDTRGLGELGHDLAKASGTLETGAQHQLSEIARMTGAMQRMGDAMNDIS
FT                   SHVAQAVQRAGDASDQVAHGRDSVDRAQSEITQLAARITTTDETVQALANQSEQIGKVL
FT                   DVIGSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAQRTAASTKEIQTIIEDL
FT                   QKGSRQAATAMSDSLQGVGRCVEDSQRASQSLRAVGEGIGHITQLNGLIATTTEQQSAV
FT                   SREMADQLRSVQTIAEHTAANIGVLATSSQSLSPLAIRLEALGKSFHA"
FT   misc_feature    complement(156031..156096)
FT                   /locus_tag="Psyr_0143"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(156142..156198)
FT                   /locus_tag="Psyr_0143"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(156337..156402)
FT                   /locus_tag="Psyr_0143"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(156415..156471)
FT                   /locus_tag="Psyr_0143"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(157030..157518)
FT                   /locus_tag="Psyr_0144"
FT   CDS_pept        complement(157030..157518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0144"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35217"
FT                   /db_xref="GOA:Q500F5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35217.1"
FT                   /translation="MEGLVKLDRIDINILVELQKDGRMTNVSLADAVGLSASPCLQRVK
FT                   RLESAGYISSYKAHLNLAKITESVTVFTEISLSDHKREDFAKFEANIRHVDEVLECHLI
FT                   SGGYDYLVRFMTRSIQHYQEVIEELLDKNIGISKYFSYIVIKSPVMKDGVPLRKLLRH"
FT   gene            complement(157566..158240)
FT                   /locus_tag="Psyr_0145"
FT   CDS_pept        complement(157566..158240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35218"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35218.1"
FT                   /translation="METLPAMGLIDYRALLIDCDEVLVDRDSGVWSALQPLLDNSLSTP
FT                   AKDQVLIEFNDVVRTLYPRFDELGFSGLLCFAHRQLAERLGIKASWEEGMTFARSVPNW
FT                   TLFEDAPGAMLYLRKFYRLLVYADRDMQDRGLLCERLGLEPDSLLSLTTHPLDDTGWLA
FT                   DMDLEPRETLFVSRPPASALASGGLCLIRRGREQHSQPCTADICINSMADLVAQHQLSL
FT                   RR"
FT   gene            complement(158304..159608)
FT                   /locus_tag="Psyr_0146"
FT   CDS_pept        complement(158304..159608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0146"
FT                   /product="4-aminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35219"
FT                   /db_xref="GOA:Q500F3"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35219.1"
FT                   /translation="MNSKVDETPHLLRQRDQFVPRGIVTAHPLVIDRAQGSELWDVDGK
FT                   RYLDFVGGIGVLNIGHNHPNVVKAIQAQLTKVTHACFQVASYQPYLDLAKRLSHLIAGQ
FT                   SGIDHKAVLFTSGAEAVENAVKIARAHTNRPAIISFRGGFHGRTLLGTTLTGMSQPYKQ
FT                   NFGPMAPEVFHTPYPNEYRGVTTDVALAALHELLATQVAPERVAAILIEPMQGDGGFLT
FT                   APVEFMKALRALTEQHGIVLIADEIQSGFGRTGKWFGFEHSGIQPDLVTVAKSLAGGMP
FT                   LSGVVGRAEIMDAPLPGGLGGTYGGNALSCAAALAVIDTYEQENLLARGEQLGNQLRAG
FT                   LLKLKERYSCIGDVRGTGFMLAMEMVKNDAARSPDADLNQKVIDQARLGGLLVIKCGVY
FT                   RNVLRFLAPLVTTEQQIDEALGILDAALARVLKSS"
FT   gene            159893..160822
FT                   /locus_tag="Psyr_0147"
FT   CDS_pept        159893..160822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0147"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35220"
FT                   /db_xref="GOA:Q500F2"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35220.1"
FT                   /translation="MPALLYKADPARAERWRVLFAEHAPDIEWRVWPDIGDPADIHYLG
FT                   AWLAPDDLQELLPNLKVLFALSAGVDQLDLSRIPKSLPVVRLLDPGISHAMCEYATFAV
FT                   LSLHREMLRYRQQQVEGVWKAHPLIPANQRRVGVMGLGLQAQHILSSLKPFGFELSGWA
FT                   RSEHRIDAVQCYAGEEQLDAFLGQCDILLCVLPLTGQTEGILNRRLFEQLPKGAALINM
FT                   GRGGHLVEAELIEALDSGQLSAAVLDVLQQEPAAADHPFWTHPKILLTPHVAAMTQPES
FT                   AFPGLLDNIRRFERGEAMQGQVDRGQGY"
FT   gene            160872..161111
FT                   /locus_tag="Psyr_0148"
FT   CDS_pept        160872..161111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35221"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35221.1"
FT                   /translation="MILAAGRRSEPGDASLVRESCLNCHAWQSTSTAWLRASRFDPRKR
FT                   AFYVRKPGCVNASLREQVRSYALRAEAKANTVCF"
FT   gene            complement(161189..162646)
FT                   /locus_tag="Psyr_0149"
FT   CDS_pept        complement(161189..162646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0149"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35222"
FT                   /db_xref="GOA:Q500F0"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35222.1"
FT                   /translation="MLKNQLKDPSLLVDRAYVDGQWISADDGATLTISNPATGEALAQV
FT                   PALQGVETRRAIEAADRAWPAWRARPAAERAALLERWHQAMLDNVEDLALIMTFEQGKP
FT                   LNESRGEIRYGASFVKWFAEEARRSYGETIPAPSADRRLMTLKQPVGVCAAITPWNFPN
FT                   AMITRKCAPALAAGCPIIVKPSDLTPLSALALALLAERVGIPAGVFNVITGMPTGIGEE
FT                   LTGNPVVRKISFTGSTPVGRLLMRQSAEHIKRLSLELGGNAPFIVFDDADLEQAVTGIM
FT                   LSKFRNAGQTCVCANRILVQNGIYDRFAARLVEEVSKLKVGNGLEEGVTIGPLINPAAV
FT                   SKVARHIDDALSQGAKLLHGGSPDGTSQFVQPTVLGDTHAGMLLANEETFGPVAPLMRF
FT                   TDEAEALALANATPYGLGAYYFTQDLRRSWRFGEALEFGMVGLNTGIISMEVAPFGGVK
FT                   QSGLGREGSSYGLDEYLEVKAFHVGGL"
FT   gene            complement(162761..163918)
FT                   /locus_tag="Psyr_0150"
FT   CDS_pept        complement(162761..163918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0150"
FT                   /product="Acetylornithine deacetylase (ArgE)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35223"
FT                   /db_xref="GOA:Q500E9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35223.1"
FT                   /translation="MSPRALEILKRLIAFDTVSSEPNMALIEYVRELLASKGIESLIVK
FT                   DETGKKANLFASTGPREVPGVLLSGHTDVVPAAGQAWTMPPFQATLRDGRIYGRGTCDM
FT                   KGFIALAIDAMLDAADMPLTRPLQLALSHDEEIGCVGVRRLLDVLHLAPVRPFLCVVGE
FT                   PTLMQFAVGHKGKASYRTFCRGQEAHSSLAPRAVNAIHLASDFIAELRKSQKQIEQQGA
FT                   RDEGYDIPYSTVHIGRIDGGKALNIVPNLCTLEFEYRNLPGDNPDALLEQLRERAEVLV
FT                   REARQLSGVADIEIEVMNEYPALETHPSVEAVRLLHAFAEPGTQHIKVSYGTEGGLFAG
FT                   RLNVPVVVCGPGSIEQAHKPDEFIDESQMDAGERFLQSLLGSLKQ"
FT   gene            complement(163915..165084)
FT                   /locus_tag="Psyr_0151"
FT   CDS_pept        complement(163915..165084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0151"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35224"
FT                   /db_xref="GOA:Q500E8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35224.1"
FT                   /translation="MKQPKVDVLIVGGGFMGSASAFFLRQRGKSVTLLERDVIGQYASG
FT                   VNFGNVRRQGRHLGQLELANRSRALWQRLPELIGEDLEFLPSGHMRVCYREDEIAELEA
FT                   YAAAPEARELDLKIYSGKALHERFPFLGPDVKGGSYAPHDGHANPRLAAPAFARAAIRA
FT                   GARIEERTEVAHVEKVGNEFEVTTTDGRIFSADQLLITAGAWGQKLSTQFGESVPLDTH
FT                   GPQMAVTEPVPYALPTVIGVFTKIPHEVIYFRQIARGNIVIGGGFRSKPDMINRRAYVE
FT                   PRSIINQVQQMRRLLPGVGNLNIIRVWSGIEGYTPDSLPVMGRSGKVDGLFYAFGFCGH
FT                   GFQLGPGVGDVMAELISTGTTSTSISPFDIRRFDVSLVDNLTEQTSKAS"
FT   gene            complement(165081..166490)
FT                   /locus_tag="Psyr_0152"
FT   CDS_pept        complement(165081..166490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0152"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase:BFD-like [2Fe-2S]-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35225"
FT                   /db_xref="GOA:Q500E7"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35225.1"
FT                   /translation="MATSSRLDVRNPGSPRVVIIGAGPAGTRCAETLLAAGIKPILIDE
FT                   NRRDGGQIYRRQPEGFKRDYSALYGTEAAKARDLHESFDRLRPQIDYRPDTLAWNLTHG
FT                   ELCCASQGVHTVIEYDALILCAGATDRLMPIKGWQLAGTYSLGGSQIALKSQSVSIGSR
FT                   VVFMGSGPLLYLVASQYVKAGADVAAVLDTSPFGKRVSAMPKLLARPGLLFNGMKLLGQ
FT                   LYSAGVPVHLGVQPEEIIGSEQDGVTGVRVKLANGNALSVDCDALALGYHLRPETQLAD
FT                   LAGCQLRFDEASGQWVLAVDEEGRTSVKGFYAAGDGAKIRGADAAEQAGRLVAMALLED
FT                   LGRPVDNSRQAEVRKSLVAMDRFRVGLAEAFPWPAAQAAALPDEAIVCRCEMISAGELR
FT                   GVVREKGACEVNRAKAFSRVGMGRCQGRYCSQAGAEVIAAEAGVPVEQVGRQRGQAPVK
FT                   PLSMLIDEVAS"
FT   gene            complement(166469..166780)
FT                   /locus_tag="Psyr_0153"
FT   CDS_pept        complement(166469..166780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35226"
FT                   /db_xref="GOA:Q500E6"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35226.1"
FT                   /translation="MNGRFVRLGERDRPVVSLMVDGAPIEALQGDTLMVALLTRKATLR
FT                   QSEFDPGRRAGFCLMGACQDCWVWSRSGERLRACSNEVRDGLDIVTTQPEAKWPLLHG"
FT   gene            complement(166777..168618)
FT                   /locus_tag="Psyr_0154"
FT   CDS_pept        complement(166777..168618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0154"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35227"
FT                   /db_xref="GOA:Q500E5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35227.1"
FT                   /translation="MSQLIRVQDLRVVADGDHGELEIVKGVSFALEKGEVLALIGESGS
FT                   GKTTIALALLGYARRGCKLAGGVVQVGAHDMLSLPESQLQGLRGNRVSYIAQSAAAAFN
FT                   PAKKLIDQVIEGALIHGLGSRAELEAKAVELFRDLALPNPESIGRRYPHQVSGGQLQRV
FT                   MAAMALISDPLLVILDEPTTALDVTTQIDVLRAFKRVVRDRGATAVYVSHDLAVVAQMA
FT                   DQIVVLNGGRIIEQSSTAALLKGPVDAYSRSLLAAARPDKVLSPASEVVKDSTLLTIKG
FT                   LTAGYGKKNLQGMPMIRVLEDIDLTIRRGQAIGVIGESGSGKSTLARVVAGLLDPAHGS
FT                   LTFDGADLSGTLAGRTEEQFRRIQMVFQNADTALNPMHSISAILARPLKMYFGLKGRAL
FT                   RERIDELMDLVRLPRELAERRPNELSGGQKQRVNLARALAAKPDLILCDEVTSALDTVV
FT                   GACILELLGELRRKLGVSYLFISHDISTVRALCDDIVVMYSGHKVEEGSREAFSRVPFH
FT                   PYTDLLVHSVPELRQGWLETCGVTSGNLPPISAPANNPELCTFLNRCPARIEGLCNKTA
FT                   PGRRLIAGGSEILCHRDSDELQAVQENLNPETVGAYA"
FT   gene            complement(168620..169498)
FT                   /locus_tag="Psyr_0155"
FT   CDS_pept        complement(168620..169498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0155"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35228"
FT                   /db_xref="GOA:Q500E4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35228.1"
FT                   /translation="MTQFIAKSTPAAPQPVLRKKASLPTSWLGLLGATVCFIWLMVALF
FT                   GPWLAPHPVGEVVSDNMFENMSAAYPFGTDYLGRDMLSRVLVGARFTVGLALISAVLAS
FT                   GIGTLCALLSVVAPKWLDEIISRLMDAFISIPSKMLALIMVSAFGSSEVLLICTAVLSY
FT                   TPGAFRIARSLAVNIEALEYVQVARTRGEGRIYIACREILPNMLNPVMTDLGLRFGFIV
FT                   LLLSGMSFLGLGVQPPDADLGSLVRENIGGLSQGAPAIVIPALAIGTLTIGVNLLIDRL
FT                   ASRRGRRSGGH"
FT   misc_feature    complement(168665..168730)
FT                   /locus_tag="Psyr_0155"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(168791..168856)
FT                   /locus_tag="Psyr_0155"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(169148..169213)
FT                   /locus_tag="Psyr_0155"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(169352..169417)
FT                   /locus_tag="Psyr_0155"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(169495..170451)
FT                   /locus_tag="Psyr_0156"
FT   CDS_pept        complement(169495..170451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0156"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35229"
FT                   /db_xref="GOA:Q500E3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35229.1"
FT                   /translation="MNSNTLWLIVQRFGAAIVTLLIVSIVVFAITAVLPGDAAQQALGQ
FT                   FATPEQVAALRTQLGLDQPGVVRYLHWLTNLLGGNLGESVSNAMPVSELIAGRFPKTLM
FT                   LSATTALVSVPVALALGIGAAMYRGSRLDSALNFITLSLVAVPEFLVATLAVLIFAVNL
FT                   GWLSALSYGADVSSPWQFMRTYALPVMTLCCVIVAQMARMTRAAVIDQLDSPYVEMARL
FT                   KGVSPVRIVLRHALPNAIGPIVNAVALSLSYLLGGVVIVETIFNYPGIASLMVDAVTNR
FT                   DMALVQGCTMLFCSAYLGLVLMADLCAILSNPRLRTQ"
FT   misc_feature    complement(169522..169587)
FT                   /locus_tag="Psyr_0156"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(169657..169722)
FT                   /locus_tag="Psyr_0156"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(169858..169908)
FT                   /locus_tag="Psyr_0156"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(169969..170034)
FT                   /locus_tag="Psyr_0156"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(170074..170139)
FT                   /locus_tag="Psyr_0156"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(170347..170412)
FT                   /locus_tag="Psyr_0156"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(170362..170451)
FT                   /locus_tag="Psyr_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.687 at
FT                   residue 30"
FT   gene            complement(170483..172120)
FT                   /locus_tag="Psyr_0157"
FT   CDS_pept        complement(170483..172120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0157"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35230"
FT                   /db_xref="GOA:Q500E2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35230.1"
FT                   /translation="MTDKKNDSTLITGEDSLRVFEGLNRGLSRRDALRMLGVAGVVAAG
FT                   STSLFGAAGKVFADDADAPVKGKPGGRIRVAGMSSSTADTLDPAKGALSTDYVRHFMFY
FT                   NGLTRFDSHLVPHMELAEKIESDNATVWTVTLRQGVTFHNGKALTAGDVVFSLSRHKDP
FT                   ATGSKVLPLMAQFSEIKATGPLEVQITLSSPNAELPSILAVSHLLIVPEGTTDFSKGIG
FT                   TGPFTVKEFNPGVRSVSARNPNYWKPGLPYLDEIEFIAIADEPSRVNALLSGDVHMINE
FT                   VNPRSTTRIAASAKHRVVDAPSGNYTDLIIRQDQMPGKSPEFTEAMKYLLDREQVKSAV
FT                   FRGYARVGNDHPISPGSRYFNADLPQRAYDPEKAKFLLKKAGMEKITMAVAASPAATGS
FT                   VDIAVLLQQSAKQAGLTLNVNRLPSDGYWSNHWMKHPLSFGNINPRPNADVIFSQFFQS
FT                   TAPWNESGWKNDQFDQLLLLARGETDDAKRGKMYGDMQALVSQNCGIGIPVFISNIDGV
FT                   DKRIQGYSSNPLGGFMGYMFSEQVWLDA"
FT   gene            complement(172214..173509)
FT                   /locus_tag="Psyr_0158"
FT   CDS_pept        complement(172214..173509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0158"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35231"
FT                   /db_xref="GOA:Q500E1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35231.1"
FT                   /translation="MSDKGNEMRSESYWLDTAPGFTGAQDGAVEGQADVVVVGGGFTGL
FT                   AAARALALKGASVVVLEAGRVIGEASGRNGGQCNTGVAQDYASLSATLGADQAREYYKA
FT                   YESAVQSVVSVIDEEHIACDIKRNGKLKLAAKPGHYEGLARTCELIRREVDADVELLSA
FT                   QDLRAEIDSNEFHGGLLQRNGVQMHVGRFGVGLADAAVRHGARVYQNATVKDWKANRGG
FT                   FVVNTSKGSIQAGQLLLATGACQHGGLGWYRRRIVPVGSFVIVTEVLPQALIDQLFPHQ
FT                   RAYVTSRLIGNYFRLTPDNRLLFGGRARFAMSNSSSDAKSGKVLQAAMVQMFPQLAHVK
FT                   VDYCWGGLVDMTSDRLPRAGEHNGVFYSMGYSGHGVQMSVHMGRMMAEVMEGKAQANPW
FT                   KDLSWPAIPGHFGKPWFLPLVGAYYRYQDSRH"
FT   gene            complement(173555..174223)
FT                   /locus_tag="Psyr_0159"
FT   CDS_pept        complement(173555..174223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0159"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35232"
FT                   /db_xref="GOA:Q500E0"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35232.1"
FT                   /translation="MSFLRPKFITFDCYGTLTNFHMGTMTRELFADRVAAEQMDQFVKD
FT                   FSAYRLDQVMGDWMPYDEILKVALARTCKRWNVEYREEGQLYYDAVPTWGPHADVPAGL
FT                   SKIADKIPLVIFSNASDSQIMSNVEKLGAPFHKVFTAEQAQAYKPRLAAFEFMLDNLGC
FT                   GPEDILHVSSSFRYDLFSAHDMKIRNKAFVARGHEQPANSSFEYHQIPDIGGLAGLVGL
FT                   "
FT   gene            174758..175615
FT                   /locus_tag="Psyr_0160"
FT   CDS_pept        174758..175615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0160"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35233"
FT                   /db_xref="GOA:Q500D9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35233.1"
FT                   /translation="MLAQQRPDFEFRPMTVADVGNAHELSIALKWPHRLEDWAMLQRVA
FT                   QGFVAVHNGRLIGSAFACHQGEFSTIGLVIVSDDYQGKGIGRKLMELAVGCVAPRTAVL
FT                   NATLAGAPLYAKMGFVSFGEIQQRQGQAQPTGITELKLQERCRGLSEADHPRVLELANA
FT                   GSGMDRSVTLGDVLNNLEHAVGIERDGQLQAFALLRPFGRGLCIGPVVAQSVDQARHMI
FT                   EQLLARVPYAFVRIDIPTDSGLADWLEEAGLKRVDSVTCMSMGAVPQASQGVRQFALIT
FT                   QAIG"
FT   gene            175914..176627
FT                   /locus_tag="Psyr_0161"
FT   CDS_pept        175914..176627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0161"
FT                   /product="Protein of unknown function DUF861"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35234"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35234.1"
FT                   /translation="MPRPTVLLLARADLSPVDTEFTTGPIDAHDPFDNDRRTAFIDGQG
FT                   IAAGLVHFGTSLSVAAYPYTEMLVMHRGSVTLTSGTESLTIKTGESAVIGRGTQVRIDA
FT                   QPDSLWAFCASTQASGPDKPGITALDRLAMLTPSSPPDPAIMISALPQCRSNNLFEDSA
FT                   STLRIGVWDSTPYERISRPHKIHELMNLIEGSVELSLENGPSLTVNTGDTVFVAQGAPC
FT                   KWTSTAYVRKFYAVT"
FT   gene            177069..177518
FT                   /locus_tag="Psyr_0162"
FT   CDS_pept        177069..177518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35235"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35235.1"
FT                   /translation="MKTKSVLLTSLALATLCATVVAHAGPPVTVTFKNLGTEVAKHKPV
FT                   TRNELSTLRNARTAIGSTVQPGDSNFYTVQSTLSPDASYASVRYVMGSKVCAFSTTFVR
FT                   LAGAGGVKVPKWNRTATPEGGAICTATSRVTNLSTHAWTAEFTMK"
FT   sig_peptide     177069..177143
FT                   /locus_tag="Psyr_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 25"
FT   misc_feature    177087..177155
FT                   /locus_tag="Psyr_0162"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            177649..178356
FT                   /locus_tag="Psyr_0163"
FT   CDS_pept        177649..178356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35236"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35236.1"
FT                   /translation="MFDISHITALTSSPTLTTVAKEVSPTSSTSAISKLFSERAADSAT
FT                   LSTLSSQLNSSAMRAQIRDSRLGFKELGAVATSINDKIAGTHYYANRALHDAEVPDTDD
FT                   PALLERARQATLFKNGGGANPFSGLSQDQLKLIMYDEGGEFTINERSAASSENHLQQEA
FT                   WNRAMGKRYVDEYNETGKSTQTLVMLLAHYDQLPPIEKAQYPAHYAANITSGDSSAMDI
FT                   FAALKSPPITLEA"
FT   gene            178366..179082
FT                   /locus_tag="Psyr_0164"
FT   CDS_pept        178366..179082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35237"
FT                   /db_xref="GOA:Q500D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35237.1"
FT                   /translation="MRGGHKVRDHLSVDEEDALARAPLRTSRSASTFHRNVLVALIVVV
FT                   LCGYGLFHYIHQSKTADATPATPATPAMPPAAVAEAPVLAPPPLPQVSTPPQSLAECMG
FT                   PDNLIDEAVADCRFGKSHKTVPRSTAQGMVSAQYMSQYKARQPIRHRNYAMAQFVDSAV
FT                   VWQWDRKRTYRAEWVVDDDQIDGTSVCRNWRRGSIEYRECRKGAKVYFKEQCKRSAESA
FT                   TRQRYCSAASGFNPLG"
FT   misc_feature    178462..178530
FT                   /locus_tag="Psyr_0164"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(179100..179543)
FT                   /locus_tag="Psyr_0165"
FT   CDS_pept        complement(179100..179543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0165"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35238"
FT                   /db_xref="GOA:Q500D4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35238.1"
FT                   /translation="MILPIQREEFGIPITAEDQPDLKAIPDFYQTGTGDFWVAVQDDQV
FT                   IGSIGLRDIGAGQAALRKMFVAAPFRGREFSVAARLLERLIEESTRKGVSEVFLGTTDK
FT                   FHAAHRFYEKHGFREITKEDLPASFPLIAVDSKFYVLGLGSEQ"
FT   gene            180107..181417
FT                   /locus_tag="Psyr_0166"
FT   CDS_pept        180107..181417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35239"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35239.1"
FT                   /translation="MVMAKVRKIPYYTMERSIFRGKVWKENDGLDGAVPINTPQKISYN
FT                   RCAPGQVFLKSAEPGEEQFMVPQTEAGGQKSTAGVRKNKPFSVESKTSVSDALEADAED
FT                   KEKLPEFDLQDIPLAMDNIGWPIAAKIARQWFASPKHIYNDRPNSIQPIDDATLTLKWA
FT                   LKYGSVAEKFNELIEEKIYSEKAIAGARHKILKRVKNKFDESRSAANLSFDTAPWIGDI
FT                   RQFHIDWQIQFQAISTSNTLDGLSLTDLTATLGSFNIYAAIGVVEVAVEKFYKYDDQAR
FT                   TKTFCVDATAAITCVYTYLKDNYSFNDKNDGSSQYLGHWNKNDMILSYSAVVSDLVDGK
FT                   KIHTRMGSTPITETKINWDYLPGGQLDKPVDKRTGLVRKFMEKDVYWPVYNSSYSEWRE
FT                   KHGRGGDFMIYSRPKIHKLKKPIIIKLDTLCKPSEPM"
FT   gene            181423..181845
FT                   /locus_tag="Psyr_0167"
FT   CDS_pept        181423..181845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35240"
FT                   /db_xref="GOA:Q500D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35240.1"
FT                   /translation="MYFRSFFFFIFMLIALVVYSIAFNLFDNTDCERYNHTEALDGGAK
FT                   SFGSKGFVITVCGAGVNNSLFNGDGMERVRLTIFDNQGELLARRYYKVFWDGQPGHEPL
FT                   KVSKKSIIYQDDKEQKDHVITMPPTRLEWIRARLPL"
FT   regulatory      182170..182186
FT                   /note="4892-><-146, 100% conf. Stem=6 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(182170..182186)
FT                   /note="4892-><-146, 100% conf. Stem=6 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(182216..183760)
FT                   /locus_tag="Psyr_0168"
FT   CDS_pept        complement(182216..183760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0168"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35241"
FT                   /db_xref="GOA:Q500D1"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500D1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35241.1"
FT                   /translation="MTQTNNAVYTDLSTDELVKEALARKEGVLSDTGALVVETGHRTGR
FT                   SPVDRFIVEEPSTQDAIAWGPINRKFPAEKFDALWNRVGAYLAERERFVSHVHVGSDPA
FT                   HYLPVKMTTETAWHNLFGRCLFINPEQYNPAGKDEWEIQNAPWFVCDPERDGTNSDGTV
FT                   IINFAARKVLIAGMRYAGEMKKAMFSVQNFLLPASDVLPMHCAANMGEEGDVTLFFGLS
FT                   GTGKTTLSADESRYLIGDDEHGWGEGVVFNIEGGCYAKCIDLSEKNEPVIWKAIQHGAV
FT                   LENVVLDPVTKKADYADSSLTQNSRAAYPRELIEKRAPKNLGGEPNAVIFLTCDLTGVL
FT                   PPVSILSEEQAAYHFLSGYTALVGSTEMGSGSGIKSTFSTCFGAPFFPRPAGEYAELLI
FT                   KRIRGFKSKVYLVNTGWTGGGYGVGKRFNIPTTRGVIAAIQSGALIGAETEHLDTINLD
FT                   VPKSVPGVDTGLLNPRNTWADKAAYDEAAKALAGLFVENFKKFDVSDAIKAAGPKL"
FT   gene            complement(183940..184842)
FT                   /locus_tag="Psyr_0169"
FT   CDS_pept        complement(183940..184842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0169"
FT                   /product="Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35242"
FT                   /db_xref="GOA:Q500D0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500D0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35242.1"
FT                   /translation="MHDFPNIDFTQRFIFDESDVRGELVALERSYAEVLAKHPYPEPVA
FT                   QLLGELMAAAALLVGTLKFDGLLILQARSSGAVPLLMVECSSERELRGIARYDEALVTA
FT                   GAGLQDLMPDGSLALTIDPNKGKRYQGIVALDGVDLSESLSNYFVMSEQLGTRFWLKAD
FT                   GHRARGLLLQQLPIAQITDPEERDASWEHVITLANTLTAEEMLGLDNQTILHRLYHEDP
FT                   VRLFDEQPICFRCSCSRERSANALASLGLEDAQQLVIEHNGTIEIDCQFCNQRYLFDAT
FT                   DVAQLFAGGGVDSPSDTRH"
FT   gene            complement(185020..185427)
FT                   /locus_tag="Psyr_0170"
FT   CDS_pept        complement(185020..185427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0170"
FT                   /product="heat shock protein Hsp15"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35243"
FT                   /db_xref="GOA:Q500C9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35243.1"
FT                   /translation="MAQKMEEDDKVRLDKWLWAARFFKTRALAKAAIESGKVHCRGERC
FT                   KPGKEPRVGDEFQIRMGFDDRTVVVEALSIVRRGAPEAQTLYHETPESIARRENAAAQR
FT                   KAGNLGVTTDGKPTKKQRRELFGFRASQNND"
FT   gene            185595..186377
FT                   /locus_tag="Psyr_0171"
FT   CDS_pept        185595..186377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0171"
FT                   /product="EAL"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35244"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35244.1"
FT                   /translation="MTDFPTSLTAPKKGCEGCTGSPELGFSFDYAYQPIVNLHDQSIFA
FT                   HEALVRGPNGEGAMSVLSQVTDQNRYRFDQTCRTTAIAGAAKLGMTERLSINFLPNAVY
FT                   RPELCIRSTLEAAKRHDFPIERLIFETIESEHVCSKGHLSNILREYREFGFMTAIDDFG
FT                   AGYSGLTLLADFQPDLIKLDMNLVRDVHRNRARQAIVRAVVTMCSDLGIKVIAEGIEHI
FT                   EERDFLADCGISLMQGYLFAKPAFKALAQVAPEAWQKS"
FT   gene            186394..186870
FT                   /locus_tag="Psyr_0172"
FT   CDS_pept        186394..186870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0172"
FT                   /product="Protein of unknown function DUF785"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35245"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35245.1"
FT                   /translation="MKTFDHLTVIGLREWVALPDLGVAGLRAKIDTGASTSSLHATEIE
FT                   PFERNGQKWVRFNAHLGTVVQLRHRRCEAQLVAMKTIKSSNGQAQVRYVIRTTLALGDR
FT                   IWPVEFTLACRKSMRYRLLLGSKALIDGQLVVNPGITYVQDKPVFPASTSSGVA"
FT   gene            186867..187772
FT                   /locus_tag="Psyr_0173"
FT   CDS_pept        186867..187772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0173"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35246"
FT                   /db_xref="GOA:Q500C6"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35246.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGIERGHEMVVIDTLRAYMNIASHK
FT                   PQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSL
FT                   QLLSRRGIGLPVTGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETATAAESV
FT                   IEAFMGLKQDIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGGSASL
FT                   IKITPEERMTALRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTSKDVAGM
FT                   IIGYLEKNSGPHMTRTKGKG"
FT   gene            188229..189560
FT                   /locus_tag="Psyr_0174"
FT   CDS_pept        188229..189560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0174"
FT                   /product="Sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35247"
FT                   /db_xref="GOA:Q500C5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35247.1"
FT                   /translation="MKKAKLSLAWQILIGLVLGIAVGALLNHFSAEKAWWITNILQPAG
FT                   DIFIRLIKMIVIPIVVASLIVGIAGVGDAKKLGRIGLKTILYFEVVTTIAILVGLVLAN
FT                   VFHPGTGIDMSTLGTVDISKYQQTTAEVQHDHAFIATILNLIPSNIFAAMARGEMLPII
FT                   FFSVLFGLGLSSLQAEVREPLVKLFQGVSETMFKVTHMIMNYAPIGVFALIAVTVANFG
FT                   FASLLPLAKLVILVYVAIAFFAFVVLGLIARAFGFSVIRLMRIFKDELILSYSTASSET
FT                   VLPRVIQKMEAYGAPKAICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIGAQL
FT                   MLVLTLMVTSKGIAGVPGVSFVVLLATLGSAGIPLEGLAFIAGVDRIMDMARTALNVIG
FT                   NALAVLVISRWEGMYDDAKGERYWNSLPHWRSKEPVPMGQPTAD"
FT   sig_peptide     188229..188300
FT                   /locus_tag="Psyr_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.446 at
FT                   residue 24"
FT   misc_feature    188247..188315
FT                   /locus_tag="Psyr_0174"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    188373..188441
FT                   /locus_tag="Psyr_0174"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    188478..188546
FT                   /locus_tag="Psyr_0174"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    188703..188756
FT                   /locus_tag="Psyr_0174"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    188832..188900
FT                   /locus_tag="Psyr_0174"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    188928..188996
FT                   /locus_tag="Psyr_0174"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    189201..189269
FT                   /locus_tag="Psyr_0174"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    189312..189380
FT                   /locus_tag="Psyr_0174"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   regulatory      189578..189601
FT                   /note="152-->153, 98% conf. Stem=10 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            189651..189926
FT                   /locus_tag="Psyr_0175"
FT   CDS_pept        189651..189926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35248"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35248.1"
FT                   /translation="MTDDIDNDEEDFAASTLIEAIENQIEAGNPPAARAVFNMLTLVNY
FT                   EREDILEMMAHVLAIEIDALLEQDRPFDTQWYEAALRALPDLPPEN"
FT   gene            190143..190391
FT                   /locus_tag="Psyr_0176"
FT   CDS_pept        190143..190391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35249"
FT                   /db_xref="InterPro:IPR013468"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35249.1"
FT                   /translation="MSYTPELVAELEILALFNLGNTQEGLKVHHVAAPTAVAAAQRLFD
FT                   KGLTTQVDGGYLTSLGLEAAQHAQSLLTILNVSRQAA"
FT   gene            190574..193420
FT                   /locus_tag="Psyr_0177"
FT   CDS_pept        190574..193420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0177"
FT                   /product="adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35250"
FT                   /db_xref="GOA:Q500C2"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35250.1"
FT                   /translation="MTRNPEIRPDLDEGIDRKVLSQLRNRFLSLNDGRYARALEGMSTR
FT                   QQSVLTLLPLFFHVNHPLLPGYVSGSTPAGVSHYEPDTLALVEAQRLTRSFSYKARHGN
FT                   PPQPIHGLFLMGSLGTLAQAEQSDMDVWVCHDSELEPEAIAELRKKCQALEAWAATMGA
FT                   EAHFFLIDPQRFKSGERDSQLSSDDCGTTQHYLLLDEFYRTAIWLAGRTPMWWLVPVYE
FT                   EQNYEDYTHTLLSKRFIRASEVLDLGPMSHIPPAEFIGAGLWQLFKGIESPYKSVLKLL
FT                   LIEVYSSEHPRVQCLSLRFKQAVFANQLDPDELDPYVVVYRRIEEHLQARNEPERLELV
FT                   RRSLYLKVNKKLTGSTRQRNVGWQRQLLERLATEWGWDERQLALLDSRNQWKVRQVASE
FT                   RRALVNELNYSYRFQSRFAKTQSTADALNTRDLTILGRRLYAAFERKAGKVEFINPGIA
FT                   PDLAEDTLTLVHSPDKREPGKHQWALYNGNLGIHEWPNFSPLKRSRELLELLTWCHRNT
FT                   VIDSTTRVALHPGASDLSEFELFNLMGALQQSIQLPLPEVSDEALLMPSTPSEILLLIN
FT                   VGVDPLSHHRDLNILMTTERTDSLSYAGVRENLVLTLDQITLNTWNETLVSRYDGPHAL
FT                   LDCMSELLGSLPQRGKQPQIHVRCFCHNRAPAIAQRVEELIGTARLLLERRLNHRYLIQ
FT                   VQQQYHVLEMKPGQIGHVVVNSLPGLFKYLGEELSSYSPLHLDPQALDDHDLALILPLG
FT                   QPECIQVFYRVNEPDADLYVLDEHNSLWHQRLPYHDEQSLLVPLQRFLHALVYRRGASL
FT                   PLDDPSAPVTLETLYYQMLPSGAGPARRVEHRPAPTAADKAFYDVQAIIEETSPGQLNA
FT                   TLYCDNSEFSELEYGDRLYAAVAQQILGKRLELQRYRCYITDLDLSGLLDGKHGQSILF
FT                   LRHKAELEKLLNEAMDQA"
FT   gene            complement(193552..193959)
FT                   /locus_tag="Psyr_0178"
FT   CDS_pept        complement(193552..193959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0178"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35251"
FT                   /db_xref="GOA:Q500C1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35251.1"
FT                   /translation="MTTAPSIILTRLDVQRLEKFIADQNEDTPGIQALQAELDRADQVV
FT                   GHDEVPAGVVTMNSRVHCREEVSGKDYHLKLVYPQDAGADGTVSVLAPMGSALLGLQIG
FT                   QHIDWPAPGGKTLKLTLLAVEYQPEAAGEYE"
FT   regulatory      complement(194001..194018)
FT                   /note="156<--157, 99% conf. Stem=7 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(194094..194330)
FT                   /locus_tag="Psyr_0179"
FT   CDS_pept        complement(194094..194330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0179"
FT                   /product="Protein of unknown function DUF1289"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35252"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35252.1"
FT                   /translation="MSQSPVRPPKPLFSNVSPAVASPCISLCRLDEQKVCLGCFRHVED
FT                   IREWRSADDDRRRQIRHEADQRRARAEVDQAAG"
FT   gene            complement(194333..194665)
FT                   /locus_tag="Psyr_0180"
FT   CDS_pept        complement(194333..194665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0180"
FT                   /product="Frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35253"
FT                   /db_xref="GOA:Q500B9"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500B9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35253.1"
FT                   /translation="MSLTEARFHDLVDATQQNIEDVFDDSGLDVDLENSAGVLTVKFEG
FT                   GTQLIFSRQEPLRQLWLAARSGGFHFDYDEENQCWACDSSDELLSEMLERFTVEQAGVE
FT                   LDFSEI"
FT   gene            194904..195050
FT                   /locus_tag="Psyr_0181"
FT   CDS_pept        194904..195050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0181"
FT                   /product="lipoprotein LppL"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35254"
FT                   /db_xref="InterPro:IPR017254"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:Q500B8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35254.1"
FT                   /translation="MKRLISSLAALVAVACLVTACGQKGPLYLPDDTKTPDEQAKSQSH
FT                   KHL"
FT   sig_peptide     194904..194966
FT                   /locus_tag="Psyr_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.740 at
FT                   residue 21"
FT   misc_feature    194922..194990
FT                   /locus_tag="Psyr_0181"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            195060..196307
FT                   /locus_tag="Psyr_0182"
FT   CDS_pept        195060..196307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0182"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35255"
FT                   /db_xref="GOA:Q500B7"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q500B7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35255.1"
FT                   /translation="MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYA
FT                   DALSGMPHMVCFAVKANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGV
FT                   GKTREDMRRALEVGVHCFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYIS
FT                   TGLKENKFGIAIAAAEDVYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLALVD
FT                   RLGDCGIHLHHIDLGGGLGVRYRDEEPPLAADYIKAVRERLAGRDLGLLFEPGRFIVAN
FT                   AGALLTRVEYLKHTEHKDFAIVDAAMNDLIRPALYQAWMDVTAVRPRDSEPRAYDIVGP
FT                   ICETGDFLAKGRELALAEGDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRR
FT                   RETVAELFAGESLLPE"
FT   gene            196313..197143
FT                   /locus_tag="Psyr_0183"
FT   CDS_pept        196313..197143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0183"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35256"
FT                   /db_xref="GOA:Q500B6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500B6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35256.1"
FT                   /translation="MLLRFTKMHGLGNDFMVLDLVSQHAHILPKHAKQWGDRHTGIGFD
FT                   QLLLVEAPNNPDVDFRYRIFNSDGSEVEQCGNGARCFARFVLDKRLTAKKQIRVETKSG
FT                   IIELDIRSDGQISVDMGPPRFVPEEIPFEAAEQATCYTVDVDGQHVDMAAVSMGNPHAV
FT                   LRVDDINNAPVHELGPKIEHHPRFPARVNVGFLHVVDRQRAQLRVWERGAGETQACGTG
FT                   ACAAAVAAISQGWMDSPLLIDLPGGRLSIEWAGPGHSVMMTGPAVRVYEGQVRL"
FT   gene            197157..197891
FT                   /locus_tag="Psyr_0184"
FT   CDS_pept        197157..197891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0184"
FT                   /product="Protein of unknown function DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35257"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q500B5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35257.1"
FT                   /translation="MTDQPPASTGTPCESPVDSAAPDLEAEAVIAFLLEHPDFFAEHDE
FT                   LLVSMRIPHQRGDTVSLVERQLKLLRERNIEMRHRLSQLMDVARDNDRLFEKTRRLNLA
FT                   LMDATSLEELVIAVEDSLRQDFQVPFVSLILFSDSPMPVGRWVSGADAQKAIGGLIGEK
FT                   IICGALREHELAFLFGAEQGKEVGSTAIASLNHLGLHGVLAIGSRDPQHYKSSVGTLFL
FT                   SYIADVLSRLLPRFAHSLRSVR"
FT   gene            197894..198793
FT                   /locus_tag="Psyr_0185"
FT   CDS_pept        197894..198793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0185"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35258"
FT                   /db_xref="GOA:Q500B4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35258.1"
FT                   /translation="MDQHLDAYCMHLRSERQVSPHTLEAYRRDLGKVLAYCQKAQVSSW
FT                   SDLDIQHLRSFTARQHQQGQSSRSLARMLSAVRGFYKYLNREGICQHDPANGLSPPKGE
FT                   RRLPKTLDTDRAAQLLDGGVEDDFLAHRDQAILELLYSSGLRLSELTGLNLDQLDLRDG
FT                   LVQVLGKGSKTRVLPVGSKARQALEVWLPLRALTNPQDDAVFVSQQGKRLGPRAIQVRL
FT                   KAAGERELGQNLHPHMLRHSFASHLLESSQDLRAVQELLGHADIKTTQIYTHLDFQHLA
FT                   TVYDSAHPRAKRKGTADD"
FT   gene            198786..199478
FT                   /locus_tag="Psyr_0186"
FT   CDS_pept        198786..199478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0186"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3:HAD-superfamily hydrolase, subfamily IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35259"
FT                   /db_xref="GOA:Q500B3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q500B3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35259.1"
FT                   /translation="MIKLVTFDLDDTLWDTAPAIAGAEVTLRDWLGEHAPRLGAVPVEH
FT                   LWEIRSRLVAEDPSFKHRISALRRRVLFHALEDAGYDPDEAQDLADRGFEVFLQGRHQV
FT                   QIFPEVQPMLEILAKTFTLGVITNGNADVRRLGLADYFAFALCAEDLGIGKPDPAPFVE
FT                   ALRRAKVDAGAAVHVGDHPKDDIAGAQQAGMRAIWYNPQGKAWDADRLPDAEIHNLSQL
FT                   PEVLARWA"
FT   regulatory      199507..199525
FT                   /note="163-><-164, 100% conf. Stem=8 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(199507..199525)
FT                   /note="163-><-164, 100% conf. Stem=8 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(199549..199875)
FT                   /locus_tag="Psyr_0187"
FT   CDS_pept        complement(199549..199875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35260"
FT                   /db_xref="UniProtKB/TrEMBL:Q500B2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35260.1"
FT                   /translation="MSDDDDIKDDLEDDLEGEEDGEELAAAPGDDPVEVDDDVPAPAAK
FT                   GKAKAAVSVDELPSVEAKNKERDALARAMEEFLARGGKVQEVEANVVADPPKKPDNKYG
FT                   SRPI"
FT   gene            complement(199974..200399)
FT                   /locus_tag="Psyr_0188"
FT   CDS_pept        complement(199974..200399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0188"
FT                   /product="Protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35261"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q500B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35261.1"
FT                   /translation="MWHQSRIALRARPRGFHLVTDEIVAGLPPLRGCRVGLLHVWLQHT
FT                   SASLTVNENADPAVRRDFERFFNRLVPQGVDGYEHDDEGPDDLPAHFKASLLGCQLLLP
FT                   VTAGRLALGTWQGIYLGEHRDAGGSRNVLATLQGEWT"
FT   regulatory      200603..200617
FT                   /note="4894-><-166, 100% conf. Stem=6 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(200603..200617)
FT                   /note="4894-><-166, 100% conf. Stem=6 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(200642..201979)
FT                   /locus_tag="Psyr_0189"
FT   CDS_pept        complement(200642..201979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0189"
FT                   /product="ammonium transporter"
FT                   /note="TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35262"
FT                   /db_xref="GOA:Q500B0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q500B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35262.1"
FT                   /translation="MTLRQFAGLGALLSLALPGLALAADPVAEPVLNSGDTAWMLTSTA
FT                   LVLFMTIPGLALFYGGMVRSKNILSVMMQCFAITGLISILWVVYGYSIAFDTTGMEAGV
FT                   VNFNSFFGGMGKAFLAGITPASITGPAALFPEAVFVTFQMTFAIITPALIVGAFAERMK
FT                   FSAMLVFMGIWFTLVYAPIAHMVWGGVGGLLWDWGVLDFAGGTVVHINAGVAGLVACLV
FT                   LGKRKGFPTTPMAPHNLGYTLIGAAMLWVGWFGFNAGSAAAANGTAGMAMLVTQIATAA
FT                   AALGWMFAEWLTHGKPSALGIASGVVAGLVAVTPAAGTVGPMGALIIGLAAGVICFFCA
FT                   TSLKRKLGYDDSLDAFGVHGIGGIVGAILTGVFAAPALGGFGTVTDIGAQVWIQFKGVA
FT                   FTVVYTAIVTFIILKVLDAVMGLRVTDEEESVGLDLAQHNERGYNL"
FT   misc_feature    complement(200741..200806)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(200846..200911)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(200951..201016)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(201029..201079)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(201116..201181)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(201212..201268)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(201308..201373)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(201419..201484)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(201506..201562)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(201710..201775)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(201797..201862)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(201908..201979)
FT                   /locus_tag="Psyr_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   misc_feature    complement(201908..201958)
FT                   /locus_tag="Psyr_0189"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(202013..202351)
FT                   /locus_tag="Psyr_0190"
FT   CDS_pept        complement(202013..202351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0190"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35263"
FT                   /db_xref="GOA:Q500A9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35263.1"
FT                   /translation="MKLVTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIDVAIDDKDLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRT
FT                   GETDTDAI"
FT   gene            202769..203044
FT                   /locus_tag="Psyr_0191"
FT   CDS_pept        202769..203044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0191"
FT                   /product="Protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35264"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35264.1"
FT                   /translation="MLAPKAFLDALSGHASRLFNGETPVSRNEFETQFKALLQSGFSKL
FT                   DLVSREEFDSQMAVLARTRARLEALEAKMAELEEKAGGAAGTEKAE"
FT   gene            203272..203901
FT                   /locus_tag="Psyr_0192"
FT   CDS_pept        203272..203901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35265"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35265.1"
FT                   /translation="MDGSMTDKRPLIHCSLAATLWLCVGTSVFAQDTALHSGKYEQLML
FT                   AVTPDHQVEGYYSETRGEAFSCAFYLQGKVEAGKGAAVSSWLDDVYPGTLKASADGVVL
FT                   TIGQGRQHPGCMNVLAPDIATGLDLTRTASRQWVGLVTVTADKAWLQKTPNAKATRGAY
FT                   IVKDDVVGVLAFKDGAAQVELINADDRSFTGWISQDQYARLAAPGR"
FT   sig_peptide     203272..203364
FT                   /locus_tag="Psyr_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            complement(203917..204834)
FT                   /locus_tag="Psyr_0193"
FT   CDS_pept        complement(203917..204834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0193"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35266"
FT                   /db_xref="GOA:Q500A6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35266.1"
FT                   /translation="MDTQNAASAPGTDVCRSEIIRLLMQRFAAPGVYETAIAPLHVIRC
FT                   DAPSELIHALHRPALCVIVQGRKEVALGDEQYVYDPLNYLIVAVTVPVAGRVLEASGEA
FT                   PYLCIRLDFEPAHIAQFIAETPLNGVPDEPQRGLFLEQMDQPLLETVLRLVRLLDTPRD
FT                   IAMLAPLALRELYYRLLRGNNGRRLYEIAVGDSQTHRVTRAVDWLNSHYTEPLRIDELA
FT                   RLANLGNSTLHHRFKALTAMSPLQYQKKLRLQEARRLIINEGLDASSACYRVGYESPSQ
FT                   FSREYSRQFGCPPSTDLSRVRQIG"
FT   gene            205070..205804
FT                   /locus_tag="Psyr_0194"
FT   CDS_pept        205070..205804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0194"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35267"
FT                   /db_xref="GOA:Q500A5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35267.1"
FT                   /translation="MSNIQGKVVLITGASSGIGEAAARLIAAKGAHVVLGARRSERLQT
FT                   LAADIEAQGGSARFRALDVTDALDMQAFADFATHEFGKIDVIINNAGVMPLSPLAALKI
FT                   AEWNQMLDVNVRGVLHGIAAVLPSMQAQGHGQIINISSIGGLAVSPTAAVYCATKFAVR
FT                   AISDGLRQETDKIRVTVVCPGVVESELADSISDETAREAMKAFRKVALEPDAIARALVY
FT                   AIEQPDGVDVSEIVVRPTGSAY"
FT   gene            complement(205820..206563)
FT                   /locus_tag="Psyr_0195"
FT   CDS_pept        complement(205820..206563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35268"
FT                   /db_xref="GOA:Q500A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35268.1"
FT                   /translation="MTTSPTHPIATKKLKGITSESEAFGITKQYPNGKEILSWSIKTIA
FT                   RPSKEIFFAEMAIISIYAAMLSFGLWAGWSFYSKNPVQAIYILASASGGAIYFIVLGVR
FT                   QKTIYNYTIKTNHALVEYHLHYPDFASSLFKGIAIAVILIFVFVALFTGSLLFLIGPVA
FT                   MAFIAAIKLLNWENPIHHEQSLPWAEYNFVTVDRKRLMIVTHRTDVTLGFEARFQHEVL
FT                   FNKYLAFLRGALPPTAEFTERAWKW"
FT   misc_feature    complement(206087..206152)
FT                   /locus_tag="Psyr_0195"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(206255..206311)
FT                   /locus_tag="Psyr_0195"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(206342..206407)
FT                   /locus_tag="Psyr_0195"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(206567..209947)
FT                   /locus_tag="Psyr_0196"
FT   CDS_pept        complement(206567..209947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35269"
FT                   /db_xref="GOA:Q500A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35269.1"
FT                   /translation="MTDKSGTHTQRRAATFAKTPATATSLCPFRGPDIAIVPVRYALDR
FT                   SRYDAAPEKLKPLLKGSRWAVMPKLKTRSYTLRQLYDGYVYVYDETAGTFHEYFSSAAN
FT                   GHLSRIIWTDAQIGSDRRSGADDGKPFLLYPRNNRLHIAFSAQQWTWRICEHLRSNPAS
FT                   RASWMKALDLKRYCMTMAEPDTLPLNRIAEAVADIDKEHVVDDDRFADSAIPTSKASSE
FT                   EADPLFSPIGADVFWQGSVEDQDSSLLIALDDPLAIFNDLGMQLAADQAAYRNWQAEHE
FT                   HKIQIAQTVTALCGAEGEPEKLPASVRGNAALTHQYLSEVEAYFEQCMFEQEQIGNNTA
FT                   PGGVLLLPDIFKSPQMRRSLEMRYGSAPSDEALQAWKDRHKWRREVDLSGARQYLQQHL
FT                   PTGDTLLQQVQDTQSDFRQWSTHLGTEPLKLFVDTSHPESLLYLQTVMLNLQIIYAQDN
FT                   AASAWLAEQEANDSSLFGTLRYGFSPALKHALHQEANALLNGLGDITNLATRIGELNGT
FT                   LNHQGFADKPWMKALKQPVQDTFKALGQLASDAGKATFESILLAWVPIDSRLAVGKQQN
FT                   IVALIRTLLIGQILLDSKARIAIDHNMLAKLKTWISEWQVLNKQISDTRRSWLYPTAYN
FT                   PRKSIASHLRVLEEKLRLHELSMPALLDFQNNQYARQLQDEIRLHVQSGKAITKEWLTS
FT                   ARRWLDGLGGIAGSITWGVIMLNFINTAFTYRDLTRDGDFSAKDLGKVTYGLGYSFNLL
FT                   MAVFVEAPWAVIRDATPVLIDGKNVGILDRSAGYWRAKGNLVWGDAIRGFRVSMVAMGA
FT                   FGVAAAVLEVLDIQDDLSRVNTSEEIIAMQLKFASVLMMGAGSAIQLIAGIFPTTPLTA
FT                   VAMSPWFSITLLLIGTVYLFATTALNYFKQDSVGWWLRRCCWSRSIEYRYSTDAGGQHA
FT                   EKLDLLTIQLSPQVHVKITTRLESRYLGKGDYYSTAVQDGAGVQLLFPSAVRAQSVHFN
FT                   IISSKRPWGVLPVEKIDSPINESFLNRGQFRQAGQFGTLGNKAARNAHEDFTFPLMPHE
FT                   SEDLIWETWIPLEAEATYLELQIWYPDSLIKPDQQDIGYLYQLKLNREGDTKVDGLITA
FT                   ELEVKALNRSTALTLEVAE"
FT   misc_feature    complement(207251..207316)
FT                   /locus_tag="Psyr_0196"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(207347..207412)
FT                   /locus_tag="Psyr_0196"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(207473..207538)
FT                   /locus_tag="Psyr_0196"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(207650..207715)
FT                   /locus_tag="Psyr_0196"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(207779..207844)
FT                   /locus_tag="Psyr_0196"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            210345..211838
FT                   /locus_tag="Psyr_0197"
FT   CDS_pept        210345..211838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0197"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35270"
FT                   /db_xref="GOA:Q500A2"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35270.1"
FT                   /translation="MSLAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKES
FT                   KDRVRSAILNSGLDFPARRITLNLAPADLPKDGGRFDLAIALGLLAASGQVPLVALQDV
FT                   ECLGELALSGAIRPIQGVLPAALAARAAERTLIIPAVNAEEACLASGLRVIAVSHLLEL
FT                   VAHFNGRTVIAPYQSSGLLHQPKPYPDLSEVQGQTAAKRALVIAAAGAHNLLFSGPPGT
FT                   GKTLLASRLPGLLPPLDEHEALEVAAIQSVASQVPLTSWPQRPFRQPHHSASGPALVGG
FT                   GSRPQPGEITLAHHGVLFLDELPEFDRRVLEVLREPLESGHIVISRARDRVRFPARFQL
FT                   VAAMNPCPCGYLGEPTGRCRCSTEQVQRYRNKLSGPLLDRIDLHLTVAREATALNPDPT
FT                   TSENTASAAAVVAEARDRQQRRQGCANAFLDLPGLREYCALSSVDESWLETACERLTLS
FT                   LRSAHRLLKVARTLADLEQVDAINRSHLAEALQYRPSTN"
FT   regulatory      complement(211857..211886)
FT                   /note="174-><-175, 100% conf. Stem=12 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(211908..213215)
FT                   /locus_tag="Psyr_0198"
FT   CDS_pept        complement(211908..213215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0198"
FT                   /product="Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35271"
FT                   /db_xref="GOA:Q500A1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35271.1"
FT                   /translation="MLTFLGFAMVIAFMYLIMSKRLTALIALILVPIIFALFGGFASQI
FT                   GPMMLAGITKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKMVKGDPMRISVGTAVL
FT                   ALVVSLDGDGATTYMICVAAMLPLYSRIGMSPRIMAGLIILAGGVMNMTPWGGPTARAA
FT                   SALHVDASDIFVPMIPAMLAGVIAILAIAYFYGKRERARLGELHLQGDEVDHSEISVSQ
FT                   FPDARRPKLIWFNAALTLTLMVALIMGLLPLPVLFMIAFSIAMIINYPNLQDQKDRVSA
FT                   HAGSVLAVVGLIFAAGIFTGILSGTGMVDAMSKSLLAVIPDALGPYLAVITALVSMPFT
FT                   FFMSNDAFYYGVLPVLSEAAAHYGISPVEMARASIVGQPVHLLSPLVPSTYLLVALAGI
FT                   EFGDHQRFTLKWAILVCMCILVAALLMGIFPFYSSM"
FT   misc_feature    complement(211917..211982)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(212013..212078)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(212118..212174)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(212205..212270)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(212307..212372)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(212418..212519)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(212631..212696)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(212742..212795)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(212817..212873)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(212994..213059)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(213081..213146)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(213087..213215)
FT                   /locus_tag="Psyr_0198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.430 at
FT                   residue 43"
FT   misc_feature    complement(213159..213209)
FT                   /locus_tag="Psyr_0198"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            213512..213913
FT                   /locus_tag="Psyr_0199"
FT   CDS_pept        213512..213913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0199"
FT                   /product="Glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35272"
FT                   /db_xref="GOA:Q500A0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35272.1"
FT                   /translation="MSEMHSGGCHCGGLRYQFDAPLRDIAHCHCSICRRTSGATVVTWI
FT                   SVPLASFKWLTGSPCAYDSAPSCVRYFCGKCGAHMALFTRNSPNEIDVTIATLDQPELA
FT                   APSRHIWIENRLPWLRLDEHLPGVEGEPF"
FT   gene            complement(213976..215373)
FT                   /locus_tag="Psyr_0200"
FT   CDS_pept        complement(213976..215373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35273"
FT                   /db_xref="GOA:Q4ZZZ9"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014627"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35273.1"
FT                   /translation="MTEVAHVNDPHHAPVVIRQLLEKLAISYNEVVDEKNLPPARKVQA
FT                   VLVEDAVGALLILFPQSQLLDLSRITELTGRQLTAVPHERLARMLTKHNLRVLPGLPAL
FT                   TSSPCLYDERLLQEPTLLVGSGEPGVLLEISSEDFKGMLSKASAAHFGQSVAAIRPNLD
FT                   RPDDDPAEITQAMHAFTARRIQQRLEATLEIPPLAGTAQKIIKLRVDPDATIDDITGVV
FT                   ETDPALAAQVVSWAASPYYASTGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKD
FT                   QPQQTTPYWQQSIYTAAVIEGLTRAIPRASRPEGGLSYLAGLLHNFGYLLLAHVFPPHF
FT                   TLICRQLEVNPHLHHSFIEQHLLGISREQIGAWLMRYWDMPDELAIALRFQHDPHYKGE
FT                   HHVYANLVYLAVRLLRANGIGSGPEQDIPDELFERLGLTREKANESVKKVLEAEVLLRE
FT                   LASQFSK"
FT   gene            complement(215460..217535)
FT                   /locus_tag="Psyr_0201"
FT   CDS_pept        complement(215460..217535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0201"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35274"
FT                   /db_xref="GOA:Q4ZZZ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35274.1"
FT                   /translation="MSELSRVSVTALKGVGEAMAEKLAKVGLETLQDVLFHLPLRYQDR
FT                   TRIVPIGALRPGQDAVIEGVVSGADVVMGKRRSLLVRLGDGTGVVSLRFYHFSNAQKES
FT                   MKRGTHLRCFGEARPGASGLEIYHPEYRAITGDEPAPVEQTLTPIYPTTEGLTQQRLRQ
FT                   LCQQSLAMLGPKSLPDWLPEELARDYQLAPLDDAIRYLHHPPADADVEELALGHHWAQH
FT                   RLAFEELLTHQLSQQRLRESLRSQRAPALPVAKKLPKQFLANLGFAPTGAQQRVGKEVA
FT                   YDLSQPEPMLRLIQGDVGSGKTVVAALAALQALEAGYQVALMAPTEILAEQHYINFQRW
FT                   LEPLGVGVAWLAGKLKGKARVASLEQIAGGTPMVVGTHALFQDEVQFKNLALVIIDEQH
FT                   RFGVQQRLALRKKGVGGLMCPHQLIMTATPIPRTLAMSAYADLDTSILDELPPGRTPVN
FT                   TVLVADSRRLEVVERVRAACAEGRQAYWVCTLIEESEELTCKAAETTYEELSSALGDVR
FT                   VGLIHGRMKPAEKAAIMAEFKQGALQLLVATTVIEVGVDVPNSSLMIIENPERLGLAQL
FT                   HQLRGRVGRGSAVSHCVLLYHPPLSQIGRQRLGIMRETNDGFVIAEKDLELRGPGEMLG
FT                   TRQTGLLQFKVADLMRDADLLPAVRDAAQALLERWPQHVSPLLDRWLRHGQQYGQV"
FT   gene            complement(217547..218470)
FT                   /locus_tag="Psyr_0202"
FT   CDS_pept        complement(217547..218470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0202"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35275"
FT                   /db_xref="GOA:Q4ZZZ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35275.1"
FT                   /translation="MTLTELRYIVTLAQEQHFGHAAERCHVSQPTLSVGVKKLEDELGV
FT                   LIFERSKSAVRLTPVGEGIVAQAQKVLEQAQGIRELAQAGKNQLTAPLKVGAIYTVGPY
FT                   LFPHLIPQLHRVAPQMPLYIEENFTHVLRDKLRNGELDAVIIALPFNEADVLTLPLYDE
FT                   PFSVLMPADHPWTQKETIDASALNDKSLLLLGEGHCFRDQVLEACPTLGKGNEGAKHTT
FT                   VESSSLETIRHMVASGLGISILPLSAVDSHHYAPGVIEVRPLTPPVPFRTVAIAWRASF
FT                   PRPKAIEILADSARLCSVARPKTVAS"
FT   gene            complement(218563..219309)
FT                   /locus_tag="Psyr_0203"
FT   CDS_pept        complement(218563..219309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0203"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35276"
FT                   /db_xref="GOA:Q4ZZZ6"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35276.1"
FT                   /translation="MISTRQKLTRYSGSLLLVLAVHAIAIIVAVRWPAPQPVELPPAAM
FT                   MVELAPVPEPAPPPPPKVVQPPPPPAPEEPTPVPEVVQAPKPEIVVPKKVEKPKPKPQP
FT                   PKPQKKPEPPKEKPADEKPVDTPPTTAQPAKPVAPKPAPAPSPPSNALPNWQGDLLGHL
FT                   SKYKKYPEDARRRGMQGVARLRFVVDADGNVLSYSIANSSGSPALDRATMEMIRRAQPL
FT                   PKPPKEILNNGTIEILAPFVYSLDKR"
FT   misc_feature    complement(219205..219270)
FT                   /locus_tag="Psyr_0203"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(219232..219309)
FT                   /locus_tag="Psyr_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.392 at
FT                   residue 26"
FT   gene            complement(219306..219731)
FT                   /locus_tag="Psyr_0204"
FT   CDS_pept        complement(219306..219731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0204"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35277"
FT                   /db_xref="GOA:Q4ZZZ5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35277.1"
FT                   /translation="MGLHLNEGGDDLAENHEINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   KVDLPASTATPQPRPEKPIFLSVKTDKSLYLGEEKVAREQIGQVLDARTKGKKDTTIFF
FT                   QADKGVDYGDLMEVMNTLRGAGYLKVGLVGLETAGKK"
FT   misc_feature    complement(219606..219671)
FT                   /locus_tag="Psyr_0204"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(219735..220697)
FT                   /locus_tag="Psyr_0205"
FT   CDS_pept        complement(219735..220697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0205"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35278"
FT                   /db_xref="GOA:Q4ZZZ4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014164"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35278.1"
FT                   /translation="MKRIQSIASPTQMPRLPRAWRSIAALVLSLMFVPMALADQSAPTA
FT                   APATSTAPASPAATAPAAPDAAAPVQAMEPATEDNSLGMAHDLSPWGMYQNADVVVKAV
FT                   MIGLAIASIMTWTIWISKGFELLGAKRRLRGEIANLKKARSLTEASATASTEGTLAHLL
FT                   VHDALEEMRLSANSREREGIKERVSFRLERLVAACGRNMSMGTGVLATIGSTAPFVGLF
FT                   GTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGY
FT                   KAQVSDASAHVLLLVSRDLDHLPEPSERNQQQPHMVKVG"
FT   misc_feature    complement(219873..219938)
FT                   /locus_tag="Psyr_0205"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(220011..220076)
FT                   /locus_tag="Psyr_0205"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(220335..220400)
FT                   /locus_tag="Psyr_0205"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(220581..220697)
FT                   /locus_tag="Psyr_0205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 39"
FT   misc_feature    complement(220584..220640)
FT                   /locus_tag="Psyr_0205"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            220906..221754
FT                   /locus_tag="Psyr_0206"
FT   CDS_pept        220906..221754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35279"
FT                   /db_xref="GOA:Q4ZZZ3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35279.1"
FT                   /translation="MTAPSLLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVHG
FT                   VAGDLFETQKPAQWPAAALDYVVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPK
FT                   RLIFVSSSGVYGQQNGEWVDETSATEPGNYTGTVMLEAEQVALNSGLPATAVRLTGIYG
FT                   PGRSDLSNRVRQGHSVRIDPPVYANRIHADDAAGLLEHLLLADQRGVALESCYLGVDDD
FT                   PAALADVVAWIREYLGVTEWSEEVSVQRVGSKRCSNARARALGWAPMYPDFRAGYAALL
FT                   G"
FT   gene            complement(221807..222544)
FT                   /locus_tag="Psyr_0207"
FT   CDS_pept        complement(221807..222544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0207"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35280"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35280.1"
FT                   /translation="MRSALAISLLAVILGGCASHADRNPDGTWINQTAIDAAVKQGNLR
FT                   QALLANGPNLEWKINSKANQAIYSNGFELGEGKIVSAAEGKLHVDFYGNFFEDLSVKGD
FT                   ELVQAASESGPEQHFQKPEDPAPDGAQPGSSFEKALYGAYMGGKWTVVEGDGQGSTVQF
FT                   MPDGSVQGLPENDRYALCLAGDCAAMSGEYDSMWLEKAEKGNPWIFARKGKQLEIFQAV
FT                   NNAGADQMPELRPGPRRWLLEQQ"
FT   sig_peptide     complement(222479..222544)
FT                   /locus_tag="Psyr_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(222599..222979)
FT                   /locus_tag="Psyr_0208"
FT   CDS_pept        complement(222599..222979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0208"
FT                   /product="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35281"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35281.1"
FT                   /translation="MTKTVITSDKAPAAIGPYSQAIKAGNTVYMSGQIPLDPSTMELVE
FT                   GIEAQITQVFENLKSVAEAAGGSFKDIVKLNIFLTDLGHFAKVNELMSTYFTQPYPARA
FT                   AIGVAALPRGAQVEMDAILVIE"
FT   gene            complement(223004..225127)
FT                   /locus_tag="Psyr_0209"
FT   CDS_pept        complement(223004..225127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0209"
FT                   /product="RelA/SpoT protein"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35282"
FT                   /db_xref="GOA:Q4ZZZ0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35282.1"
FT                   /translation="MARGSALPSIDALADRLSAYLGKDQVNLVRRAYFYAEQAHDGQRR
FT                   RSGEAYVTHPLAVANILADMHMDHQSLMAAMLHDVIEDTGIAKEALSAQFGETVAELVD
FT                   GVSKLTQMNFETKAEAQAENFQKMAMAMARDIRVILVKLADRLHNMRTLEVLSGEKRRR
FT                   IAKETLEIYAPIANRLGMHSVRIEFEDLGFKAMYPMRSSRINQAVKRARGNRKELVNKI
FT                   EESLSHCLAVDGIEGDVSGRQKHLYGIYKKMRGKRRAFNEIMDVYAFRIIVDKVDTCYR
FT                   VLGAVHNLYKPLPGRFKDYIAIPKANGYQSLHTTLFGMHGVPIEIQIRTREMEEMANNG
FT                   IAAHWLYKSSDDEQPKGTHARARQWVKGVLEMQQRAGNSLEFIESVKIDLFPDEVYVFT
FT                   PKGRIMELPKGSTAVDFAYAVHTDVGNSCIACRINRRLAPLSEPLQSGSTVEIVSAPGA
FT                   RPNPAWLNFVVTGKARTHIRHALKLQRRSESINLGERLLNKVLNGFECSLDKIGQERIQ
FT                   LVLNEYRVEVLEDLLEDIGLGNRMAYVVARRLLGEGDQLPSPEGPLAIRGTEGLVLSYA
FT                   KCCTPIPGDPIVGHLSAGKGMVVHLDNCRNISEIRHNPEKCIQLSWAKDVTGEFNVELR
FT                   VELEHQRGLIALLASSVNAADGNIEKISMDERDGRISVVQLVVSVHDRVHLARVIKKLR
FT                   ALTGVTRITRMRA"
FT   gene            complement(225170..225433)
FT                   /locus_tag="Psyr_0210"
FT   CDS_pept        complement(225170..225433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0210"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35283"
FT                   /db_xref="GOA:Q4ZZY9"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35283.1"
FT                   /translation="MARVTVEDCLEHVDNRFELVMLSTKRARQLATGGKEPKLAWENDK
FT                   PTVMALREIAAGVMDYSVIAEAEIVEDEPLFAAFEDESNEAV"
FT   gene            complement(225581..226225)
FT                   /locus_tag="Psyr_0211"
FT   CDS_pept        complement(225581..226225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0211"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35284"
FT                   /db_xref="GOA:Q4ZZY8"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35284.1"
FT                   /translation="MTHITGTLYIISAPSGAGKTSLVKALMDAQQEPQHGAQAKIRVSV
FT                   SHTTRAMRPGEVDGVNYNFVDRATFLSMIEHGDFLEQAEVFGNLYGTSQSHLQQTLDEG
FT                   HDLILEIDWQGARQVRAQMPQARSIFILPPTQQALRQRLTNRGQDSDEIIEARMREAVS
FT                   EMSHYSEYEYVVVNDDFAGALEDLKAIFRANRLTQQHQQEQYSELFQELLA"
FT   gene            complement(226239..227102)
FT                   /locus_tag="Psyr_0212"
FT   CDS_pept        complement(226239..227102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0212"
FT                   /product="Conserved hypothetical protein 255"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35285"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35285.1"
FT                   /translation="MVHSMTAFARVERAGAQGTLSWELRSVNHRYLEPHLRLPESFRDL
FT                   EGAIREALRQGLSRGKVECTLRFVEETAGKPLQVDLERAGQLVAAAESVAGLIKQPAAL
FT                   NPLEVLAWPGVLVADANDPQVLNTEALKLFNDALTELKSGRGREGADLARLLDERLSSI
FT                   VEEVATLRTLVPQMLATQRQKVLDRFADMKAELDPQRLEQEMVLLAQKSDVAEELDRLS
FT                   THVTEVRRVLKAGGQAGRRLDFLMQELNREANTLGSKAFDPRSTQAAVNLKVLIEQMRE
FT                   QVQNIE"
FT   gene            227415..228137
FT                   /locus_tag="Psyr_0213"
FT   CDS_pept        227415..228137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0213"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35286"
FT                   /db_xref="GOA:Q4ZZY6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35286.1"
FT                   /translation="MKRPSGRAADQLRSIRITRNYTKHAEGSVLVEFGDTKVICTVSVE
FT                   NGVPRFLKGQGQGWLTAEYGMLPRATGERNQREASRGKQGGRTLEIQRLIGRSLRAALD
FT                   MSKLGDVTLYVDCDVIQADGGTRTASITGAMVALADALKVIKKRGGLKGGDPLKQMIAA
FT                   VSVGMYQGEPVLDLDYLEDSAAETDLNVVMTSAGGFIEVQGTAEGAPFQPEELNAMLAL
FT                   AQKGMTELFELQRAALAD"
FT   gene            228159..228527
FT                   /locus_tag="Psyr_0214"
FT   CDS_pept        228159..228527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35287"
FT                   /db_xref="GOA:Q4ZZY5"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35287.1"
FT                   /translation="MSDSLQPFSKPPQSARQWAMFCHLSAFAGLMFPFGNLLGPLIIWQ
FT                   LKKDSDPFIDAQGKEALNFQITVAIAATVSMLLVVLIIGFALLTLVGIGAAALAIIAGI
FT                   KANDGVNYRYPFTLRLIK"
FT   misc_feature    228228..228296
FT                   /locus_tag="Psyr_0214"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    228339..228407
FT                   /locus_tag="Psyr_0214"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    228411..228470
FT                   /locus_tag="Psyr_0214"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   regulatory      228551..228567
FT                   /note="191-><-192, 100% conf. Stem=7 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(228551..228567)
FT                   /note="191-><-192, 100% conf. Stem=7 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(228597..229376)
FT                   /locus_tag="Psyr_0215"
FT   CDS_pept        complement(228597..229376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0215"
FT                   /product="Exodeoxyribonuclease III xth"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35288"
FT                   /db_xref="GOA:Q4ZZY4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35288.1"
FT                   /translation="MRIISVNVNGIQAAVERGLLSWLQAQNADVICLQDTRASTFELDD
FT                   PAFQLDGYFLYACEAEVPAQGGVALYSRLQPKAVISGLGFETADRYGRYLQADFDKVSI
FT                   ATLLFPSGMNGDEDLNQKFKLMDDFGKYMDKQRRKRREYIYCGSLYVAQQKLDIKNWRD
FT                   SQQSPGFLAPERAWMDEIVGTMGYVDALREVSREGDQYSWWPDNEQAEMLNLGWRFDYQ
FT                   ILTPGLRRFVRSARLPRQPRFSQHAPLIVDYDWTLTI"
FT   gene            229459..230100
FT                   /locus_tag="Psyr_0216"
FT   CDS_pept        229459..230100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0216"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35289"
FT                   /db_xref="GOA:Q4ZZY3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35289.1"
FT                   /translation="MQAYQRDFIRFAIDRGVLRFGEFTLKSGRTSPYFFNAGLFNTGSA
FT                   LAQLGRFYAAAVVESGIAFDVLFGPAYKGIPLASATAVALAEHHDRDLPWCFNRKEAKA
FT                   HGEGGSLVGSPLAGNVLIIDDVITAGTAIREVMQIIKDQDATAAGVLIALNRQERGNGE
FT                   LSAIQEVERDFGIPVVSIVSLNQVLEFLADDPQLKQHLPAVEAYRAQFGI"
FT   gene            230111..230743
FT                   /locus_tag="Psyr_0217"
FT   CDS_pept        230111..230743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35290"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35290.1"
FT                   /translation="MAVGSRARFSVSGTLSALRALLAVVMLVPMLAQAADAPEPRLYRY
FT                   VDSRGVTVIDTQGVPPDYVAKGYEVLNSRGRVVQVVPPAPTAEQIRQSEADKRQAAADA
FT                   QLLSLYSSVAEVDRMKARKLAELDALVGVALGNIQGLAAQQRSLQGQAADLERAGRPVQ
FT                   QALVDQLNDLRDQQQKLQADIAGYQAARVKAEADFAVDRARVQRLTQ"
FT   sig_peptide     230111..230215
FT                   /locus_tag="Psyr_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 35"
FT   regulatory      231028..231055
FT                   /note="194-><-195, 100% conf. Stem=11 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(231028..231055)
FT                   /note="194-><-195, 100% conf. Stem=11 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(231075..231980)
FT                   /locus_tag="Psyr_0218"
FT   CDS_pept        complement(231075..231980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0218"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35291"
FT                   /db_xref="GOA:Q4ZZY1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35291.1"
FT                   /translation="MTLERDAASNVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELK
FT                   TGFARDIVLMKAVGINPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAQTMDVVEMVL
FT                   GGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGQVGEVV
FT                   GVNTGLLNMLVKGDFIPVIAPIGVGPDGESYNINADLVAGKVAEALKAEKLILLTNIAG
FT                   LMNKQGEVLTGLTTEQVDGLIADGTIYGGMLPKIRCALEAVQGGVNSSHIIDGRVPNAV
FT                   LLEIFTDSGVGTQITNRKRH"
FT   gene            complement(232009..233406)
FT                   /locus_tag="Psyr_0219"
FT   CDS_pept        complement(232009..233406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0219"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35292"
FT                   /db_xref="GOA:Q4ZZY0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35292.1"
FT                   /translation="MNSPASVAPNLPETIFRAYDIRGVVGDTLNAETAYWIGRAIGSES
FT                   LAQNEPNVSVGRDGRLSGPELVQQLIQGLHDSGCHVSDVGLVPTPALYYAANVLAGKTG
FT                   VMLTGSHNPKDYNGFKIVIAGDTLANEQIQALHERIKTNNLTSQKGSITQVDILERYFQ
FT                   QIKNDIVMARKLKVVVDCGNGAAGVIAPQLIEALGCEVISLFAEVDGNFPNHHPDPGKL
FT                   ENLQDLIAKVKETGADLGLAFDGDGDRVGVVTNAGNVVYPDRLLMLFALDVLKRNPGAD
FT                   IIFDVKCTRRLTPLISEHGGRPVMWKTGHSLIKKEMKKSGALLAGEMSGHIFFKERWFG
FT                   FDDGIYSAARLLEILSQESANAEDLFETFPNDISTPEINIKVTDVTKFSIIKALETDAQ
FT                   WGDAKLTTIDGVRVDYPKGWGLVRASNTTPVLVLRFEAETEAELQRIKDVFHAELKKVA
FT                   PDLDLPF"
FT   gene            complement(234646..235101)
FT                   /locus_tag="Psyr_0220"
FT   CDS_pept        complement(234646..235101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0220"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35293"
FT                   /db_xref="GOA:Q4ZZX9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35293.1"
FT                   /translation="MHALQAKILDPRIGNEFPLPAYATTGSAGLDLRAMLKEDTLLEPG
FT                   QTLLIPTGLSIYIGDPGLAALILPRSGLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG
FT                   HTAFNIAVGERIAQLVLVPVVQAHFELVEAFDESQRGAGGFGHSGSH"
FT   gene            complement(235108..236355)
FT                   /locus_tag="Psyr_0221"
FT   CDS_pept        complement(235108..236355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0221"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35294"
FT                   /db_xref="GOA:Q4ZZX8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35294.1"
FT                   /translation="MAVVCSLDQKGRSMQRLYRKRIVLGVGGGIAAYKSAELVRRLRDQ
FT                   GAEVRVVMTRGGAEFITPLTMQALSGHPVHLDLLDPAAEAAMGHIELAKWADLILIAPA
FT                   TADLIARLAQGIANDLLTTIVLATDATVAIAPAMNQAMWRDASVQANTRLLEERDFRVF
FT                   GPASGSQACGDVGFGRMLEADDLAQCAADCFQRLTLTGKHVLITAGPTQENIDPVRYIT
FT                   NHSSGKMGFALAEAAVEAGARVTLITGPVNLPTPDRVSRIDVVSARDMLAACEAAIPCD
FT                   LFIASAAVADYRPEVVAPHKLKKDPSNGDGLLLQMVRNPDILATIATRPDRPFSVGFAA
FT                   ETEHLLDYAARKLKDKNLDLIVANDVANPSIGFNSEENACSVIDRGLHATLFAQTSKAK
FT                   IARQLVTFIADRMNQV"
FT   gene            236452..237126
FT                   /locus_tag="Psyr_0222"
FT   CDS_pept        236452..237126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0222"
FT                   /product="DNA replication and repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35295"
FT                   /db_xref="GOA:Q4ZZX7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35295.1"
FT                   /translation="MSIRSWPAAERPRERLLELGAASLSDAELLAIFLRTGVAGKSAVD
FT                   LARHLLNQFDGLRPLLDADLSAFTSQLGLGPAKFAQLQAVMEMARRHMAESLRRESALE
FT                   NPTQVRSYLKALLRHEPHEVFGCLFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMA
FT                   HNAASLILCHNHPSGITTPSRSDIDLTKRLKEALLLVDVHVLDHVIVGDGEPLSMVERG
FT                   LM"
FT   gene            complement(237260..238846)
FT                   /locus_tag="Psyr_0223"
FT   CDS_pept        complement(237260..238846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0223"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35296"
FT                   /db_xref="GOA:Q4ZZX6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35296.1"
FT                   /translation="MRLAALPFLLVPLLLPVAAQASNLVVCTEASPEGFDVVQYNSLTT
FT                   TNASADVLMNRLVDFDAKSGKLVPSLADSWTVSKDGLTYDFKLHPGVKFHTTDYFKPTR
FT                   ELSADDVLFSFQRMLDPQNPWHKIAQSGFPHAQSMQLPALIKSIEAPDAHTVRFTLNHA
FT                   DSTFLATLSMGFASIYSAEYTAQLLKAGTPEKLNSQPIGTGPFVFKRFQKDAVVRYEAF
FT                   DDYFAGKSDIDTLVYAITPDANVRLQKIRQDECQIALSPKPLDIQAASKDDSLKVEKTE
FT                   AFMTAFVAINSQHPPFDKPEVRQAINLAFDRDNYLKAVFEGTAEKANGPYPPNTWSYAK
FT                   DLPGYQHDVAKAKALLAKAGVKEGFKTTIWTRPSGSLLNPNPSLGAQLLQADLKQIGIN
FT                   AEIKIIEWGELIRRAKAGEHDLLFMGWAGDNGDPDNFLTPQFSCAAVQSGTNFARYCDK
FT                   TLDKLIADGKSVSDQGERSKLYHQAQQQIQQQALWIPLAHPTAAALVRKDVTGYQVSPF
FT                   GRQDFYKVQVK"
FT   sig_peptide     complement(238781..238846)
FT                   /locus_tag="Psyr_0223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 22"
FT   gene            239211..239444
FT                   /locus_tag="Psyr_0224"
FT   CDS_pept        239211..239444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0224"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35297"
FT                   /db_xref="GOA:Q4ZZX5"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35297.1"
FT                   /translation="MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEGEKR
FT                   FVRLRVSAKGMRIIDKRGIEVVLAELRRDGKI"
FT   gene            239456..239611
FT                   /locus_tag="Psyr_0225"
FT   CDS_pept        239456..239611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0225"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35298"
FT                   /db_xref="GOA:Q4ZZX4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35298.1"
FT                   /translation="MRELIRLVSSAGTGHFYTTDKNKRTTPDKIEIKKFDPVVRKHVIY
FT                   KEGKIK"
FT   regulatory      239636..239649
FT                   /note="202-><-203, 100% conf. Stem=5 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(239636..239649)
FT                   /note="202-><-203, 100% conf. Stem=5 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(239693..240061)
FT                   /locus_tag="Psyr_0226"
FT   CDS_pept        complement(239693..240061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0226"
FT                   /product="Protein of unknown function DUF861"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35299"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35299.1"
FT                   /translation="MSIESIVDFSEASTAAEHYRPAPEKVFKGDPAQTLYNHYNSPCGQ
FT                   MSAGVWNGEPGQWQVNYSEHEYCEIVQGVSVLRDEQGHAKTLRAGDRFVIPAGFKGTWE
FT                   VLETCRKIYVVFEAAADK"
FT   gene            240295..241794
FT                   /locus_tag="Psyr_0227"
FT   CDS_pept        240295..241794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0227"
FT                   /product="gamma-glutamyl-gamma-aminobutyraldehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35300"
FT                   /db_xref="GOA:Q4ZZX2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35300.1"
FT                   /translation="MQMTTLTRADWEQRARNLKIEGRAFIQGEYTAASSGETFDCISPV
FT                   DGRMLAKVASCDAADAQRAVDSARSAFNSGVWSRLAPAKRKATMIRFAGLLEQNAEELA
FT                   LLETLDMGKPISDSLGVDIPGGARALSWSGEAIDKLYDEVAATPHDQLGLVTREPVGVV
FT                   AAIVPWNFPLMMACWKLGPALSTGNSVILKPSEKSPLTAIRIAQLAIEAGIPAGVLNVL
FT                   PGYGHTVGKALALHMDVDTVVFTGSTKIAKQLMIYAGESNMKRVWLEAGGKSPNIVFAD
FT                   APDLQAAASAAASAIAFNQGEVCTAGSRLLVERSIKDRFLPMVIEALSAWKPGNPLDPA
FT                   TTVGALVDTQQMNTVLSYIEAGHSDGAKLVAGGKRILQETGGTYVEPTIFDGVNNAMKI
FT                   AQEEIFGPVLSVLTFDTAEEAIQIANDTQYGLAAAVWTANISKAHLTAKALRAGSVWVN
FT                   QYDGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKSTWIKL"
FT   gene            242037..243185
FT                   /locus_tag="Psyr_0228"
FT   CDS_pept        242037..243185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0228"
FT                   /product="Major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35301"
FT                   /db_xref="GOA:Q4ZZX1"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35301.1"
FT                   /translation="MRWGTYFAVLASVLGVGLAMGVSMPLVSLRLAGWGYGSFAIGIMA
FT                   AMPAVGVLLGAALASRLAARFGTANLMRLCLWAGAVSVGALALLPYYWIWLVLRLTLGV
FT                   ILTIVFVLGESWINQLVIERLRGRLVALYGSTYALSQLAGPLLLGVIGTQADYGFWIGV
FT                   ALLVGSPFLLLGRTGAPSTEACNVTFADLSGFCRGMPAIAWAVALFAAFEALILTLLPL
FT                   YCIRHGFTPEIALIMVSVVVVGDALLQLPIGMLADRISRRAMFTGCAALLLASSLLVPL
FT                   LIDTVLIWPLWTVFGASAGGLFTLSLILIGERYRDDSLVRANAHVAQLWGIGCLLGPLI
FT                   AGAGSQWVSGEALPLMMAAGALGLLILIRRRGAFGDAQAVPA"
FT   sig_peptide     242037..242102
FT                   /locus_tag="Psyr_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.664 at
FT                   residue 22"
FT   misc_feature    242055..242123
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    242151..242219
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    242256..242324
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    242334..242402
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    242421..242489
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    242508..242576
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    242637..242705
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    242733..242801
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    242826..242885
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    242898..242966
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    243000..243059
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    243072..243140
FT                   /locus_tag="Psyr_0228"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(243182..244762)
FT                   /locus_tag="Psyr_0229"
FT   CDS_pept        complement(243182..244762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0229"
FT                   /product="Phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35302"
FT                   /db_xref="GOA:Q4ZZX0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35302.1"
FT                   /translation="MNNSWALPFCLLVALCVSGCAHQQVTSEPSQAMPSSGSAFGRSIQ
FT                   AMAVPHEGRSGFRLLPDSSDAFKARAELIRNAKSSLDLQYYIVHDGLSTRALIDELLKA
FT                   ADRGVRVRILLDDTTSDGLDQAIATLAAHPNIQIRLFNPQNLGRETGITRSLGRLMNLS
FT                   RQHRRMHNKLWLADSSVAIVGGRNLGDEYFDAEPNLNFTDIDMLSVGPVAEQLGHSFDQ
FT                   YWNSTLSKPIGEFIYFLPDGEDLAEARRKLDDSLEQAHQQHKALYERLMAYKTQPRMKT
FT                   WLNELVWAYNQALWDAPTKVLAQGEPDPHLLLTTQLAPELLNTHKELMLISAYFVPGPE
FT                   GLLYLTGRADAGVNVSLLTNSLEATDVPAVHGGYAPYRKALLEHGVKLFELRRQPGDTE
FT                   TMRGSGPHLFKKSHSLVSSESSLHSKAMIFDRQKVFVGSFNFDPRSVLWNTEVGVLVDS
FT                   PQLAEELRELTLQGMAPSLTYEARLEDGKVVWVTEDNGQIHTLHTEPGDWWRRFNAWMS
FT                   RAIGLERML"
FT   sig_peptide     complement(244691..244762)
FT                   /locus_tag="Psyr_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.751 at
FT                   residue 24"
FT   gene            complement(244835..246256)
FT                   /locus_tag="Psyr_0230"
FT   CDS_pept        complement(244835..246256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0230"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35303"
FT                   /db_xref="GOA:Q4ZZW9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35303.1"
FT                   /translation="MTLYVNLAELLGSRIENGFYRPGDRLPSVRALSVEHGVSLSTVQQ
FT                   AYRVLEDHGLAAPKPKSGYFVSVSRKAPALPAVGRPVQRPVDISQWDQVLDLIRVAPLE
FT                   AVTQLGRGMPDVTSPTLKPLMRALSQLSRHQDMPGLYYDNIYGVRRLREQIARLMLDSG
FT                   CSLTANDLIVTNGCHEALSASVRAICSPGDIVAVDSPSFFGAMQTLKGVGMKAMEIPTD
FT                   PLTGISLEALELALEQWPIKVIQLTPNCNNPLGYVMPEARKRALLTLAQRFDVAIIEDD
FT                   VYGDLAYNYPRPRTIKSFDEDGRVLLCSSFSKTLAPGLRIGWVAPGRYLEQVLHMKYIG
FT                   TGSTAPQPQLAIADFIEGGHYEPHVRRMRSQYQRSRDQMIDWVMRYFPEGTRASRPQGG
FT                   FMLWVELAEGFDTLRLNRALLGKGVQIAVGSIFSASGKYRNCMRMNFATKPSREIESAV
FT                   RIVGETIALLNAQTD"
FT   gene            246432..246683
FT                   /locus_tag="Psyr_0231"
FT   CDS_pept        246432..246683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35304"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35304.1"
FT                   /translation="MNGFSDVRLALHSQELNEYRPATVRTVRSNKADLLAGMGRWALYR
FT                   HRWASRRSLLTLTDDQLRDIGLDFRQARVEAMKPFWRP"
FT   gene            complement(246686..247999)
FT                   /locus_tag="Psyr_0232"
FT   CDS_pept        complement(246686..247999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0232"
FT                   /product="gamma-glutamylputrescine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35305"
FT                   /db_xref="GOA:Q4ZZW7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35305.1"
FT                   /translation="MNARVQNTPRQDQHVASYYAASSHAQADHPALQGEVKVDVCVVGG
FT                   GFSGLNTAIELAERGFSVALLEARKIGWGASGRNGGQLIRGVGHGVEQFANVIGSEGVR
FT                   QLKLLGIEAVEIVRQRIERYAIDCDLKWGYCDLANKPRDLHSLAEDAEELRSLGYRHAL
FT                   QLLQPEEMHSVVGSSRYVGGLIDMGSGHLHPLNLALGEAAVAQSLGVRLFEHSAVTSID
FT                   YGPQVRVHTAAGSVQAQTLVLGCNAYLNDLNPEISGKVLPAGSYIIATEPLSEAQAREV
FT                   LPQDMAVCDQRVTVDYYRLSADRRLLFGGACHYSGRDPQDIAAYMRPKMLDVFPQLAAV
FT                   KIDYQWGGMIGIGANRLPQIGRLKQHPNVFYAQAYSGHGLNATHLAGRLLAEAIAGQHS
FT                   DGFELFAKVPHMTFPGGKHLRSPLLALGMLWHRLKELR"
FT   gene            248105..248458
FT                   /locus_tag="Psyr_0233"
FT   CDS_pept        248105..248458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0233"
FT                   /product="Protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35306"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR016928"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35306.1"
FT                   /translation="MSCNRQKIADLRRQIPSFECVPGCHDCCGPVTTSPEEMSRLPRKT
FT                   AAEQEAALDELNCVHLGPQGCTVYDERPLICRLFGTTASLPCPNGRRPVELIHPRVEKQ
FT                   IHEYMASTRQVLV"
FT   gene            complement(248466..248954)
FT                   /locus_tag="Psyr_0234"
FT   CDS_pept        complement(248466..248954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0234"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35307"
FT                   /db_xref="GOA:Q4ZZW5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35307.1"
FT                   /translation="MRTQHQSNRELDKIDRNILRILQADGRISFTELGERVGLSTTPCT
FT                   ERVRRLEREGIIMGYTARLNPQSLKASLLVFVEISLDYKSGDTFEEFRRAVLKLPHVLE
FT                   CHLVSGDFDYLVKARISEMASYRKLLGDILLKLPHVRESKSYIVMEEVKESLNLPIPD"
FT   gene            249112..250413
FT                   /locus_tag="Psyr_0235"
FT   CDS_pept        249112..250413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0235"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35308"
FT                   /db_xref="GOA:Q4ZZW4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35308.1"
FT                   /translation="MRVLVLGSGVIGTTSAYYLARAGFQVTVVDRQPAAAMETSFANAG
FT                   QVSPGYASPWAAPGVPLKALKWLLQRHAPLAIKATADIDQYLWMAQMLRNCTASRYAIN
FT                   KERMVRLSEYSRDCLDELRLETGIAYEGRSLGTTQLFRTQAQLDNAAKDIAVLEQSGVP
FT                   YELLDRDGIARVEPALAGVTGILSGALRLPNDQTGDCQLFTTRLAEMAVALGVEFRYGQ
FT                   NIERLDHAGDRINGVWIDGKLETADRYVLALGSYSPQLLKPLGIKAPVYPLKGYSLTVP
FT                   ITNPDMAPTSTILDETYKVAITRFDNRIRVGGMAEIAGFDLSLNPRRRETLEMIVGDLY
FT                   PQGGDLTQADFWTGLRPTTPDGTPIVGATPFRNLFLNTGHGTLGWTMACGSGRLLADLI
FT                   ARKTPRISAEGLDISRYGNTQENAQHVHPAPAHQ"
FT   gene            250385..250738
FT                   /locus_tag="Psyr_0236"
FT   CDS_pept        250385..250738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0236"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35309"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35309.1"
FT                   /translation="MSIQRQLTNERMSQVVVHNGTVYLSGQVGNDMTAGVEQQTREVLN
FT                   SIERLLDLAGTDKTRILSVTIYLKDIDADFAGMNSVWDKWLPKGFAPARATVEAKLCEP
FT                   EILVELSVVAALP"
FT   gene            250813..251886
FT                   /locus_tag="Psyr_0237"
FT   CDS_pept        250813..251886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0237"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35310"
FT                   /db_xref="GOA:Q4ZZW2"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35310.1"
FT                   /translation="MRPARAFIDLQALRHNYQLARESSGGKALAVVKADAYGHGAVRVA
FT                   QALEAQADGFAVACIEEALELRAAGIRAPVLLLEGFFEADELALIVEHDLWTVVHATWQ
FT                   LEAIEQARLGKPITVWLKLDTGMHRVGLHPHEYQAGYQRLLATGKVARIVLMSHFSRAD
FT                   ELNSGCSDEQLAVFETFRKGLAAETSLKNSPAVLGWPQIPSDWSRPGIMLYGATPFDQV
FT                   HPLADRLQPVMTLESKIISVRELPVGEPVGYGATFVCDRPLRIGVVAMGYADGYPRHAP
FT                   TGTPVQIDGQPSRLLGRVSMDMLCVDLTEVPQAGLGSRVELWGKQVLASEVAQRAETIP
FT                   YEIFCNLRRVPRIYSED"
FT   gene            251961..252560
FT                   /locus_tag="Psyr_0238"
FT   CDS_pept        251961..252560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0238"
FT                   /product="Helix-turn-helix motif protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35311"
FT                   /db_xref="GOA:Q4ZZW1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35311.1"
FT                   /translation="MMAFTSTRPDKTWGNIALDVGERLQSIRKLKGLSQRELAKRAGVT
FT                   NSTISMIEKNSVSPSISSLRKVLGGIPMSMVEFFSEESVPENAAQVVYKASELIDISDG
FT                   AVTMKLVGKSHQGRAIAFLTETYPPGADTGEEMLVHEGEETGILVEGRLELVVGLDTYV
FT                   LEAGDSYYFESTRPHRFRNPFDVPARLISAATPANF"
FT   gene            252586..252909
FT                   /locus_tag="Psyr_0239"
FT   CDS_pept        252586..252909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0239"
FT                   /product="cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35312"
FT                   /db_xref="GOA:Q4ZZW0"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35312.1"
FT                   /translation="MKLTWKILSSAGVLTLWALNAQAADSARAPDDIIAAHCVACHSVG
FT                   LLNAPKIGDTAAWEQRAQQKGGLDGLLASTIKGLGIMPPKGTCGDCTNDELKSAIQSMS
FT                   GLK"
FT   sig_peptide     252586..252657
FT                   /locus_tag="Psyr_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            252906..253160
FT                   /locus_tag="Psyr_0240"
FT   CDS_pept        252906..253160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35313.1"
FT                   /translation="MRCTLVPVPERPALCMRFMGASRATLRLLAKMMFRSMHFGDSTHP
FT                   FREQVRSYALWAEARKPFVPGVSGIVYNDNALRDEHAAL"
FT   gene            253210..255141
FT                   /locus_tag="Psyr_0241"
FT   CDS_pept        253210..255141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35314"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35314.1"
FT                   /translation="MPYSCSIEHAVDHVLAQLPEHIHLGMPLGLGKPNRFVNALYQRIS
FT                   ELPERRLTIYTALTLGRPTPGEGLQARFLEPFLERVFADYPELDFLAALRRDKLPANIH
FT                   VQQFFMQPGSLLNSHSAQQDYVSSNYSHAARDINANGLNLVAQLVARDEQHPGTLSLSC
FT                   NPDVTLDLLPMIAKRRAAGETILMLGQVHADLPYMPGDSELDVDAFDVLIDEDERSTLF
FT                   STPNMPVGYQDHLIGLHASTLVRDGGTLQIGIGSMGDALTGALLARQADNETWRGLLAE
FT                   LNMSNWQTLIDREGGVQPFASGLYGCSEMFVNGLLVLADAGVVRRKVYADAELQRLANM
FT                   GTLDEDAHPGGVVVHGGFFLGPRSFYARLRELPAERLAQFNMTAISYINELYGQEELKR
FT                   LQRRDARFINSAFTVTLMGAAVADQLEDGRVLSGVGGQYNFVAQAHALEGARSILMLRS
FT                   WRESGGEVSSNIVWQYGHTTIPRHLRDIVVTEYGIADLRGQTDAMVIERILNITDSRFQ
FT                   SGLIEQAQKAGKLPKDFRLDPRFTDNTPERLKDTASRYPSLFTEYPLGCDFTAEERDLL
FT                   RALNWLKSKLKLTEILELGKATLDAPDPEAFLAHLQRMQLDAPQGLREELYQRLLLAGL
FT                   QNSTGLAG"
FT   regulatory      255152..255178
FT                   /note="217-><-218, 98% conf. Stem=12 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(255189..255713)
FT                   /locus_tag="Psyr_0242"
FT   CDS_pept        complement(255189..255713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0242"
FT                   /product="Protein of unknown function DUF962"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35315"
FT                   /db_xref="GOA:Q4ZZV7"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35315.1"
FT                   /translation="MKTLVDHLSQYAAYHRDSRNIVTHFVGIPLIVLAVAVLLSRPGWT
FT                   VSGLWLSPAALLALGSTVFYLRLDRALGMVMAVLLALCIWAGANLAQQATMVWLSAGVG
FT                   LFVIGWIIQFVGHYYEGRKPAFIDDLTGLIIGPLFVVAELAFLMGQRKALQHAIEERAG
FT                   PVGRATRKATT"
FT   misc_feature    complement(255273..255338)
FT                   /locus_tag="Psyr_0242"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(255369..255425)
FT                   /locus_tag="Psyr_0242"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(255441..255497)
FT                   /locus_tag="Psyr_0242"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(255510..255575)
FT                   /locus_tag="Psyr_0242"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(255597..255653)
FT                   /locus_tag="Psyr_0242"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            255795..256505
FT                   /locus_tag="Psyr_0243"
FT   CDS_pept        255795..256505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0243"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35316"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35316.1"
FT                   /translation="MTNGVSWRSRLLSDYWFSHLPADLQDSLLDAARQRRKTPGRRLFE
FT                   KGDLPCGVYVLLEGSVRIGAAHEQRLLTNVEPASAPCWFGEVSLFDGLPRRFEVCSLEQ
FT                   SIFLHIPQPFLARLLDRHSEYWRWFAALLSQKVGLPLQSPEKMRQLPPRARVAWRLLML
FT                   SEGYGPLSHARRLIALDDIQAAERLALASPALLEVLQDLHERRIVRLGEGHLEVFDVDR
FT                   LRRVANFSRARAVC"
FT   gene            256622..257623
FT                   /locus_tag="Psyr_0244"
FT   CDS_pept        256622..257623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0244"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35317"
FT                   /db_xref="GOA:Q4ZZV5"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35317.1"
FT                   /translation="MQASKRLLAALTLTLLGSTAQAADEVVVYSSRIDELIKPVFDAYT
FT                   ASTGVKIKFITDKEAPLMQRIKAEGENATADLLLTVDAGNLWQAERMGILQPFTSPVIE
FT                   ANILPQYRSSSHGWTGLSLRARTIAYSTDRVKPAELSTYEALADKNWEGRLCLRTAKKV
FT                   YNQSLTATLIETHGAEASEKILKGWVNNLSTDVFSDDIAVLEAINAGQCDVGIVNSYYY
FT                   GRLHKEKPGLAVKLFWPNQADRGVHVNLSGIGLTKYAPHPEAAKSLVEWMTGPEAQKIF
FT                   SSVNQEFPANPNVAPSEEVASWGPFKADTLPVEVAGKRQAEAIRMMDRAGWN"
FT   sig_peptide     256622..256690
FT                   /locus_tag="Psyr_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 23"
FT   gene            257895..259511
FT                   /locus_tag="Psyr_0245"
FT   CDS_pept        257895..259511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0245"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35318"
FT                   /db_xref="GOA:Q4ZZV4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35318.1"
FT                   /translation="MAHPAQRRWYPLVFAIAALVVLPLSVLLLSWETVDQQIWSHLLET
FT                   QMARLLSNTLILVLGVGVGVTLLGVSLAWLTSLCEFPGRRWLDWALMLPFAIPAYVLAF
FT                   VFVGLLDFSGPVQTLMREWFGSGLRLPRVRSTGGVIIVLVLVFYPYVYLLARTAFLAQG
FT                   KGLMEAARVLGNTPLQAFWRVALPMARPAIGAGVALALMETLADFGAVSVFNFDTFTTA
FT                   IYKTWYGFFSLSSAAQLASLLLLAVLVLLYGERRARRASRPANERPRGAALYRLSGIKA
FT                   WAASFWCGLVFLCAFVVPMLQLIVWVWQRGRFDLDERYTGLILHTLYLGGMAALITVSV
FT                   ALILAFARRMAPTPAIRSGVSLANLGYALPGSVLAVSIMLAFSYLDRELVIPLSGWLGG
FT                   AGKPLLLGSLSALLLAYLVRFIAVAFGPLEHSLSRIRPSLPEAARSLGVSGPKLFLNVY
FT                   LPLLVPGALSAALLVFVDVLKEMPATLLMRPFGWDTLAVRIFEMTSEGEWARAALPALS
FT                   LVLVGLLPVIGLIRRSARQIG"
FT   sig_peptide     257895..257987
FT                   /locus_tag="Psyr_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.720) with cleavage site probability 0.627 at
FT                   residue 31"
FT   misc_feature    257928..257996
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    258054..258122
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   regulatory      complement(258107..258139)
FT                   /note="hrp box; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and or weight matrix
FT                   scans; (PMID 17073298)"
FT                   /regulatory_class="promoter"
FT   misc_feature    258159..258227
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    258291..258359
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    258468..258536
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    258579..258647
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    258741..258809
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    258867..258935
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    258972..259040
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    259104..259172
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    259251..259319
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    259416..259484
FT                   /locus_tag="Psyr_0245"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            259665..260747
FT                   /locus_tag="Psyr_0246"
FT   CDS_pept        259665..260747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0246"
FT                   /product="aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35319"
FT                   /db_xref="GOA:Q4ZZV3"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35319.1"
FT                   /translation="MGQRTPLFDLHLALGAKMVDFGGWDMPLHYGSQVEEHHQVRRDCG
FT                   VFDVSHMNVIDVLGRQARAWLRRLLANDVDKLKTPGRALYSAMLDESGGVIDDMIVYLT
FT                   PEGYRLVVNAATGVKDLAWMQAQLGDFDVQLVERSEMAMLAIQGPKARARIAELVSSTR
FT                   AELIHQLKPFEGLDDGDWFIARTGYTGEDGLEIMLPAEEAQSFFNELVGAGISPIGLGA
FT                   RDTLRLEAGMNLYGQDIGEHVSPLASNMAWSIAWEPADRDFIGRKALESERAEGTAFKL
FT                   VGLVLEERGVLRAHQVVRVAEIGEGEITSGSFSPTLSKSIALARVPMATADRAEVEIRG
FT                   KWYPVRVVQPAFVRHGKTLI"
FT   gene            260791..261177
FT                   /locus_tag="Psyr_0247"
FT   CDS_pept        260791..261177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0247"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35320"
FT                   /db_xref="GOA:Q4ZZV2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35320.1"
FT                   /translation="MSNIPAELRFAESHEWARLESDGTVTVGISDHAQEALGDVVFVEL
FT                   PEIGTAFAAGDTAGVVESVKAASDIYSPVAGEVIEVNTALGDAPESLNSDSYGAWIFKL
FT                   KPSDASGDLAKLLDAAGYKSAIGE"
FT   regulatory      261199..261215
FT                   /note="223-><-224, 100% conf. Stem=7 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(261199..261215)
FT                   /note="223-><-224, 100% conf. Stem=7 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(261247..261567)
FT                   /locus_tag="Psyr_0248"
FT   CDS_pept        complement(261247..261567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35321"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35321.1"
FT                   /translation="MRLKFAVATVALLSIPMGSAMADTFWRNVLSSGATTGSTYLTFKD
FT                   HKLIVAAQDDAGSFVASDGGIRGPFLEAAIEQVRKDNPGLKATDMELANAILDKNLVAE
FT                   NQ"
FT   sig_peptide     complement(261499..261567)
FT                   /locus_tag="Psyr_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(261709..263493)
FT                   /locus_tag="Psyr_0249"
FT   CDS_pept        complement(261709..263493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0249"
FT                   /product="type II secretion system protein E:General
FT                   secretory system II, protein E, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35322"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35322.1"
FT                   /translation="MAALAPSSQDRWLDLNDVLRDLVAEGYLGQDDAETALTQRRSAVN
FT                   IQLHPLEFLASLQFDDFKRPGKKLDVETLTAWLAKACGQPYMRIDPLKINVAAVTPLMS
FT                   YAFAQRHKILAVAVDRESVTIASAQPYVRSWEADLAHVLKLQIKRVVANPADIQRMAME
FT                   FFRLAKSVSGASASEQKMSNMGNFEQLLKLGASDQEPDANDAHIVNIVDWLFQYAFQQR
FT                   ASDIHIEPRREQGTVRFRIDGVLHNVYQFPAQVIMAIVSRLKSLGRMNVAEKRKPQDGR
FT                   VKTTTPENREVELRLSTLPTAFGEKMVMRIFDPEVLLKDFDQLGFSSDDLRRWQEMTRQ
FT                   PNGIILVTGPTGSGKTTTLYTTLKKLATSEVNLCTIEDPIEMVEPAFNQMQVQHNIDLS
FT                   FAAGVRALMRQDPDIIMIGEIRDLETAEMAIQAALTGHLVLSTLHTNDAPSAISRMLEL
FT                   GVPHYLLKATILGVMAQRLVRTLCPHCKAPINLNETDWQTLTRPWQAPVPPGAHQAVGC
FT                   VECRDTGYRGRAGVYEIMVMSDNIKALISADLDLTAMRRQAFKEGTRSLRLSGAQKVSA
FT                   GLTTLEEVLRVTPQSEQR"
FT   gene            complement(263604..263987)
FT                   /locus_tag="Psyr_0250"
FT   CDS_pept        complement(263604..263987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35323"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35323.1"
FT                   /translation="MQRFPASLWSISMPNLEAVTLPSQRPDSWSSSNAQCCARYRVCAE
FT                   AEPALLCQVLNLFAMQYLIPDQLSAVQQESLLLIDLQVSRLSWHRAQVIGEKMRNLIDV
FT                   CSVEVEQVDARNTAQSRAALATG"
FT   gene            264077..264547
FT                   /locus_tag="Psyr_0251"
FT   CDS_pept        264077..264547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0251"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35324"
FT                   /db_xref="GOA:Q4ZZU8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35324.1"
FT                   /translation="MQIELDSYDRRILALLQEDASLSSAQIAEQVGLSQSPCWRRIQRL
FT                   KDEGVIRRQVALLDRKKIGLNTQIFAEVKLNAHGRSNFTEFTDAIRGFPEVLECYVLTG
FT                   SVDFLLRIVTPDIEAYERFFFEKLSLVPGIQEVNSTVALSEIKSTTSLPLLR"
FT   gene            complement(264861..266315)
FT                   /locus_tag="Psyr_0252"
FT   CDS_pept        complement(264861..266315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0252"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35325"
FT                   /db_xref="GOA:Q4ZZU7"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35325.1"
FT                   /translation="MSCTLTASAAVQSWAALPFIRISVWIPPAMQKETEIKLRVSRETL
FT                   AALREHPLLKKRNKSGWERLELSNQYFDTPEGELAQAKVALRIRRDGDQIIQTMKTRGQ
FT                   SVAGLSERNEYNWDLSKAKLDLKKLEGDCWPEQLADLDKKTIKPLFTTDFVREKAEIAW
FT                   GRGKAKVVIEAALDLGQVVAGKQKEEICELELELREGEPAALLELAAELAATLPLMPCD
FT                   ISKAERGYRLLDASSYSLSLHAPALNAETPLDDAYSALAWHLLGSSQRLAEQYRFNGHW
FT                   RLLQDWVEMLAELRALTSSLGQAAPRTSTAPLRTALDALLEDWRPLVQAGQDDADVRGA
FT                   AHEQFLEELQDTRWGEFSLNTSRWLLTRSWTTERNTRGNRQGAALLSSWLPRLLGEEAT
FT                   SLQLSRYQQQPEDLAEQLPRIERIQSWLHWARGALDLPELDRLYGELRKLEELAHLDIS
FT                   DEVLDARVQQAITVFQSRAWKTLLRL"
FT   gene            266353..267540
FT                   /locus_tag="Psyr_0253"
FT   CDS_pept        266353..267540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0253"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35326"
FT                   /db_xref="GOA:Q4ZZU6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35326.1"
FT                   /translation="MMGRVPSRLQEASMPLPSMKDQFAALIAVPSVSCTQPSLDQSNRP
FT                   VIDLLAGWLGDLGFACDIQQVSPGKFNLLATYGTGPGGLVLAGHSDTVPFDEALWKTDP
FT                   LKLTEVDGRWVGLGSCDMKGFFALVIEAVRGLLDQPFKQPLLILATCDEESSMAGARAL
FT                   ADAGRPLGRAAVIGEPTGLKPIRLHKGVMMERIDILGRSGHSSDPSLGHSALEAMHDAI
FT                   SELKGLRTQWQAKYRNPQFTVPQPTLNLGCIHGGDNPNRICGQCSLEFDLRPLPGMDPE
FT                   MLRSAIRQKLQPLAELHQVQIDYAPLFPECAPFEQIADAELVRVAERLTGHTAAAVAFG
FT                   TEAPYLQRLGCETLVLGPGDIACAHQPGEYLEMSRLDPTVRLLRQLIEHYCLTPQ"
FT   gene            267685..268983
FT                   /locus_tag="Psyr_0254"
FT   CDS_pept        267685..268983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0254"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35327"
FT                   /db_xref="GOA:Q4ZZU5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35327.1"
FT                   /translation="MPEYVNWLRHASPYINAHRDCTFVVMLPGDGVAHPNFGNIVHDLV
FT                   LLHSLGVRLVLVHGSRPQIESRLAQRGITPRYHRDLRITDTETLECVIDAVGQLRISIE
FT                   ARLSMDMAASPMQGSRLRVTSGNVVTARPIGVLEGVDYQHTGEVRRVDRKGINRLLDER
FT                   HIVLLSPLGYSPTGEIFNLACEDVATRAAIDLAADKLLLFGAETGLLDEQGRLVRELRP
FT                   QQVPAHLQRLGANYQAELLDAAAEACRGGVARSHIVSYAENGALLTELFTRDGGGTLVA
FT                   QEQFELVREAAIEDVGGLMDLITPLEEQGILVRRSREVLEREITQFSVVEREGLIIACA
FT                   ALYPIADSESGELACLAVNPEYRHGGRGDELLERIENRARALGIKTLFVLTTRTAHWFR
FT                   ERGFEPSSVDRLPSARASLYNYQRNSKIFEKAI"
FT   gene            complement(269298..270905)
FT                   /locus_tag="Psyr_0255"
FT   CDS_pept        complement(269298..270905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0255"
FT                   /product="glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35328"
FT                   /db_xref="GOA:Q4ZZU4"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35328.1"
FT                   /translation="MKDYTLSEFLNRRLALLGERNNLSLLEQCLHGIERECLRVTATAE
FT                   LACTPHPQALGAALTNGQVTTDYSESLLEFITPALKNPAETIDNLDRIHRFVYSKLGDE
FT                   LLWSPSMPCPLPDEEHIPIAYYGTSNIGKLKYVYRKGLALRYGKTMQCIAGIHYNFSLP
FT                   EDAWALLKQTEDFAGDARDYQSHSYIALIRNFRRYSWLLMYLFGASPALDAGFLRGRKH
FT                   QLEQHFDADTLYLPYATSLRMSDLGYQSDAQADLTPCYNDLVSYTDSLRKAVATPYKPY
FT                   VEVGTHDQNGEWVQLNTNVLQIENEYYSNIRPKRVTYSGERPIQALVARGVQYVEVRCL
FT                   DINPFLPTGISLEQSRFIDAFVLYCALEESQQLARHECSNASSNFLSVVKEGRRPGLSL
FT                   MRDNRPVDLKTWATELMEKITPIARLLDQAQGIDEHLKSIAVQQAKIDDTALTPSAQVL
FT                   ASMEAHNEGFTAFSLRQSQVHAEYFRTHPLSAQEQADFEAQAKTSIEEQAELEATEEVV
FT                   DFDTFVGSYQASILSISN"
FT   gene            complement(271132..271515)
FT                   /locus_tag="Psyr_0256"
FT   CDS_pept        complement(271132..271515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0256"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35329"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35329.1"
FT                   /translation="MDIPEDLTHSAYFKMLGCELRRLDEGVAEVALPLEAHLRNRGNVM
FT                   HGGAIFSLVDIAMGLACSSVHGFDQRSVTIECKINYVRGVSEGEVLCIARVLHAGRRTL
FT                   VVEAEVVQGDKLVAKAQGTFAVI"
FT   gene            complement(271515..273833)
FT                   /locus_tag="Psyr_0257"
FT   CDS_pept        complement(271515..273833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0257"
FT                   /product="RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35330"
FT                   /db_xref="GOA:Q4ZZU2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35330.1"
FT                   /translation="MDSINSRIAEELGVRPQQVAAAVALLDEGSTVPFISRYRKEVTGS
FT                   LDDTQLRHLEERLRYLRELDERRVSILASIEEQGKLTPELARDIKLADTKTRLEDLYLP
FT                   YKQKRRTKGQIALEAGLGELADGLFNDPSLAPEAEAARFVDADKGVADIKAALEGAKYI
FT                   LMERFAEDASLLDKLRSFLKQEAVISARVVPGKEEEGAKFRDYFEHDEPLKSMPSHRAL
FT                   AIFRGRNEGFLSSALKVGEELPGAMHPCELMIGERFGIQNQNRPADKWLAEVVRWTWKV
FT                   KLYSHLETDLLGELRDGAETEAINVFAHNLHDLLLAAPAGQRATLGLDPGLRTGCKVAV
FT                   VDATGKLLDYATVYPHVPKNQWDQTIAVLAALCAKHSVDLIAIGNGTASRETDKLAADL
FT                   IKKYPDLKMTKVMVSEAGASVYSASELAAKEFPDLDVSIRGAVSIARRLQDPLAELVKI
FT                   DPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLARISGLNTTLAQN
FT                   IVAHRDENGAFKTRAALKKVSRLGEKTFEQAAGFLRVMTGDNPLDASAVHPEAYPLVQR
FT                   IAAETDRDIRSLIGDASFLKRLDPKKFTDETFGLPTVTDILQELEKPGRDPRPEFKTAE
FT                   FQDGVEDLKDLQLGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFIKDPREAVK
FT                   AGDVVKVKVMEVDIPRKRVGLSMRMSDTPGEKIDGARGARPGSSPRQNNAPRKETTAPA
FT                   PANNAMASLFANAKQLKKR"
FT   gene            274133..274873
FT                   /locus_tag="Psyr_0258"
FT   CDS_pept        274133..274873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0258"
FT                   /product="Two-component response regulator OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35331"
FT                   /db_xref="GOA:Q4ZZU1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35331.1"
FT                   /translation="MSSTAQNAEGEKILIVDDDPGLSSLLERFFTSKGYRARAVANVEQ
FT                   MDRLLAREVFNLVVLDLMLPGEDGLSACRRLRAANNQVPIIMLTAKGDELSRIKGLELG
FT                   ADDYLAKPFNPDELMARVKAVLRRQAAPVPGAPGSEDESVSFGDYVLSLATRELKRGEE
FT                   VHMLTTGEFAVLKALVMHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRLIEPDP
FT                   SKPRYIQTVWGVGYVFVPDGAGSR"
FT   regulatory      274910..274952
FT                   /note="234-->235, 100% conf. Stem=19 Gap=-5"
FT                   /regulatory_class="terminator"
FT   gene            275025..276347
FT                   /locus_tag="Psyr_0259"
FT   CDS_pept        275025..276347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0259"
FT                   /product="Osmolarity sensor protein envZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35332"
FT                   /db_xref="GOA:Q4ZZU0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35332.1"
FT                   /translation="MAAVMKTPLWFPQSFFSRTLWLVLIVVLFSKALTLVYLLMNEDVL
FT                   VDRQYSHGVALTLRAYWAAGENDREAIAEAAGLIRVVGGGVPEGEQHWPYSEIYQRQMQ
FT                   AELGADTEVRLRVHAPPALWVRAPSLGDGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLS
FT                   TASAWIFVRQLNQPLKRLVFAARQLGQGRSVRLPVSDTPSEMTEVYRAFNQMAEDVEQA
FT                   GQERELMLAGVSHDLRTPLTRLRLSLELMNDNEFSEGMVRDIEDMDAILDQFLAFIRDG
FT                   RDEEIEEVDLGHLVRDVVAPFNDDEDSIRLCLEPIPPFPLRRVSMKRLLTNLIGNAKHH
FT                   AGNGIEVAAYVSGDRNAPYVVLSVLDRGAGIDPSELDTIFNPFIRGDRARSGKGTGLGL
FT                   AIVKRIAAMHGGNVELRNRSGGGLEARVRLPLGLMLPRDAI"
FT   misc_feature    275082..275141
FT                   /locus_tag="Psyr_0259"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    275469..275537
FT                   /locus_tag="Psyr_0259"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   regulatory      complement(276563..276595)
FT                   /note="235-><-236, 100% conf. Stem=15 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      276567..276591
FT                   /note="235-><-236, 100% conf. Stem=11 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(276603..277070)
FT                   /locus_tag="Psyr_0260"
FT   CDS_pept        complement(276603..277070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35333"
FT                   /db_xref="GOA:Q4ZZT9"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35333.1"
FT                   /translation="MHTSFRTLAAALLMGGSAMVMAANDGQSRVNELLSSAPEYRTTWA
FT                   KVVKKEERLPDWVINLSGASGQQMTAATEDGDNYLVGPLCETADTCKSKRLIVAFSLDK
FT                   EDAYAMLVEVPAGLPADKSPTRHATYRYLGKPDEGMQKLLNEELRKDPNWY"
FT   sig_peptide     complement(277002..277070)
FT                   /locus_tag="Psyr_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(277295..277582)
FT                   /locus_tag="Psyr_0261"
FT   CDS_pept        complement(277295..277582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35334"
FT                   /db_xref="GOA:Q4ZZT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35334.1"
FT                   /translation="MNSQRIAQLRISPLHIQQGLFLLLALLVTLIAIQQFQRWNQANEA
FT                   AQPKQQFIQTSSISYRGVSAPAVKDMSSSLRNVDGLVSVDEVAPQQKWVF"
FT   misc_feature    complement(277484..277537)
FT                   /locus_tag="Psyr_0261"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(277811..278650)
FT                   /locus_tag="Psyr_0262"
FT   CDS_pept        complement(277811..278650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0262"
FT                   /product="Transport-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35335"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35335.1"
FT                   /translation="MFSLKKIALITAAAALLGSGPVLAQPDLPAQLTEARQEGSIWTAF
FT                   ALNKHLSPFKIDVGVEQGTATLKGKVENEVDRELAERIALDTKGIEKVDNQLEVDPSVA
FT                   SEPGTRTNMAQRFEDATLVATVKSKLLWSSVTEALNIEVDSKDGVITLKGRAQSPEAKE
FT                   LAGSLASNTDGVVSVNNLISLSAADSIAAKAQPQSLTPTEEMSDAWITSKVKASLIYSR
FT                   TLDGLNIKVDTKAGVVSLNGVVANFAEKELAVEIAKNIRGVKGVNGDALKVMARSAG"
FT   sig_peptide     complement(278576..278650)
FT                   /locus_tag="Psyr_0262"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            278848..280194
FT                   /locus_tag="Psyr_0263"
FT   CDS_pept        278848..280194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0263"
FT                   /product="Two-component response regulator AlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35336"
FT                   /db_xref="GOA:Q4ZZT6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35336.1"
FT                   /translation="MEAATENQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQAD
FT                   TLMQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAVDTAVDAIQAGAA
FT                   DYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEVRKPKDGLDSHSPSMMAILETARQ
FT                   VAVTDANILILGESGTGKGELARAIHGWSKRAKKSCVTINCPSLTAELMESELFGHSRG
FT                   AFTGASESTLGRVNQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADV
FT                   RILAATNLNLEDMVRSGRFREDLLYRLNVITLNLPALRERSEDILTLADRFLARFVKEY
FT                   ARPARGFSEEARAALLNYRWPGNIRELRNVIERASIICPQERVEVSHLGMAEQPTNNAP
FT                   RVGAALSLDELEKAHIGAVLATSETLDQAAKTLGIDASTLYRKRKQYNL"
FT   gene            280205..281992
FT                   /locus_tag="Psyr_0264"
FT   CDS_pept        280205..281992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0264"
FT                   /product="Alginate biosynthesis sensor protein KinB"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35337"
FT                   /db_xref="GOA:Q4ZZT5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35337.1"
FT                   /translation="MKLAMKLRTRLFLSISALITVALLGLLLGLVSVMQMARTQESLIQ
FT                   HNFAILDLGLKLRQNMGDQLVLMTGSSRNEPELQRMQKQFEELLEEGSAQDTQQNVRNG
FT                   FEKTRGDYQRFIATWQQYGNDPRGIRGNSQLSESFDTLRNGLMDVHRKALENISNAEIN
FT                   SRDRALWIAGLLGLVGLAVLCIGFVTAHGIARRFGAPIEALAKAADRIGEGDYEVTLPI
FT                   SSAAEMNLLTRRFGIMAEALRQHQATNVDELLAGQQRLQAVLDSIDDGLLMIDRQGHLE
FT                   HLNPVAQRQLGWDESRLGHSLGEALGRPELDEQLHLVLRGGTLERAPEDLAIEIDGESR
FT                   LLTYSMTPVSHTKGHILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAFG
FT                   LLQERLHFAPESREADLLNTVTEEMQRLMQLINDLLNFSRYQNGLQKLKLAPCSIETLL
FT                   QEAKARFEDQAQEQDIVLMLDMQEPMPRLHADQSQLERVLDNLLDNALRHTPPNGLIRL
FT                   QARRHGERAIISVEDNGEGIAYGQQGRIFEPFVQVGRKKGGAGLGLALCKEIVQLHGGR
FT                   MGVYSRPGQGTQFYMALPL"
FT   sig_peptide     280205..280318
FT                   /locus_tag="Psyr_0264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.782 at
FT                   residue 56"
FT   misc_feature    280235..280303
FT                   /locus_tag="Psyr_0264"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    280706..280774
FT                   /locus_tag="Psyr_0264"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(282046..282897)
FT                   /locus_tag="Psyr_0265"
FT   CDS_pept        complement(282046..282897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0265"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35338"
FT                   /db_xref="GOA:Q4ZZT4"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35338.1"
FT                   /translation="MAGAPCYLYTFCYDVSFPADAADLMKLYLSAFLMLLLTACASGPR
FT                   LDTSHPSVNFDGRAQYVVMHYTSTSLEHSLQLLTHGEVSAHYLIGDDSKATIYKLVDEN
FT                   ARAWHAGESEWEGRTWLNSSSIGIEIVNPGFKETPTGRLWYPYTEAQTQSIIVLLKDIV
FT                   KRNRIDPKHIIGHSDIAPLRKQDPGPLFPWKRLAAEGLGNWPDERQVAQRQALLATNLP
FT                   SITWFQQQLARLGYSTPQTGELDVATRQVLAAFQMHYRPARFDGEPDAQSAAILQVLNH
FT                   SN"
FT   gene            complement(282921..284993)
FT                   /locus_tag="Psyr_0266"
FT   CDS_pept        complement(282921..284993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0266"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35339"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35339.1"
FT                   /translation="MSDDAERWKEKYLKGIEQQDTLEKRWDARLDLLRRGLVRSSLAAE
FT                   GSDRAVDECMKEMREIVRKDDMDAGLAALIPRLEKAVLDSEQRREVRAAQISSALTALV
FT                   AQLQSLPLPRDVRKPLKRFAKELEERASQARELPLLLGELSNLQGQALTQIEKPEEGPR
FT                   QGLLQRLFGSREGHGHEPHPEAAHPEDAASSAPESHEPDVAPQAANTYAPPDASPVEAE
FT                   AVDSTAAAAVAADSTPPTPAPETDAPAAVIPAVATPEEPAPSTTAADIAPAPTEAVAEP
FT                   APITVEPIDFADLLAPVPSVPYQQRPAPIDVPVEEPDAEAEQQPESAEGEEGYALPSSP
FT                   EPSYSSVAAHIEQTLLGLLDDLTLSEHFRPQVEDMQLRLKHGLNWYELLPILDDLAVLM
FT                   LAINNGGQQEFGTYLKQLNERLESFQSHLQAASEDHAEDQSTARDLNEQLREQVGGLQS
FT                   SVQDASDLPSLKRVLDNRLEALLGTMDHYQLKRDAREREVASRLQGLAARVASMEQEAL
FT                   GFRTHLEEQRQKALIDPLTGLPNRAAWGERLEREMARWHEEKNSLLVCILDLDHFKRIN
FT                   DGYGHLAGDKVLKIVANVLSKRLRADDFMARFGGEEFVMLLPATPPATGLKLLDELRAA
FT                   VESCPFHFKGERVTITVSIGMTAFRPSERSDTAIKRADQALYKAKENGRNRIEQG"
FT   gene            complement(284990..285865)
FT                   /locus_tag="Psyr_0267"
FT   CDS_pept        complement(284990..285865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0267"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35340"
FT                   /db_xref="GOA:Q4ZZT2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35340.1"
FT                   /translation="MRRWGKGSTRIVGLHDPQVNEHHLLQNGLPQDGRLRLLSFNIQVG
FT                   ISTQRYHHYLTRSWQHLLPHGGRAGNLQKIGDLINDFDLVALQEVDGGSMRSGFVNQVE
FT                   HLAQLGGFPYWYQQLNRNLGRLAQHSNGVLSRLRPTKIEDHPLPGPAGRGAILVRFGEG
FT                   EDALVVVMMHLALGTRTRTRQLAYIRELIGGYRHQVLMGDMNTHANDLLEHSPLRDLGL
FT                   LAPQIEATFPSWRPQRCLDHILLSPTLTLERVQVLAQPISDHLPVAVEIRLPDSLRGDS
FT                   LPVPSGGSLA"
FT   gene            complement(285875..286519)
FT                   /locus_tag="Psyr_0268"
FT   CDS_pept        complement(285875..286519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0268"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35341"
FT                   /db_xref="GOA:Q4ZZT1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35341.1"
FT                   /translation="MRNLIISAALVAASLFGMSAQAATPIEAGKQYVELASAVPVAEPG
FT                   KIEVVELFWYGCPHCYAFEPTINPWVEKLPSDVKFVRIPAMFGGPWDAHGQLFITLDTM
FT                   GVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKEDFLKTFDSFAVKGKIAQYKE
FT                   LAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLEVADQLIAKERAAAAAAK"
FT   sig_peptide     complement(286451..286519)
FT                   /locus_tag="Psyr_0268"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            286741..287448
FT                   /locus_tag="Psyr_0269"
FT   CDS_pept        286741..287448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0269"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35342"
FT                   /db_xref="GOA:Q4ZZT0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35342.1"
FT                   /translation="MRTHPNETDTSCRTPCRQVFTGNHMQLKNPILGLCQQATFMLSAA
FT                   KVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFGLDEDRRL
FT                   VDLPGYGYAKVPIPLKLHWQRHLEAYLGSRESLKGLILMMDIRHPMTDFDVLMLDWAIA
FT                   SNMPMHILLTKADKLTYGAAKNTLLKVQAEIRKGWGDAVSIQLFSAPKRMGLEEAYTVL
FT                   ADWMELEDKAPAE"
FT   gene            complement(287690..290455)
FT                   /locus_tag="Psyr_0270"
FT   CDS_pept        complement(287690..290455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0270"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35343"
FT                   /db_xref="GOA:Q4ZZS9"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35343.1"
FT                   /translation="MTQAPLVLVDGSSYLYRAFHALPPLATSKGLPTGAVKGVLNMLKS
FT                   LRRQYPDSPLAVVFDAKGGTFRDALYNDYKANRPSMPDDLRVQVDLLHACVKGMGYPFL
FT                   CVEGVEADDVIGTLARSSAAADRPVVISTGDKDMAQLVDGHITLVNTMTGSVLDVAGVK
FT                   EKFGVGPEHIIDYLALMGDKVDNIPGVPGVGEKTAVGLLVGIGGGIKELYENLDKVASL
FT                   PIRGAKTLAAKLEEHREMAFLSYELATIKIDVPLDIELDQLHCGEPDRDTLMELYAELE
FT                   FKSWIEDLQRDAKRAGQELTIEEPTAEAREAAYEVILEQGQFDAWLKKLQAAPLFAFVT
FT                   QSNGTDAQRAQLVGLSFAIQTHEAAYIPLTHSYMGVPQQLDRDTVLKALKPLLEDPDKI
FT                   KVGQHAKFAINLLANCAIDGDQAQGIDLQGVRFDTILESYVLDSTATRHDRDSLVAKYL
FT                   THTPINFQEIAGKGAKQLSFDQIALEQAGNYAAEEADLTLRLHEVFDARLAAIPTLQPV
FT                   LNDIEMPLVPVLARIERQGALVDANLLGIQSVELGDKMTALEREAFAIAGEEFNLGSPK
FT                   QLGVILYEKLGMPILSKTATGQASTAEAVLAELAEQDFPLPKVLMQYRSMSKLKSTYTD
FT                   RLPEQINPRTGRIHTSYHQAVAVTGRLSSSDPNLQNIPIRTAEGRRIRQAFVAPKGYKL
FT                   LAADYSQIELRIMAHLAQDEGLLHAFRNDLDVHRATAAEVFGVELENVTTDMRRSAKAI
FT                   NFGLIYGMSAFGLAKQIGVDRKQSQAYVDRYFARYPGVLNYMERTRAQAAEQGFVETIF
FT                   GRRLYLPDINAKNQSLRKGAERMAINAPMQGTAADIIKKAMVAVNGWLDESGLDARVIL
FT                   QVHDELVLEVREDLVDQISEQIRPHMSGAAELAVPLLVEVGVGNNWDEAH"
FT   gene            290530..290817
FT                   /locus_tag="Psyr_0271"
FT   CDS_pept        290530..290817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35344"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35344.1"
FT                   /translation="MCKVNRLILTGLLAFCPLLAVAAEDPPSAAPDVTIRTDGDRTIQE
FT                   YRQNGFLYAVKITPKHGKPYFLVRADGTSPNFIRSDQPDMLIPQWEIFSW"
FT   sig_peptide     290530..290598
FT                   /locus_tag="Psyr_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 23"
FT   gene            290854..291804
FT                   /locus_tag="Psyr_0272"
FT   CDS_pept        290854..291804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0272"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35345"
FT                   /db_xref="GOA:Q4ZZS7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35345.1"
FT                   /translation="MSVFTPLARPELETFLAPYGLGRLLDYQGIAAGSENTNYFISLEQ
FT                   GEFVLTLVERGPVQEMPFFIELLDVLHEADLPVPYALRTTDGQALRELADKPALLQPRL
FT                   PGKHISEPNTQHCVQIGELLANLHLATRGQIVERKTDRGLDWMLSEGRNFLSHLGETQR
FT                   ALLEKSLQEIEACKPQIMALPRANLHADLFRDNVLFEGTHLTGLIDFYNACSGPMLYDL
FT                   AITLNDWCSRENGQLDAVRARALLGAYAGLRPFTAAESKLWATMLRIACVRFWLSRLIA
FT                   AETFAGQDVLIHDPAEFERRLAERQEAHIALPFAL"
FT   gene            complement(291899..292735)
FT                   /locus_tag="Psyr_0273"
FT   CDS_pept        complement(291899..292735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0273"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35346"
FT                   /db_xref="GOA:Q4ZYW0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZYW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35346.1"
FT                   /translation="MELRPLHPLDGLLKFAGLARSTFYYQQKVLLVDDKYAGLKDLIQA
FT                   TFYEHKGRYGYRRITAALRRAGHLVNHKTVQKLMGQLGLKSLIRVKKYRSYKGETGKAA
FT                   PNLLKRDFKAQYLNQKWATDVTEFKVGGQKLYLSPIMDLYSGEIISYAIARRPLYSMVD
FT                   EMLEGAFKRLGPHEKPILHSDQGWQYRMPIYQRLLNENSIAASMSRKGNCYDNAAIESF
FT                   FSTLKSEFFYLNKFNDLDELQAGIEEYIEYYNHSRIKLKLNGLSPVEYRMQAAKAA"
FT   gene            complement(292735..293274)
FT                   /locus_tag="Psyr_0274"
FT   CDS_pept        complement(292735..293274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0274"
FT                   /product="ISPsy9, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35347"
FT                   /db_xref="GOA:Q4ZYV9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZYV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35347.1"
FT                   /translation="MGKYTEQAKLAAVKEYCAGKAGLRDVARRHDVDFSCLRQWVAAYQ
FT                   IHGPAALKEKRRQRYSDEFKLAVLKRMHDERLSLRQTAALFDIRQFGIINLWQRLFDEG
FT                   ALNASSKPPKKVGRPRKMTTPLPPVNSAPINDESRSRDELLAEVKQLRMEVDYLKKLDA
FT                   LVQKKQRIAQQKKRKS"
FT   gene            complement(293509..294450)
FT                   /locus_tag="Psyr_0275"
FT   CDS_pept        complement(293509..294450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0275"
FT                   /product="Periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35348"
FT                   /db_xref="GOA:Q4ZZS4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35348.1"
FT                   /translation="MRRLLNLAAVFWVSLLIISPAQAEVRVLTSIKPLQLIAAAVQDGV
FT                   GTPEVLLPPGASPHNYALRPSDVRRVQEVELLYWIGPDMETFLPRVIQGRKLPAVAVQT
FT                   LPGMHLRHFGEDNASHDDHEHDHDNDADEHDHDHRPGSLDSHLWLSTVNARVIAAKMAT
FT                   DLSAADPANAARYASNAEAFSKRLDTLDARIKQRVSTVAGKPYFVFHEAFDYFEEAYGL
FT                   KHAGVFAIAAEIQPGAQHVAAMRERLKAAGKTCVFSEPPLRPRLAETLSAGLPVKLAEL
FT                   DALGGYTPATAQGYEQVLQKLADDLAGCLSSL"
FT   sig_peptide     complement(294379..294450)
FT                   /locus_tag="Psyr_0275"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            294518..295000
FT                   /locus_tag="Psyr_0276"
FT   CDS_pept        294518..295000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0276"
FT                   /product="zinc uptake regulation protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35349"
FT                   /db_xref="GOA:Q4ZZS3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35349.1"
FT                   /translation="MPNTPLASRPHDHSHCVHSALAEADALCAKQGLRLTTLRRRVLEL
FT                   VWQSHKPLGAYDILAVLSDEDGRRAAPPTVYRALDFLLENGLVHRIASLNAFTGCNHPT
FT                   HAHQGQFLICRLCHAAIELQHPAISNAVVDAAAGVGFAVEGQTVEIVGVCAGCKAA"
FT   gene            295000..295788
FT                   /locus_tag="Psyr_0277"
FT   CDS_pept        295000..295788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0277"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35350"
FT                   /db_xref="GOA:Q4ZZS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35350.1"
FT                   /translation="MSDALIRLDKVAVTLSGQNVLDDIQLSVKPGEIVTLIGPNGAGKT
FT                   TLVRAVLGLLKPDSGTVWRKPKLRVGYMPQKLHVDQTLPLSVLRFLRLVPGVDRTAAAS
FT                   ALEEVGAGKVIDSPIQGISGGEMQRVLLARALLRKPELLVLDEPVQGVDVAGQAELYSL
FT                   ITRLRDRHRCGVLMVSHDLHLVMSTTDQVVCLNRHVCCSGHPEQVSHDPAFVELFGKNA
FT                   QSLAIYHHHHDHAHDLHGAVVNDAAPLSHTHVHGDSCKHG"
FT   gene            295781..296569
FT                   /locus_tag="Psyr_0278"
FT   CDS_pept        295781..296569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0278"
FT                   /product="ABC-3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35351"
FT                   /db_xref="GOA:Q4ZZS1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35351.1"
FT                   /translation="MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLG
FT                   VALGFLLDISPTIAVTVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFM
FT                   HEVRIDLMAYLFGDLLAISPADLGWILGGSTLVLVLIVALWRPLLAMTVHEELARVEGL
FT                   PVATLRMTLMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGV
FT                   IAVCAGLSLSWFKDTPAGPSIVVSAAALFLLSFVLPRRAV"
FT   sig_peptide     295781..295840
FT                   /locus_tag="Psyr_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.888 at
FT                   residue 20"
FT   misc_feature    295793..295861
FT                   /locus_tag="Psyr_0278"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    295928..295996
FT                   /locus_tag="Psyr_0278"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    296033..296101
FT                   /locus_tag="Psyr_0278"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    296159..296227
FT                   /locus_tag="Psyr_0278"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    296303..296371
FT                   /locus_tag="Psyr_0278"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    296414..296482
FT                   /locus_tag="Psyr_0278"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    296501..296554
FT                   /locus_tag="Psyr_0278"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            296608..297324
FT                   /locus_tag="Psyr_0279"
FT   CDS_pept        296608..297324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0279"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35352"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35352.1"
FT                   /translation="MKPFAPRYLLLVAFSILLGACQSAPTVETPASEAQPDAFAQLEQN
FT                   IAGNELATAEDQLAALQAANPADIRLEPFQRRLAEAYLSRSQISLQKGDMNAAASALSR
FT                   ARALMPKAPALTSGVNGAIAHARKAELEKAEADLKAAEARRVARLIDPSAESTTIELKI
FT                   GDMPALRRQLDDIAADTVAFNCEVLMVVPRTEDYPWLATLLTKRVVKANPDFELQLRRQ
FT                   IERNEKAHIILTPAKS"
FT   sig_peptide     296608..296679
FT                   /locus_tag="Psyr_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.924 at
FT                   residue 24"
FT   regulatory      complement(297435..297460)
FT                   /note="255-><-256, 99% conf. Stem=11 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(297477..299627)
FT                   /locus_tag="Psyr_0280"
FT   CDS_pept        complement(297477..299627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0280"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35353"
FT                   /db_xref="GOA:Q4ZZR9"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35353.1"
FT                   /translation="MASKNAPPVTETPKSEMAGTDTLDRGNTNEKLESLEQFRSDATQQ
FT                   ALRTNHGVKISDNQNTLKVGSRGPSLLEDFIMREKITHFDHERIPERIVHARGTAAHGY
FT                   FQTYEDHGALSKAGFLRDPGKKTPVFVRFSTVQGPRGSGDTVRDVRGFAVKLYTDEGNF
FT                   DLVGNNMPVFFIQDAIKFPDFVHAVKPEPHNEIPTGGSAHDTFWDFVSLVPESAHMVLW
FT                   TMSDRAIPKSLRTMQGFGIHTFRFINTEGKSSFVKFHWKPKFGVCSLVWDEAQKLAGKD
FT                   TDFHRRDLWESIEMGDYPEWELGVQIVAEEDEHKFDFDLLDPTKIIPEELVPVTPLGKM
FT                   VLNRNPDNYFAETEQVAFCPGHIVPGIDFSNDPLLQGRLFSYTDTQISRLGGPNFHEIP
FT                   INRPIAPNHNGQRDAQHRTTIDKGRASYEPNSIDGGWPKETPAGPVDGGFETYPERVEA
FT                   HKVRERSESFGDHFSQATLFFQSMSHHEKEHIIAAYSFELGKVEREYIRARQVNEILAN
FT                   IDMDLAKRVAANLGLPAPAAGTVPARQTSVKESPALSQVNLLSGDIVSRKVAILVADGV
FT                   DGKAVEAMKAALTAEGAHAKVLGPTSAPVKTADGKSLPVDASAEGLPSVAFDAVFVPGG
FT                   KASIEALKGDGVALHFILEAYKHLKAISFAGEAKELLSLLRLEEDAGLLEVSDSTSFKP
FT                   FFHAIAQHRVWDREAKAKAVPA"
FT   gene            299935..300942
FT                   /locus_tag="Psyr_0281"
FT   CDS_pept        299935..300942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0281"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35354"
FT                   /db_xref="GOA:Q4ZZR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35354.1"
FT                   /translation="MIEFHNVHKTYRVAGKEIPALHPTSLRVDSGQVFGIIGHSGAGKS
FT                   TLLRLINRLETPSGGQIVVDGEDVTALDANGLRRFRQQVGMIFQHFNLLASRTVADNVA
FT                   MPLTLAGDMPRKQIDQRVAELLERVGLSDHAKKYPAQLSGGQKQRVGIARALATKPKIL
FT                   LCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDAGVIVE
FT                   HGKVADVFLHPQHATTRRFVQEDEQIDENEQRDDFAHVQGRIVRLTFQGEATYAPLLGT
FT                   VARETGVDYSILAGRIDRIKDTPYGQLTLAVTGGDMDAAFARFTAADVHMEVLR"
FT   gene            300942..301616
FT                   /locus_tag="Psyr_0282"
FT   CDS_pept        300942..301616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0282"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35355"
FT                   /db_xref="GOA:Q4ZZR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35355.1"
FT                   /translation="MDAFLNLFSNVDWYEIWVATGDTLIMLGVSLGFTILLGLPLGVLM
FT                   FLTSPRQLLEHKQLYATVGVIVNMLRALPFIILLIVMMPLTEIITGTSLGILGTLPPLI
FT                   AGATPFFARLVETALREVDRGIIEATQAMGATTRQIIVKALLPEARPGILAAITVTAIA
FT                   LVSFTAMAGAVGAGGLGDLAIRYGYQRFQNDVMFVTVVLLLVLVQILQTIGDRLVAHFT
FT                   HR"
FT   misc_feature    301014..301082
FT                   /locus_tag="Psyr_0282"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    301119..301187
FT                   /locus_tag="Psyr_0282"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    301215..301283
FT                   /locus_tag="Psyr_0282"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    301398..301466
FT                   /locus_tag="Psyr_0282"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    301524..301583
FT                   /locus_tag="Psyr_0282"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            301667..302440
FT                   /locus_tag="Psyr_0283"
FT   CDS_pept        301667..302440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0283"
FT                   /product="NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35356"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35356.1"
FT                   /translation="MKKLLAIFAAVTALSAQANETLTVAASAVPHAEILEFVKPTLAKE
FT                   GVDLNIKVFNDYIQPNVQVSQNRMDANFFQHQPYLDEFNKGKGTDLVAVAKVHIEPFGA
FT                   YSEKFKTLAELPNDANVALPNDATNEGRALLLLAKAGLITLKEPGNILSKPSDVVNNPK
FT                   NLKFRELEAATLPRVLTQVDLALINTNYALSAKLDPTKDALILEGADSPYANILVARPD
FT                   NKDSDAMKKLVAALQSPEVKTFLAEKYKGAVLPAF"
FT   sig_peptide     301667..301723
FT                   /locus_tag="Psyr_0283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 19"
FT   gene            complement(302686..303318)
FT                   /locus_tag="Psyr_0284"
FT   CDS_pept        complement(302686..303318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0284"
FT                   /product="Electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35357"
FT                   /db_xref="GOA:Q4ZZR5"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35357.1"
FT                   /translation="MTRTQKSVFIAAAIVALILGVILSQVLPGRSSQDQAALNDAGIVL
FT                   LPKSRQLPALSMTDQNGAAVPLDGLKDQWTLMFFGYTFCPDICPTTLAQIKQIRSELPE
FT                   ETVKRMRVVLVSVDPNRDTPQQLKQYLGYFDPQYIGLTAPVADIQTLANAVSIPFIPAD
FT                   TGKPNYFVDHSGNLALIGPDGTQRGFIRAPLNNRKLVKQLPGLLGRD"
FT   misc_feature    complement(303232..303297)
FT                   /locus_tag="Psyr_0284"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(303244..303318)
FT                   /locus_tag="Psyr_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.741 at
FT                   residue 25"
FT   gene            complement(303388..303879)
FT                   /locus_tag="Psyr_0285"
FT   CDS_pept        complement(303388..303879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0285"
FT                   /product="Cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35358"
FT                   /db_xref="GOA:Q4ZZR4"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35358.1"
FT                   /translation="MSQPLLSKRLVLRLTCLIVIMLIGGLALPSLYGVLTGHDNALPGE
FT                   DASRQVEVQFTASNVAGMTWAFYPQASQMQVHPGTVNEMIFIAQNPTDRPMKAQAVPGI
FT                   SPGKAAAWFHKTECFCFTQQTLQPGERIEMPVRFIIDRDMPDDVKHLTLAYTLFDVTTP
FT                   "
FT   sig_peptide     complement(303778..303879)
FT                   /locus_tag="Psyr_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.544 at
FT                   residue 34"
FT   misc_feature    complement(303784..303849)
FT                   /locus_tag="Psyr_0285"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            304127..304777
FT                   /locus_tag="Psyr_0286"
FT   CDS_pept        304127..304777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35359"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35359.1"
FT                   /translation="MNTAALREQIQLAHQHEARTGHLLQQLAQKLPHLHPAIHLPEVDA
FT                   KDVLARFVTAYIDLVPDLLDAAHEVALEAGIEGQIKPVLKIAEHFFAAPPSIMDGHEGL
FT                   ESLLDEAYLAHRLVEEVNDLYIKHFGQPLIPSNTTVASVIAHQLIGEQFANQLDEAVHH
FT                   AVDELLDEESFALDSVEAYREKLISPETGAAWQRWPSLSRQLGVGLELERSAV"
FT   gene            complement(304898..306430)
FT                   /locus_tag="Psyr_0287"
FT   CDS_pept        complement(304898..306430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0287"
FT                   /product="Sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35360"
FT                   /db_xref="GOA:Q4ZZR2"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35360.1"
FT                   /translation="MGITALKTALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLIT
FT                   GIVGGLIVGWIAGSPLQVSGPAAGLAVLVFEVVREHGMAMLGPILVLAGLLQLLAGRFK
FT                   LGCWFRVTAPAVVYGMLAGIGVLIVLSQAHVMFDSGPKPSGLDNLIAFPSTLIQAFGPG
FT                   TGMQAGMLGLGTMLIMWGWEKLRPQSLRFVPGALLGVGIATGISLFMALQVKRVEVPDN
FT                   LADAIDWLRPADLMNLADPAILVAAIVVAFIASAETLLSASAVDRMHSGQRSDFDKELS
FT                   AQGVGNMLCGVLGALPMTGVIVRSSANVQAGATTRFSTIFHGLWLLAFVLLLSSVLQSI
FT                   PVASLAGVLVYTGLKLVDLKAFRGLGRYGRMPMFTYAATAVAIIFTDLLTGVLVGFGLT
FT                   LVKLAFKASRLKINVVELAGEKEFELRLVGAATFLKVPALTQALGTIPQGSTVHVPLGN
FT                   LSYIDHSCLELLEEWGRSNAAHGTRLLIEPRGLKRRLEGRIYTTTGIGSGAA"
FT   misc_feature    complement(305243..305308)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(305369..305461)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(305522..305578)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(305639..305704)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(305789..305854)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(305894..305959)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(306020..306085)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(306122..306187)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(306233..306298)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(306320..306385)
FT                   /locus_tag="Psyr_0287"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(306326..306430)
FT                   /locus_tag="Psyr_0287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.887 at
FT                   residue 35"
FT   gene            complement(306535..307275)
FT                   /locus_tag="Psyr_0288"
FT   CDS_pept        complement(306535..307275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0288"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35361"
FT                   /db_xref="GOA:Q4ZZR1"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35361.1"
FT                   /translation="MTDIGKQHSATSSSTSSHSDSADVALKHIVDGFVHFRKEVFPQQE
FT                   ELFKKLATAQSPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVST
FT                   ALEYAVVALGVQHIIVCGHSDCGAMRAVLNPDSLDKMPTVKAWLRHAEVARTVVEQNCS
FT                   CSGELETMQVLTQENVISQLQHLRTHPSVAAKMASGQLFIHGWVYSIETSEILAYDAEL
FT                   DRFIPLDGTGPTPMASPKARFSAD"
FT   gene            complement(307483..308541)
FT                   /locus_tag="Psyr_0289"
FT   CDS_pept        complement(307483..308541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0289"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35362"
FT                   /db_xref="GOA:Q4ZZR0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35362.1"
FT                   /translation="MSSPYPVRGRGTASNPHNRFAPSQSVAEDDGWYQEVPLTQGTQVT
FT                   SETAKSIITRNSSPDIPFDRSINPYRGCEHGCIYCFARPSHAYWDMSPGLDFETRLIAK
FT                   TNAAALLEQQLSKPGYRCAPITLGANTDPYQPIEREYRITRATLEVLLRYRHPVSIITK
FT                   GSLILRDLDLLAEMARLRLVSVFVSLTTLDDELKCILEPRAAAPKARLRAIRVLRQAGV
FT                   PVGVLCAPMIPMINDSELEALLSEAKAAGALSASYVMLRLPLEVAPLFDEWLKTHYPQR
FT                   AEHVMSLIRQSRGGAVYDSTFGSRMRGEGPFADLLAQRYALAIKRLGLNKRGGFALDCD
FT                   AFCPPGGQMSLL"
FT   regulatory      complement(308619..308641)
FT                   /note="265<--266, 100% conf. Stem=9 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(308664..309332)
FT                   /locus_tag="Psyr_0290"
FT   CDS_pept        complement(308664..309332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0290"
FT                   /product="ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35363"
FT                   /db_xref="GOA:Q4ZZQ9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35363.1"
FT                   /translation="MQKKVAVILSGCGVYDGAEIHESVLTLLRLDQRGAQVQCFAPDIN
FT                   QHHVVNHLTGEEMPESRNVLVESARIARGEVKDIREANAEDFDALIIPGGFGSAKNLSD
FT                   LALQGPACQVEAGLLELAEAFAEAGKPVGLICITPALAAKIYGPGVTCTIGNDPETAAA
FT                   ITKMGGSHAECAVDDIVEDEARKLVSTPAYMVAKSISEAASGINKLVDRVLELTHEGDA
FT                   "
FT   gene            complement(309519..310181)
FT                   /locus_tag="Psyr_0291"
FT   CDS_pept        complement(309519..310181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0291"
FT                   /product="DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35364"
FT                   /db_xref="GOA:Q4ZZQ8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35364.1"
FT                   /translation="MLQNFLNEFGYFALFLGTFFEGETILVLAGFLAFRGYMDLNIVIL
FT                   VAFFGSYAGDQLWYFMGRKHGRKLLARKPRWQLMGDKALRLVRKHPDIWVLGFRFVYGL
FT                   RTVMPVAIGLSGYPPGRYLLLNGIGAAVWAAALGSAAYHFGAVLEGLLGNVKKYELWVL
FT                   GALILLGLALWIRRRIKNARIAREEREERSRFCASAAASDLEEPITVPVDLTKKSDE"
FT   misc_feature    complement(309654..309704)
FT                   /locus_tag="Psyr_0291"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(309750..309815)
FT                   /locus_tag="Psyr_0291"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(309837..309902)
FT                   /locus_tag="Psyr_0291"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(309996..310061)
FT                   /locus_tag="Psyr_0291"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(310083..310148)
FT                   /locus_tag="Psyr_0291"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            310413..311423
FT                   /locus_tag="Psyr_0292"
FT   CDS_pept        310413..311423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0292"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35365"
FT                   /db_xref="GOA:Q4ZZQ7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35365.1"
FT                   /translation="MSFTPANRLFPLTRLRRNRRDDFSRRLVRENVVTVDDLILPVFVL
FT                   DGENRRESIASMPGVERLSVDLLLKEAEHWVALGIPALALFPVTPPEKKSLDGAEAWNP
FT                   DGIAQRATRALRDRFPELGVITDVALDPFTTHGQDGILDEEGYVQNDITVDALVKQALS
FT                   HADAGAQVIAPSDMMDGRIQAIRESLELAGHVNVRIMAYSAKYASAYYGPFRDAVGSSL
FT                   NLGKANKASYQMDPANSNEALHEVAADLAEGADMVMVKPGMPYLDILYRVKDEFKVPTF
FT                   VYQVSGEYAMHMAAIQNGWLSEGVILESLTAFKRAGADGILTYFAVRAAQLLKGQ"
FT   gene            311440..313650
FT                   /locus_tag="Psyr_0293"
FT   CDS_pept        311440..313650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0293"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35366"
FT                   /db_xref="GOA:Q4ZZQ6"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35366.1"
FT                   /translation="MNTEALIEAAVQVDVPEATPVVEPDIEVIPAIEAPAAVVPAIVAP
FT                   NLDDSSLYIHRELSQLQFNIRVLEQALDESYPLLERLKFLLIFSSNLDEFFEIRVAGLK
FT                   KQITFAREQAGADGLQPHQALARISELVHGHVDRQYAILNDILLPELEKHQVRFIRRRH
FT                   WTAKLKAWVRRYFRDEIAPIITPIGLDPTHPFPLLVNKSLNFIVELEGIDAFGRDSGLA
FT                   IIPAPRLLPRVIKVPEEVCGPGDNFVFLSSMIHAHADDLFQGMKVKGCYQFRLTRNADL
FT                   ALDSEDVEDLARALRGELFSRRYGDAVRLEVADTCPKHLSDYLLKQFNLHESELYQVNG
FT                   PVNLTRLFSITGLDSHPELQYPPFTPAIPKLLQNSENVFSVVSKQDILLLHPFESFTPV
FT                   VDLLRQAAKDPHVLAVRQTLYRSGANSEIVDALVDAARNGKEVTAVIELRARFDEESNL
FT                   QLASRLQAAGAVVIYGVVGFKTHAKMMLILRREAGEIVRYAHLGTGNYHAGNARLYTDY
FT                   SLLTSDDALCEDVGKLFSQLIGMGKTLRMKKLLHAPFTLKKGMLDMIARETQFALDGKP
FT                   AHIIAKFNSLTDPKIIRALYKASQSGVRIDLVVRGMCCLRPGIAGVSHNIHVRSIIGRF
FT                   LEHTRVFYFLNGGDEQMFLSSADWMERNLDKRVETCFPVEGKKLILRVKKELESYLTDN
FT                   THSWLLQSDGRYVRSTPTGNQNPRSAQATLLERLSNPVLSVR"
FT   gene            complement(313637..315217)
FT                   /locus_tag="Psyr_0294"
FT   CDS_pept        complement(313637..315217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0294"
FT                   /product="Exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35367"
FT                   /db_xref="GOA:Q4ZZQ5"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35367.1"
FT                   /translation="MPEQLRVGGRHGSWHDGPVIEPDFLTMPHSTPKNFSLIAAIDLGS
FT                   NSFHMVVAKANQGEIRILERLGEKVQLAAGIDEERQLTEESMQRGLDCLKRFAQLINGL
FT                   PPGAVRIVGTNALREARNRNDFIHRAEEILGHPVEVISGREEARLIYLGVSHTLADTPG
FT                   KRLVADIGGGSTEFIIGQRFEPLLRESLQMGCVSFTQRYFRDGKVTPARYAQAYTAARL
FT                   EIMSIEHALHRLKWDEAIGSSGTIRAIGLALKANGYGAGEVNAEGLAWLKRKLFKLGDV
FT                   DKIDFDGIKPDRRAIFPAGLAILEAIFDALELKRMDHCEGALREGVLYDLMGRHHHEDV
FT                   RERTLSSLMERYHVDLEQAARVEAKALHALEQVAESWELQHESYAELLSWAAKVHEIGL
FT                   DIAHYHYHKHGAYLIEHSDLAGFSREDQQMLALLVRGHRRNIPKDKFADFGAEGIKLIR
FT                   LCVLLRFAILFHHIRGTQEMPRVTLRADGPNLDAEFPKGWLENNQLTQADFALEAEWLT
FT                   RVGIVFSVR"
FT   gene            complement(315811..316545)
FT                   /locus_tag="Psyr_0295"
FT   CDS_pept        complement(315811..316545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0295"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35368"
FT                   /db_xref="GOA:Q4ZZQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35368.1"
FT                   /translation="MPLLRISALHKYYGDHHVLKGIDLSVEEGQVVAIIGRSGSGKSTL
FT                   LRTLNGLESINDGVIEVDGEYLDAARADLRTLRQKVGMVFQQFNLFPHLSVGENVMLAP
FT                   QVVQKVPKAEAAKLARKMLERVGLGEKFDAFPDRLSGGQQQRVAIARALAMSPKVLLCD
FT                   EITSALDPELVNEVLSVVRQLAADGMTLIMVTHEMRFAREVGDKLVFMHQGKVHEVGDP
FT                   KELFANPKTPELANFIGTVEHA"
FT   gene            complement(316532..317179)
FT                   /locus_tag="Psyr_0296"
FT   CDS_pept        complement(316532..317179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0296"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35369"
FT                   /db_xref="GOA:Q4ZZQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35369.1"
FT                   /translation="MDFTLWDIVRNLLIGLQWTVALSLVAFIGGGLIGLLIMGMRTSEK
FT                   SGPRVTAKLYIELFQGTPLLMQLFLVFFGVALMGLNISPWAAAALALTLFTSAYLAEIW
FT                   RGCVESISKGQWEASASLALTPFEQMRYVILPQALRIAVAPTVGFSVQVVKGTAVTSII
FT                   GFTELTKTGSMLANATFEPFMVYGFVALGYFILCYPLSLCARHLERRLHASA"
FT   misc_feature    complement(316574..316630)
FT                   /locus_tag="Psyr_0296"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(316691..316756)
FT                   /locus_tag="Psyr_0296"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(316868..316924)
FT                   /locus_tag="Psyr_0296"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(316940..317005)
FT                   /locus_tag="Psyr_0296"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(317069..317134)
FT                   /locus_tag="Psyr_0296"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(317179..317844)
FT                   /locus_tag="Psyr_0297"
FT   CDS_pept        complement(317179..317844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0297"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35370"
FT                   /db_xref="GOA:Q4ZZQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35370.1"
FT                   /translation="MAYHFDFTPVLQNLDVLLRGALFTLELTAIGTLLGVSLGIVGAVV
FT                   RAWKIQPFATIFAIYVELIRNTPFLVQLFFIFFGLPSLGVQITEWQAAVLAMVINLGAY
FT                   STEIVRAGIQAIPKGQLEASAALAMSRYEAFRHVVLVPALGKVWPALSSQIIIVMLGSA
FT                   VCSQIATEELSFFANFIQSRNFRSFETYIVTTLIYLAMALLIRQLLAWIGRRYISRNR"
FT   misc_feature    complement(317206..317271)
FT                   /locus_tag="Psyr_0297"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(317581..317646)
FT                   /locus_tag="Psyr_0297"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(317710..317775)
FT                   /locus_tag="Psyr_0297"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(317876..318661)
FT                   /locus_tag="Psyr_0298"
FT   CDS_pept        complement(317876..318661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0298"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35371"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35371.1"
FT                   /translation="MTKRYSALLTALFASLMLSQTPAHANGLDDVVARGTLKVAVPQDF
FT                   PPFGSVGPDMKPRGLDIDTAQLLADKLKVKLELTPVNSTNRIPFLTTGKVDLVISSLGK
FT                   NPDREKVIDFSRAYAPFYLAVFGPPDSPVKDIADLKGKTISVTRGAIEDIELSNVAPEG
FT                   ATIKRFEDNNSTIAAYLAGQTDLIASGNVVMVAISERNPKRIPAMKVKLKDSPVYVGVN
FT                   KGQPELLGKVNEILNAAKADGTLEKASQKWLKDPLPADL"
FT   sig_peptide     complement(318584..318661)
FT                   /locus_tag="Psyr_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            318912..319616
FT                   /locus_tag="Psyr_0299"
FT   CDS_pept        318912..319616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0299"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35372"
FT                   /db_xref="GOA:Q4ZZQ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35372.1"
FT                   /translation="MPHTSLAVPESALRAIRKLIAEQGYKPGESLPSQRDLAVLLGVSR
FT                   ASLREALSSLSALGVVSVQPGKGVFVQSISEPEQRTGGFSWPYEAQVSPADTFQLRYAL
FT                   EGFAAGMAAVTLTADERDVLEDNVEAMRLELRAGDFEAAARLDFEFHRHILVASGNQAM
FT                   LGIVTAGADIFLESQKMPFIRAARVMETWQEHRKILRALARHASGPAQKAMQDHIRGAA
FT                   LRTGIVFVSPAN"
FT   gene            319738..320088
FT                   /locus_tag="Psyr_0300"
FT   CDS_pept        319738..320088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0300"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35373"
FT                   /db_xref="GOA:Q4ZZP9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35373.1"
FT                   /translation="MSSDLIKHVTDGTFDAEVLEAQGPVLVDYWAEWCGPCKMIAPVLD
FT                   EIASTYKGRLTVAKLNIDQNPDTPAKHGVRGIPTLMLFKGGNVEATKVGALSKSQLTAF
FT                   LEGNGIDLPKPV"
FT   regulatory      320101..320117
FT                   /note="276-->277, 100% conf. Stem=7 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            320320..321579
FT                   /locus_tag="Psyr_0301"
FT   CDS_pept        320320..321579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0301"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35374"
FT                   /db_xref="GOA:Q4ZZP8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35374.1"
FT                   /translation="MNLTELKQKPITELLEMAEQAGIENMARSRKQDVIFSLLKRHAKS
FT                   GEEISGDGVLEILQDGFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPP
FT                   KEGERYFALLKVDTINYDRPENAKNKILFENLTPLFPTIRMKMEAGNGSTEDLTGRVID
FT                   LCAPIGKGQRGLIVAPPKAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRT
FT                   VRGEVVASTFDEPPTRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDAHALEKPKRFFGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGN
FT                   MELPLDRKIAEKRVFPAININRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFL
FT                   IDKLKQTKTNDEFFLSMKRK"
FT   gene            321695..323173
FT                   /locus_tag="Psyr_0302"
FT   CDS_pept        321695..323173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0302"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35375"
FT                   /db_xref="GOA:Q4ZZP7"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35375.1"
FT                   /translation="MAGLMKFKDLRDFVQQLEQRGELKRIQMPISPVLEMTEICDRTLR
FT                   AKGPALLFEKPVGFDIPVLGNLFGTPERVAMGMGAEAVSELREIGKLLAFLKEPEPPKG
FT                   LKDAWSKLPIFRKVIAMAPKVVKDAPCQEVVIEGDDVDLGMLPVQTCWPGDVAPLITWG
FT                   LTVTKGPNKERQNLGIYRQQVIGRNKIIMRWLSHRGGALDFRDWCVKHPGEPYPVAVAL
FT                   GADPATILGAVTPVPDSLSEYAFAGLLRGSRTELIKCRGSNLQVPASAEIVLEGVIHPG
FT                   EMADEGPYGDHTGYYNEVDSFPVLTVERITHRIKPIYHSTYTGRPPDEPAILGVALNEV
FT                   FVPILQKQFPEIVDFYLPPEGCSYRMAVVTIKKQYPGHAKRVMLGVWSFLRQFMYTKFV
FT                   IVTDDDINARDWNDVIWAITTRMDPKRDTVMIDNTPIDYLDFASPVSGLGSKMGLDATN
FT                   KWPGETSREWGRAIVKDEATTRRVDEIWTQLGID"
FT   gene            323173..324141
FT                   /locus_tag="Psyr_0303"
FT   CDS_pept        323173..324141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0303"
FT                   /product="Ferredoxin:Oxidoreductase FAD/NAD(P)-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35376"
FT                   /db_xref="GOA:Q4ZZP6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35376.1"
FT                   /translation="MRVTLQPSGAVLETLPGERILDAAQRLGYECPQSCRNGNCHVCSA
FT                   LLVEGRVMQSGQTLDHGEIHTCVAEPLTECLVLWDGVLAKGELPVRSFACQLSECVEVG
FT                   GDVWRVGLRAPAGKPPRYHAGQYLMIERENGEKSAFSIASAPHSGRDLELHVLAREDSA
FT                   RSLIEQLQRNRMARVELPFGDTHLAELPDGPLVLIAAGTGMAQMNSLLEHCRSTGFSHP
FT                   VHLYWGMRRPEDFYQVSHWDEWAKLPNLFLHKVVSDLCGWEGRCGLLHEAVCEDIKDLS
FT                   AVHVYASGSPAMIYGTLDALVDSGMDAHQMRADVFAYAPRP"
FT   gene            324350..325018
FT                   /locus_tag="Psyr_0304"
FT   CDS_pept        324350..325018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0304"
FT                   /product="ChaC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35377"
FT                   /db_xref="GOA:Q4ZZP5"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35377.1"
FT                   /translation="MENPINELAAAVHDGLGLTYPPVIDMGPQLTREQLLASMNATMRR
FT                   HKGGPVWLFAYGSLIWRPECTAVESQRARVHGYHRGLYLWSHEHRGTPEVPGLVFGLDR
FT                   GGSCTGFAYRLPDECLEKSLLALWEREMPYPSYRPHWLNCRLEDGRKVQALGFVLERHL
FT                   PSYAGNLPDSVLSQVLASARGRYGTTREYVEQTAKALRSHAMPDLNLEARLKRCKSETA
FT                   "
FT   gene            complement(325019..326368)
FT                   /locus_tag="Psyr_0305"
FT   CDS_pept        complement(325019..326368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0305"
FT                   /product="GlpT transporter:Glycerol-3-phosphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35378"
FT                   /db_xref="GOA:Q4ZZP4"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35378.1"
FT                   /translation="MFGFFRPARHQAPLPEEKVDSTYRRLRWQIFAGIFIGYAGYYLLR
FT                   KNFSLAMPYLIDEGYTRGQLGVAMSAIAIAYGLSKFLMGIVSDRSNPRYFLPFGLLVSA
FT                   GIMFIFGFAPWATSSVTIMFVLLFINGWAQGMGWPPSGRTMVHWWSQKERGGVVSVWNV
FT                   AHNVGGGLIGPLFLLGMGWTNDWHAAFYVPAAVALLVAVFAFATMRDTPQSVGLPPIEH
FT                   YKNDYPEGYDASHEEEFSAREIFVKYVLRNKFLWYIAMANVFVYLLRYGVLDWAPTYLK
FT                   EAKHFTVDKTSWAYFLYEWAGIPGTLLCGWMSDKIFKGNRGLTGMVFMFLVTIATLVYW
FT                   LNPEGNPTVDMIALVSIGFLIYGPVMLIGLQALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAAMGYTVDHFGWDGGFVLLIGACILAMVFLAPTLRHKQVASTSRDTKG"
FT   misc_feature    complement(325064..325129)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(325145..325210)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(325250..325315)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(325346..325411)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(325433..325489)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(325550..325606)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(325751..325807)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(325838..325903)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(325943..326008)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(326021..326086)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(326108..326173)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(326234..326284)
FT                   /locus_tag="Psyr_0305"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            326643..327308
FT                   /locus_tag="Psyr_0306"
FT   CDS_pept        326643..327308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0306"
FT                   /product="TonB, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35379"
FT                   /db_xref="GOA:Q4ZZP3"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35379.1"
FT                   /translation="MRMTAFMITAALAAHVGAAEPFLVPIYTPTPVFPPELVKTRYAGK
FT                   VRAQLWIKSDGQVREVRAVESGHPQLAAAVEQALRQWRYKPWVGTVGAPPMTTITVPVI
FT                   FGSHGYRRFNTEVTVGLGNIRCGYLNHEVKSARQDYPKEPLSKVDVFWYTGQALFGSHV
FT                   AHLRSEPQRQVLLEQLGAAIPMMVSNCRSNPDRLYGDYLPAPIKALIVGLAEQAEGSE"
FT   sig_peptide     326643..326699
FT                   /locus_tag="Psyr_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.502 at
FT                   residue 19"
FT   gene            complement(327895..328398)
FT                   /locus_tag="Psyr_0307"
FT   CDS_pept        complement(327895..328398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35380"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35380.1"
FT                   /translation="MDMHHFRCEGRCTMNQYEIENVIQSAIHGWLRLDVDLDYGSTAAA
FT                   MSKITRETSFSDLSKEYKPLDKNKLLASVFTSMIQKRLDIPDRFKKIYVDQLADAGIFV
FT                   GNVINKNIPNYPSTTVDAAYLEDAVNSELEYAVVKGIDFTPDVDTEIANAKTIGELAAM
FT                   IAKP"
FT   gene            complement(328687..329424)
FT                   /locus_tag="Psyr_0308"
FT   CDS_pept        complement(328687..329424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35381"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35381.1"
FT                   /translation="MEELHHHLQQLRGDLQAEIAAYVGDWSGMNYIEIADKHIHAANHL
FT                   ISSKRAHLQPGYIELANTPKENIRVAPGNGGLADLVAEARYFLDSILGLENFKRSIEDL
FT                   FARLLELDRQHAERLALEARAEEAARARAEAEEAARRLAEEQAAQQRAIEAAFQLAQRQ
FT                   VEEAEHALALRNAEEARAKEAESNRAIEMTFGPEASREIDNAIKVLRGTIEIAITDFSN
FT                   AISAHGALDMSQLEAIQNMSATH"
FT   gene            complement(329472..329744)
FT                   /locus_tag="Psyr_0309"
FT   CDS_pept        complement(329472..329744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0309"
FT                   /product="Colicin immunity protein/pyocin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35382"
FT                   /db_xref="GOA:Q4ZZP0"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35382.1"
FT                   /translation="MIFKEKIEDYTEEEFLEFLKGLSSEYSQLHGDEFIKHMDRSVEHF
FT                   VKITEHPAQTDVIFYPEEGQEDTPEGILKVIKEWRAKNGKPGFKS"
FT   gene            complement(329734..331704)
FT                   /locus_tag="Psyr_0310"
FT   CDS_pept        complement(329734..331704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0310"
FT                   /product="HNH endonuclease:S-type Pyocin"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35383"
FT                   /db_xref="GOA:Q4ZZN9"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="InterPro:IPR037146"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35383.1"
FT                   /translation="MADEQEKHIYVKYWPIPDLGSADRAAAEAAANKASGGGNSGWSIG
FT                   IGGGGGGPSTTGLGPGRGRRRGITNKQLRRLLRQQEAEAHALAQRQAAEHAAHLARLEA
FT                   EAHARAMAEAAERERVETQVRAQAEKDQAHRQALETLTASYPSLQSGLAQNYLLASASL
FT                   PNDLQKEIASGHDLNADPPRDEQALELILQKKIRVNYLLAIKQPLLEERRAQALSLTGQ
FT                   ELDHATQKDHLNYLVYYSQGDPPRVQQAHEAWIQALSQTYEAKLLAESVTLLNEQSAAL
FT                   SMRHAELSLANKPASQDARQAAGIDKLWSVIAPASTTTAATGIRTVATNIAKDQLIRIA
FT                   TRTLGSNLVTLLAMYPQPLGDAELPPAVIATPLSQLNLPPHIDLHYLASVKGTLDVPHR
FT                   LTSDEAGTSGAARWVATDGVEVGTKVRVRTFTYNAQNNSYEFIRDGESTPALIWTPIAR
FT                   PADSSTSSPAGPPALPVDPGNVVTPFVPELEAYPAIDRDDPDDYILISPIDSGLPNSYL
FT                   LFKDPRSIPGVASGYGEAVNGVWLGDKTRAEGASIPAHIADQLRGRRFGNFDSLRKATW
FT                   IAVANDPELVKQFTQHNLEIMRDGGAPYPRLVDQAGGRTKFEIHHKKHIANGGAVYDID
FT                   NLVIMTPRQHIDHHRSHENDL"
FT   gene            complement(331803..332150)
FT                   /pseudo
FT                   /locus_tag="Psyr_0311"
FT   CDS_pept        complement(331803..332150)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0311"
FT                   /note="oxidoreductase, zinc-binding"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(332270..332632)
FT                   /locus_tag="Psyr_0312"
FT   CDS_pept        complement(332270..332632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35384"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35384.1"
FT                   /translation="MERYPLFEIQDAIYHILHTNTEINLDTYSARNAANQVIWETQFSE
FT                   LHNKYGEIDKAKLALYLLNGMKNSKLETPKKLKGILEENAWSDENYSIVESDIYYELRT
FT                   EIKNTKTIGELADLLK"
FT   gene            complement(332888..333874)
FT                   /locus_tag="Psyr_0313"
FT   CDS_pept        complement(332888..333874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0313"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35385"
FT                   /db_xref="GOA:Q4ZZN7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35385.1"
FT                   /translation="MKALLCKAFGPASTLVLEDVPGPAIKKNEILLDVHAAGVNFPDTL
FT                   IIEGKYQFKPPFPFSPGGEAAGVIAAVGENVSHLKPGDRVMALTGWGSFAEQVAVPHYN
FT                   VLPIPQGMDFTTAAAFSMTYGTSMHALTQRARLQPGEILLVLGASGGVGLAAVEIGKAL
FT                   GARVIAAASSAEKLEVARNAGADELINYSETSLKDEIKRLTHGNGADVIYDPVGGDLFD
FT                   QAIRSIAWNGRLLVVGFASGRIPELPVNLTLLKGASVVGVFWGSFAQRQPQDNAANFKQ
FT                   LFAWFEEGKLKPLVSTVYPLERAGEAIDLLGGRRAVGKVVVLIGKTA"
FT   gene            334005..334412
FT                   /locus_tag="Psyr_0314"
FT   CDS_pept        334005..334412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0314"
FT                   /product="Flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35386"
FT                   /db_xref="GOA:Q4ZZN6"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35386.1"
FT                   /translation="MKAWILMLLALSLPVMAQEEAKEEGGPPKAAYVSLTPPFVGNYAL
FT                   DGGPKLRVYKADIALRVTGADAEAAVKRNDALIRNQLVSLFTQQTVDSMSSAEAKENIR
FT                   QEALKQVQRVMNDEEGKPIVEDLLFNNFIVQ"
FT   sig_peptide     334005..334058
FT                   /locus_tag="Psyr_0314"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 18"
FT   gene            complement(334419..334868)
FT                   /locus_tag="Psyr_0315"
FT   CDS_pept        complement(334419..334868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0315"
FT                   /product="Protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35387"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35387.1"
FT                   /translation="MAYWLMKSEPDEFSISDLQRLGKARWDGVRNYQARNFLRTMAEGD
FT                   KFFFYHSSCPEPGIAGIGKVARSAYPDPTALDPQSHYHDAKATEEKNPWSAIDVEFVDI
FT                   FKHVLGLGYLKQQSQLEQLPLVQKGSRLSVMPVTAEQWAAILALR"
FT   gene            335062..335214
FT                   /locus_tag="Psyr_0316"
FT   CDS_pept        335062..335214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35388"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35388.1"
FT                   /translation="MKRKPDLLWILVILFGLGVVTTGYAQSLWSTKDDAPVEITQQQQK
FT                   VPGRH"
FT   sig_peptide     335062..335139
FT                   /locus_tag="Psyr_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.688 at
FT                   residue 26"
FT   misc_feature    335080..335148
FT                   /locus_tag="Psyr_0316"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(335260..335871)
FT                   /locus_tag="Psyr_0317"
FT   CDS_pept        complement(335260..335871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0317"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35389"
FT                   /db_xref="GOA:Q4ZZN3"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35389.1"
FT                   /translation="MISAQSLTRPQLRRQLRKARKALSQSQQRAAARDIYRQLAQHPLF
FT                   RRARHVSLYLPMDGEIDPRLLLREAQRRGKATYLPVLNAWPRTRMVFQRVRPGETFIPN
FT                   RFRIPEPRIDRARQRPVWALDLILMPLVGFDDEGGRLGMGGGFYDRSLAYLARRKTWRK
FT                   PLLLGLAHECQKVDRLAQASWDVPLHGTLSDKGWYVTQTL"
FT   gene            complement(336175..336504)
FT                   /locus_tag="Psyr_0318"
FT   CDS_pept        complement(336175..336504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0318"
FT                   /product="cell division protein ZapA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35390"
FT                   /db_xref="GOA:Q4ZZN2"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35390.1"
FT                   /translation="MSNGNSVTVQILDKEYSIICPQEERTNLVSAARYLDGKMREIRSS
FT                   GKVIGADRIAVMAALNITHDLLHKEHLPDVQTSGSTREQVRDLLDKVDLVLATDTPGTP
FT                   DSTRG"
FT   gene            complement(336501..336710)
FT                   /locus_tag="Psyr_0319"
FT   CDS_pept        complement(336501..336710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35391"
FT                   /db_xref="InterPro:IPR012662"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35391.1"
FT                   /translation="MEDTDLQALMKRVELLLKYAEQLKGQNALLLAQEKTWREERAQLI
FT                   EKNEIARQKVESMISRLKALEQDS"
FT   gene            336861..337430
FT                   /locus_tag="Psyr_0320"
FT   CDS_pept        336861..337430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0320"
FT                   /product="Protein of unknown function UPF0149"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35392"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35392.1"
FT                   /translation="MPIQNSPYKAFATLLNSGGHKVSPAELHGLLLGRSCAGAGFDSEG
FT                   WFADASMLLETELLETEPQENIRAALVGLQEMVKGELTGDDMTVVLLLPGDDEPLTERA
FT                   AALGQWCQGFLAGFGLSIGDKVLGSEAKAVLEDLAAIAQVQDALEESEDGETDYMEVME
FT                   YMRVAPLLLFTEFNEPSAPQPKPSLH"
FT   gene            337506..338840
FT                   /locus_tag="Psyr_0321"
FT   CDS_pept        337506..338840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0321"
FT                   /product="aminopeptidase P, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35393"
FT                   /db_xref="GOA:Q4ZZM9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35393.1"
FT                   /translation="MIQIPKSEYARRRKALMAQMEPDSIAILPAAAVAIRNRDVEHVYR
FT                   QDSDFQYLSGFPEPEAVVVLIPGREYGEYVLFCRERNPERELWEGLRAGQEGAIREYGA
FT                   DDAFPINDIDEILPGLIEGRDRVYSAMGSNPEFDRHLMDWINVIRSKAHLGAQPPKEFV
FT                   ALDHLLHDMRLYKSAAEIKVMRCAADISARAHVRAMQACRAGLHEFSLEAELDYEFRKG
FT                   GSKMPAYGSIVASGRNGCILHYQQNDAVLRDGDLVLIDAGCEIDCYASDITRTFPVNGR
FT                   FSPEQKAIYELVLKSQQAAFAAIGPDKHWNQAHEATVKVITAGLVELGLLRGDVRELIE
FT                   SEAYKMFYMHRAGHWLGMDVHDVGEYKVGGEWRVLEVGMTLTVEPGIYISPDNLDVAKK
FT                   WRGIGVRIEDDVVVTRQGCEILSGGVPKTVAEIEALMAAAQEQVV"
FT   gene            338837..340024
FT                   /locus_tag="Psyr_0322"
FT   CDS_pept        338837..340024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0322"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase /
FT                   2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35394"
FT                   /db_xref="GOA:Q4ZZM8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35394.1"
FT                   /translation="MSRFNIAIVGGGLVGASLALSLQAGAKARGWKIVLIEPFAPGEAW
FT                   QPSYDARSSALSFGSRRIYERLGLWQQISRRAEPILQIQVSDRGRFGATRLSAIEEGVP
FT                   ALGYVVENAWLGQALWAGLDRDVVSWRVPAEVKHMQPLADGYRLSLSDDSELDCDLAVL
FT                   ADGGRSSLREQLGIGVRQRPYDQHALIANITPSEAHCGQAFERFTEDGPMALLPLPDNR
FT                   CALVWTRPGNDTQRLAELDDRSFLEELQGVFGYRLGTLRQVGARHVYPLALIEAEEQVR
FT                   SHLVILGNAAHSLHPVAGQGFNLSLRDADALAETLLDSDAPPGALPTLQLYRERQRQDQ
FT                   QLTVGFSDKVTRLFGSSRSAVATGRNVGLLGLDLLPAAKRWFARQAMGLGTRSDV"
FT   sig_peptide     338837..338911
FT                   /locus_tag="Psyr_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.627 at
FT                   residue 25"
FT   gene            340076..341305
FT                   /locus_tag="Psyr_0323"
FT   CDS_pept        340076..341305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0323"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase / 2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35395"
FT                   /db_xref="GOA:Q4ZZM7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35395.1"
FT                   /translation="METRADVLIVGAGMVGSALALALQDSGLDVLVVDGGPLSVEPFDQ
FT                   QSSFEPRVSALSAASQRILQRLGVWEGIAARRISPYAHMQVWDGSGTGQIHFSASSVHA
FT                   DVLGHIIENRVVQDALLDRLHASDIGLLANARLEQMRHSGDDWLLTLADGRQLRAPLVV
FT                   AADGANSAVRRLTETPTREWDYLHHAIVTSVRTADPHRKTAWQRFTDDGPLAFLPLERE
FT                   GEHWCSIVWSVTPAEAERLMVLEDDLFCRELEQAFEGRLGQVLSADSRLCVPLRQRHAK
FT                   RYVAGGLALIGDAAHTIHPLAGQGVNLGFLDAAVLAEVLTHAARRGERWSDLRVLGRYE
FT                   RRRMPHNLALMAAMEGFERLFQADPLPLRWLRNTGLKMVNRMPEAKALFVREALGLSGD
FT                   LPELARIEAR"
FT   sig_peptide     340076..340144
FT                   /locus_tag="Psyr_0323"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.739 at
FT                   residue 23"
FT   gene            complement(342094..343086)
FT                   /locus_tag="Psyr_0324"
FT   CDS_pept        complement(342094..343086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0324"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35396"
FT                   /db_xref="GOA:Q4ZZM6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35396.1"
FT                   /translation="MPEPSSLASWTPALRKQLTALGMDSDALCQSAGIDLNLLSEPGAQ
FT                   FSPDVTAALWQRAVQASLDPALGLRVSRFVSPTAFHALGYTLVASGSLREVFERIVRYR
FT                   SMAEDSLELDFRTVGERYEFRFGTPPSCQSPVHELLDAFAAIYVRTCRNRLGRGYAPLA
FT                   VHLQRPAPDDPRPWHDLFRSPVMFAAQENLLEFDGDQFDSHLDDGPVQLNGQESQGDPL
FT                   PSLIWEQRVRSAIETLLPDGEPTVRSIAEALHLSPRNLQRHLADEGCCYDLLLNQCRQN
FT                   LALLHMNDQQSSLSEIAYLLGFSDTDCLSRAFKRWTGLTPEQYRSSVVR"
FT   gene            343698..345008
FT                   /locus_tag="Psyr_0325"
FT   CDS_pept        343698..345008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0325"
FT                   /product="General substrate transporter:TonB box,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35397"
FT                   /db_xref="GOA:Q4ZZM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35397.1"
FT                   /translation="MKIKGIRWWMVGLVTAGLVVNYLARNTLSVAAPTLMSELSISTEQ
FT                   YAHIVVAWQLCYAIMQPVAGYIIDAIGTKMGFAIFAIAWSAACAAAAFATGWQSLAIFR
FT                   GMLGLTEAAGLPAGVKATTEWFPAKERSVAIGWFNIGSSFGALLAPPLVVWAILQSGWE
FT                   LAFLIVGGLGIVWSGLWLLLYKHPRDQKRLGDAERDYILSGQEARLKDAPAQKGSWKRL
FT                   FKNRNFYAIASARILSEPAWQTFNAWIPLYLMTERHMNIKEVAMFAWLPFLAADIGCVL
FT                   GGYLSPLFHKYCKVSLFTSRKMVMLFGCSCMIGPACIGLVESPYTAIALLCIGGFAHQT
FT                   LSGALYSITSDSFGKNEVATATGMGGMFGFFGAAAFTMVFGVLVTKIGYSPLFVVLAIF
FT                   DIVAAIVVWNVAREVPQYDDTVPLTADEQGPRTVPAT"
FT   sig_peptide     343698..343772
FT                   /locus_tag="Psyr_0325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.653) with cleavage site probability 0.481 at
FT                   residue 25"
FT   misc_feature    343710..343769
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    343842..343910
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    343920..343988
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    344100..344168
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    344181..344249
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    344496..344564
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    344607..344660
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    344679..344747
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    344775..344843
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    344862..344930
FT                   /locus_tag="Psyr_0325"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   regulatory      345069..345100
FT                   /note="299-->300, 100% conf. Stem=14 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            345222..345803
FT                   /locus_tag="Psyr_0326"
FT   CDS_pept        345222..345803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0326"
FT                   /product="Protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35398"
FT                   /db_xref="GOA:Q4ZZM4"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35398.1"
FT                   /translation="MHNESIRYLIVPGWQGSPDDHWQTHWQNSLPNSTRVEQADWLKPR
FT                   REDWVGELQRTIAAHDTPVILIAHSLGCVTVAHWARLAPLETLRQVQGALLVAPADVER
FT                   PNCPPALRNFAPIPTDLLPFPTQIVSSDNDPAVSSQRAMEMARHWGAELGFLSQAGHIN
FT                   VKSGHQRWEQGFAYLYRLQNRLEQHARRRA"
FT   gene            345887..346837
FT                   /locus_tag="Psyr_0327"
FT   CDS_pept        345887..346837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0327"
FT                   /product="Sigma-54 factor, interaction region"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35399"
FT                   /db_xref="GOA:Q4ZZM3"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35399.1"
FT                   /translation="MSLHENFGQPLLTFPDAEKSPLSIRAKALVFIDPRSRRLREEMEQ
FT                   LAPRSLPVLIRGESGTGKELLARHIHRGSDRSGLFVSVNCGAISPTYADAELFGYAAGA
FT                   HSGTVSSRAGWFGSANGGTLYLDEIGDLPLPIQVKLLAALENHEVTRVGAQQPSPVDVR
FT                   LVAATSIDLAQAVAAGKFHERLYHYLSEGRLDLPALREQPGNILPLAEYFVGIYSQRLN
FT                   LPVQLISEEAQRTLEAHSWPGNTRELENVIHFALLVSSGDEIRAQDINLPDIADPLTLI
FT                   ERQTQLLLNGSDGRQLSALRQLLETVTSELARRPA"
FT   gene            347041..347823
FT                   /locus_tag="Psyr_0328"
FT   CDS_pept        347041..347823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0328"
FT                   /product="NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35400"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35400.1"
FT                   /translation="MKKTFLLTALAAVFSIGLAHAGEKLVVGATPVPHAEILKLIQPTL
FT                   AKEGVDLEIKVFTDYVQPNVQLSEKRLDANYFQTKPYLDGFNKGKGTNLVTGVGVHVEP
FT                   FGGYSKKYKSVKDLPEGATIAIPNEGSNAGRALILLDKNGLITLKDPKNALSTPKDIAS
FT                   NPKNFKFRELESAVLPRALSQVDLALINTNYALEAKLNPKKDALIIEGSDSPYVNFLVT
FT                   REDNAHTDAIEKLSKALTSQEVKDFINKKYDGAVLPAF"
FT   sig_peptide     347041..347106
FT                   /locus_tag="Psyr_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(347986..349239)
FT                   /locus_tag="Psyr_0329"
FT   CDS_pept        complement(347986..349239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0329"
FT                   /product="Secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35401"
FT                   /db_xref="GOA:Q4ZZM1"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35401.1"
FT                   /translation="MYSSPGSSTALVALLIALLTGCSGAPGTSAKTVGDTQPGEGGVPA
FT                   FYAWTDKVPSTPGRMLRAEPLTPIQSLDNAGQNVRILYTSTDGLNNQPVVVSGALFTPK
FT                   GTPPKGGWPLMAWAHGTVGSADVCAPSFAGRSGRDTRYLNEWLGRGYAIVATDYEGLGT
FT                   PGLHPFGLSSPLAYGVLDSIRAVQRADFNLSSRVVVFGQSQGGRAAFATAVYKKTYAPE
FT                   LNIVGVVATGTPYPMASGHAGHIGQGTSRDQVTPSLAYNLLRLSTAGLINPSFVPTDYL
FT                   SDRAQPAFGVSQRDCLHAIEREVVADGLTFNNSFSRSPEAALDQVNRESSYPTLTSDIP
FT                   IFIGTGGKDVVSPVRSQIALVKDACTAGDRIEWHYYPQLDHSGAVNGSLPDSTRFVEKA
FT                   FSGELMTGNCGETKSVAR"
FT   sig_peptide     complement(349147..349239)
FT                   /locus_tag="Psyr_0329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.869 at
FT                   residue 31"
FT   gene            349706..350386
FT                   /locus_tag="Psyr_0330"
FT   CDS_pept        349706..350386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35402"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35402.1"
FT                   /translation="MRVVDSSVLKKWYDSEYSACSSGTLFGELREELKRFLSNLPDGPG
FT                   DVLELGCGDGRNLAALAIKGYSLSGVDMVDSTVHSRQLNPWLKDMNFQQANILNYTPAP
FT                   EGYDVLVCSEVLHFFTKDELQQVMPKIIGAVKPGGYIVLDLLSDLTRFFQATGEPFIWD
FT                   KEAGLSIQDSEGFFDRWLSGFDIVDFSHFFDNQSWPLTDSVSLPIEPYTWQGTYVSVCA
FT                   KKRK"
FT   gene            350422..351963
FT                   /locus_tag="Psyr_0331"
FT   CDS_pept        350422..351963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0331"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35403"
FT                   /db_xref="GOA:Q4ZZL9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35403.1"
FT                   /translation="MQLFHQVIADNARRYPTKPAIILDGQATSYRELQQRVDDIASLLA
FT                   TLGILPGDRVGLYAPISIDLIASYLGMLQAGVITAATHHTLSRTKLIHQLKHSGARVLI
FT                   TDCTDDLPDLINEAGLELVLLTVPIPTAIPGVIQLAEAVSGYRDEVSAVASLLTDDPER
FT                   PTSIFYTSGSTFNPKGVLVNHRIMLAASSRVTAYLGNEADDRILSYSTLASDYGVYNVM
FT                   MPLYAGATSVIESRPAGSAEEVLAVVEREAVTAMHVFPPVFCLLANAGPEWQARVPGLR
FT                   YISSSGQALHSRHIQRIRQALPQVQIFSNYGLTECKRVSYLPPEEIDRRPTSVGKPLPG
FT                   VSLYLVDEHDRVIDQPGQVGELLVTSDYLMLEYWDMPEANARAFVHNAFGHSRLYRSGD
FT                   LFKQDAEGYLYYVARKDDVFARNIWNVNPREIEQCLASHPAVAEVLVVPVADESAGHVP
FT                   KACIVLDSDHRQTSGQTLIDYCKAHLDWHMVPTQCVFLEALPKTDSGKFSAKGLI"
FT   gene            351980..353011
FT                   /locus_tag="Psyr_0332"
FT   CDS_pept        351980..353011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35404"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35404.1"
FT                   /translation="MKTSLQPNVDTPLDRDLQQSAMLKLAGHFHSLATGATQVPLQSLD
FT                   SHLRCEIQDPQVLDYHDRLISGAGPLFSHFLASVPYILEELARVGVALARFAQLNSRET
FT                   GQTFSLFEVDAFDGSNGRALAGHSHGLIQSFTSSPNAANQITFNRHADPALSLFFAQSV
FT                   FKVTGALLATPEYDRFRGGFDFIYEMAAFQFYTRDRVGQISHIKQFLKPGGLVFFLEKL
FT                   DHPDPEEYLLRERIKDEQFKTRYFSEEEIRWKRQQMLEYMQNGQVTLEALVSALCARFK
FT                   CVHLLWSSSNFCEFVASDDPQQLEQFLDLLGPTVQPADFCFERSRLGAIAPSQKGVVEF
FT                   GDA"
FT   gene            353004..354185
FT                   /locus_tag="Psyr_0333"
FT   CDS_pept        353004..354185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35405"
FT                   /db_xref="GOA:Q4ZZL7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35405.1"
FT                   /translation="MLEPAEQAFQRNVVSLMCQRAVAYLPLWRERAAVAETNRRLSSST
FT                   FDELFTEGWLDLVSPRAPVTRTGHWPTLVESARIAARACASTGWMLALVGGHGSIARRL
FT                   PPACVDQLYSHGPRQLFASASTSTDSLLSFEPEGVRVDGRWRFSSGIEDATWLMLNAPC
FT                   ADHPEAACTPRFLVLVAANEVERLHNWDSCGMAATGSHDVLLRRLLVPHDRVFALHEVF
FT                   AQDPLALACDYIDRLPLVPYLTTSIIGPLLGCAEGALAAFVAAFNSSSAVSDPRIAEQA
FT                   AHSAAQLYSVELLYDSLISRLHEAGLSDRVLDAAQLLQLKRDRAYLAQQCVQAVHRLVE
FT                   RLGASSLVASNPLQRHWRDIQAMAAHRDVTWNETMQACGDAILRPATDNAQKN"
FT   gene            354221..354607
FT                   /locus_tag="Psyr_0334"
FT   CDS_pept        354221..354607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0334"
FT                   /product="ectoine synthase"
FT                   /EC_number="4.2.1.108"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35406"
FT                   /db_xref="GOA:Q4ZZL6"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35406.1"
FT                   /translation="MFVRNKTDVENTPYFVEWGAGTSHRLLTERDAMGFTLCHTIVRAG
FT                   TESLLHYRNHLEACYCIGGEGEVEDMQGNVFPIRPGDVYVLDQHDRHFLRGGKEQDLIL
FT                   VSVFNPPLRGDERHNLNDGTGSAY"
FT   gene            354656..355882
FT                   /locus_tag="Psyr_0335"
FT   CDS_pept        354656..355882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0335"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35407"
FT                   /db_xref="GOA:Q4ZZL5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35407.1"
FT                   /translation="MRKDYLAFFISLFLSRLADQILLFIVPLVVFQTTNSASWAGLAFF
FT                   VESLPRFLAFPLCGALCDKYPPVKILHISQIYRASLCVLAMVLYAIFGGIGWLVVLSAL
FT                   CGVLTTQGIMAREVLMPYIFQHYSYTRTLSYSQIADQSGLVLGPLVAALMLEVWAWHWV
FT                   VLLTAGLFLLADLSMLAWQRLSRITLEVFEQHQDIWLQPLRIAFGHIRSLAELKKIITL
FT                   AVGVNLIVGVTLATSAAMVIGEYSAGKDSYAGLQAAGAVTTIVILFFLARVALPMRVLG
FT                   GVGFSMIATGAFISALSPNLIGYALGFLLIVGFDKMFNVYMRTLRQRVIPPQDFGKTVG
FT                   VITLLNNLSQPLAGLLVALLAAPLGIRQVILMLAMLTSVIGAGALWWFAKARSPFPTRI
FT                   VEADREAGK"
FT   sig_peptide     354656..354712
FT                   /locus_tag="Psyr_0335"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.565 at
FT                   residue 19"
FT   misc_feature    354674..354742
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    354770..354838
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    354899..354967
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    355127..355195
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    355313..355381
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    355409..355477
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    355490..355546
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    355556..355624
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    355685..355753
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    355763..355822
FT                   /locus_tag="Psyr_0335"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(355995..358982)
FT                   /locus_tag="Psyr_0336"
FT   CDS_pept        complement(355995..358982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0336"
FT                   /product="Outer membrane autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35408"
FT                   /db_xref="GOA:Q4ZZL4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35408.1"
FT                   /translation="MDLLSGFNTLWTTGATWDTGTPTALGQSLLRRNLQIVVDRANSRT
FT                   LAQETAAYFDDRRDQSYSAISGLGSLSDAYKAGAGAFTTITQFDDSNKTVRYDDKGNGA
FT                   GSSSSALGKVVDLVGAVRNDASTTPAKSHYLYPRPWRQSLDGQSLAFVVAPSLRPAEST
FT                   TPASDSGFPSGHTNAAYLSAYALAYAIPERFSELMLRASEIGDNRIEAGMHSPFDVMGG
FT                   RITATYFAIDNLSNPANAQLRADARAQALAYFTAQCGGNVNNCMTAIDPATDRTSQHAQ
FT                   DKALYTARMTYGFDPVGPTNLAPVVPTNAEVLLETRFPYLDASQRREILATTELSSGYA
FT                   VIDQSGGYGRLNLYAAGDGYGAFNSNVTVNMNASLGGYNAIDAWRNDISGSGALIKNGT
FT                   GNLILTGNNTYSGGTLIKGGTLTGHAQAFGSGTITDNATLVVDQSTNDTLANTLTGNGA
FT                   LIKRGVGSLNLTGNSSLSGATTVQAGRLAVNGSLGNSIVSVQQGATLGGNGTVGGINVA
FT                   QGGVVAPGNSVGQLNVNGDVNLAQGSVYQVESDASGKADRIVASGRATINNSTLSLVEG
FT                   GNWLAASRYSILSAAGGVSGAFAAVQTNFAFLTPTLNYTATDVGLTLDRNAQTFASLAP
FT                   TRNAKAVAQGLDSAGAGNALWRQVVQDDASTAQATFSALSNELHASTQSALIEDSRLVR
FT                   NAMNARMQQAQSAQAFGSTTQTLAGDASRGVVWTQAIGATGQTDSSRDASGLETRTSGL
FT                   LFGADVPLDDTWRVGALAGFSNSSFDLRHASGSTDSDNYHLGVYGGAKWGQLGLRLGAV
FT                   RTWHELTAKRTLDLPGSSEHFKEDYKAATNQVFGELGYTLEMGNAQLEPFANLAHVRLD
FT                   TDAFDENSNAISLQNKSQDNHITFSTLGLRAATHLSAGNVVIKPNATLGWRRTYGDVTP
FT                   ESRSAFSGGSTFELSGAPIARSAAVLGAGVDLGLSDTLSVGLSYDGQVSNDASDQSLNA
FT                   RVTLAF"
FT   gene            359311..360207
FT                   /locus_tag="Psyr_0337"
FT   CDS_pept        359311..360207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0337"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35409"
FT                   /db_xref="GOA:Q4ZZL3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35409.1"
FT                   /translation="MPAASLASSSAQPASQAFEVRPFTEKVGAEIVGLDLSRPLNDADF
FT                   ARVHQAHLDHHVVVFRDQQITPQQQIDFSRRFGVLQIHVLKQFLLANHPEILIVSNIVE
FT                   NDKPVGLGDAGKYWHSDLSYKELPSLGSMLYAQELPSEGGDTLFADMHLAWETLPQHLR
FT                   DAVEGRSAVHSYTARYAEGHNAANWRPTLTAEQLAQVVEVSHPIVRTHPENGRKALFVS
FT                   EGFTTRILGLPEDESRQILNEIYAHSVKPEHIYRHQWRANDMVFWDNRSLTHLAAGCPA
FT                   HLRRKLHRTTIQGTAPF"
FT   gene            360224..361099
FT                   /locus_tag="Psyr_0338"
FT   CDS_pept        360224..361099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0338"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35410"
FT                   /db_xref="GOA:Q4ZZL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35410.1"
FT                   /translation="MNAVAQGHTASTQAQSAAQPTAEALLQVRGVSLEYRTPERVVRAT
FT                   HQVSFEVDPADRFVLLGPSGCGKSTLLKAVAGFIEPSEGEIRLAGQQVTEPGPDRIVVF
FT                   QEFDQLPPWKTVIENVMFPLLASRTLKRPEALERARYYLEKVGLSAFADAYPHTLSGGM
FT                   KARVAIARALAMQPKILLMDEPFAALDALTRRKMQEELLELWDEVRFTLLFVTHSIEEA
FT                   LVVGNRILLLSPHPGRVRAEINSHQYDLKSLGGVGFQQTAQRIHRLLFDEGEAGPVEQD
FT                   LNFQDIRIAY"
FT   gene            361263..362198
FT                   /locus_tag="Psyr_0339"
FT   CDS_pept        361263..362198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0339"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35411"
FT                   /db_xref="GOA:Q4ZZL1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35411.1"
FT                   /translation="MLCVLMLPRAFCIRFLRLPRTRIMSLAPPAREEYEITLEPFTQED
FT                   LARDLPLAQRIWQLGWVRKCVIMIALAVIWELAARLQNNDLLLPSFLQTAAAFYDGLIS
FT                   GELPGKVWISLTVLIQGYLIGIVLAFALTTLAVSTQLGRDLLSTLTAMFNPLPAIALLP
FT                   LALLWFGLGQNSLIFVLVHSVLWALALNTYAGFLGVSETQRMAGRNYGLKGLRFVWHIL
FT                   IPAALPSILAGLKIGWAFAWRTLIAAELVFGASSGKGGLGWYIFQNRNELYTDKVFAGL
FT                   AAVILIGLLVENLLFANIERLTVKRWGMQR"
FT   misc_feature    361596..361664
FT                   /locus_tag="Psyr_0339"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    361707..361775
FT                   /locus_tag="Psyr_0339"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    361788..361856
FT                   /locus_tag="Psyr_0339"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    361914..361982
FT                   /locus_tag="Psyr_0339"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    361995..362063
FT                   /locus_tag="Psyr_0339"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    362091..362159
FT                   /locus_tag="Psyr_0339"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            362237..363256
FT                   /locus_tag="Psyr_0340"
FT   CDS_pept        362237..363256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0340"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35412.1"
FT                   /translation="MNTAFQRPALSVLAATLGLFGALLSGGAQAEGKISIAQQFGIGYL
FT                   ILDVVRDQKLIEKHGKEQGLDIKVDWNSISGATAMNEALLAGALDVVSAGVPPMLTVWD
FT                   RTKGKQNVKAIASLGSMPNYLLTNNPNVKTLKDFTDKDRIAVPAAGVGFQSRTLQIETA
FT                   KLFGNDNYKKFDNISVSLAHPDATSALIAGGSEINSHFSSPPFQYQELENPNVHKVLSS
FT                   YDVLGGQATFNVLYTTEKFHDENPKTYKAFYDALAEAEKIIKADKPAAAQTYIRVEQSK
FT                   LPLPLVEKIVADPEIDFTVTPQRTFIYAEKLHELGVLKNKAASWKDFFFEEAHGTEGS"
FT   sig_peptide     362237..362329
FT                   /locus_tag="Psyr_0340"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 31"
FT   gene            363882..364115
FT                   /locus_tag="Psyr_0341"
FT   CDS_pept        363882..364115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35413"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35413.1"
FT                   /translation="MINSTPSPPLPNSLEDSLMQVSDILRCASATAYETGDNLDGLKRD
FT                   LAFSVVHLINMAKAELERSLECVQNPDSPDET"
FT   gene            364205..365200
FT                   /locus_tag="Psyr_0342"
FT   CDS_pept        364205..365200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35414"
FT                   /db_xref="GOA:Q4ZZK8"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35414.1"
FT                   /translation="MRQQTTPCRYRYDALDRLATRTPVGGSIARSFYQSDTLASEIQDA
FT                   EHLRFLHHDRQLLATQSALATLLIGSDQQHSVLHTVSAGLPAAIAYTPYGHRQALNPLP
FT                   GFNGERPDPLTGHYLLGNGYRAYNPVLMRFNSPDSLSPFGNGGVNAYGYCAGDPVNRSD
FT                   PTGHGLIDDVQTYIYLGTALVTGVFGLLTARSSIKAVIKGVKLDPEANAVDNALSQTSA
FT                   LRRPATTVEKVSAAIGVGALIASATWTASYIAGKFERDSLAARTLRSVAIVVVVPVLGF
FT                   RGWTYYRSRLPARSAKKASMSKRSSTGSDRIRSSRSSIRNDDPEIEITPL"
FT   misc_feature    364901..364969
FT                   /locus_tag="Psyr_0342"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    365012..365065
FT                   /locus_tag="Psyr_0342"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            365313..366428
FT                   /locus_tag="Psyr_0343"
FT   CDS_pept        365313..366428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35415"
FT                   /db_xref="GOA:Q4ZZK7"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35415.1"
FT                   /translation="MAILCKYTYDPLDRVSTLTPLAQAVANRFYNGEQLMTELQGGRQR
FT                   TCVRAGGQLLAQQLREGDEVVTTMIAGDRNNSVLHASEAGQQSDVVYTPFGHHQAVQAS
FT                   AELPGFNGEQPDPLTGHYLLGNGYRAYNPVLMRFNSPDSMSPFGKGGLNAYAYCVGDPV
FT                   NRVDPTGHFSALAALISGIVLSAAGAGAIATAAGLKDSDSTLGTTLTVVGSISLMAGLG
FT                   AFATTGFKLKQTSVKLKQMRAKIKTGKREASDLASARKQSSARHAEALTRQADELTRHA
FT                   DELKGPPASSDSALTFRLELMEADVMKNGPYDYYSSSFLDPVMLNKIRDKDAKRVVVLD
FT                   STSRPPGLLTLTRIDDGQTLRTKAHAIREIT"
FT   misc_feature    365826..365894
FT                   /locus_tag="Psyr_0343"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    365937..366005
FT                   /locus_tag="Psyr_0343"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            366781..367899
FT                   /locus_tag="Psyr_0344"
FT   CDS_pept        366781..367899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0344"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35416"
FT                   /db_xref="GOA:Q4ZZK6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35416.1"
FT                   /translation="MPVRISRLVTFGLAAALAALAGCGEEKPAAPELPRVYVQTVKSAD
FT                   FAASVALTGDVQARVQTRLSFRVNGKIIQRNVDVGDRVTARQVLARLDPKDLQTNVDSA
FT                   AAAVAAEQARVSQSRAAFVRQQKLLPKGYTSRSEYDSAQAAVRGSESSLKAAQAQLANA
FT                   REQLGYTALVADAPGVITARQAEVGQVVQATMPIFDLARDGDRDAVFNVYESLFVQPPT
FT                   NQAVQVTLLDNPNIKVSGKVREVTPAVSAQTGTLQIKIALDPLPEGMDLGSVVSVALSA
FT                   PANASVELPWAALTKDLGEQLGKPAVWVVDEQGKVNLRKVTVTRYLTSKVIIGDGLKSG
FT                   EKVVVAGGQLLHPDMQVDIAEQPKPQNAQVQP"
FT   sig_peptide     366781..366855
FT                   /locus_tag="Psyr_0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.662 at
FT                   residue 25"
FT   gene            367896..368981
FT                   /locus_tag="Psyr_0345"
FT   CDS_pept        367896..368981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0345"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35417"
FT                   /db_xref="GOA:Q4ZZK5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35417.1"
FT                   /translation="MKRRSCLLLGSLLLSGVLLSGCGKDEAPPEPVRPVVFVEVRPESN
FT                   QDFGRFAGNIQARYQSVLGFRVAGRIARRDVDVGAEVKKGDLLATLDPTDQQNTVRARQ
FT                   GDLANVQAQLINAQANARRQQELFDRGVGAQAQLDIALTDLKTASSSQEQAKAAAQQAR
FT                   DQLSYSELRSDHDAVVTEWKVEAGQVVTAGQEVVTLAQPDIKEAVIDLPDTLADQLPSD
FT                   VVFTVASQLNPEVNTTATIREIEPQADRTTRTRRARLSLAQTPAAFRLGTAISVTLSST
FT                   ITPRMRLPINALQEVDGKRQVWIVDSQSQTVNPRAVTIASRDSDSFVLTDGVKAGEKVV
FT                   SAGVNSLKPGQKVKVDEESPR"
FT   sig_peptide     367896..367961
FT                   /locus_tag="Psyr_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.327 at
FT                   residue 22"
FT   gene            368978..372079
FT                   /locus_tag="Psyr_0346"
FT   CDS_pept        368978..372079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0346"
FT                   /product="Acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35418"
FT                   /db_xref="GOA:Q4ZZK4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35418.1"
FT                   /translation="MKGNFNLSEWAIKHQSFVWYLMFVALLMGVFSYMKLGREEDPSFT
FT                   IKTMIIQTRWPGATVDETLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLRDTTS
FT                   AKAIPEIWYQVRKKVDDIRGQFPQGLQGPSFNDEFGDVYGSIYAFTADGFSMRQLRDYV
FT                   EKVRADIRDVPGLGKVEMIGQQDEVVYLNFSTRKLAALGIDQSQVVQSLQSQNAVTPAG
FT                   VIEAGPERISVRTSGQFASEKDLAAVNLRINDRFYRLSDIADITRGYTDPPKPLFRFDG
FT                   KPAIGLAIAMQKGGNIQSFGKALHERMDATTAELPVGIGVHKVSDQAEVVNKAVGGFTS
FT                   ALFEAVIIVLLVSFVSLGFRAGLVVACSIPLVLAMVFVFMEYSGITMQRISLGALIIAL
FT                   GLLVDDAMITVEMMVTRLEMGESKEQAATYAYTSTAFPMLTGTLVTVAGFVPIGLNNSS
FT                   AGEYTFTLFAVIAVAMLVSWVVAVLFAPVIGVHILSANIKPKSEEPGRIGRAFNGSMLW
FT                   AMRHRWLAIAITVGLFAASLFSMQFVQNQFFPSSDRPEILVDLNLPQNASINETRKVVD
FT                   RFEASLNDDPDIERWSTYIGQGALRFYLPLDQQLENPFYAQLVIVSKGLEERGALTARL
FT                   QKRLRDDFVGIGSYVQALEMGPPVGRPLQYRVSGENIDKVRQHAIELATLLDHNPHVGE
FT                   VIYDWNEPGKVLRIDINQDKARQLGLSSEDVAKLMNSVVSGSTVTQVRDDIYLINVVGR
FT                   AEDAERGTPETLQNLQIVTPTGTSIPLLAFATVGYELEQPLVWRRDRKPTITVKGAVRD
FT                   AIQPTDLVKQLQPEIDKFAAGLPVGYKVATGGTVEESSKAQGPIASVAPLMLFLMATFL
FT                   MIQLHSIQKMFLVASVAPLGLIGVVLALIPTGTPLGFVAILGVLALIGIIIRNSVILVT
FT                   QIDAYEKSGYLPWDAVVEATEHRRRPILLTAAAASLGMIPIAREVFWGPMAYAMIGGII
FT                   IATLLTLLFLPALYVAWYRIKEPTDEQRREAADKDEGEHAQPAH"
FT   misc_feature    369020..369088
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    369980..370048
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    370058..370126
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    370145..370213
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    370271..370339
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    370373..370441
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    370538..370606
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    371543..371611
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    371621..371680
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    371699..371767
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    371930..371998
FT                   /locus_tag="Psyr_0346"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(372139..372636)
FT                   /locus_tag="Psyr_0347"
FT   CDS_pept        complement(372139..372636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35419"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35419.1"
FT                   /translation="MANEYVQNGDFSDGLAHWATPEDFEPDFKPMGEGAGQSIKLNIGV
FT                   AISQSIVDLRAKTLHIEFDVMSADLRLDEVLFVIAVGGYNQEGAMNLSPVIGLATQQWE
FT                   HISGDIKFGELLDDFFLNVSAPSEAFILAFSNSRLASPYGPVRFANLSLSTIDAEDADG
FT                   ND"
FT   gene            complement(372774..373400)
FT                   /locus_tag="Psyr_0348"
FT   CDS_pept        complement(372774..373400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35420"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35420.1"
FT                   /translation="MKLDPQTLAQITAATLGNYNSVADDFRAGTRDHDVSQNIDALLRH
FT                   IEGPTPWQILDFGCGPGRDLKAFTAMGHVAVGLDGSERFAEMARAETGCEVVQQNFLEL
FT                   DLPQGRFDGLFANAVLFHIPKQELPRVLRQLHATLKPGGVLFSSNPRGENQEGWNGERY
FT                   GAYHDLESWRKLLTEAGFVELEHYYRPAGLPREQQPWLASVWRRQ"
FT   gene            complement(373457..374101)
FT                   /locus_tag="Psyr_0349"
FT   CDS_pept        complement(373457..374101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0349"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35421"
FT                   /db_xref="GOA:Q4ZZK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35421.1"
FT                   /translation="MWVDRLLQGTLDTFLMVGVSSLIALLLGIPLAVILVTSSKGGIYA
FT                   APGINRVLGGFVNLFRSIPFLILMVALIPFTRMIVGTTYGVWAAVVPLTIAATPFFARI
FT                   AEVSLREVDHGLVEAAQAMGCRRWHIIWHVLLPEARPGIVGGFTITLVTMINSSAMAGA
FT                   IGAGGLGDIAYRYGYQRFDTQVMLTVIVLLVAVVALVQLGGDRLARSFDRR"
FT   misc_feature    complement(373490..373546)
FT                   /locus_tag="Psyr_0349"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(373607..373672)
FT                   /locus_tag="Psyr_0349"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(373787..373852)
FT                   /locus_tag="Psyr_0349"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(373865..373930)
FT                   /locus_tag="Psyr_0349"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(373991..374056)
FT                   /locus_tag="Psyr_0349"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(374091..375221)
FT                   /locus_tag="Psyr_0350"
FT   CDS_pept        complement(374091..375221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0350"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35422"
FT                   /db_xref="GOA:Q4ZZK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35422.1"
FT                   /translation="MTATAQRQRPIDTTGAGQRAQQAELHPELNRAHVRFINLGKTYHG
FT                   KQGPVEALGNIDLAVQHGEIFGIIGRSGAGKSSLIRTINRLEQPSNGRVLIDQVDIGEF
FT                   DEDKLVELRRRIGMIFQHFNLMSAKNVWQNVELPLKVAGVPREQRARKVAQLLELVGLQ
FT                   DKHKAYPAQLSGGQKQRVGIARALVHDPAILLCDEATSALDPETTQSILGLLREINQRL
FT                   GLTIVLITHEMAVIRDICHRVVVLEQGRIVEQGPVWQVFGDPQHEVSKTLLAPLQTGLP
FT                   KEWAERLSDQPQRPDAALLLDVHFTGVSAEGPDLAALFTALGGKVELLQGGVERIQDRA
FT                   IGHLILSVAGSPHSRDELLARARTLAPRAEVLGYVG"
FT   gene            complement(375218..376006)
FT                   /locus_tag="Psyr_0351"
FT   CDS_pept        complement(375218..376006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0351"
FT                   /product="NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35423"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35423.1"
FT                   /translation="MSKTLAALALGLLTLTAYADDKPLKVGTTAAFAIPLEAAVEEAGK
FT                   QGLKVELVEFTDWIAPNVSLAAGDIDVNYFQHIPFLTNANEAAGFGLVPYAPGIINNVG
FT                   LYSKKYKRFDELPTGATVAIANDPINSGRGLQLLAKAGLVTLKEGVGYKATEEDITANP
FT                   KKLKLIQVEAVQLVRAYDDADLVQGYPAYIRLAKTFPADSAILFDGLDHPEYVIQFVIK
FT                   PDHKDDPRLAKFVDIYQHSPVVRASLDKVNGKLYQAGWKE"
FT   sig_peptide     complement(375947..376006)
FT                   /locus_tag="Psyr_0351"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(376391..377749)
FT                   /locus_tag="Psyr_0352"
FT   CDS_pept        complement(376391..377749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0352"
FT                   /product="monooxygenase, DszA family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35424"
FT                   /db_xref="GOA:Q4ZZJ8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35424.1"
FT                   /translation="MARKKILLNAFNMNCIGHINHGLWTHPRDTSTQFNSLEYWTELAK
FT                   LLERGLFDGLFIADIVGVYDVYQNSVDVTLKEAIQLPVNDPLLLVSAMAGVTRHLGFGL
FT                   TANLTYDAPYLFARRMSTLDHLSRGRVGWNIVTGYLDSAARAMGLSEQNEHDRRYDQAD
FT                   EYLEVLYKLWEGSWEDDAVINDREQRVYAQPGKVHKVRHQGEFYQVEGYHLCEPSPQRT
FT                   PVLFQAGSSERGLQFAGQNAECVFISGQNKAATREQVDKVRASAVQAGRNPEDIKVFMG
FT                   LNVIVAATEALAREKHAEYRRHASAEAGVAHFAASTGIDFSQYELDEPIQYVKNNAIQS
FT                   ATKNLKNNDWTRQKLLDQHALGGRYITLIGSPRQVADELESWIEETGLDGFNLTRIVTP
FT                   ESYEDFIDLVIPELQRRGSYKTAYQEGSLRKKLFPQGTDRLPERHAGAAHRHI"
FT   gene            complement(377749..378954)
FT                   /locus_tag="Psyr_0353"
FT   CDS_pept        complement(377749..378954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0353"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35425"
FT                   /db_xref="GOA:Q4ZZJ7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35425.1"
FT                   /translation="MSSNPKARVNAALITSDAQALHIARELALQLKTDSAQRDRERRLP
FT                   HAELDLFSQSGLWGISVPQAFGGAGVSNVTLAKVIQLISEADGSLGQIPQNHFYALEVL
FT                   RVNGSPQQQARLYAEALAGVRFGNALAELGTRTAHDRTTRLSRDGDGYRINGRKFYATG
FT                   ALYAQRIPTSVIDDEGVQQLVFVAHDSEGLSVIDDWSGFGQRTTGSGSVVFDNVYVSAN
FT                   DVVPFQSAFQRPTTVGPLAQILHAAIDTGIARAAFEDALTFVQTRTRPWIDSGIEKAVD
FT                   DPLTLHSFGKLGIRLHAAEALLERAGEFLDVAQADSNAETVAAASIAVAEARAISTEIS
FT                   LAAGSTLFELAGSQSTLAEHGLDRHWRNARVHTLHDPVRWKFHAIGNYYLNETNPPLRG
FT                   TI"
FT   gene            complement(378980..380302)
FT                   /locus_tag="Psyr_0354"
FT   CDS_pept        complement(378980..380302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0354"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35426"
FT                   /db_xref="GOA:Q4ZZJ6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35426.1"
FT                   /translation="MVPFTTIPVDKPRVVSIDGERRESDPATVAAHSVEAPQEPDVAPR
FT                   LLKASVLQNDAQAIAAAHELAAAAQVNAANRDRQRALPWAEIEQFTRSGLGSISIPRAY
FT                   GGPQVSFVTVAEVFRIISAADPALGQIPQNQFGILHLLQSSATEQQKKALFQSVLDGWR
FT                   IGNAGPERGTKNTLELKARITANGDRLAITGQKFYSTGALFAHWVAVKALDDQGRQIMA
FT                   FIERGTPGLRIVDDWSGFGQRTTASGTVLLDNVPVDAGLVVDNWRLSLTPNIQGAVSQL
FT                   IQAAIDAGIARGAIDDAIAFVREKSRPWVDANVERASDDLYVIADIGKLKLELHAAEAL
FT                   LRKAGQELDEISAAPIDEHSAARASIAVARAKVLTTEISLLASEKLFELAGSRATLAEF
FT                   NLDRHWRNARVHTLHDPVRWKYHAVGTWHLNGTLPARHSWI"
FT   gene            complement(380690..381409)
FT                   /locus_tag="Psyr_0355"
FT   CDS_pept        complement(380690..381409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35427"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35427.1"
FT                   /translation="MSQNTCKASPMSLPIPAVPLASRHGIGVRNASQLVVHVDPYGSME
FT                   EGDLIELFWDGCYVASTILKASDVGKPVVLRVPESFLQNGKARTYYRVMKIGGVPVTSP
FT                   CRKLWVKLDAPGGLLVSASTEENQGLAPLYVAPSVIRHGLSRRHLEGGLPMTIEPYLNM
FT                   AVHDEITIRWGDLRMDLPPLTADDIGEPVDLVVPPELIREGGDEQRLEVSYCVIDRVGN
FT                   NSLWAPPRIIRIQPLGH"
FT   regulatory      complement(381938..381961)
FT                   /note="329<--330, 100% conf. Stem=8 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(381987..382730)
FT                   /locus_tag="Psyr_0356"
FT   CDS_pept        complement(381987..382730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0356"
FT                   /product="L-cystine ABC transporter ATP-binding protein /
FT                   Diaminopimelate ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35428"
FT                   /db_xref="GOA:Q4ZZJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35428.1"
FT                   /translation="MIVVEKLTKAFKGNQVLKGIDLRIEAGEVVAIIGPSGSGKTTLLR
FT                   CLNLLETPDSGRIKVGDIEINGTRSMNQQQGLIRQLRQQVGFVFQNFNLFPHRTALENV
FT                   IEGPVVVKKVAREAAEALGRKLLAKVGLSGKEDAYPRRLSGGQQQRVAIARALAMEPQV
FT                   ILFDEPTSALDPELVGEVLTTIRALAEEKRTMVIVTHEMSFAREVANRVIFIDKGVIVE
FT                   QGEAKALFANPKEERTRQFLERTRS"
FT   gene            complement(382734..383402)
FT                   /locus_tag="Psyr_0357"
FT   CDS_pept        complement(382734..383402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0357"
FT                   /product="Diaminopimelate ABC transporter membrane protein
FT                   / L-cystine ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35429"
FT                   /db_xref="GOA:Q4ZZJ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35429.1"
FT                   /translation="MIEESLQLALDSAPFLLKGAYYTVFLSLGGMFFGLLLGFGLALMR
FT                   LSRIKPVNWIARIYVSFFRGTPLLVQLFVIYYGLPELGIQLEPLSAALIGFSLNMAAYA
FT                   CEILRAAISSVERGQWEAAASIGMTRWQTMRRAILPQAARTALPPLGNSFISLVKDTAL
FT                   AATIQVPELFRQAQLITARTFEIFTMYLAAALIYWILATALSHLQNKLEARVNRHDLET
FT                   "
FT   misc_feature    complement(382788..382853)
FT                   /locus_tag="Psyr_0357"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(383064..383129)
FT                   /locus_tag="Psyr_0357"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(383175..383240)
FT                   /locus_tag="Psyr_0357"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(383277..383342)
FT                   /locus_tag="Psyr_0357"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(383399..384196)
FT                   /locus_tag="Psyr_0358"
FT   CDS_pept        complement(383399..384196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0358"
FT                   /product="Diaminopimelate-binding protein /
FT                   L-cystine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35430"
FT                   /db_xref="GOA:Q4ZZJ2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35430.1"
FT                   /translation="MNISAIRRTFLFSAMGLMLSAGIAGQAMAGEQLQKIKDSGTLNVG
FT                   LEGTYPPFSFVDESGKLTGFEVEFSEALAKELGVKAKIQPSKWDGILAALDSKRLDVVI
FT                   NQVTISDERKKKYDFSEPYTISGIQALVLKKNADTIKSVKDLSGKKVGVGLGTNYEEWL
FT                   KANVPDAIVKTYDDDPSKIQDLSVGRIDAILVDRLAALEMAAKTKNKLVPAGEAFSRQA
FT                   SGIALRKGEPELLAAIDKAIDKLRADGTLKKLSEKYFNADVTQ"
FT   sig_peptide     complement(384107..384196)
FT                   /locus_tag="Psyr_0358"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(384416..385414)
FT                   /locus_tag="Psyr_0359"
FT   CDS_pept        complement(384416..385414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0359"
FT                   /product="D-cysteine desulfhydrase"
FT                   /EC_number="4.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35431"
FT                   /db_xref="GOA:Q4ZZJ1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35431.1"
FT                   /translation="MIKHQLARFNRLDLISAPTALEKLERLSIWADRDIYIKRDDTTTL
FT                   ALGGNKVRKLEYLAADALAQGADTLITAGAIQSNHVRQTAALAARLGLGCVALLENPIG
FT                   TEDPSYLKNGNRLLLELFDAKVELVENLDNADEQLHALAARLRSSGKKPYLVPIGGSSP
FT                   VGALGYVRAGLELAEQIKQTGIEFAAVVLASGSAGTHSGLALALAHELPQLPVIGVTVS
FT                   RSEEAQLPKVQGLAERTAELLGVALPEHFKVELWDEYFAPRYGEPNAGTLSAIKLVASH
FT                   EGLLLDPVYTGKAMSGLLDGIGRQRFNDGPLIFLHTGGAPALFAYPDAFDQ"
FT   gene            385612..386565
FT                   /locus_tag="Psyr_0360"
FT   CDS_pept        385612..386565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0360"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35432"
FT                   /db_xref="GOA:Q4ZZJ0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35432.1"
FT                   /translation="MSDIPEASADGRSSHWQLQRIVSQLRGAREDWRARNRRVSGEHGG
FT                   RELPSRAAMGEILEALSGALFPMRLGPVDLREESEDFYVGHTLDVALNALLAQARLELR
FT                   YVAHQQGGDLKSIDARALELIQGFAMALPGIRLLLDTDVLAAYHGDPAARSVDEVLLCY
FT                   PGILAVIHHRLAHYLYRAGLPLLARISSEIAHSATGIDIHPGAQIGPSFFIDHGTGVVI
FT                   GETAIIGERVRIYQAVTLGAKRFPSDEDGQLQKGHARHPIVEDDVVIYAGATILGRITI
FT                   GKGSTIGGNVWLTRSVPADCNLTQANLLQQDDCSRK"
FT   gene            complement(386578..387285)
FT                   /locus_tag="Psyr_0361"
FT   CDS_pept        complement(386578..387285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35433"
FT                   /db_xref="GOA:Q4ZZI9"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35433.1"
FT                   /translation="MTRPLDDNIHELAGEYVLGTLSGQKRLDVQRRLSREPDLRAAVDA
FT                   WEQRLQPLTGLAEPVTPSPGLWDRIERNLLDMAAPASTPQRPRVRWWDNLSIWRGLAGA
FT                   GLAASLVLGMTLLTRAPAQPSYLVVLVGPQDKAPGWVVQASNSQEIQLIPLGVFEVPTD
FT                   KALEFWTKGDDWQGPVSLGLVKPGQSLHVPLDKLPPLQPNQLFELTLEKSTGSPIGKPT
FT                   GPIQFIGRAVKVI"
FT   misc_feature    complement(386935..387000)
FT                   /locus_tag="Psyr_0361"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(387282..387848)
FT                   /locus_tag="Psyr_0362"
FT   CDS_pept        complement(387282..387848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0362"
FT                   /product="Sigma-70 region 2"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35434"
FT                   /db_xref="GOA:Q4ZZI8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35434.1"
FT                   /translation="MSSHESLFDYEATLQACARGEKQALQRLYQQESARLLGVAQRLVR
FT                   DRALAEDIVHDAFLKIWSHAASFDASRGSARGWIFSVTRHLALNTLRNTTREVRVEDDG
FT                   SEDHHEQATLEGWQEIGDAFDWQVNPGRITSCLEQLEPVRRNCIFHAYVDGYSHQEIAQ
FT                   KIGAPLGTVKAWIKRSLTALRECMG"
FT   gene            complement(387952..388485)
FT                   /locus_tag="Psyr_0363"
FT   CDS_pept        complement(387952..388485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35435"
FT                   /db_xref="InterPro:IPR021851"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35435.1"
FT                   /translation="MNAKRLLCLAGTTLAFTCLSSVAMAQTDLPESVRVPAGNKVGMQT
FT                   TGVGEITYECRAKANMPNEMEWAFVGPKAVLNDKSGKQVGTYYGPPATWEAKDGSKITG
FT                   TQVAVAPSSTGNLPYQLVKANPAEGKGAMTGVTYIQRVALKGGVAPAKACAESNKGAKE
FT                   VVKYQADYLFWTAG"
FT   sig_peptide     complement(388408..388485)
FT                   /locus_tag="Psyr_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            complement(388591..389766)
FT                   /locus_tag="Psyr_0364"
FT   CDS_pept        complement(388591..389766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0364"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35436"
FT                   /db_xref="GOA:Q4ZZI6"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35436.1"
FT                   /translation="MTQVPNRETPRGIAILARFLASESAGGIVLMVAALAALIVANSPL
FT                   SAGYFSILHSVWLGLSVELWINDGLMAIFFLMVGLEIKREVLAGGLASWGQRALPGFAA
FT                   AGGMLVPALIYIAINWGNPQTLSGWAIPAATDIAFALGVLSLLGNRVPTSLKVFLAALA
FT                   ILDDLGAVTIIAFFYSAGLNLPMLAAAFVTLAVLIVMNRLNVRRLLPYLLLGALLWFFV
FT                   LQSGVHATLAGVALALCIPMGKPEEEARSPLLFLEEKMHYWVAFAVVPIFGFANAGVSL
FT                   AGITLGNLVDPVPLGVALGLFVGKQIGVFLAAVLAIRAGLAVLPEGSNWVQLYGVAMLC
FT                   GIGFTMSLFIGNLAFPGSQHLIDEVKVGVLIGSGLAAIAGIVLLRSRFSRP"
FT   misc_feature    complement(388615..388665)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(388702..388767)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(388813..388878)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(388915..388980)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(389071..389136)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(389158..389223)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(389236..389301)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(389323..389388)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(389404..389469)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(389533..389598)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(389644..389709)
FT                   /locus_tag="Psyr_0364"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(389816..390412)
FT                   /locus_tag="Psyr_0365"
FT   CDS_pept        complement(389816..390412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0365"
FT                   /product="protein of unknown function DUF886"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35437"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35437.1"
FT                   /translation="MSQTRILRAADYPRMPWKNGGGSTEEIARDAGQDLDGFGWRLSIA
FT                   DIETSGGFSVFAGYQRIITVLQGAGMTLDVDGLSSRPLLPSDPFAFSGDSQVNCTLMDG
FT                   PIRDFNLIYAPHRYTARLHWIDVRHPQRLFSSASTLVLFSMAEQVAISVDSQPWEILGK
FT                   HDCAQVDNAGGLLEVELQSPRASRCCLIELTATGQ"
FT   gene            complement(390409..391230)
FT                   /locus_tag="Psyr_0366"
FT   CDS_pept        complement(390409..391230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0366"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35438"
FT                   /db_xref="GOA:Q4ZZI4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35438.1"
FT                   /translation="MVSVSALQRLNALENTVSNNKDSHVSTPPAASSLAAQMGESPAPL
FT                   YARVKQMIALQIQNGTWPPHHRVPSESELVTQLGFSRMTINRALRELTAEGLLVRMQGV
FT                   GTFVAEPKSQSALFEVHNIADEIAARGHRHTCKVMVLKEEAAGSERALALDMREGQRVF
FT                   HSLIVHYENDIPVQIEDRFVNAQVAPDYLRQDFTLQTPYAYLSQVAPLTEGEHVVEAIL
FT                   AEADECRLLQIEAGEPCLLIRRRTWSGRQPVTAARLIHPGSRHRLEGRFTK"
FT   gene            391324..392688
FT                   /locus_tag="Psyr_0367"
FT   CDS_pept        391324..392688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0367"
FT                   /product="formimidoylglutamate deiminase"
FT                   /EC_number="3.5.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35439"
FT                   /db_xref="GOA:Q4ZZI3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35439.1"
FT                   /translation="MSAFFAERALLPDGWARNVRLEVGQDGILTRVEANADQQGAEKVS
FT                   GPLLPGMPNLHSHAFQRAMAGLAEVAGNPNDSFWTWRDLMYRLVGRISPQQLGVIARQL
FT                   YIEMLKGGYTSVAEFHYVHQDSDGKPYADPAELALQISQAAASVGIGLTLLPVLYSHSG
FT                   FGGQAPNEGQRRFIHSIDSYLDLQARLRPVLAAQPAQQPGLCFHSLRAVTPQQISQVLA
FT                   ASDRQCPVHIHIAEQQKEVDDCLSWSGRRPLQWLYENAPVDNRWCLVHATHAEADEVAL
FT                   MAQSGAVAGLCLTTEANLGDGIFPAVDYIAQGGRWGIGSDSHVSLSVVEELRWLEYGQR
FT                   LRDQRRNRLYRSDQPMVGRTLYDAALAGGAQALGQQIGTLQVGHRADWLVLDGNDPYIA
FT                   TASDDAILNRWLFAGSDRQIRDVAVNGRWVIREGRHAAEEQSNREFAQVLRALLG"
FT   gene            complement(392869..393447)
FT                   /locus_tag="Psyr_0368"
FT   CDS_pept        complement(392869..393447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0368"
FT                   /product="lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35440"
FT                   /db_xref="GOA:Q4ZZI2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35440.1"
FT                   /translation="MIKVLVRFGICVMASFLAIGFAHSADNLEPKTVDSVDLKQYQGTW
FT                   YEIARLPMFFQRKCAQSEARYTLKDDGNIAVTNRCRTIEGKWEEATGTASPQVPGKTDK
FT                   LWVVFDNWFSRLLPSVAKGDYWILDVSEGYRTAVVGNPDRKYLWLLSRTPTVSASVRED
FT                   MLSKARQQGYDTSRLIWREDDSKIGKGEK"
FT   sig_peptide     complement(393373..393447)
FT                   /locus_tag="Psyr_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            complement(393451..393705)
FT                   /locus_tag="Psyr_0369"
FT   CDS_pept        complement(393451..393705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0369"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35441"
FT                   /db_xref="GOA:Q4ZZI1"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35441.1"
FT                   /translation="MSLRSVALLSFCVLLAACSKITQENYSKLSAGMPKAQVESLLGSP
FT                   TECSGALGMSSCTWGDQNTFISVQYAADKVVLFSGQGLK"
FT   sig_peptide     complement(393646..393705)
FT                   /locus_tag="Psyr_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.595 at
FT                   residue 20"
FT   gene            complement(393957..394967)
FT                   /locus_tag="Psyr_0370"
FT   CDS_pept        complement(393957..394967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0370"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35442"
FT                   /db_xref="GOA:Q4ZZI0"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35442.1"
FT                   /translation="MSRVTLSRYLIEQTRSNNTPADLRFLIEVVARACKEISHAVSKGA
FT                   LGGVLGSMGTENVQGEVQKKLDVISNEILLEANEWGGHLAGMASEEMDNAYQIPGKYPK
FT                   GAYLLVFDPLDGSSNIDINAPVGTIFSVLRCPNEYLSQNEALNEKAFLQPGTEQVAAGY
FT                   AIYGPQTMLVLTLGDGVKGFTLDREMGSFVLTHEDITIPESTQEFAVNMSNQRHWEAPV
FT                   QRYVSELLAGEDGPLKKNYNMRWVAAMVADVHRILTRGGLFMYPRDSREPSKPGKLRLM
FT                   YEANPMSFLVEQAGGASTDGHQRILDIQPEGLHQRVAVYLGSKEEVERATAYHKA"
FT   gene            complement(395102..396481)
FT                   /locus_tag="Psyr_0371"
FT   CDS_pept        complement(395102..396481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35443"
FT                   /db_xref="GOA:Q4ZZH9"
FT                   /db_xref="InterPro:IPR025060"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35443.1"
FT                   /translation="MRKPFLSHPAMKIAVLGLALCTAITALAQDKPADFASQTPLSLSG
FT                   QGPWYRIELPLAVQLNARQTDLSDVRVFNAEGQPQAYSIRPRQPAPEQEPTPIEVNWFA
FT                   LYSTQEAGDTAPVIRIERSSNGSVIEVQPQSDIEAGEEVLRGWLLDTSAIKAPLEQLVI
FT                   DWSTEREGFQNFSIEASDDLQHWRNWGEGQVARLSFADEVVEQREVGLPGQSARYLRLL
FT                   WRSPHSAPLLISAHLLSASSGTPASPLTWSPPVQGSVESPNEYVWQLPTGLPIGRVKID
FT                   IAQPNSLAPATLYGRLDAGQPWQPISSGLLYRLSQNNSDVLQDQLQLSGRIVQQLKLVV
FT                   DDRGGGLGNEAPQLSVAVPATEVVFLARGDGPFTLAIGNPSVKAANLSLATLIPDLSAE
FT                   KLATLGTASPATATVANMAAAPIAVPQGTDFKRLGLWAVLLLGVVFLGWMTFSTLRAAK
FT                   R"
FT   misc_feature    complement(395117..395182)
FT                   /locus_tag="Psyr_0371"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(396395..396481)
FT                   /locus_tag="Psyr_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(396478..396747)
FT                   /pseudo
FT                   /locus_tag="Psyr_0372"
FT   CDS_pept        complement(396478..396747)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0372"
FT                   /note="membrane protein, putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    complement(396553..396609)
FT                   /pseudo
FT                   /locus_tag="Psyr_0372"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(396646..396702)
FT                   /pseudo
FT                   /locus_tag="Psyr_0372"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(396747..397178)
FT                   /pseudo
FT                   /locus_tag="Psyr_0373"
FT   CDS_pept        complement(396747..397178)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0373"
FT                   /note="membrane protein, putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    complement(397047..397112)
FT                   /pseudo
FT                   /locus_tag="Psyr_0373"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(397612..400062)
FT                   /locus_tag="Psyr_0374"
FT   CDS_pept        complement(397612..400062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0374"
FT                   /product="Phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35444"
FT                   /db_xref="GOA:Q4ZZH8"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35444.1"
FT                   /translation="MSQEPLVRDADVAAFRAAVLAKLTYSVGKDPDHAFEHDWFEAVAL
FT                   AARDHMVEHWMDHTRQIYRKVQKRVYYLSLEFLIGRLLYDSLSNLGLLEVAREALTELG
FT                   VDIERIRLLEPDAALGNGGLGRLAACFMESMSTLGIAGHGYGIRYEHGLFRQGIVDGWQ
FT                   QEQTENWLDFGNPWEFERPEVVYSIGFGGSVDTVPTEAGDSRQVWRPGETVRAIAYDTP
FT                   VVGWRGKSVNTLRLWRARAVEDLHLERFNAGDHFGAVAEVVRAESISRVLYPNDATEAG
FT                   QELRLRQEYFFVSASLQDLLRRHLNQHATLTDLSEHAAIQMNDTHPSIAVAELMRQLID
FT                   NHNIPWDTAWKITVGTLGYTNHTLLPEALETWSVGLMERMLPRHMQIIYLINAQHIDTL
FT                   RAKGVDDVNVLRAVSLIEEDNGRRVRMGNLAFLGSHSVNGVSALHTQLMRKTVFAELHK
FT                   IYPERINNKTNGITFRRWLFQANPKLTEMLVESLGEDVLDNAETRLKELEPFAEKSSFR
FT                   KQMADQRLHSKRALAAIIHERLGIAVNPAAMFDVQVKRIHEYKRQLLNLFHTVALYQAI
FT                   RAEPGTDWVPRVKIFAGKAAASYHSAKLIIKLTNDIARTVNNDPTVRGLLKVVFMPNYN
FT                   VSLAESIIPAADLSEQISTAGLEASGTSNMKFGLNGALTIGTLDGANVEMSEQVGLEHM
FT                   FIFGMSSQQVEARKQAGEFSAHDDVAASGRLNDVLQAIRGGVFSPDDPNRYVGLIDQLL
FT                   AYDRFLVCADFDSYWAAQAKVEERWHDSKEWWRSAVLNTARMGWFSSDRTIREYAGDIW
FT                   KALE"
FT   gene            400343..401314
FT                   /locus_tag="Psyr_0375"
FT   CDS_pept        400343..401314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0375"
FT                   /product="prolyl aminopeptidase, Serine peptidase, MEROPS
FT                   family S33"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35445"
FT                   /db_xref="GOA:Q4ZZH7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35445.1"
FT                   /translation="MQTLYPQIKPYARHDLAVEQPHVLYVDESGSPEGLPVVFIHGGPG
FT                   SGCDAHSRCYFDPNLYRIVTFDQRGCGRSTPHASLENNTTWKLVEDLEAIREHLGIDKW
FT                   VLFGGSWGSTLALAYAQTHPDRVHAMILRGVFLARQQEIDWFYQAGASRLFPDYWQDYV
FT                   APIPLDERDNILAAFHKRLTGPDQIAQMHAAKAWSTWEGRCATLRPNPQVVDRFAEPHR
FT                   ALSIARIECHYFMNNAFLEDNQLIRDMPKIAHLPAIIVHGRYDVICPLDNAWELHQNWP
FT                   GSELQVIREAGHSAAEPGIADALVRAAAEVARNLLDLPPEEA"
FT   gene            401354..401791
FT                   /locus_tag="Psyr_0376"
FT   CDS_pept        401354..401791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0376"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35446"
FT                   /db_xref="GOA:Q4ZZH6"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35446.1"
FT                   /translation="MKGLLQRVRSARVEVGTEVVGAIEQGILVLVGIEPQDTRASADKL
FT                   LHKLLNYRVFSDVEGKMNLSLREVGGGLLLVSQFTLAADTKSGLRAGFSKAAPPALGAE
FT                   LFDYLLSQARIAHPTVAAGQFGADMQVHLINDGPVTFLFDT"
FT   gene            402055..403983
FT                   /locus_tag="Psyr_0377"
FT   CDS_pept        402055..403983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0377"
FT                   /product="Periplasmic glucan biosynthesis protein, MdoG"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35447"
FT                   /db_xref="GOA:Q4ZZH5"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35447.1"
FT                   /translation="MIVSPCDAPKTPVKRLRSALLASSALVCLFSAGQLWAFNLDDVAA
FT                   KAKEMAGQKFEAPRSNLPNELRDMKFADYQKIRFRDDKAEWAGEKTPFKVSFYHQGMHF
FT                   DTPVKINEVTATSVDEIKYDPNRFDFGDLKIDPKSTEKLGYAGFRVLYPINKDDKQDEI
FT                   MTMLGASYFRVIGKGQVYGLSARGMAIDTASPSGEEFPRFKEFWIEKPGPDDNHLVIFA
FT                   LLDSPRATGAYQLTLRPGTNTLVDVKSRMFLRDKVNKLGVAPLTSMFLFGANQPSRVPN
FT                   YRRELHDSSGLSIQAANGEWLWRPLNNPKHLSISSFSVENPRGFGLLQRGRDFSQYEDL
FT                   DDRYDKRPSAWIEPKGDWGKGTVELVEIPTADETNDNIVAYWKPETLAEPGQEMAFDYR
FT                   LHWTMQENSIHSPDLGWVKQTQRSIGDVRQSNLIRQPDGSLAFLVDFVGPVLAALPEDK
FT                   TIRSQVTTDDNVELVENNLRYNPVTKGYRLTLRVKVKDSSKPTEMRAYLLREIPAEPGK
FT                   EPALLVADKAEEKKAAAKEAAKPAVSKESANDQVEIAKADAPKPEAAKPETAKSEAGKA
FT                   DAAKGKGEVAKADAGKADASKAEAAKDKDGKEIQQPETEAAPTHPEPAKTLQVMTETWS
FT                   YQLPSDE"
FT   sig_peptide     402055..402168
FT                   /locus_tag="Psyr_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 38"
FT   gene            403976..406558
FT                   /locus_tag="Psyr_0378"
FT   CDS_pept        403976..406558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0378"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35448"
FT                   /db_xref="GOA:Q4ZZH4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35448.1"
FT                   /translation="MSNSLPVPMSLNEYLAHLPMSDEQRAELAGCTTFAELHERLSAQP
FT                   VTDPAEAAQASVGRRLTLTTADQLEDAEMLGVDASGRLCLKATPPIRRTKVVPEPWRTN
FT                   ILVRGWRRLTGKGNPPKPEHDDLPRDLPKARWRTVGSIRRYILLILMLGQTIVAGWYMK
FT                   GILPYQGWSLVSLDEITRQTFVQTALQVMPYALQTSILLLFGILFCWVSAGFWTALMGF
FT                   LELLTGRDKYRISGASAGNEPIEKGARTALVMPICNEDVPRVFAGLRATFESVAATGDL
FT                   DRFDFFVLSDTNETDIAVAEQQAWLDVCRETKGFGKIFYRRRRRRVKRKSGNLDDFCRR
FT                   WGGDYRYMVVLDADSVMSGECLTSLVRLMEATPDAGIIQTAPRASGMDTLYARMQQFAT
FT                   RVYGPLFTAGLHFWQLGESHYWGHNAIIRMKPFIEHCALAPLPGKGAFAGAILSHDFVE
FT                   AALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRWCHGNLMNFRLFLVKGMHPVHR
FT                   AVFLTGVMSYLSAPLWFFFLVLSTALLAVNTLMEPTYFLEPRQLYPLWPQWHPEKAVAL
FT                   FSTTIVLLFLPKLLSVILIWAKGAKGFGGKFKVTVSMLLEMLFSVLLAPVRMLFHTRFV
FT                   LAAFLGWAATWNSPQRDDDSTPWIEAVKRHGPQTLLGACWALLVFWLNPSFLWWLAPIV
FT                   VSLMLSIPVSVISSRTNLGVKARDEKFFLIPEEFEPPQELISTDRYTYENRWHALKQGF
FT                   IRAVVDPRQNALACALATSRHRQAQPIEVVRMERVDQALKVGPAKLGNQERLMLLSDPV
FT                   ALGRLHERVWSEGHEEWLAAWRASIEADPHAPLLPLQPEGKASEPVPV"
FT   misc_feature    404408..404461
FT                   /locus_tag="Psyr_0378"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    404576..404644
FT                   /locus_tag="Psyr_0378"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    405545..405613
FT                   /locus_tag="Psyr_0378"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    405695..405763
FT                   /locus_tag="Psyr_0378"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    405800..405868
FT                   /locus_tag="Psyr_0378"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    406028..406096
FT                   /locus_tag="Psyr_0378"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   regulatory      406580..406606
FT                   /note="352-><-4899, 100% conf. Stem=11 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(408100..410043)
FT                   /locus_tag="Psyr_0379"
FT   CDS_pept        complement(408100..410043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0379"
FT                   /product="Histidine kinase, HAMP region:Bacterial
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35449"
FT                   /db_xref="GOA:Q4ZZH3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35449.1"
FT                   /translation="MFRLINQALGNMNVRFKLSLGFGLVLLLTLIITLTGWHGLYTMID
FT                   RSESLSDIAQLNGLTKDLRAERITDRVQKTPESTALVTEKLNEMKAQLTLLHKQSDEEA
FT                   TIKLLNGQFETLNRIEKTFADVRDNRQTRNQIRTRLEQTSEQALQAIAQVEVEVLKSVS
FT                   QEQDSSERMEEFTNISQLRQQVQTARYQVQTYTFTTRDADESAAIAAIDEALKEIGQIA
FT                   QDQGNESLQGLTPATAALQSYRERLGEFKQIQTKAEADQEIMEGLGETLLDSVGALNHL
FT                   QTAQRDSEAANSSAMLSSVAGLALLIGLLAAWIMTRQITVPLQQTLSAAARIAQGDLSR
FT                   DISVTRRDEMGQLQGSMQTMTVSLRELVGGISEGVSQIASAAEQLSAVTKQTCIGVTSQ
FT                   KDETDQVATAMNEMAATVQEVARNAQEASQAAAQADQQARSGDEVVGQAITQIEQLARE
FT                   VLNSTQSMSALKQESNKIVGVLDVIKSVSQQTNLLALNAAIEAARAGEAGRGFAVVADE
FT                   VRGLAQRTQKSTEEIEELIAALQTGTQQVATTLDSSRTLTDNTVELSRRAGGALEQITR
FT                   TVATIQHMNEQIATASEEQSVVAEQINRNVISVRDISEQTAAASEQTAASSVELARLGT
FT                   HLQTLVGKFRVG"
FT   misc_feature    complement(409918..409983)
FT                   /locus_tag="Psyr_0379"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(410246..412162)
FT                   /locus_tag="Psyr_0380"
FT   CDS_pept        complement(410246..412162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0380"
FT                   /product="Histidine kinase, HAMP region:Bacterial
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35450"
FT                   /db_xref="GOA:Q4ZZH2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35450.1"
FT                   /translation="MSRGLSKSLANASVSLKLAIGFGLVLLMTLMISATGWFSNQALID
FT                   RGDRVTAIAEVNELTLQLRINRMSYEVLYNAETAAKVRSTLDELDAALQTARNLLRSPE
FT                   NLQLLDVQIQATRDYRQSFEDMSKAIDTREASRSQMGENADKAVDQANRIEAELLKEDN
FT                   ILAFNGIVGVSKLIQQARFQVRGYTYSGRPDFEKDANKAIDDAVTGINTLAGDISSTYS
FT                   PMLQQAIAGLNGYRAAVGKYRDAQAASKAALDKMTTLGVSMLATSNDLITRQNKSRDAD
FT                   SAKSVQMIIAATALAMVLGILAAWVITRQITTPLQETLEVVERVASGDLSRNLNVDRKD
FT                   ELGKLQATIQRMTVSLRELVGGIRDGVTQIASAAEELSAVTEQTSAGVNSQKVETDQVA
FT                   TAMHEMTATVQEVARNAEEASEAAVAADRQARDGERVVNEAIAQIERLASAVGNSSEAM
FT                   GALKQESDKIGSVLDVIKSVAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLAQRT
FT                   QKSTEEIEALIARLQSGTQQATTVMDSSRELSTSSVELTRRAGGSLANITKTVSSIQAM
FT                   NQQIAAAAEEQSATAEEINRSIINVRDVSEQTSAASEETAASSVELARLGNHLQVLVSR
FT                   FTV"
FT   misc_feature    complement(411242..411307)
FT                   /locus_tag="Psyr_0380"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(412043..412108)
FT                   /locus_tag="Psyr_0380"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(412058..412162)
FT                   /locus_tag="Psyr_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.339 at
FT                   residue 35"
FT   gene            complement(412251..412958)
FT                   /locus_tag="Psyr_0381"
FT   CDS_pept        complement(412251..412958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0381"
FT                   /product="Conserved hypothetical protein 46"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35451"
FT                   /db_xref="GOA:Q4ZZH1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35451.1"
FT                   /translation="MNLLLLEEADFIAADRVVLRDRRLKHMQEVHRAEVGDSVRVGRVN
FT                   GLLGNAQLLRLEPHEAELRVELQSAPPAKLPLTLLLALPRPKMLRRVFQTVATMGVPKV
FT                   ILLNSYRVEKSFWQTPFLEPEAIREQLILGLEQARDSVLPEIVIEKRFKPFVEDRLPQI
FT                   ALDTLALVGHPGDFPACPRAVTQPVTLAIGPEGGWIPYEIDLLRQSGLQPVQLGERILR
FT                   VETAVTALLARLF"
FT   gene            complement(412955..413755)
FT                   /locus_tag="Psyr_0382"
FT   CDS_pept        complement(412955..413755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0382"
FT                   /product="Sec-independent periplasmic protein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35452"
FT                   /db_xref="GOA:Q4ZZH0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35452.1"
FT                   /translation="MSADTPENDQQMPLISHLTELRTRLLRCVAAVFLIFAGLFYFTQK
FT                   IYTLVSAPLRVYLPEGATMIATDVASPFITPFKLTMMVALFLSMPVILHQIWGFIAPGL
FT                   YKHEKRVAVPLLVSSIILFYAGMAFAYFLVFPLIFHFFASVTPEGVSMMTDIASYLDFV
FT                   MTLFFAFGVAFEIPVAVVLLVWIGIVDVKYLKKIRPYVIIGCFVVGMILTPPDIFSQTL
FT                   LAVPMWLLFELGVLCSTMIKKRGEHPDDEAEDADKQDQPPATTP"
FT   misc_feature    complement(413084..413149)
FT                   /locus_tag="Psyr_0382"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(413189..413254)
FT                   /locus_tag="Psyr_0382"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(413351..413416)
FT                   /locus_tag="Psyr_0382"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(413453..413518)
FT                   /locus_tag="Psyr_0382"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(413624..413680)
FT                   /locus_tag="Psyr_0382"
FT                   /note="1 of 5 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(413752..414228)
FT                   /locus_tag="Psyr_0383"
FT   CDS_pept        complement(413752..414228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0383"
FT                   /product="Twin-arginine translocation protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35453"
FT                   /db_xref="GOA:Q4ZZG9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35453.1"
FT                   /translation="MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWIGRLKRSFNA
FT                   IKQEVEREIGADEIRRQLHNEHILSMEDEARKMFAPNQPSENSPEPANPPPAPAAAEAA
FT                   SPVHNQAAHHEIGPAQPAAPKTELSLEKTAKPADAGTPVPAPPAHDSSLPPRAP"
FT   gene            complement(414233..414508)
FT                   /locus_tag="Psyr_0384"
FT   CDS_pept        complement(414233..414508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0384"
FT                   /product="Twin-arginine translocation protein TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35454"
FT                   /db_xref="GOA:Q4ZZG8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35454.1"
FT                   /translation="MGIFDWKHWIVILIVVVLVFGTKKLKGLGSDVGESIKGFRKAMND
FT                   DDKPAEQPAPQPQQAQPAPQGSPLNQPHTIDAQAHKVDEPIRKDQV"
FT   gene            complement(414553..414885)
FT                   /locus_tag="Psyr_0385"
FT   CDS_pept        complement(414553..414885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0385"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35455"
FT                   /db_xref="GOA:Q4ZZG7"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35455.1"
FT                   /translation="MTDTLSRLAEVLESRKDAAADSSYVASLYHKGLNKILEKLGEESI
FT                   ETIIAAKDAAVSGNCSDVIYETADLWFHSMVMLAALGQHPQAVLDELDRRFGLSGHAEK
FT                   AARTAE"
FT   gene            complement(414888..415280)
FT                   /locus_tag="Psyr_0386"
FT   CDS_pept        complement(414888..415280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0386"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35456"
FT                   /db_xref="GOA:Q4ZZG6"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35456.1"
FT                   /translation="MKDWLDEIHWNSDGLVPAIAQDHKTGRVLMMAWMNREALSLTAAE
FT                   NRAIYWSRSRGKLWRKGEESGHVQKLHELRLDCDADVIILMVEQIGGIACHTGRESCFY
FT                   RVYEKSGWKTVDPVLKDPDAIYPAGH"
FT   gene            complement(415348..416967)
FT                   /locus_tag="Psyr_0387"
FT   CDS_pept        complement(415348..416967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0387"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35457"
FT                   /db_xref="GOA:Q4ZZG5"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35457.1"
FT                   /translation="MKLLAVRRLFRIQRVVIRYRLDDLLFALPLPWWMLALRFVLPWRW
FT                   LPRRKSELSRGVRFRLALQDLGPIFIKFGQLLSTRRDLLPEDIADELMLLQDRVPPFDQ
FT                   QLAIKLIEEQLGARICDVFSRFDEKPLASASVAQVHAACLKTGEEVVVKVVRPGLKPII
FT                   GQDLAWLFILARMAERVSADARLLHPVQVVMDYEKTIYDELDLLREAANASQLRRNFEG
FT                   SDLLYVPQVYWDWCRPKVLVMERIYGLQVTDMAGLADQRTDMKLLAERGVEIFFTQIFR
FT                   DSFFHADMHPGNIFVSTVNPWAPKYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRV
FT                   AQLHIDSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQ
FT                   PQLVLLQKTLLNIEGLGRQLYPELDLWSTAQPYLERWMRERVSPKTLLGNLQSQVEQLP
FT                   HIAGMTRDLLERMSRPHASDPPRPWHDRKDEPVLRLIGAALLVGGAIQGWVMSEAATQL
FT                   LTLTAWPAAIMLIAGLYLIVRR"
FT   misc_feature    complement(415357..415422)
FT                   /locus_tag="Psyr_0387"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(416964..417587)
FT                   /locus_tag="Psyr_0388"
FT   CDS_pept        complement(416964..417587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0388"
FT                   /product="Protein of unknown function DUF1243"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35458"
FT                   /db_xref="GOA:Q4ZZG4"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35458.1"
FT                   /translation="MLLRGLLASIEHGINRVLRLDSTALPRMARLSGRVIAVDCRDPSL
FT                   KLFILPSDQGLLLAADWAAEADCTLRAPASSLVRLSLSKDKTAVLHGPDVELDGDSGAL
FT                   LELVGILQDLELDWEHELSNWIGPVASQLFSSHLRNSGRWTRESFNSLSQNVTDYLSEE
FT                   SRTLVGKHEAEARFAELDQIKLDLERLEARFARLAHSLNTSDNA"
FT   gene            complement(417587..418357)
FT                   /locus_tag="Psyr_0389"
FT   CDS_pept        complement(417587..418357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0389"
FT                   /product="2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
FT                   / demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35459"
FT                   /db_xref="GOA:Q4ZZG3"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35459.1"
FT                   /translation="MNDQRKGSDAEPTTHFGYKNVPESQKAEKVAEVFHSVAAKYDLMN
FT                   DLLSGGMHRLWKRFAIELSGVRTGNRVLDIAGGTGDLTRKFSNLVGPTGQVVLADINAS
FT                   MLKVGRDRLLDLGVSGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLR
FT                   VLKPGGRLLVLEFSKPTNKLMSKAYDAYSFAFMPLMGKLVTNDSESYRYLAESIRMHPN
FT                   QETLKSMMVEAGFDRVTYHNMTAGVVALHRGIKP"
FT   gene            418502..418780
FT                   /locus_tag="Psyr_0390"
FT   CDS_pept        418502..418780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35460"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35460.1"
FT                   /translation="MAKITVERPHALGLEKARKKAEQLVEKLSTRYGLAHEWAGDTVKL
FT                   EGKGAKGEVEVEEALIRVNIELNFILSAMSGSIKTEVERVLDKALAA"
FT   gene            419054..419746
FT                   /locus_tag="Psyr_0391"
FT   CDS_pept        419054..419746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0391"
FT                   /product="Poly granule associated"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35461"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35461.1"
FT                   /translation="MAGKKKTEKDGSSWMGEVEKYSRQIWLAGLGAYSKISNDGSKLFE
FT                   TLVKDGEKAEKLTKVEAQKQLDDVKNTSKSAKSRVDDVKDLAVGKWNELEEAFDKRLNG
FT                   AIARLGVPSRSEVQALNSKVDQLTRQIELLTGAKARPAASRTVAAKPAATKSAAKPLVK
FT                   AAPKPAVKKAAAMPVEAAKKPAATSTRKTSTATKTAAAKKPATRKPAAKPATKPPTPAV
FT                   PEKPAIQS"
FT   gene            419859..420164
FT                   /locus_tag="Psyr_0392"
FT   CDS_pept        419859..420164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35462"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35462.1"
FT                   /translation="MGMYFVTLRVTNLRRTALSGQDAERPERHTHAEHGHDDVLAGTYR
FT                   SSRSSVGMYFMTLRVTDQRRATCSREDAERPERHAHAAHRHNGVHADTCRRIRASV"
FT   gene            complement(420148..420519)
FT                   /locus_tag="Psyr_0393"
FT   CDS_pept        complement(420148..420519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0393"
FT                   /product="Protein of unknown function DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35463"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35463.1"
FT                   /translation="MLPTAIQLHKASKTLTLKYAPDEEYHLPAEFLRVHSPSAEVQGHG
FT                   RPILQFGKLGVGLTKVEPAGQYALKLTFDDGHDSGLFTWEYLYELATRQASLWEDYLQE
FT                   LEKSGKSRDPSEHVIKLML"
FT   regulatory      complement(420570..420597)
FT                   /note="366<--367, 100% conf. Stem=10 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(420627..421964)
FT                   /locus_tag="Psyr_0394"
FT   CDS_pept        complement(420627..421964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0394"
FT                   /product="Heat shock protein HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35464"
FT                   /db_xref="GOA:Q4ZZF8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35464.1"
FT                   /translation="MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRV
FT                   EVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLAD
FT                   AAIKLLREQEIVKVRHRAEDAAEERILDALLPPARVGFNEDPAQSSDSNTRQLFRKRLR
FT                   EGQLDDKEIEIEINEAVGVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKEALKL
FT                   VREEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLP
FT                   LIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFER
FT                   ILSEPHASLTEQYRELLKTEGLKIEFKPEGIKRLAEIAWQVNEKTENIGARRLHTLLER
FT                   LLEEVSFSAGDLAISPDAAPIEIDAEYVNSHLGDLAENEDLSRYIL"
FT   gene            complement(422031..422609)
FT                   /locus_tag="Psyr_0395"
FT   CDS_pept        complement(422031..422609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0395"
FT                   /product="HslV component of HslUV peptidase, Threonine
FT                   peptidase, MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35465"
FT                   /db_xref="GOA:Q4ZZF7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35465.1"
FT                   /translation="MSLHQGIFAPQCGDSPLTTIVSVRRHGKVVMAGDGQVSLGNTVMK
FT                   GNAKKVRRLYHGEVIAGFAGATADAFTLFERFEAQLEKHQGHLVRAAVELAKDWRTDRS
FT                   LSRLEAMLAVANKDASLIITGNGDVVEPEDGLIAMGSGGAFAQAAARALLLKTDLSARE
FT                   IAETSLHIAGDICVFTNHNITIEEQDLAG"
FT   gene            complement(422977..423672)
FT                   /locus_tag="Psyr_0396"
FT   CDS_pept        complement(422977..423672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0396"
FT                   /product="Sporulation related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35466"
FT                   /db_xref="GOA:Q4ZZF6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35466.1"
FT                   /translation="MAVAKKKPAPKRGASRYQAPAKKPIPGWLWLAIGLTVGAFVVFLM
FT                   KLEPGGDDVKRVRADAKAAKIAEANKTPPSPTAPVKPKYDFYTLLPESEVIVPNEAVPE
FT                   KTPPPVAPTAPVSPEQAAKIDTARAQAALSGLTPPPAPPVATTKPAAVTTFFLQAGSFR
FT                   KQADAEKVRAQIILLGQTSTVESGTVKDETWYRVLVGPFSNREQLTTAQKQLASGGFSN
FT                   LLLQQRQSR"
FT   misc_feature    complement(423538..423594)
FT                   /locus_tag="Psyr_0396"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(423674..425413)
FT                   /locus_tag="Psyr_0397"
FT   CDS_pept        complement(423674..425413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0397"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35467"
FT                   /db_xref="GOA:Q4ZZF5"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35467.1"
FT                   /translation="MKDTIRQLIQQALTRLVTEGVLPEGLTPAIQVENARDKTHGDFAS
FT                   NIAMMLAKPAGMKPRDLAEKLIAALPADQQISKVEIAGPGFLNFFQNTAALAARLDAAL
FT                   ADPEKLSVRKAGAAQRVVVDLSAPNLAKEMHVGHLRSTIIGDGVANVLEFLGDTVIRQN
FT                   HVGDWGTQFGMLLAYLQEKPATSDELSDLENFYRAAKQRFDESEEFAERARGLVVKLQA
FT                   GDAECLALWTRFKDISLSHCQETYERLNVKLTPADVMGESAYNDDLANVVNDLKATGLL
FT                   VESNGAQCVFLEEFRTADDTPLPVIVQKAGGGYLYATTDLAAIRYRSKVLKADRVLYFV
FT                   DQRQALHFQQVFEVARRAGFVHDGMQLEHMGFGTMNGADGRPFKTRDGGTVKLIDLLDE
FT                   AEERAYTLVREKNPEVAEAELRSIAKAVGISAVKYADLSKHRASDYSFNFDQMLSFEGN
FT                   TAPYLLYAYTRVAGVFRKLGSAFDASKGQIVLAAPQEQELAARLAQFTETLNNVAEKGT
FT                   PHVLCAYLYDLAGLFSSFYENCPILGAENPDQQQSRLRLAALTGRTLKQGLDLLGLETL
FT                   ERM"
FT   gene            complement(425511..427730)
FT                   /locus_tag="Psyr_0398"
FT   CDS_pept        complement(425511..427730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0398"
FT                   /product="replication restart DNA helicase PriA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35468"
FT                   /db_xref="GOA:Q4ZZF4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35468.1"
FT                   /translation="MPDAILRLALPSPLRRLFDYRAPAGVSRSALQPGMRLRVPFGRRE
FT                   MIGILVEVVDHSEVPADKLKPAIALLDSEAPLPPALFKLCLWTSQYYQHSLGDTLSWAL
FT                   PVLLRQGELAESRQERFWHVAPGASVDDPRIARAPKQREALTTLAQHPHGVAHQLLSKL
FT                   MLNRDSLNLLLAKELVYVEVRSHAPSARHEHWLAQPELPLNTEQRAAYEAIRAGFDSFH
FT                   AFLLAGVTGSGKTEVYLQLIRETLEAGKQALVLIPEINLGPQTLARFEQRFNARIALIH
FT                   SAVNDRERLDAWLAARDGEADIIIGTRSALFTPMKNPGLIIIDEEHDGSYKQQEGLRYH
FT                   ARDLALVRARQENIPIVLGSATPSLESLHNAYTGRYGLLRLNQRAGGAQQPRFMRLDVK
FT                   SRPLDSGISGPMQQAIGQTLAAGQQVLVFLNRRGFAPTLLCHDCGWMSGCQRCDARMTV
FT                   HQRSGELRCHHCGYVERVPRQCPSCGKVDLRPVGAGTERAEERLAILFPDYPVLRVDRD
FT                   STSRKDAMNQLFTTIQRGQPCILVGTQMLAKGHHFPRVTLVSILDADGGLFSGDFRASE
FT                   RMAQLIVQVAGRAGRAEEPGKVIIQTHLADHPLLIQLTEQGYFAFAEQALSERRSASLP
FT                   PFSHLALLRAEAHKPGQAETFLDQACSDAEQLVAQMALGGIELLGPVPAPMERRAGRYR
FT                   AQLLVQSSARAPLHKLLATWLLALEQMPSGRQVRWSLDVDPVDLY"
FT   gene            427900..428121
FT                   /locus_tag="Psyr_0399"
FT   CDS_pept        427900..428121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0399"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35469"
FT                   /db_xref="GOA:Q4ZZF3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35469.1"
FT                   /translation="MKADIHPVYEAIDATCSCGNVIKTRSTLAAPLSLDVCNECHPFYT
FT                   GKQKMLDVGGRVDKFKSRFGAFGATKAK"
FT   gene            428135..428938
FT                   /locus_tag="Psyr_0400"
FT   CDS_pept        428135..428938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0400"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35470"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35470.1"
FT                   /translation="MGISRLLEKALLVGVFFMPAIWVSAAQAFCPAPASLPIAQVQRVV
FT                   DGDTLKLTDGRSVRMIGLNTPETGRKGRSAEPFAEAAKKRLQTLVNESGGKVRLRIGQQ
FT                   GKDHYGRTLANVYDRKGANLEAQLLSEGLGYLVAVAPNVRLVACQQGAERQAREARLGV
FT                   WRNSPVQSSTRLSKGGFAIVSGQVRRVQRNRGGIWIELQGSLVLRVAPAHLNAFDTAML
FT                   QRLEGQQVEARGWVVDRSRRAGLKAGQSRWLLPLTHPAMLSPSRR"
FT   sig_peptide     428135..428221
FT                   /locus_tag="Psyr_0400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.773 at
FT                   residue 29"
FT   gene            429120..430388
FT                   /locus_tag="Psyr_0401"
FT   CDS_pept        429120..430388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0401"
FT                   /product="Malate dehydrogenase (oxaloacetate
FT                   decarboxylating) (NADP+)"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35471"
FT                   /db_xref="GOA:Q4ZZF1"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35471.1"
FT                   /translation="MSDLKTAALEYHANPRPGKLSVELTKPTATARDLALAYSPGVAEP
FT                   VREIARDPELAYKYTGKGNLVAVISDGTAILGLGDLGPLASKPVMEGKGVLFKRFAGID
FT                   VFDIEVDSESPQAFIDTVKRISITFGGINLEDIKAPECFEIEKALIEQCDIPVFHDDQH
FT                   GTAIVTAAGMINALEIVGKTLESAKIVCLGAGAAAISCMKLLVSMGAKIENIFMVDRTG
FT                   VIHSGRTDLNQYKAAFAHATEKRSLTDALDGADVFVGLSGPNLLSAENLKLMAKDPIVF
FT                   ACSNPDPEISPELAHATRSDVIMATGRSDYPNQVNNVLGFPFIFRGALDVRAKRINEEM
FT                   KIAAANALRELAKLPVPQEVSDAYGGIKLEFGREYIIPKPMDTRLLGLIADAVAKAAIE
FT                   SGVATLPYPKHYPLTSVDDVFKG"
FT   regulatory      430408..430427
FT                   /note="374-><-375, 100% conf. Stem=8 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(430408..430427)
FT                   /note="374-><-375, 100% conf. Stem=8 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(430973..433417)
FT                   /locus_tag="Psyr_0402"
FT   CDS_pept        complement(430973..433417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0402"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35472"
FT                   /db_xref="GOA:Q4ZZF0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35472.1"
FT                   /translation="MIRLLKFFWWSLVAVFCSLLLGLSGAFLYLSPTLPSVDALRSIQL
FT                   QIPLRVFTSDGKLIAEFGEMRRTPIRFAEIPPNFINALLSAEDDNFANHYGVDPGSLMR
FT                   AATQLVKSGHIQSGGSTITMQVAKNFFLTSERSFSRKTTEILLALQIERQLTKDEILEL
FT                   YVNKIYLGNRAYGIEAAAQVYYGKSIRDVSLAQMAMIAGLPKAPSRFNPLANPTRAKER
FT                   RDWILGRMYRLGKIDQAAYQAALNEPLNASYHVPTPEVNAPYIAEMARAEMVGRYGSEA
FT                   YTEGFRVTTTVPSDLQEHANKSIQQGLIDYDQRHGYRGPESRFPGMTRANWVQELTKQR
FT                   MINGLEPGIVTQVDKTGLRVLTHNGEKEETVDWATMKWARPYLNTNSLGANPKQPGDVA
FT                   KVGDLVRLLRQDDGSLKFSQIPVAQSALVSLDPQNGAIRALVGGFAFEQSNYNRAMQAK
FT                   RQPGSSFKPFIYSAALDNGYTASSLVNDAPIVFVDEYLDKVWRPKNDTNTFLGPIRLRE
FT                   ALYKSRNLVSIRLLQALGIDSTIDYITRFGFSKQDLPRNLSLALGTATLTPMEIATGWA
FT                   TFANGGYKVSPYLIQTIENRDGQTLFVANPPSVPANDVNTAPNTSTFAVHDSPSVVTGP
FT                   PGAPAQPQAPAVAERVVDARTTYILNSMLQDVIKRGTGRRALSMNRPDIAGKTGTTNDS
FT                   KDAWFSGYNADYVTTVWSGFDQPESLGRHEFGGTVSLPIWMDYMSAALKDKPPHQQAEP
FT                   PGILSLRVDPLSGRAATPSTPNAFFELFKSEDTPPSVNELGGSSAPGSPLPADESAPID
FT                   LF"
FT   sig_peptide     complement(433331..433417)
FT                   /locus_tag="Psyr_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.457 at
FT                   residue 29"
FT   misc_feature    complement(433331..433396)
FT                   /locus_tag="Psyr_0402"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            433624..434688
FT                   /locus_tag="Psyr_0403"
FT   CDS_pept        433624..434688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0403"
FT                   /product="Type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35473"
FT                   /db_xref="GOA:Q4ZZE9"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35473.1"
FT                   /translation="MFELFSKKANTLLGIDISSTSVKLLELSRSGTRYKVESYAVEPLP
FT                   ANAVVEKNIAELEGVGQALSRVLAKAKTSVKNVAVAVAGSAVITKTIEMDAGLSDDDME
FT                   NQLKLEADQYIPYPLEEVAIDFEVQGYSVRNPERVEVLLAACRKENVEVREAALALAGL
FT                   TARVVDVEAYALERSFGLLAAQLGNGHDELTVAVVDIGATMTTLSVLHHGRIIYTREQL
FT                   FGGRQLTDEIQRRYGLSMEEAGLAKKQGGLPDDYVSEVLDPFKEALVQQVSRSLQFFFA
FT                   AGQYNSVDHIMLAGGTASISGLEHLIQRRIGTPTMVANPFADMALSSKVNAGALASDAP
FT                   ALMIACGLALRSFD"
FT   gene            434688..435263
FT                   /locus_tag="Psyr_0404"
FT   CDS_pept        434688..435263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0404"
FT                   /product="Fimbrial assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35474"
FT                   /db_xref="GOA:Q4ZZE8"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35474.1"
FT                   /translation="MARINLLPWREELREERKKRFLTALVGVLVVSVGILFLIDRYVSN
FT                   ALEHQMARNAFLQTQIAQLDIRIKEISDLKARRKQLLERMKIIQDLQGNRPITGRVFDQ
FT                   LARTLPDGVYYSQVKMTDKLIAINGAAESNNRVSDLMRNLEASDWLEAPSLTEVKATTA
FT                   GAVDQANVFQLTVRQTQPPVAAAAGAKP"
FT   misc_feature    434748..434816
FT                   /locus_tag="Psyr_0404"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            435260..435883
FT                   /locus_tag="Psyr_0405"
FT   CDS_pept        435260..435883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0405"
FT                   /product="Pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35475"
FT                   /db_xref="GOA:Q4ZZE7"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35475.1"
FT                   /translation="MNMSEWLEGLRKVDLSELDLNNLGSWPAAIKAIAGVLVAVMIFAL
FT                   GYFFFIQDLETQLESAQGSEVTLKEQFSNKAFQAANLEPYKKQMEEMENTFGALLRQLP
FT                   SDTEVPGLLEDITRTGLGSGLEFEEIKLLPEAAQQFYIELPIQITVVGGYHDLATFVSG
FT                   VASLPRIVTLHDFEIKPVDPKVPTKLRMSILAKTYRYNDEGLKK"
FT   misc_feature    435344..435412
FT                   /locus_tag="Psyr_0405"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            435880..436407
FT                   /locus_tag="Psyr_0406"
FT   CDS_pept        435880..436407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0406"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35476"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35476.1"
FT                   /translation="MRAARLLCVSVVLAGLAGCGNDNDFADLSEFMDQARARPSGNIEP
FT                   LPKFRPYEAFTYNASTLRSPFQPPVKIDLLNRQKGSRLVAPDEHRVKQFLEGFNIESFE
FT                   MVGTIGNESGTFALLRGAGGVHRVKVGDYLGRNNGRVVSIGDAQVDVIEIVPDGEGAWL
FT                   ERPRTIALKERS"
FT   sig_peptide     435880..435942
FT                   /locus_tag="Psyr_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.656 at
FT                   residue 21"
FT   gene            436404..438560
FT                   /locus_tag="Psyr_0407"
FT   CDS_pept        436404..438560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0407"
FT                   /product="type II and III secretion system
FT                   protein:NolW-like protein:NolW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35477"
FT                   /db_xref="GOA:Q4ZZE5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35477.1"
FT                   /translation="MKWARPSMHSSAQRKLIMTRILSIIGVSLCIAMLSPVLQAANLKT
FT                   LDVAALPGDRIELKLAFDAPVPAPRGYTTSQPARIALDLPGVTSQLATKSRDLGTGNAR
FT                   SVVVVQAQDRTRVIINLTTLSPYSSRVDGNNLFVVIGQGAGAAQASQPTTAMGAQRVAV
FT                   PPPTPASAKPFIPAGVKAIRNVDFQRGELGEGNVVIDLSNPSIAPDIQEQGGKIRVDFA
FT                   KTQLPEPLRVRLDVKDFATPVQFVSASATGDKASILIEPSGAFDYSAFQTENKLTISVR
FT                   PLTNEDLDRRAADKPVYTGEKLSLNFQDIDVRSVLQLIADFTNLNLVASDTVQGGITLR
FT                   LQNVPWDQALDLVLKTKGLDKRKVGNVLLVAPADEIAARERQELESLKQIAELAPLRRE
FT                   LLQVNYAKAADIAKLFQSVTSAESKADERGSITVDDRTNNIIAYQTQERLDELRRIVSQ
FT                   LDIPVRQVMIEARIVEANVDYNKQLGVRWGGSTNTSGSGKWTTYGLDNNGDEAGNTSGN
FT                   LTPNVPFVDLGAAGATSGIGLGFVTNNTLLDLELSAMEKTGNGEIVSQPKVVTSDKETA
FT                   KILKGTEIPYQESSSSGATTVSFKEASLSLEVTPQITPDNRIIMEVKVTKDEPDYLNAV
FT                   LGVPPIKKNEVNAKVLISDGETIVIGGVFSNTQSKVVDKVPFLGDVPYLGRLFRRDVVS
FT                   ESKSELLVFLTPRIMNNQAISVSR"
FT   sig_peptide     436404..436526
FT                   /locus_tag="Psyr_0407"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 41"
FT   misc_feature    436464..436532
FT                   /locus_tag="Psyr_0407"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            438565..439083
FT                   /locus_tag="Psyr_0408"
FT   CDS_pept        438565..439083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0408"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35478"
FT                   /db_xref="GOA:Q4ZZE4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35478.1"
FT                   /translation="MRNLILVGPMGAGKSTIGRLLAKELRLPFKDSDKEIELRTGANIP
FT                   WIFDKEGEPGFRDREQAMIAELCAADGVVLATGGGAVMRSENRHALRAGGRVVYLHASI
FT                   EQQVGRTARDRNRPLLRTADPARVLSELLAIRDPFYREIADIVIETDERPPRMVVLEIL
FT                   ARLAELPPR"
FT   gene            439198..440301
FT                   /locus_tag="Psyr_0409"
FT   CDS_pept        439198..440301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0409"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35479"
FT                   /db_xref="GOA:Q4ZZE3"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35479.1"
FT                   /translation="MQTLKVELGERSYPIHIGEGLLDQPELLTPHIVGRQVAIVSNTTV
FT                   APLYLERLTQTLAGYNVLPIVLPDGEAFKNWETLQTIFDGLLTARHDRRTTVIALGGGV
FT                   IGDMAGFAAACYQRGVNFIQIPTTLLSQVDSSVGGKTGINHPLGKNMVGAFYQPSVVLI
FT                   DTASLNTLPERELSAGLAEVIKYGLICDEPFLTWLEEHVDALRGLDQAALTVAIERSCA
FT                   AKALVVGADERESGVRATLNLGHTFGHAIETHMGYGVWLHGEAVAAGTVMALEMSSRLG
FT                   WISTQERDRGIRLFQRAGLPVVPPQDMTQDNFLEHMAIDKKVIDGRLRLVLLRRMGEAV
FT                   ITDEYPKEVLQATLVADYRALVDQLRG"
FT   gene            440312..441934
FT                   /locus_tag="Psyr_0410"
FT   CDS_pept        440312..441934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35480"
FT                   /db_xref="GOA:Q4ZZE2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35480.1"
FT                   /translation="MTSLHADEAFLGHYQLSHDPFAARVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLLLAVTGPQGSGKTLLRQALVASTNKQSVQSVVISARGAGDAAGVLQQVAQALS
FT                   VAQAEMQSILSQVVQLGLTGQEVYLLVDDAEQLGDSALEALLGLAAGTPEGRPHVFLFG
FT                   EPSLLDRLDQMCADLQGDVEGERFHVIELQPYTEEETREYLAQRLEGAGQGIALFTADQ
FT                   ITDIHEQSDGWPGAINQVARDSMIEAMIASRSAVKRPSVGFKMPKKHVLALGAVVIVAV
FT                   AAAVLIPGRGDKTGTPANAPASAQAQLPLGEGKPTAQQSNNGSPAIEFAGNSQPMPLPM
FT                   NGNQPVMRGPLAEAAGSSDSDEDAVPTGSPAQPPTVTTTAPPAGVPAGQAAAQTPRSSI
FT                   PAPTPAPAPAAKPAPAQTQVATAKPAPAPAAKPAEKPAAAAAKPAAGGSWYSSQAPGHY
FT                   VVQILGTSSEATAQAYVAEQGGEYRYFKKTLQGKPLYVVTYGNFPDRAAALAAIKVLPA
FT                   KVQAGKPWPRTVASVQQELGATR"
FT   gene            442293..446738
FT                   /locus_tag="Psyr_0411"
FT   CDS_pept        442293..446738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0411"
FT                   /product="glutamate synthase (NADPH) large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35481"
FT                   /db_xref="GOA:Q4ZZE1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35481.1"
FT                   /translation="MKAGLYQPDEFKDNCGFGLIAHMQGEPSHHLLQTAVQALTCMTHR
FT                   GGINADGKTGDGCGLLIQKPDGFLRAIAKQHFDVDLPRQYAVGMVFLNQDDAKADAARE
FT                   NMNREILAEGLDLVGWRQVPIDTSVLGRLALERLPKIEQVFIGGEGLSDQEFAIKLFSA
FT                   RRRSSVSNAADTDHYICSFSHKTIIYKGLMMPADLTAFFPDLSDERLQTAICVFHQRFS
FT                   TNTLPKWPLAQPFRFLAHNGEINTITGNRNWAQARRTKFTNDLMDLDELGPLVNRVGSD
FT                   SSSMDNMLELMVTGGIDLFRGVRMIIPPAWQNVETMDPDLRAFYEYNSMHMEPWDGPAG
FT                   VVMTEGRHAVCLLDRNGLRPARWVTTRNGYITLASEIGVWDYKPEDVIAKGRVGPGQIF
FT                   AVDTETGQILDTDAIDNRLKSRHPYKQWLRKNALRIQATMEDNDHGSAFYDSEQLKQYM
FT                   KMYQVTFEERDQVLRPLGEQGQEAVGSMGDDTPMAVLSRRVRSPYDYFRQQFAQVTNPP
FT                   IDPLREAIVMSLEICLGAERNIFQESPEHASRVILSSPVISPAKWRSLMNLERPGFERH
FT                   IIDLNYDESLGLEAAVRNVADQAEEAVRSGHTLIVLSDRHIAPGKLPVHASLAVGAVHH
FT                   RLTEQGLRCDSNILVETATARDPHHFAVLIGFGASAVYPFLAYEVLGDLIRTGEVLGDL
FT                   YEVFKNYRKGITKGLLKILSKMGISTVASYRGAQLFEAIGLSEEVCDMSFRGVPSRLKG
FT                   ARFVDIEAEQKALAAEAWSPRKPIQQGGLLKFVFGGEYHAYNPDVVSTLQAAVQQGDYS
FT                   KFKEYTSLVDQRPVSMIRDLLQVRTIDQPLNIDEIEPLSEILKRFDSAGISLGALSPEA
FT                   HEALAEAMNRLGARSNSGEGGEDPARYGTVRSSKIKQIATGRFGVTPEYLVNADVLQIK
FT                   VAQGAKPGEGGQLPGGKVNGLIAKLRYAVPGVTLISPPPHHDIYSIEDLSQLIFDLKQV
FT                   NPAALVSVKLVAEAGVGTIAAGVAKAYADLITISGYDGGTGASPLTSIKYAGAPWELGL
FT                   AETHQTLRGNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGTAPMIALGCKYLRIC
FT                   HLNNCATGVATQNEKLRKDHYIGTVDMVINFFTYVAEETREWLARLGVRSLEELIGRTD
FT                   LLDILPGETEKQQHLDLTPLLGSDHIPADKPQFSQVDRNPPFDKGLLAEKMVEMAKPAI
FT                   ESLSGGDYELDICNCDRSIGARISGEIARLHGNQGMNKAPVTFRFKGTAGQSFGVWNAG
FT                   GLNMYLEGDANDYVGKGMTAGKLVIVPPKGSPFKTNESAIIGNTCLYGATGGKLFAAGT
FT                   AGERFAVRNSGAHTVVEGTGDHCCEYMTGGFVCVLGKTGYNFGSGMTGGFAYVLDLDNT
FT                   FVDLVNHELVEIQRISGESMEAYRTHLQSVLNEYVAETDSEWGRNIAENLDDYLRRFWL
FT                   VKPKAANLKSLLSSTRANPQ"
FT   gene            446857..448275
FT                   /locus_tag="Psyr_0412"
FT   CDS_pept        446857..448275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0412"
FT                   /product="glutamate synthase (NADPH) small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35482"
FT                   /db_xref="GOA:Q4ZZE0"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35482.1"
FT                   /translation="MAERLSNDFQFIDVGRKDPKKKLLRQRKKEFVEIYEPFKPQQSAD
FT                   QAHRCLGCGNPYCEWKCPVHNFIPNWLKLVAEGNILAAAELSHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGSVEKYITDTAFAMGWRPDMSKVVPTGKRVAIIGAGPAGLG
FT                   CADVLVRGGVTPVVFDKNPEIGGLLTFGIPEFKLEKSVLSHRREVFTGMGIEFRLNTEV
FT                   GKDVTIDQLLAEYDAVFMGMGTYTYMKGGFPGEDLPGVHDALDFLIANVNRNLGFEKAP
FT                   EDFVDMKGKRVVVLGGGDTAMDCNRTSIRQGAKSVTCAYRRDEENMPGSRKEVKNAKEE
FT                   GVKFLYNRQPIAIIGEGKVEGVKVVETRLGEPDARGRRSPEPIPGSEEIIPAEAVVIAF
FT                   GFRPSPAPWFEQFTISTDSQGRVVAPEQAQYKHQTSNPKIFAGGDMVRGSDLVVTAIFE
FT                   GRNAAEGILDYLGV"
FT   gene            448609..451833
FT                   /locus_tag="Psyr_0413"
FT   CDS_pept        448609..451833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35483"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35483.1"
FT                   /translation="MLKAAPRGKLARSTEQQSLGPDRFTPSSIAVREHRNRERADRIID
FT                   QFVERFTEKDFFPDDGDDALFALLVQLPEWPADLSIRIHNESDEVLAVFLKGSDDSVVQ
FT                   SSILLTLNADAYIAPDDVPISDDEPLLHLIFSQLPVGSDLGTGGNFPGSNSVAGRIVTL
FT                   REQIAGLAKDQRPLLFDALVAANEDVSKSQLDTRTRNPLLPLWVRQQAFLTPALGVLCA
FT                   LCPEVPVARLEELLDQMPLTAQEETGFLERTLLPDAFGEALNISLDEWSSSLAIDGLAR
FT                   TRSFNTYTDELARRLASQLLTDTLGRALVIIEYGMSLYVTPGPDDTSIVLLHDDYGNYR
FT                   AQDTGNGEITSFKEGTDSFYLAISAQLKAEERALLGMQFEQDVKGFRELLTRLAIKENR
FT                   GWFDPGKPTEIESGFLPEWFAAAADVEKHRWKAAVQDYTQALLEAQAPDLLDPSGYGEP
FT                   EQLRNYAREKLRARILLDHGVAVDPDAVIVHTASIEIDPGIIIDTDYTYVGPSEIEPNV
FT                   ETQQRSLTELSLENIAVTDINFLLTGRAFDDHGQLISFLSAGYLFSLIRDLNVGENHVR
FT                   FLNTELLTSTAGQWHRERFASVMRAQMRLDALEAKMAGDFLGDGGLPPELANRGYKWLA
FT                   AVLDHPSEGGDRAAVEGHRIQVSQLSINGVTLNGILLVGAESLSSVASLVVFTPQVPDG
FT                   KCFREMSDAQALQQQVLLEPELLDYLVSRAPLASRGHVRHVLTSGRDTLFMALQPCTGS
FT                   FLDAVYESEVARVISAVDEQTNTTWETNWESAWEITKAVGDIVLTFAPFKVRLPMAALR
FT                   SFYAIWQGVATTADDKASAPLYFVQAALLLADGLALPKGRRVRTPAATSIGRSVLDPRT
FT                   AVARIPGGLKLRDDGFYKGVYEKSREDAPSRFYAVQHDKAYAVRYDADSAVWRVIDPRR
FT                   PDAYYQLPIQLDRQNVWVHASAGLRGGKKHSKPKSSSGSGSDSGSPDNGNRVRRYKVDL
FT                   EGFFESRNFKNAQKNIEDDLVVAVRKATERFELDGNGSLHKHGKTGFSLDLPGVGRSTG
FT                   RGAWRLILEPGEKGIIRAVDVKDPHK"
FT   regulatory      451894..451913
FT                   /note="386-->387, 98% conf. Stem=8 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            451965..453029
FT                   /locus_tag="Psyr_0414"
FT   CDS_pept        451965..453029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0414"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35484"
FT                   /db_xref="GOA:Q4ZZD8"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35484.1"
FT                   /translation="MTALKNDRFLRALLKQPVDVTPVWMMRQAGRYLPEYRASRASAGD
FT                   FMSLCKNPQFACEVTLQPLDRYPLDAAILFSDILTIPDAMGQGLYFETGEGPRFRKTVS
FT                   TLADIEALPIPDAQQDLGYVMDAVSTIRRELNGRVPLIGFAGSPWTLATYMVEGGSSKD
FT                   FRKSKAMLYDNPQAMHLLLDKLAQSVTSYLNGQILAGAQAVQIFDSWGGSLSSAAYQEF
FT                   SLAYMRKIVSGLIRENDGRKVPVIVFTKGGGLWLESIADIGADTLGLDWTCDIGEARQR
FT                   VGSKVSLQGNMDPTVLYARPEAIRQEVARILASYGSGTGHVFNLGHGITPEVDPANAGA
FT                   FINAVHELSAQYHV"
FT   regulatory      453080..453101
FT                   /note="387-><-388, 100% conf. Stem=9 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(453090..454565)
FT                   /locus_tag="Psyr_0415"
FT   CDS_pept        complement(453090..454565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0415"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35485"
FT                   /db_xref="GOA:Q4ZZD7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35485.1"
FT                   /translation="MFYDLIIRDALVIDGSDTPGVRADVAISDGRIQRIGSLAGDRARE
FT                   EVDAAGRVLAPGFIDVHTHDDTVVIRKPDMLPKISQGVTTVIVGNCGISASPVSLSGNP
FT                   PDPMNLLGDAAAFIYPRFTDYRAAVENARPAVNVAALIGHTALRSNHMDDLLRSASPEE
FT                   IAAMREQLRDSLEAGALGLSTGLAYASAFSAETSEVKQLAEELSAFGAIYTTHLRSEFE
FT                   PVLEAMAEAFEIGRHARSPVIISHMKCAGAGNWGRSPQLLAALEEAAQDHPVGCDCYPY
FT                   AASSSTLDLKQVTDAFRITITWSTPHPDQGGRDLQDIAADWGLSLLDAARKLQPAGAVY
FT                   YGMDESDVERIMSHPLAMIGSDGLPEDPFPHPRLWGAFPRVLGHFSRDKGLFALHTAVH
FT                   KMTGLSAARFALHERGLIREGYWADLVLFNPQTVRDVADFKDPQRAAQGIDGVWVNGRL
FT                   SYAEGQPQGERQGRFLPRNGSLLQGFKDEKAPT"
FT   gene            complement(454569..455429)
FT                   /locus_tag="Psyr_0416"
FT   CDS_pept        complement(454569..455429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0416"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35486"
FT                   /db_xref="GOA:Q4ZZD6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35486.1"
FT                   /translation="MDILYQIRARQDSFSAGEGRIARLLLSDIAFAASASLDELASRAE
FT                   VSSATLSRFARSIGCRDLRDLRLQLAQASGVGSRFLHPEPAPEQSAFFARIVDDIEATL
FT                   RQHLAGFDATRFAAAIACVTDARMIHTFGMGGCSSLCSEELQTRLVRLGYPVAACRDPV
FT                   MMRMVAATLGPQHSLIVCSLSGRTPELLDAVTLARSYGARVLAITLPDSPLAQLAEVVL
FT                   PLQIAETNFIYKPTAARYGMLLTIDVLATELALSSPEDNQERLRRIKLALDEYRGGEDG
FT                   LPLGD"
FT   gene            complement(455430..456779)
FT                   /locus_tag="Psyr_0417"
FT   CDS_pept        complement(455430..456779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0417"
FT                   /product="gluconate permease GntT"
FT                   /note="TC 2.A.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35487"
FT                   /db_xref="GOA:Q4ZZD5"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35487.1"
FT                   /translation="MSPSPGISLLVYAAVAIIALIVLIARYRLNPFIVITLVSVGLALV
FT                   AGMPASGVVASYEAGVGKTLGHIALVVALGTMLGKMMAESGGAEQVARTLIDRFGERNA
FT                   HWAMVCIAFLVGLPLFFEVGFVLLVPIAFTVARRVGVSILMVGLPMVAGLSVVHALVPP
FT                   HPAAMLAVQAYQASVGQTLFYAILIGIPTAIIAGPVYAKFIVPRIHLPAENPLAKQFLD
FT                   REPRQKLPSFGLTMATILLPVVLMLLGGWANLISTPGSAFNSFLLFIGNSVIALLLATL
FT                   LSFWTLGIAQGFNRDSILKFTNECLAPTASITLLVGAGGGLNRILIDSGVTNEIVGLAQ
FT                   DFHLSPLLMGWLFAALMRVATGSATVAMTTASGIVAPVAMGLGYPHPELLVLATGAGSV
FT                   IFSHVNDGGFWLIKEYFNMTVAQTFKTWTVLETLISVVAFALTLGLAQVL"
FT   misc_feature    complement(455442..455507)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(455547..455612)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(455673..455738)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(455799..455864)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(455910..455975)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(456015..456080)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(456168..456233)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(456297..456362)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(456393..456458)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(456522..456587)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(456618..456683)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(456705..456761)
FT                   /locus_tag="Psyr_0417"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(457049..457696)
FT                   /locus_tag="Psyr_0418"
FT   CDS_pept        complement(457049..457696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0418"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35488"
FT                   /db_xref="GOA:Q4ZZD4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35488.1"
FT                   /translation="MRRIIKGTEPASFTEWKASANEDWTPTYPTLQNPQKRDLHDRLLQ
FT                   EQNFSCCYCGREIELDSSHIEHFRPQDHYLPLALEFSNLHASCLRETTPGSPLHCGHYK
FT                   GNWFDEDLHISPTEDDCEQRFRYLLTGKIQSTSHTDLPATTMIEKLALDIAYLTKRRQE
FT                   AITGVFDEQFISSASDAELANLVDSLRSGTANTSIAFGHVVARYAEQLLTQR"
FT   gene            complement(457693..458958)
FT                   /locus_tag="Psyr_0419"
FT   CDS_pept        complement(457693..458958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35489"
FT                   /db_xref="GOA:Q4ZZD3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35489.1"
FT                   /translation="MRLDRLHLQNFRCYEDAHFDFQPGFNLVVGVNGSGKTSLLLGVAG
FT                   CFGNLLGSIGVHRPSIAESDVRFELVKFEDRIRFERSYPLVLTAQGGAFEHQEWHVSLE
FT                   RSSLQTNFSALNSLVFSENLISIDGATHGDLPVFAVYQANRRWLTMSVTAEHAAQSKPS
FT                   RLDAYTSWFDAASNLKNFETWFIGKTLERFQRLARTGFPGILTDELTWINSAIQCALPE
FT                   SKGIEYDMEMRGLMVDIDDRKTPFNDLSDGQRGMVALFADIARRICLLNPHMGKDVLSK
FT                   TNGIIVIDELDIHLHPGWQRTIAPALKKAFPSIQFIAASHSPQVIGSLQPGEVILLNNH
FT                   DGSHPRATYGLDSSSILEEVMGVPQREPEIEELLDQLFSTLENNELEKARSQLDALKKK
FT                   APDLPEFAGAEALLKRKEIIGR"
FT   gene            complement(459036..460304)
FT                   /locus_tag="Psyr_0420"
FT   CDS_pept        complement(459036..460304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0420"
FT                   /product="General substrate transporter:Major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35490"
FT                   /db_xref="GOA:Q4ZZD2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35490.1"
FT                   /translation="MNPAVAPPTPDLNTSSVQSSTLPGDTYIEKNTPLFKRTALALFAG
FT                   GFSTFTLLYCVQPMMPTLSSEFSLTAAQSSLILSVATAMLAIGLLITGPISDRLGRKPV
FT                   MVMALFCASLFTIASALMPSWEGVLITRALVGLSLSGLAAVAMTYLSEEIHPTHLGLAM
FT                   GLYIGGSAVGGMSGRLIVGVMIDYVSWHAAMLVVGGLALIAAAVFWKILPASRNFRPRS
FT                   LHPRSLLDGFVVQFRDAGLPLLFLTGFLLMGAFVTLFNYIAYRFLSAPYNLSQAVVGVF
FT                   SVVYLSGIYSSAKIGSLADRLGRRQVLWAVIVMMLAGLLLTLFTPLPLVIVGVLIFTFG
FT                   FFGAHSVASSWVGRRATTARGQAASLYLFCYYAGSSVAGTGGGVFWHYAGWNGIGVFIG
FT                   VLLLIALGVALRLARLQPLGSQV"
FT   misc_feature    complement(459066..459131)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(459147..459212)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(459252..459317)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(459333..459383)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(459420..459485)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(459516..459581)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(459669..459734)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(459765..459830)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(459852..459917)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(459930..459986)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(460026..460091)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(460122..460187)
FT                   /locus_tag="Psyr_0420"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            460420..461310
FT                   /locus_tag="Psyr_0421"
FT   CDS_pept        460420..461310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0421"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35491"
FT                   /db_xref="GOA:Q4ZZD1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35491.1"
FT                   /translation="MELRHLRYFIAVAEELHFGRAAQALGISQPPLSQQIQTLEQELGT
FT                   RLFERTNRRVELSESGRLFLDEARLVLAQVDKATDVARRAQLGEIGELKIGFTSSAPFT
FT                   SSIPQAIFAFRQACPDVHLTLTEITSQEVAAGLEDKTIQVGIMRPLALPDSLVVFELLS
FT                   EPLVAIMRADHPLAAESEEGIYMAALAAEPFVFFPRTYGSGIYAQVLSLARAAGFSPLI
FT                   TQEAGEVMTIIGLVAAGLGVTVLPASYRRMRIDGVVYRNVLDPGATSAVWLVQRKDEQS
FT                   PMARAFTELLTRNVG"
FT   misc_feature    461098..461166
FT                   /locus_tag="Psyr_0421"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(461547..462773)
FT                   /locus_tag="Psyr_0422"
FT   CDS_pept        complement(461547..462773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0422"
FT                   /product="Beta-ketoacyl synthase:Beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35492"
FT                   /db_xref="GOA:Q4ZZD0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35492.1"
FT                   /translation="MKRVVVTGMSGITSVGSDWPTIDARFTANRSGIRRMDEWNRFAEL
FT                   NTRLAGPIDDFAVPGHWTRKQLRSMGRVSRLAVAAAEQALIDAGLLNDPIIRDGRMGTA
FT                   CGSSTGSTDEIKAFGNMLINSVAVGLNANSYVRMMPHTTAANISIFFGLTGRLIPTSSA
FT                   CTSGSQGIGYAYEAIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTTPRPY
FT                   DSGRDGLVIGEGGGMLVLEELEHAQARGAHIYAEIVGFGSNADGAHSTRPEQTTMRRAM
FT                   ELALEDANLSPDAIGYVNGHGTATEQGDIAETLATSSLFGPRMPLSSQKSFLGHTLGAC
FT                   GALESWFSIEMLNSDRYIHTLNLVDIDPQCGELDYIVGEPRHMSNEYVMNNNFAFGGVN
FT                   TSLIFRRWG"
FT   gene            complement(462773..463501)
FT                   /locus_tag="Psyr_0423"
FT   CDS_pept        complement(462773..463501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0423"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35493"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35493.1"
FT                   /translation="MTESILVTGSSRGIGRAIALRLAQAGYDLILHCRTGRSEAEAVQA
FT                   EVVALGRQARVLQFDVSDRAACKAVLEQDVETHGAYYGVVLNAGLTRDGAFPALSDDDW
FT                   DQVLRTNLDGFYNVLHPLTMPMIRRRTAGRIVCITSVSGLIGNRGQVNYSASKAGLIGA
FT                   AKALAIELGKRKITVNCVAPGLIDTAMLDENVPVDELLKMIPAQRMGTPEEVAGAVNFL
FT                   MSTEASYITRQVLAVNGGLC"
FT   gene            complement(463498..463953)
FT                   /locus_tag="Psyr_0424"
FT   CDS_pept        complement(463498..463953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35494"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35494.1"
FT                   /translation="MTEWPLAELIPHAGDMILIDQVLSFDEEQIRTRLTVRADGLFNQA
FT                   DGSLPAWLGIELMAQSVAAYAGCKARNKGEAVKLGFLLGSRKFDCNVTRFPLGSELHIH
FT                   AVRSLQDDNGMGMFECTLTGPGIEAFARLNVYCPPNTADYLAEGAPA"
FT   gene            complement(463950..465146)
FT                   /locus_tag="Psyr_0425"
FT   CDS_pept        complement(463950..465146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0425"
FT                   /product="Beta-ketoacyl synthase:Beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35495"
FT                   /db_xref="GOA:Q4ZZC7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35495.1"
FT                   /translation="MTAYLNALGVICSLGDSREEVSRRLFAGDSSGMVFESGWVPERAL
FT                   PVGAVKSALPPIPPAVHLHHSRNNQLLLAAALQIEEDISQAITRFGAGRIGVIIGTSTS
FT                   GIDEASESMAVWLRERTFPDDYDYRQQELGAPANFLAAWLQLSGPAYVISTACTSSSRA
FT                   LLSARRALDMGLCDAVLCGGVDSLCRLTLQGFSALEAMSPQLCNPFSSNRNGINIGEAA
FT                   ALFLMTREADSRHSIALLGAGASCDAHHISAPEPTGRGARDAMLQALRNARLEAEQIGY
FT                   LNLHGTATPHNDAMESLAVQGVFPNGVPCSSTKPLSGHTLGAAGALEAAFCWLSLAPQN
FT                   TEQALPPHLWDGEADPLLPALHWTHAGSRLTPENARYMMSNSFAFGGNNISLIIGDAP"
FT   gene            complement(465143..465625)
FT                   /locus_tag="Psyr_0426"
FT   CDS_pept        complement(465143..465625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0426"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35496"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35496.1"
FT                   /translation="MIRVLFLAFLLLGGCAAQAPLPTSAPTLQLPMQLHIERRQADQHQ
FT                   DWLLIIQRENGGLRWSMMDPLGIPQARQLLIDGKWQADGLLPPNPEARELFAALMFAMT
FT                   PDLEMHGRYPTAYRQGMQRRLDDRWLVEYQSANAFTVRLKDRLSYKVTPLNNESLP"
FT   sig_peptide     complement(465569..465625)
FT                   /locus_tag="Psyr_0426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.500 at
FT                   residue 19"
FT   gene            complement(465622..466356)
FT                   /locus_tag="Psyr_0427"
FT   CDS_pept        complement(465622..466356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35497"
FT                   /db_xref="GOA:Q4ZZC5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35497.1"
FT                   /translation="MNRPFLSDSYVEETRFGLWFLRSNIWQYRVLRVAIDDLRSLFASA
FT                   PPVAPVLLDAGCGQGRSFQHLNKVFQPSRLIGVDADPHSLDMSREEARARGVEVELIGS
FT                   DCAALPVPDASVDLLFCHQTFHHLVDQERALAEFYRVLKPGGYLLFAESTEAYIDTWVI
FT                   RWLFRHPMHVQKSAAQYLQMIRDQGFEFDAQNVSYPYLWWSRARDFGLLEVLKLQKPRP
FT                   FGQREETLVNVVARKPLEVGAS"
FT   gene            complement(466353..467600)
FT                   /locus_tag="Psyr_0428"
FT   CDS_pept        complement(466353..467600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0428"
FT                   /product="Monooxygenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35498"
FT                   /db_xref="GOA:Q4ZZC4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35498.1"
FT                   /translation="MPITDREIRQVVVIGAGPAGSIAAALLKRQGHDVLIIERQLFPRF
FT                   SIGESLLCHCLDFVEEAGMLEAVQAAGFQPKNGAAFARGEQYSDFDFGDTFSNGRPTTF
FT                   QVQRSEFDKLLADQAALQGVEIRYQEEIVSADFDGPQPVLRVRREDGSEYSVQASFVLD
FT                   ASGYGRVLPRLLDLEAPSGFPVRQAVFTHIQDRIESPPFDRRKILVSIHPQHSDVWFWS
FT                   IPFSEGRCSIGVVASAERFKDKPEDLDACLRTFIAETPQLASVLKNAVWDTPARTIGGY
FT                   SANVKTLHGKGFALLGNAAEFLDPVFSSGVTIAMRSASMAAGVLSRQLQGENVDWESEF
FT                   AVPLKRGVDTFRAYVEGWYDGTFQNVIFYPGSAPDIRRMISSILAGYAWDERNPFVSEP
FT                   KRRLRTLSEICAGSGS"
FT   gene            complement(467655..470030)
FT                   /locus_tag="Psyr_0429"
FT   CDS_pept        complement(467655..470030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0429"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35499"
FT                   /db_xref="GOA:Q4ZZC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35499.1"
FT                   /translation="MRSVMTSKTERLLPRLFLLILAGVLALAGWQWHDRSPLSANLMEL
FT                   VPGTDNDELVVSAEKRMQEPLNREMLVLVGHSDRQKAVELARNLAEQWQSTGLFEKVQW
FT                   SLQADLPALRTQLLQGRIAMLPTADRTLLIDDPKTFIEQRVQTLFDPFAGFSLVPGQDD
FT                   WLGLTGRIQNGLPKQGSVEADLASGALVASTEGKSWVLLRSRTRTDAFDMHLPGQVADL
FT                   LAQARVQASQAGGQLLAASGLLYAADGQKQASREITWVGGGATVGILLLLLLAFRRWSV
FT                   LLAFVPVVVGMLFGAVACVAIFGSMHVMTLVLGSSLIGVAVDYPQHYLSKSWSLKPWRS
FT                   WPALRLTLPGLSLSLITSCIGYLALAWTPFPALTQIAVFSAAGLIGAYLTAVCLLPALL
FT                   ANVEISPAQWPLKLAQLMLDCRAALLLRISTPILLVLLLAFCGGGLWHLTTKNDIRQWV
FT                   AAPQALTDEAQAIARITGYQPTSQFFLVRGKDQQQLLDRQSELTQRLDQLVSMDKLQGY
FT                   MALNQLLDSPAEQQATRDALGKLPQYWAPLVQLGVPASALKAELAQLQALPTQDVDQAL
FT                   QGPLSEPWRTLWLGPTRDDNGDQGVASIVSLRGMNSMALLRVQAIGLEGVQLVDRLGEL
FT                   NEVFAHTQISAAELKLASCVLIVLLLITPFGFGGALRIVALPLLAALCSLASLGWLGQP
FT                   LTLFSLFGLLLVTAISVDYAILMREQIGGAAVSLLGTLLAALTTWLSFGLLAVSSTPAI
FT                   SNFGLSVSLGLAFSFLLAPWASPRKALHSPATTEGQHA"
FT   misc_feature    complement(467712..467777)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(467793..467858)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(467880..467945)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(468006..468071)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(468693..468758)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(468831..468896)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(468936..469001)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(469122..469187)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(469203..469259)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(469929..469994)
FT                   /locus_tag="Psyr_0429"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(469944..470030)
FT                   /locus_tag="Psyr_0429"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.987 at
FT                   residue 29"
FT   gene            complement(470002..470616)
FT                   /locus_tag="Psyr_0430"
FT   CDS_pept        complement(470002..470616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35500"
FT                   /db_xref="GOA:Q4ZZC2"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35500.1"
FT                   /translation="MNRPLRTLILLGLLCLSSLAQAFDLQQLSDQLAKPAVVQGRFVQE
FT                   KHLRALPQPLLSKGRFVLARDFGLLWLLETPLKQDYRINADGIARRETAGNVSTWKPVP
FT                   NKNAGAEQNRLFLAVLQGDSSGLQRDFDLQLKGEATAWHLTLTPRSMLLQQVFKQINID
FT                   GGELVQRIELLETQGDSTVLKMIDSSSATTLTDAQRNDFKD"
FT   sig_peptide     complement(470548..470616)
FT                   /locus_tag="Psyr_0430"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 23"
FT   gene            complement(470613..471062)
FT                   /locus_tag="Psyr_0431"
FT   CDS_pept        complement(470613..471062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0431"
FT                   /product="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35501"
FT                   /db_xref="GOA:Q4ZZC1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35501.1"
FT                   /translation="MRSKGFLHIDTEIVVPFFDVDMMNIVWHGHYVKYLEVARCALLDH
FT                   IGHNYMQMLESGYGWPVIDLQLRYVRSAVFGQTLNVRASLVEWENRLKINYLITDAHTG
FT                   ERLTRASTVQVAVDSQSREMQLASPQVFIDAVKNALESTIESASP"
FT   gene            complement(471117..472064)
FT                   /locus_tag="Psyr_0432"
FT   CDS_pept        complement(471117..472064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35502"
FT                   /db_xref="GOA:Q4ZZC0"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35502.1"
FT                   /translation="MSIDKSPREHWASHQERGSFMLMKLTAWGMRVLGRRLLSPVLYGI
FT                   VLYFFVFGRRARHSIWQYQQHLADWSGKPELRPGQRRVFGQFMAFADALLDKLDVWNGR
FT                   LGIDQIEIVDQALLRQNLRGQRGQMLVGAHLGNLEVCRALAELGEKVTMNVLVHTKHAE
FT                   RFNRLLGEAGATHLRLIQVSELDPAIMLQLSQRLDEGEWLAIAGDRVALHGGRNVRVDF
FT                   LGQPANFPQGPWLLAGLLKCPVNLFFCLKGAKGYRVILEPFADAIEWRRSDRAQVIEQW
FT                   ATRYAERLGHYCLEAPQQWFNFYPFWKSADESGS"
FT   misc_feature    complement(471912..471968)
FT                   /locus_tag="Psyr_0432"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(472061..472795)
FT                   /locus_tag="Psyr_0433"
FT   CDS_pept        complement(472061..472795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0433"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35503"
FT                   /db_xref="GOA:Q4ZZB9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35503.1"
FT                   /translation="MHKPCVIIPVFDHELAVPTVVKAVRNAGLPCILVDDASSPACEAV
FT                   LQQLAQGEAIYLLRLPVNQGKGGAVMAGFREALRLGFSHALQVDADGQHDLSDIPLFLE
FT                   QSRQHPDALICGYPQFDESVPKGRLYARYLTHVWVWINTLSLHIRDSMCGFRLYPLAPV
FT                   VALIDRVQIGRRMDFDSEILVRLSWRGQPMRWLPTRVHYPQDGLSHFRLFHDNALISKM
FT                   HAKLFFGMLVRLPMILWRRWRP"
FT   gene            complement(472788..474479)
FT                   /locus_tag="Psyr_0434"
FT   CDS_pept        complement(472788..474479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0434"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35504"
FT                   /db_xref="GOA:Q4ZZB8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35504.1"
FT                   /translation="MDRMNWLNLEHLLLDALPDRLLTLAPTLDHAQFRDQALSVAAGLQ
FT                   ARGITHLAVHLEDAADLAIALFAAWRADVHVLLPADLQGQTRERWANQVDLWLTDLPGD
FT                   TQLSDLRAAPLPAAALDLDQCRLSLCTSGSSGEPKLIEKRLRQLANEVCGLEQLWGAEL
FT                   GSACMIGSVATQHIYGLLFRLLWPLCAARPFVRRQLPFAEDLQRASREYPSFAWVASPA
FT                   LLKRMGDNLDWHSLAAVRRVFSSGGALPADATQSLQQRLGQWPTEILGSSETGGIAWRQ
FT                   GGQRWQAFDGVELSQDAQGALRISSPYLPPGHVEQTADAALIGEDGRFELLGRLDRIVK
FT                   LEEKRVSLPLIEQALAAHEWVSEARLGVVQANRASLGALLVLSDAGLLALRNQGRRALT
FT                   EALRQHLQPHCETIALPRRWRLLRQMPLNAQGKLPQADVEALLLAPRSKQPEVLEQQNV
FT                   EGELHLHLSVPPDLAFFSGHFPKAPILPGVVQVDWAISLGRRLLDLPCGFAGMEVLKFQ
FT                   QLVRPGDRLTLTLRFDAARSKLHFAFRNADNAPCSSGRILLEDDHA"
FT   gene            complement(474481..475026)
FT                   /locus_tag="Psyr_0435"
FT   CDS_pept        complement(474481..475026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0435"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35505"
FT                   /db_xref="GOA:Q4ZZB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35505.1"
FT                   /translation="MKRLIGLILVLAGVLYPFAVYWGTEHFAPWQFALLLGSLWLARAL
FT                   TGERRQGSLAMAIVALIFCVVLGALDSHMMLRWYPVLVSTFMLGLFGSSLVYGPPIVEK
FT                   MARLNRPDLPEAGIRYTRKVTQIWCLFFLVNGLTSAILTLWAPLSWWTLYTGLISYGLM
FT                   GVLFAVEWIVRPPSAGGK"
FT   misc_feature    complement(474508..474573)
FT                   /locus_tag="Psyr_0435"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(474589..474645)
FT                   /locus_tag="Psyr_0435"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(474736..474801)
FT                   /locus_tag="Psyr_0435"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(474817..474867)
FT                   /locus_tag="Psyr_0435"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(474889..474945)
FT                   /locus_tag="Psyr_0435"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(474961..475011)
FT                   /locus_tag="Psyr_0435"
FT                   /note="1 of 6 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   sig_peptide     complement(474967..475026)
FT                   /locus_tag="Psyr_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.826 at
FT                   residue 20"
FT   gene            complement(475023..475277)
FT                   /locus_tag="Psyr_0436"
FT   CDS_pept        complement(475023..475277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0436"
FT                   /product="Phosphopantetheine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35506"
FT                   /db_xref="GOA:Q4ZZB6"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35506.1"
FT                   /translation="MQTREDIFEILRAAMVELFELEPERVTLEANLYQDLEIDSIDAVD
FT                   LIDHIKRKTGKKIAAEEFKSVRTVKDVVEAVYKLVNTAE"
FT   gene            complement(475287..475547)
FT                   /locus_tag="Psyr_0437"
FT   CDS_pept        complement(475287..475547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0437"
FT                   /product="acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35507"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35507.1"
FT                   /translation="MSDLHQDIKLLIIDALGLEDITPEDIGNDMTLFGEGLGLDSVDAL
FT                   ELGLAIQKRYGIRIDADAKDTRNHFASVDSLAAFVSARQPA"
FT   gene            complement(475522..476334)
FT                   /locus_tag="Psyr_0438"
FT   CDS_pept        complement(475522..476334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0438"
FT                   /product="Phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35508"
FT                   /db_xref="GOA:Q4ZZB4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35508.1"
FT                   /translation="MELATQSLKKGRDAYYWRLLATGISFALFGLSGLCLRLFVFPVLG
FT                   CLPGNVASHQRRARRTISRLFWLFIRIMARMRVLTYDVQGAEKLGRPGQMIIANHPSLI
FT                   DVVFLIGLVRDANCVVKRSLWENPFTRGPVRATGYISNDGSMDMLDAAVERLQSGQTLI
FT                   IFPEGTRTQPGQPPVFHRGAAAIALRGASVITPVTIKVQPTTLTKAEPWYRIPQRRVHF
FT                   TLRVGADIDPTAFSALGPPPLASRKLNDYLHDYFTKELASDERSAPGH"
FT   misc_feature    complement(476212..476277)
FT                   /locus_tag="Psyr_0438"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(476310..477029)
FT                   /locus_tag="Psyr_0439"
FT   CDS_pept        complement(476310..477029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35509"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35509.1"
FT                   /translation="MITFNIARWQAWAPGLASAEDWQRWSLDPTLLETSDAAPDVSFLP
FT                   AMQRRRLGRMARMAFAVGWPLTEGLGRVPLVFVSRHGETPRTFEILRDLAANEPLSPTQ
FT                   FSLSVHNAVIGLWSIMRGETSEMTALAATGDGLEYGAFEAAALLAEGAEAVLLVVTEEQ
FT                   PPQAYAQWIDDVPFPYAVGLLLTPGNEWQLSLNTDTQGTTRTQWPHALNLLRALHTDQS
FT                   VCLHPWNNRLWNWQRSH"
FT   gene            477339..478118
FT                   /locus_tag="Psyr_0440"
FT   CDS_pept        477339..478118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0440"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35510"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35510.1"
FT                   /translation="MRRVVFNQKGGVGKSSIACNLAAVSAHEGYRTLLIDLDAQANSTQ
FT                   YLTGLTGQDIPMGIAEFFKNTLSGSPVAKKNHVDIYETPFDNLHVVTATAELADLQPKL
FT                   EAKHKINKLRKLLDELSEDYERIYLDTPPALNFYAVSALIASDRVLIPFDCDSFSRQAL
FT                   YGLMREIEELKEDHNEGLQVEGIIVNQFQPRASLPQQMLDELIAEGLPVLPVYLNASVK
FT                   MRESHQANLPLIHLDPRHKLTQQFMELHHLLETNAHP"
FT   gene            complement(478811..479206)
FT                   /locus_tag="Psyr_0441"
FT   CDS_pept        complement(478811..479206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35511"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35511.1"
FT                   /translation="MSFIVREGDLTTTGGFVLAASASEVIERRRVARMGDPVWCPACRE
FT                   IGFIAQGNPTYIDELVAVATQGHEVQCGCEPGSNTLTTSQEHVQADMDATITIPEELAN
FT                   TARQNAEHLARSMKDGSFTPDVLRPLT"
FT   gene            479613..481289
FT                   /locus_tag="Psyr_0442"
FT   CDS_pept        479613..481289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0442"
FT                   /product="Malonate decarboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35512"
FT                   /db_xref="GOA:Q4ZZB0"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35512.1"
FT                   /translation="MTTTTSPDARWTRRRSEKQRRLQQVRALADGVVLPTDNIVAALEA
FT                   LLVSGDRVVLEGNNQKQADFLSRALAKVDPGKVHDLHMIMPSVGRAEHLDLFEQGIARK
FT                   LDFSFAGTQSLRISQLLEDGLLEIGAIHTYIELYSRLVVDLIPNVVLAAGFMADRAGNI
FT                   YTGPSTEDTPALIEPAAFSDGIVIVQVNQLVDDVSELPRVDIPASWVDFVVVADKPFYI
FT                   EPLFTRDPRHIKPVHVLMAMMAIRGIYEKHNVQSLNHGIGFNTAAIELILPTYGESLGL
FT                   KGKICRNWTLNPHPTLIPAIESGWVESVHCFGTELGMENYIAARPDVFFTGRDGSLRSN
FT                   RQLCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHATPAW
FT                   LDMRQQHDDGPAAYLERGKKLVVQMVETFQEGGKPTFVETLDAVEVAKKSGMPLAPIMI
FT                   YGDDVTHLLTEEGIAYLYKARSLEERQAMIAAVAGVTVIGLRHNPKDTARMRREGLIAL
FT                   PEDLGIRRTDASRELLAAKSIADLVQWSGGLYNPPAKFRSW"
FT   gene            481289..482164
FT                   /locus_tag="Psyr_0443"
FT   CDS_pept        481289..482164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0443"
FT                   /product="Triphosphoribosyl-dephospho-CoA synthase"
FT                   /EC_number="2.4.2.52"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35513"
FT                   /db_xref="GOA:Q4ZZA9"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35513.1"
FT                   /translation="MSALQWSPHPASLAERLADLAVDALIDEADLSPKPALVDRRGSGA
FT                   HTDLHLGLMHSSALSLWPTFKWMADAATQFGVVGQPLREALGRLGREGEATMLRTTSGV
FT                   NTHRGAIWALGLLVTAAALDAQECAPEAICARAGALARIKDRQVLTQNSHGDQVVRRYG
FT                   VMGAREQAQQGFPAVRLFALPQLQRSRAAGSGEQNARLDALLAIMTTLDDTCVLHRAGI
FT                   EGLNAMQQGAQRVLYAGGSVSLAGRRALNALDQHLLALNASPGGAADLLAACLFIDGLE
FT                   PALGPVSRSA"
FT   gene            482166..482465
FT                   /locus_tag="Psyr_0444"
FT   CDS_pept        482166..482465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0444"
FT                   /product="Malonate decarboxylase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35514"
FT                   /db_xref="GOA:Q4ZZA8"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35514.1"
FT                   /translation="METLSFEFPAGQPPKGRALVGVVGSGDLEVLLEPGKPGTLSIQVV
FT                   TSVNGAALRWQHLFERMFDGQTPPALSIDIHDFGATPGVVRMRLEQGFEEIGHD"
FT   gene            482458..483309
FT                   /locus_tag="Psyr_0445"
FT   CDS_pept        482458..483309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0445"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35515"
FT                   /db_xref="GOA:Q4ZZA7"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35515.1"
FT                   /translation="MTDNARLLNQHSFIELGARQRARALLDAGSFRELLGPFDRVMSPW
FT                   LAMQGVVPQADDGVVVGKGTVDGRPVVIAAIEGSFQGGSMGEVGGAKMAGALELAAEDN
FT                   RNGIPTAAIVLLETGGVRLQEANLGLAAIAEIHAAIVDLRQYQPVIGVVAGSVGCFGGM
FT                   SIAAGLCSYLLVTQEARLGLNGPQVIEQEAGIEEYDSRDRPFIWSLTGGEQRFASALVD
FT                   GFAADDVADVRQQVSGWLKQGVPDTHRSSQYPLFLQRLASLDTEPQIDPQSVRTLYQGA
FT                   RS"
FT   gene            483306..484106
FT                   /locus_tag="Psyr_0446"
FT   CDS_pept        483306..484106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0446"
FT                   /product="Malonate decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35516"
FT                   /db_xref="GOA:Q4ZZA6"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35516.1"
FT                   /translation="MSHSQRGLNWFNALSAGAREVTGLPASLKVADGVLGEQPVRFLAV
FT                   IADTDNCFPRARQGEVGLLEGWGLAKAVDEAIEQDRDRAEKRALIAIVDVPSQAYGRRE
FT                   EALGIHQALAGAVDSYARARLAGHPVIGLLVGKAMSGAFLAHGYQANRLIALRDPGVMV
FT                   HAMGKASAARVTLRSVEDLEKLAASIPPMAYDIDSYASLGLLWETLTVKQIEQPAADDL
FT                   VQVRNVLSSAIKDVQARGVDLSSRLGASNRAASVNVRQLLRAQW"
FT   gene            484100..484741
FT                   /locus_tag="Psyr_0447"
FT   CDS_pept        484100..484741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0447"
FT                   /product="malonate decarboxylase subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35517"
FT                   /db_xref="GOA:Q4ZZA5"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35517.1"
FT                   /translation="MVISNTGAVLPHDLLWGMPLTALPDDAPKWAVEAVLAGQPVVVRR
FT                   QAMPAGQQVAVGLRGRGREQRYAASMPLAEVCRRVMPEQLIDAPTEIHQQWPALQALRQ
FT                   IRPVMEALELDWGVGGSAGFELASGIAALHQDSDLDLILRTPGRLNRRCAAELVEALET
FT                   SVCRVDVQLQLESGAVALREWARPTGRVLLKTATGARLVADPWHLGQVCA"
FT   gene            484738..485673
FT                   /locus_tag="Psyr_0448"
FT   CDS_pept        484738..485673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0448"
FT                   /product="Acyl transferase region"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35518"
FT                   /db_xref="GOA:Q4ZZA4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35518.1"
FT                   /translation="MSSLWVFPGQGSQQTGMLHQLPDEAVVRDCLQEAADALGEDVLAL
FT                   DTAGALQATRAVQLCLLIAGVACARVLQARDCVPDYLAGLSIGAYPAAVVSGALAFDDA
FT                   VRLVALRGELMQSAWPQGYGMTALIGLDQTQVEALIGQVHSAKTPVFLANINADNQMVI
FT                   SGSAEAMHQVGQLAKAAGAAAVKRLAVSVPSHCALLDAPAQQLAEAFSRVALQAPTLRY
FT                   LSGSTARPVLSAEKLRDDLAFNMCRVIDWRSTVETAWERGVRLHIELPPGSVLTGLARK
FT                   VFQQGSALAFQAARLDSLVALSREEGRRTP"
FT   gene            485743..486159
FT                   /locus_tag="Psyr_0449"
FT   CDS_pept        485743..486159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0449"
FT                   /product="Malonate transporter MadL subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35519"
FT                   /db_xref="GOA:Q4ZZA3"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35519.1"
FT                   /translation="MIIYGVALLAICTLAGVILGDMLGVLLGVKSNVGGVGIAMILLIC
FT                   ARLWMEKHGGMSKDCEMGVGFWGALYIPVVVAMAAQQNVVTALKGGPVAVLAAVGSVVL
FT                   CACTIALISRTNRGEPLPKEEPLLTPEIAPAGGR"
FT   sig_peptide     485743..485805
FT                   /locus_tag="Psyr_0449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.648 at
FT                   residue 21"
FT   misc_feature    485761..485829
FT                   /locus_tag="Psyr_0449"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    485839..485892
FT                   /locus_tag="Psyr_0449"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    485929..485982
FT                   /locus_tag="Psyr_0449"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    486010..486078
FT                   /locus_tag="Psyr_0449"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            486161..486925
FT                   /locus_tag="Psyr_0450"
FT   CDS_pept        486161..486925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0450"
FT                   /product="Malonate/sodium symporter MadM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35520"
FT                   /db_xref="GOA:Q4ZZA2"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35520.1"
FT                   /translation="MWDLIEKGLEHNGLITAFAFVGIIMWVSVVLSRRLTFGRVHGSAI
FT                   AIVIGLILAWVGGTLTGGQKGLADITLFSGIGLMGGAMLRDFAIVATAFEVQATEARKA
FT                   GLIGVIALLLGTILPFIVGASIAWMFGYRDAISMTTIGAGAVTYIVGPVTGAALGATSD
FT                   VMALSIATGLIKAILVMVGTPMAARWMGLDNPRSAMVFGGLAGTVSGVTAGLAATDRRL
FT                   VPYGALTATFHTGLGCLLGPSVLYFIVRAIVG"
FT   misc_feature    486203..486259
FT                   /locus_tag="Psyr_0450"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    486278..486346
FT                   /locus_tag="Psyr_0450"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    486374..486442
FT                   /locus_tag="Psyr_0450"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    486476..486544
FT                   /locus_tag="Psyr_0450"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    486572..486640
FT                   /locus_tag="Psyr_0450"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    486659..486727
FT                   /locus_tag="Psyr_0450"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    486755..486814
FT                   /locus_tag="Psyr_0450"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    486851..486919
FT                   /locus_tag="Psyr_0450"
FT                   /note="1 of 8 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(486927..487853)
FT                   /locus_tag="Psyr_0451"
FT   CDS_pept        complement(486927..487853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0451"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35521"
FT                   /db_xref="GOA:Q4ZZA1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037400"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35521.1"
FT                   /translation="MQIDDELTLKKLEIFLAFMRTGNLARAAEELQTSNVSVHRAIHSL
FT                   ESALRCPLFKHEGRNLTPLESAYVLEERAQKLVQDVLATVELTRQAAGFSAARFRLGAL
FT                   YSLTVKTVPQLIMGLKIRRSELNIDLILGSNMDLLYKLKNMEVDAMLVSLDESTHDPDC
FT                   EHLALFSDDIFLAVPTDSPFAEHPEVDLSDLREATFITLTQGFATHRDGIRVFQQAGFE
FT                   PKVAMQVNDIFTLLSMVSSGVGYALLPGRIAAVYENRVRLIPLQSRYRMQQHIGIVFLK
FT                   SKQRDPNLLALLAECRMYTNRLLEQTT"
FT   gene            487976..488590
FT                   /locus_tag="Psyr_0452"
FT   CDS_pept        487976..488590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0452"
FT                   /product="HylII"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35522"
FT                   /db_xref="GOA:Q4ZZA0"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35522.1"
FT                   /translation="MYYGEKFNAWSHLVGAVLAAVGAIWLLVMASLHGDVWKVVSMAIY
FT                   GVCLVTLYSVSTVYHSVKGRSKSIMQKVDHFSIYLMIAGSYTPFCLVTLRGAWGWTLFG
FT                   IVWGLALIGILQEIKPRSEARIMSIVIYAVMGWIVLVAVKPLLAALGVSGFIWLAGGGV
FT                   LYTVGILFFAYDQIRHFHGIWHLFVIAGSLMHFVAICFYVL"
FT   misc_feature    487994..488062
FT                   /locus_tag="Psyr_0452"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    488093..488161
FT                   /locus_tag="Psyr_0452"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    488198..488251
FT                   /locus_tag="Psyr_0452"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    488261..488320
FT                   /locus_tag="Psyr_0452"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    488357..488425
FT                   /locus_tag="Psyr_0452"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    488438..488497
FT                   /locus_tag="Psyr_0452"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    488516..488584
FT                   /locus_tag="Psyr_0452"
FT                   /note="1 of 7 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(488697..489416)
FT                   /locus_tag="Psyr_0453"
FT   CDS_pept        complement(488697..489416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0453"
FT                   /product="16S rRNA m(3)U-1498 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35523"
FT                   /db_xref="GOA:Q4ZZ99"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35523.1"
FT                   /translation="MRLSRFFTETPLSLGEHELPEAQAHYISRVLRMTEGDALQLFDGS
FT                   GQEFRGTLLEVGKKRVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVS
FT                   EITPIVSERCEVRLKDERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTE
FT                   ADLKLVLHPVAEPLTSHDKPASLAFLIGPEGGLNDAEVTQAQDAGFHAARLGPRVLRTE
FT                   TAPVVALSVAQQLWGDF"
FT   gene            complement(489548..490954)
FT                   /locus_tag="Psyr_0454"
FT   CDS_pept        complement(489548..490954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0454"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35524"
FT                   /db_xref="GOA:Q4ZZ98"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35524.1"
FT                   /translation="MGLNDQWMQRDLKVLWHPCTQMKDHENLPLIPIKRGEGVWLEDFE
FT                   GKRYLDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQPVIELSERLVKLTP
FT                   DGLTRCFYADNGSSCIEVALKMSFHYWLNRGQPDKKRFVTLTNSYHGETMAAMSVGDVP
FT                   LFTETYKALLLDTIKVPSPDCYHRPDGMSWEEHSRNMFVAMEQTLAEHHASVAAVIVEP
FT                   LIQGAGGMRMYHPIYLKLLRDACDRYGVHLIHDEIAVGFGRTGTMFACEQAGIRPDFLC
FT                   LSKALTGGYLPLAACLTTDDVYDAFYDDYPTLRAFLHSHSYTGNPLACAAALATLDIFE
FT                   QDNVIENNKALAQRMATATAHLVDHPHVAEVRQTGMAIAIEMVQDKATKTAYPWQERRG
FT                   MKVFQHALERGALLRPLGSVVYFLPPYVITPEQIDFLAEVASEGIDIATRSSVSVAVRE
FT                   NFHPDFRDPG"
FT   gene            491164..493038
FT                   /locus_tag="Psyr_0455"
FT   CDS_pept        491164..493038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0455"
FT                   /product="Amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35525"
FT                   /db_xref="GOA:Q4ZZ97"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35525.1"
FT                   /translation="MLSGWLRACALIVAGLVSVSTLADEKQRTAIVVGGGLAGLTAAYE
FT                   LQAKGWQVTLLEAKPSLGGRSGLATSEWIGNTKAQPVLNRYLDSFKLPTVPAPEFVRTP
FT                   SYLIDGVYFTQADLAVKQPATAEAIKRYNDTLDNLARSVDDPENPASNSTLFALDQINV
FT                   ANWLDRLNLPVTARQLINQQIRTRYDEPSRLSLLYLAQQSRVYRSVDERDLRAARLPGG
FT                   SAVLTQAFVKQLKTVKTSSPVTAVIQEKDKVTVKAGATSYTADYAVMAVPLRSLGKIQM
FT                   TPALDAQHMGAIKSTNYGWRDQIMLKFKTPVWDSKARMSGEVFSNTGLGMLWVEPALKG
FT                   GANVVINLSGDNARIMQAFGDKQMVDQVLIRLHAFYPEARGAYTGYEIRRYSVDPSTGG
FT                   SYLAFGPGQISKYWRLWERPILRVAFAGEHTDTLYPGTLEGALRSGQRAAGQVQDLAAG
FT                   KSFEPVKVAPPKAPAPAAQKSEGNFFSNLFGGSSDKPAEPAKPQADKPGFFSRIFGGGE
FT                   QPAPAPAPVEKAVEPAPAPAPAAAPAPVVAPVVQPAKPPVKAEPAKKPATKAEPAKKVQ
FT                   SKEAARKEAAKKEAAKKEAAKKEAAKKAQSKPAPAKTPADAAPADANN"
FT   sig_peptide     491164..491235
FT                   /locus_tag="Psyr_0455"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   regulatory      493060..493083
FT                   /note="428-->429, 100% conf. Stem=10 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            493396..493944
FT                   /locus_tag="Psyr_0456"
FT   CDS_pept        493396..493944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0456"
FT                   /product="Cytochrome B561, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35526"
FT                   /db_xref="GOA:Q4ZZ96"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35526.1"
FT                   /translation="MQLRNSSSRYGLVSMVLHWGVAAVVFGMFALGLWMVGLDYYDTWR
FT                   KAGPDLHKSIGITLFAVMLIRVVWRLLSPPPPPLTSYSKLTRIGAAFGHLFLYVALFAV
FT                   MFAGYLISTADGVGIPIFGLFDVPALVSGLPDQAETAGWIHLYLAWVIVIFAGLHGLAA
FT                   LKHHFIDRDVTLKRMLGRN"
FT   misc_feature    493438..493506
FT                   /locus_tag="Psyr_0456"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    493663..493731
FT                   /locus_tag="Psyr_0456"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    493816..493884
FT                   /locus_tag="Psyr_0456"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            493972..494550
FT                   /locus_tag="Psyr_0457"
FT   CDS_pept        493972..494550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0457"
FT                   /product="YceI"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35527"
FT                   /db_xref="GOA:Q4ZZ95"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35527.1"
FT                   /translation="MLKKSLAALALGTALLSAGQAMAADYVIDKEGQHAFVDFKISHLG
FT                   YSFIHGTFKDWDGTFSFDAAKPEASKINVELKTASLFTNHAERDKHISSKDFLDVAKYP
FT                   EAKFVSTAVKSTGEKTADVTGDLTLHGVTKPIVIKATFNGEGKDPWGGYRAGFNGTSTL
FT                   NLNDFGIKGPGPTSQTLDLDISFEGVQKK"
FT   sig_peptide     493972..494043
FT                   /locus_tag="Psyr_0457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   regulatory      494572..494591
FT                   /note="430-><-431, 100% conf. Stem=8 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(494903..494923)
FT                   /note="430-><-431, 100% conf. Stem=8 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(494944..496833)
FT                   /locus_tag="Psyr_0458"
FT   CDS_pept        complement(494944..496833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0458"
FT                   /product="Helicase, C-terminal:Type III restriction enzyme,
FT                   res subunit:DEAD/DEAH box helicase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35528"
FT                   /db_xref="GOA:Q4ZZ94"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35528.1"
FT                   /translation="MSFASLGLSEALVRAIEAAGYTQPTPVQQRAIPAVLQGRDLMVAA
FT                   QTGTGKTGGFALPILERLFPNGVPDKSQRHGPRQPRVLVLTPTRELAAQVHESFKLYAR
FT                   DLKFVSACIFGGVGMNPQVQAMSRGVDVLVACPGRLLDLAGQGSVDLSHVEILVLDEAD
FT                   RMLDMGFVHDVKKVLARLPAKRQNLLFSATFSNDITSLAGKLLHNPERIEVTPPNTTVE
FT                   RIEQRVFRLAANHKRSLLAHLITVGAWEQVLVFTRTKHGANRLAEYLDKHGLAAVAIHG
FT                   NKSQNARTKALADFKAGDVRIMVATDIAARGLDIDQLPHVVNFELPNVDEDYVHRIGRT
FT                   GRAGRSGEAISLVAPDEEKLLKSIERMTKQKIADGDLMGFDITAVEAEKPEVRERPDVR
FT                   NSRGARPARGDGDKNNGGRRDKGKDKGKEKPAAASATGERPARQPREKKPREGTPRSEQ
FT                   RASQPATPRPAADRAPDEFRDDEVDNFGNRADYVSPYQGKGQNRGRRPAAAPGAAAPAA
FT                   GGAARPANPGRPAGGARNGSGSGAPKRNGSGSSAPRSRDGQPRGRRPAREDQPLPREGQ
FT                   EPAARAPRDGQPQPKIVHKESKIDRFPSAEQLDQLPSRPRGEKPALLTRNRDS"
FT   gene            complement(497145..497990)
FT                   /locus_tag="Psyr_0459"
FT   CDS_pept        complement(497145..497990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0459"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35529"
FT                   /db_xref="GOA:Q4ZZ93"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35529.1"
FT                   /translation="MSQERRFSFEFFPTKTDAGHEKLLTVARQLATYNPDFFSCTYGAG
FT                   GSTRDRTLNTVLQLENEIKVPAAPHLSCVGDSKDDLRNLLAQYKDAGIKRIVALRGDLP
FT                   SGMGMASGELRHANDLVSFIRQESGSHFHIEVAAYPEMHPQARNFEDDLKHFVNKANAG
FT                   ADSAITQYFFNADSYFNFVERVEKMGVSIPIVPGIMPITNYSKLARFSDACGAEIPRWI
FT                   RKQLEAYGDDVQSIQAFGEEVITQMCERLLQGGAPGLHFYTLNQAEPSLAVWNNLQLPR
FT                   "
FT   gene            complement(498180..499589)
FT                   /locus_tag="Psyr_0460"
FT   CDS_pept        complement(498180..499589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0460"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35530"
FT                   /db_xref="GOA:Q4ZZ92"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35530.1"
FT                   /translation="MSAVMTPAEFNDYKVADISLAAWGRRETIIAESEMPALMGLRRKY
FT                   AGDQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIP
FT                   VFAWKGETEEEYEWCIEQTILKDGQPWDANMILDDGGDLTEIIHKKYPAMLDKIHGVTE
FT                   ETTTGVHRLLDMLAKGELKIPAINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGK
FT                   QALVIGYGDVGKGSAQSLRQEGMIVKVTEVDPICAMQACMDGFELVSPFIDGENDGTEA
FT                   SIDKALLGKIDLIVTTTGNVNVCDSNMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWE
FT                   EVKPQVHKIHRTGPGSFDAQNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQI
FT                   FLFEQKYADLAPAKKSERLTVEVLPKKLDEEVALEMVRGFGGVVTKLTKTQADYIGVTV
FT                   EGPFKPDAYRY"
FT   gene            499944..500339
FT                   /locus_tag="Psyr_0461"
FT   CDS_pept        499944..500339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0461"
FT                   /product="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35531"
FT                   /db_xref="GOA:Q4ZZ91"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35531.1"
FT                   /translation="MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQR
FT                   VVTKYISEINFVSASRQGDIIELGITATEFGRTSITLKCQVRNKITRKSILTVEKIVFV
FT                   NLDEDGQPVPHGRTEIRYIKDQFDVED"
FT   gene            complement(500492..501277)
FT                   /locus_tag="Psyr_0462"
FT   CDS_pept        complement(500492..501277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0462"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35532"
FT                   /db_xref="GOA:Q4ZZ90"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35532.1"
FT                   /translation="MPRFAANLSMLYPQHDFLERFAAAAADGFGAVEYLFPYAYTPQEL
FT                   KQRLSDNGLVQALFNAPPGDWDACERGIATLPGREAEFRSGIERALEYAQVLGNDRVHV
FT                   MAGLLPNEGLRERHQAVYLENLAFAAEQAKSAGVTILIEPINTRDMPGFFLNRQDQAQD
FT                   ICKLVGADNLKVQFDCYHCQIVEGDLTTKLRRDFAGIGHIQIAGVPDRNEPDLGELNYE
FT                   HLFNVIDELGYSGWIGCEYRPKGDTSEGLAWLRALQAKG"
FT   gene            complement(501300..502757)
FT                   /locus_tag="Psyr_0463"
FT   CDS_pept        complement(501300..502757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0463"
FT                   /product="Gluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35533"
FT                   /db_xref="GOA:Q4ZZ89"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35533.1"
FT                   /translation="MTPLMLMVVAGAGIALLLFLVLKYKFQPFVALMLVSIIVALVAGV
FT                   KPADLVATIEGGMGKTLGHIAIIIALGAMIGRVIELSGGAEALAKTLINRFGNKRTPLA
FT                   LTVAGFMVGIPVFFEVGVIILMPLAYGVARAARKPLLIFALPMCAALLAVHAFLPPHPG
FT                   AVAAASQLGADLGRVLMLGIPIVAVLCMIGYFVAGRMTRKTYPMTDDIRAEVYGPHVTN
FT                   EDLEAWARNDYSAVREASETRTMGVEESASSLASKLPPAPAPGFGLIIALILLPIVLIL
FT                   MGTLATTMLPATSTLRAVLTVLGAPLVALLIDTLLCAWLLGSRRGWSRTQVSDVIGSAL
FT                   PGVAMVILIAGAGGVFGKVLVDTGIGAVVSEALRNTGLPVLALGFLLTLLLRAVQGSTT
FT                   VALVTTAGILSPLIATLDLSANHLALLCLAMGGGGLAMSHINDAGYWMFTKLAGLNVAD
FT                   GLRTWTVLVTLLGTLGFVITLLLWPFV"
FT   misc_feature    complement(501312..501377)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(501438..501503)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(501576..501641)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(501687..501752)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(501792..501857)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(501903..501968)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(502164..502229)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(502275..502340)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(502362..502427)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(502605..502670)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(502692..502745)
FT                   /locus_tag="Psyr_0463"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(502892..503530)
FT                   /locus_tag="Psyr_0464"
FT   CDS_pept        complement(502892..503530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35534"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35534.1"
FT                   /translation="MIDENALRQEICDVGRLLYGRGYTVGSAGNISARLDDGWLITPTD
FT                   ACLGRMDPADIAKVNLAGEWVSGSKPSKTLALHREVYDRNPQVGGVVHTHSTHLVALTL
FT                   AGVWQEDDILPPLTPYQVMKVGHIPLIPYERPGSPKVAERVAELANSVRGVMLERLGPV
FT                   VWESSVAKACYALEELEETARLWLMSNPKPAPLAPAALEELRQVFDARW"
FT   gene            complement(503530..504819)
FT                   /locus_tag="Psyr_0465"
FT   CDS_pept        complement(503530..504819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0465"
FT                   /product="HopAN1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35535"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35535.1"
FT                   /translation="MSLNNARPLLGCIADDFTGATDLANMLVRGGMRTVQSIGIPSAEM
FT                   AAGLDADAIVIALKSRTTPSAEAVAESLAALEWLRERGCEQIFFKYCSTFDSTAAGNIG
FT                   QVSEALLEQLGSDFTLACPAFPENGRTIFRGHLFVQDQLLSESGMQNHPLTPMTDANLV
FT                   RVLQAQTSHKVGLLRYDSIAQGVEGVRNRIAELRAEGVSMAIADALSDADLYTLGEACA
FT                   DLPLLTGGSGLALGLPGNFRKAGKLRDIDAAKQVAISGGEVVLAGSASVATNGQVAAWL
FT                   EADRPALRINPLELAAGKPVVEQALAFARDAGQTVLIYATSTPDEVKAVQQELGVERSG
FT                   AMVEAALGEIAKGLLDAGVRRFVVAGGETSGAVVQALGVQLLQIGAQIDPGVPATVSSG
FT                   AQPLALALKSGNFGARDFFAKALKQLAGAA"
FT   gene            complement(504830..505735)
FT                   /locus_tag="Psyr_0466"
FT   CDS_pept        complement(504830..505735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0466"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35536"
FT                   /db_xref="GOA:Q4ZZ86"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35536.1"
FT                   /translation="MTGKNVGVIGLGAMGLGIARSLLRSGFTVHACDVRTSVTEAFAQE
FT                   GGVACDSPASMAAACDVIITVVVNAEQTETVLFGENGAIAALRPGCLVIGCATVAPTFA
FT                   VELGERLAAQNLLYLDAPISGGAAKAAAGQMTMMTSGPAESYAKAEAILNGMAGKVYRL
FT                   GDVHGLGSKVKIINQLLAGVHIAASAEAMALGLREGVDADALYEVITNSAGNSWMFENR
FT                   VPHILNADYTPLSAVDIFVKDLGLVLDTARSSKFPLPLSATAHQMFMQASSAGFGREDD
FT                   SAVIKIFPGIELPKAKPEKA"
FT   regulatory      complement(505899..505913)
FT                   /note="439<--440, 98% conf. Stem=5 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(505961..506416)
FT                   /locus_tag="Psyr_0467"
FT   CDS_pept        complement(505961..506416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0467"
FT                   /product="Protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35537"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35537.1"
FT                   /translation="MKPTLIAAAELDRIDTWAKYSSHMCGGCVSSCCTLPVEVKIKDLI
FT                   RIGIVDEFERGDPAKNIAKRLQKEGIVERYNQKSEIFTLQRMSNNDCLYLDRKSRLCTI
FT                   YDKRPDTCRNHPKVGPRPGYCAYKPKEVVRQESGSLRNATSAPVPKF"
FT   gene            complement(506590..507798)
FT                   /locus_tag="Psyr_0468"
FT   CDS_pept        complement(506590..507798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0468"
FT                   /product="Aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35538"
FT                   /db_xref="GOA:Q4ZZ84"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35538.1"
FT                   /translation="MADQGSPRRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGN
FT                   PDGATPPHIVDKLITVAQREDTHGYSTSRGIPRLRRAISNWYKKRYEVDIDPESEAIVT
FT                   IGSKEGLAHLMLATLDQGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVPGVDFFDELEK
FT                   AIRGSIPKPKMMILGFPSNPTAQCVELDFFERVVALAKQYDVLVVHDLAYADIVYDGWK
FT                   APSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVNALARIKSYHDYGTFTPL
FT                   QVAAIAALEGDQQCVLDIAEQYRQRRNVLVKGLHELGWMVENPKASMYVWAKIPQAYAH
FT                   LGSLEFAKKLLAEAKVCVSPGIGFGEYGDDHVRFALIENQDRIRQAVRGIRSMFRADDK
FT                   LKS"
FT   regulatory      507823..507855
FT                   /note="hrp box; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and or weight matrix
FT                   scans; (PMID 17073298)"
FT                   /regulatory_class="promoter"
FT   gene            508137..509984
FT                   /locus_tag="Psyr_0469"
FT   CDS_pept        508137..509984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0469"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35539"
FT                   /db_xref="GOA:Q4ZZ83"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35539.1"
FT                   /translation="MPDYRSKTSTHGRNMAGARALWRATGMKDEDFKKPIIAIANSFTQ
FT                   FVPGHVHLKDMGQLVAREVERAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMVNAHCADAIVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLASHGLDLV
FT                   DAMVIAADSTASDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLALPGNGSALAT
FT                   HSDREQLFLQAGRTIVDLCRQYYKENDDSVLPRNIANFKAFENAMTLDIAMGGSTNTIL
FT                   HLLAAAQEAEIDFDLRHIDHLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSILGELARG
FT                   GLLHTDLPTVHSKTLAEGIAKWDITQTDDEAVHTFFKAGPAGIPTQTAFSQSTRWESLD
FT                   DDRENGCIRSVQHAYSQEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGSAKIFESQDS
FT                   AVRGILADEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKDCALLTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLVRDGDKVLIDIPNRSINLLIDDAEMAERRTEQDKKGWK
FT                   PVESRPRKVTTALKAYALLATSADKGAVRDKALLDKLVP"
FT   regulatory      510007..510039
FT                   /note="442-><-443, 100% conf. Stem=14 Gap=2"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(510007..510039)
FT                   /note="442-><-443, 100% conf. Stem=14 Gap=2"
FT                   /regulatory_class="terminator"
FT   gene            complement(510060..510383)
FT                   /locus_tag="Psyr_0470"
FT   CDS_pept        complement(510060..510383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35540"
FT                   /db_xref="GOA:Q4ZZ82"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35540.1"
FT                   /translation="MDFVLDLLATVSRWSRSNLSEIALALVGCLLVLFGSDIKGWLEQR
FT                   ISGITGALRIPLIALLCAVGSGAALIYATPWVVRGLSQFNNYSLAPVLLVVLVLIGVIA
FT                   DRK"
FT   misc_feature    complement(510072..510122)
FT                   /locus_tag="Psyr_0470"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(510153..510218)
FT                   /locus_tag="Psyr_0470"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(510258..510323)
FT                   /locus_tag="Psyr_0470"
FT                   /note="1 of 3 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(510393..511607)
FT                   /locus_tag="Psyr_0471"
FT   CDS_pept        complement(510393..511607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0471"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35541"
FT                   /db_xref="GOA:Q4ZZ81"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35541.1"
FT                   /translation="MTHDSPAQPLFLGESGFSSESPRPALPHLPPLSLYIHIPWCVRKC
FT                   PYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFFGGGTPSLFSADALGR
FT                   LLQGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIGIQSFQESKLKALGR
FT                   IHNGDEAIRAADMARRAGFDNFNLDLMHGLPDQSQDEALADLRQAIALAPTHLSWYQLT
FT                   LEPNTVFWNQPPVLPEDDILWDIQETGQQLLATHGYAQYEVSAYAQPGKPARHNLNYWA
FT                   FGDFIGIGAGAHGKLSHPDGRIVRTWKTRLPKDYLNPDKPFQAGSKLLPLDELPFEFLM
FT                   NALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQDPTRLIATPQGQLFLNDLL
FT                   QYFLI"
FT   regulatory      complement(510838..510870)
FT                   /locus_tag="Psyr_0471"
FT                   /note="hrp box; putative HrpL-dependent promoter; location
FT                   identified by hidden Markov model and or weight matrix
FT                   scans; (PMID 17073298)"
FT                   /regulatory_class="promoter"
FT   gene            complement(511604..512197)
FT                   /locus_tag="Psyr_0472"
FT   CDS_pept        complement(511604..512197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0472"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35542"
FT                   /db_xref="GOA:Q4ZZ80"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35542.1"
FT                   /translation="MNLTQLVLASHNGGKLKELQAMLGDSVTLRSVSEFSLVEPEETGL
FT                   SFVENAILKARNAARLSGLPALADDSGLAVDFLGGAPGIYSARYADGQGDAANNAKLLE
FT                   ALKDVPDEQRGAQFVCVLALVRHADDPLPILCEGLWHGRILHAASGEHGFGYDPLFWVP
FT                   ERNCSSAELGPTEKNQLSHRARAMVLLRQRLGLQ"
FT   gene            complement(512231..512851)
FT                   /locus_tag="Psyr_0473"
FT   CDS_pept        complement(512231..512851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0473"
FT                   /product="Methionine biosynthesis MetW"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35543"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35543.1"
FT                   /translation="MRADLEIIQEWIPAGSRVLDLGCGDGELLTWLRDHKQVTGYGLEN
FT                   DAANIAECVAKGINVIEQDLDKGLGNFASNSFDVVVMTQALQAVHYPDRILDEMLRVGR
FT                   QCIITFPNFGHWRCRWYLASKGRMPVSEFLPYTWYNTPNIHFCTFGDFEELCRERDAQV
FT                   LDRLAVDQQHRHGWASKLWPNLLGEIGIYRVTSPGLTDHRIAV"
FT   gene            complement(512859..513998)
FT                   /locus_tag="Psyr_0474"
FT   CDS_pept        complement(512859..513998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0474"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35544"
FT                   /db_xref="GOA:Q4ZZ78"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35544.1"
FT                   /translation="MPTVFPHDSVGLVTPQTAHFSEPLALACGRSLPAYDLIYETYGQL
FT                   NAARSNAVLICHALSGHHHAAGFHSADDRKPGWWDSCIGPGKPIDTTKFFVVSLNNLGG
FT                   CNGSTGPSSIDPDTGKPFGANFPVVTVEDWVNSQARLADLLGIDTWAAVIGGSLGGMQA
FT                   LQWTISYPNRVRHCLAIASAPKLSAQNIAFNEVARQAILTDPEFHGGSFQERGVIPKRG
FT                   LMLARMVGHITYLSDDSMGEKFGRGLKSEKLNYDFHSVEFQVESYLRYQGEEFSGRFDA
FT                   NTYLLMTKALDYFDPAANFNDDLAKTFANATARFCVMSFTTDWRFSPARSRELVDALMA
FT                   ARKDVCYLEIDAPQGHDAFLIPIPRYLQAFGNYMNRISL"
FT   gene            complement(514265..514855)
FT                   /locus_tag="Psyr_0475"
FT   CDS_pept        complement(514265..514855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0475"
FT                   /product="Protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35545"
FT                   /db_xref="GOA:Q4ZZ77"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35545.1"
FT                   /translation="MIGLNTAAIYVLQTLGSLYLLIVLLRFVLQLVRANFYNPLCQFIV
FT                   RATQPLLKPLRRIIPSLFGLDMSSLVLAIIVQMILMALTLLLMFGTTGDPLHLLLWSII
FT                   GVTALFLKIFFFALIISVILSWVAPGSHNPGAELVNQICEPALAPFRKIVPNLGGLDIS
FT                   PILAFLVLKLLDMLVINNLAAMSNMPDVLRLLM"
FT   misc_feature    complement(514304..514369)
FT                   /locus_tag="Psyr_0475"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(514496..514561)
FT                   /locus_tag="Psyr_0475"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(514583..514648)
FT                   /locus_tag="Psyr_0475"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(514769..514834)
FT                   /locus_tag="Psyr_0475"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(514881..515699)
FT                   /locus_tag="Psyr_0476"
FT   CDS_pept        complement(514881..515699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0476"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35546"
FT                   /db_xref="GOA:Q4ZZ76"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35546.1"
FT                   /translation="MSKTRIAFVGAGNMAASLIGGLRAQGVEAALISASAPGAETRERI
FT                   ANDHGIQVFADNADAIKGVDVVVLAVKPQMMKTVCQALKSGLEPHQLIVSVAAGITCAS
FT                   LTQWLGEQPVVRCMPNTPSLLRQGASGLYATDNVTPEQREQAEALLAAVGIAVWVEQEK
FT                   HMDAVTAVSGSGPAYFFLMMEAMTAAGVKLGLPEDIAKKLTLQTALGSALIATGSDAGA
FT                   GELRRRVTSPGGTTEAAIKAFQAGGFEALVETALTAADHRAAELAEQLGK"
FT   sig_peptide     complement(515625..515699)
FT                   /locus_tag="Psyr_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.614 at
FT                   residue 25"
FT   gene            complement(515721..516407)
FT                   /locus_tag="Psyr_0477"
FT   CDS_pept        complement(515721..516407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0477"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35547"
FT                   /db_xref="GOA:Q4ZZ75"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35547.1"
FT                   /translation="MSTIAANISTLEQRIRDAALAAERDPASVGLLAVSKTKPASDLRE
FT                   AYNAGLRDFGENYLQEALGKQLELSDLPLCWHFIGPIQSNKTRAIAENFDWVHSVDRLK
FT                   IAQRLSEQRPEALEPLNICIQVNVSGEASKSGCTPQDLPALAATIIALPRLRLRGLMAI
FT                   PEPTDDPAAQDASFAAVRALQEQLNLALDTLSMGMSHDLEAAIAQGATWVRIGTALFGA
FT                   RDYGQP"
FT   gene            516463..517497
FT                   /locus_tag="Psyr_0478"
FT   CDS_pept        516463..517497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0478"
FT                   /product="pilus retraction ATPase PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35548"
FT                   /db_xref="GOA:Q4ZZ74"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35548.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLDAK
FT                   EVKALIYDIMNDKQRQDFEERLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKIL
FT                   SMEDLGMGNVFRKITDVARGLILVTGPTGSGKSTTLAAMIDYLNNNKHHHILTIEDPIE
FT                   FVHESKKCLVNQREVHRDTLGFSEALRSALREDPDVILVGEMRDLETIRLALTAAETGH
FT                   LVFGTLHTTSAAKTIDRIVDVFPAQEKSMIRSMLSESLHAVVSQALLKKVGGGRVAAHE
FT                   IMMGTPAIRNLIREDKVAQMYSSIQTGGSMGMQTLDMCLADLVKKGLITRESARERAKV
FT                   PDNF"
FT   regulatory      517525..517550
FT                   /note="451-><-452, 100% conf. Stem=11 Gap=0"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(517525..517550)
FT                   /note="451-><-452, 100% conf. Stem=11 Gap=0"
FT                   /regulatory_class="terminator"
FT   gene            complement(517592..518269)
FT                   /locus_tag="Psyr_0479"
FT   CDS_pept        complement(517592..518269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0479"
FT                   /product="NLP/P60"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35549"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35549.1"
FT                   /translation="MRPFFKTWLTICLFMPLAAHATNREQQLPASFSGYTAKSHSSPAL
FT                   ATRNAPQEAATTRTQYGATAAVQKPLSRKNAKKVAALQASAPAKQGSAVVKRALQAVGT
FT                   PYRWGGTTPGKGLDCSGLVKYAYTDVREVDLPRTSNAMAQGHGQTVDRKDLKPGDLLFF
FT                   NIKSRNINHVAIYLGDNKFVHAPRRGKAVTVDTLNKPYWNSHYKIAKRVLPKQAGQMRV
FT                   VQR"
FT   gene            518520..518924
FT                   /locus_tag="Psyr_0480"
FT   CDS_pept        518520..518924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0480"
FT                   /product="TM2"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35550"
FT                   /db_xref="GOA:Q4ZZ72"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35550.1"
FT                   /translation="MNAYRSDTHSKVMGYLMWIFGFLGAHRFYYGKPVTGTLWFFTFGL
FT                   FGIGWLIDLFLIPSMDRDADLRFTPGSTDYSVAWVLLTFLGLFGVHRMYQGKWITGIIY
FT                   LFTGGLFLVGILYDFWTLNDQISMKNARRG"
FT   misc_feature    518553..518609
FT                   /locus_tag="Psyr_0480"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    518622..518690
FT                   /locus_tag="Psyr_0480"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    518748..518801
FT                   /locus_tag="Psyr_0480"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    518811..518879
FT                   /locus_tag="Psyr_0480"
FT                   /note="1 of 4 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(519207..520478)
FT                   /locus_tag="Psyr_0481"
FT   CDS_pept        complement(519207..520478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0481"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35551"
FT                   /db_xref="GOA:Q4ZZ71"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35551.1"
FT                   /translation="MKLSILGARVIDPVSGLDQITDLHLEAGKLSAIGSAPAGFEPTQT
FT                   IDATGLVAAPGLVDLNVSLREPGYSRKGSIASETRAAVAGGVTSLCCPPRTKPVLDTSA
FT                   VAELILDRAREAGFSKVFPIGALSKGLDGEQLAELIALRDAGCVAFGNGLSSFSNTRTL
FT                   CRALEYAATFDLTVIFNSQDRDLAEGGLAHDGPTASFLGLAGIPETAETVALARDLLLV
FT                   EQSGVRAHFSQLTSARGAALIAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPP
FT                   LRTRADRDGLREAVKSGVIQAISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLV
FT                   DDGLLDLPTLIARLSSGPAAALRLPAGKLSAGAPADIVLFDPAASTVAGETWLSKGENC
FT                   PFIGHCLPGSVRYTLVDGRISYSR"
FT   gene            complement(520475..521479)
FT                   /locus_tag="Psyr_0482"
FT   CDS_pept        complement(520475..521479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0482"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35552"
FT                   /db_xref="GOA:Q4ZZ70"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35552.1"
FT                   /translation="MTPLDAKRPLQLNHLGQLRHFLSLDGLPRELLTEILDTADSFLEV
FT                   GARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSTSKGETLF
FT                   DTLRNLEAMAADMFVVRHADSGAAHFIAEHVCPDVAIINGGDGRHAHPTQGMLDMLTIR
FT                   RHKGGFENLSVAIVGDILHSRVARSNMLALKALGCPDIRVIGPKTLLPVGVEQYGVKVY
FT                   TDLNEGLKDVDVVIMLRLQRERMTGGLLPSEGEFYRLFGLTTARLAAAKPDAIVMHPGP
FT                   INRGVEIESAVADGAHSVILNQVTYGIAIRMAVLSMAMSGQNAQRQFEQENAQ"
FT   gene            complement(521492..522004)
FT                   /locus_tag="Psyr_0483"
FT   CDS_pept        complement(521492..522004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0483"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35553"
FT                   /db_xref="GOA:Q4ZZ69"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35553.1"
FT                   /translation="MSLPDPAELIRQMATDLNAHLSKRGISDPRFIGIRTGGVWVAQAL
FT                   LKALNNPAPLGTLDVSFYRDDFSQNGLHPQVRPSELPFEIEGQHLVLIDDVLMSGRTVR
FT                   AALNELFDYGRPASVTLVCLLDLDAGELPVRPNVVGATLSLAPDERIKLSGPEPLALEL
FT                   QDLSTAL"
FT   gene            complement(522103..522543)
FT                   /locus_tag="Psyr_0484"
FT   CDS_pept        complement(522103..522543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0484"
FT                   /product="Conserved hypothetical protein 250"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35554"
FT                   /db_xref="GOA:Q4ZZ68"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35554.1"
FT                   /translation="MAALRLLLGIDYGTKQIGVAVGQAITGQARELCTLKAQNGVPDWD
FT                   KVQALINEWKPDAIVVGLPLNMDGTPSDMSARAEKFSRKLNGRFGVTVYTHDERLTTFE
FT                   AKGERMARGGQKGSYRDNPVDAIAAALLLQGWLDEHPELLNV"
FT   gene            complement(522543..523115)
FT                   /locus_tag="Psyr_0485"
FT   CDS_pept        complement(522543..523115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0485"
FT                   /product="Protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35555"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35555.1"
FT                   /translation="MKKVSPSYLKHHFLIAMPHMHDENFAQTLTYIVEHNANGAMGLVI
FT                   NRPQSLTLADVLEQLRPELPAPRHCQDIVIHTGGPVQTDRGFVLHPSGQTFQATVNLPG
FT                   GISLSTSQDVLFSIADGYGPDQNVITLGYAGWDAGQLDAEMADNAWLTCSFDPAILFDV
FT                   DSDQRLEAAARRLGINLNLISTQAGHA"
FT   gene            complement(523191..524093)
FT                   /locus_tag="Psyr_0486"
FT   CDS_pept        complement(523191..524093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0486"
FT                   /product="TonB, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35556"
FT                   /db_xref="GOA:Q4ZZ66"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35556.1"
FT                   /translation="MTSMANNDLPLELANAGVRPADRLGFTMMIAALIHLAVILGVGFT
FT                   YVKPEQISQTLEITLATFKSEEKPKQADFLAQDDQQGSGTLDKAETLKTTELAPYQDTK
FT                   VNKVTPPPASKPVVKQEAPKTAVATTAPSQQKTVAKRDEVKPEPTTKAAPTFDSSELSN
FT                   EIASLEAELSTEQQLYAKRPKIHRLNAASTMRDKGAWYKDDWRKKVERVGNLNYPEEAR
FT                   RKQIYGNLRLLVSINRDGSLYEVLVLESSGQPLLDQAAQRIVRLAAPFAPFTGDLADID
FT                   RLEIIRTWKFARGDKLSSN"
FT   misc_feature    complement(523956..524021)
FT                   /locus_tag="Psyr_0486"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(524260..525219)
FT                   /locus_tag="Psyr_0487"
FT   CDS_pept        complement(524260..525219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0487"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35557"
FT                   /db_xref="GOA:Q4ZZ65"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35557.1"
FT                   /translation="MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLY
FT                   QNAGQARARMKPLKVFADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLE
FT                   QAERAGVLVVNKPQSLRDCNEKLFATLFPQCTPPTLVSRRADIIREFAEQHGDVILKPL
FT                   DGMGGASIFRHRAGDPNLSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPY
FT                   CLARIPAAGETRGNLAAGGRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLT
FT                   EINVTSPTCIREIDNAFGTNIGGLLMDAIEKKLQARKG"
FT   gene            525474..525884
FT                   /locus_tag="Psyr_0488"
FT   CDS_pept        525474..525884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0488"
FT                   /product="Response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35558"
FT                   /db_xref="GOA:Q4ZZ64"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35558.1"
FT                   /translation="MEQHASALKVMVIDDSKTIRRTAETLLKNAGCEVITAIDGFDALA
FT                   KIADNHPRIIFVDIMMPRLDGYQTCALIKNNRAFKSTPVIMLSSKDGLFDKAKGRIVGS
FT                   DQFLTKPFSKEELLSAIKAHVPGFVAAEQHIS"
FT   gene            525931..526296
FT                   /locus_tag="Psyr_0489"
FT   CDS_pept        525931..526296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0489"
FT                   /product="Response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35559"
FT                   /db_xref="GOA:Q4ZZ63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35559.1"
FT                   /translation="MARILIVDDSPTEMYKLTGMLEKHGHEVLKAENGADGVALARQEK
FT                   PDAVLMDIVMPGLNGFQATRQLTKDPDTTNIPVIMITTKDQDTDKVWGKRQGARDYLTK
FT                   PVDEETLMKTLNAVLAG"
FT   gene            526311..526850
FT                   /locus_tag="Psyr_0490"
FT   CDS_pept        526311..526850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0490"
FT                   /product="CheW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35560"
FT                   /db_xref="GOA:Q4ZZ62"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35560.1"
FT                   /translation="MAEPRTAFELLLDMDRRCRSLAAGLPLQEAHQQDWVGIGFRMGEQ
FT                   RFVAPIGEIAEILHEPHHAVMPGVKFWVAGIANLRGRLLPLMDLCGFFGHELVPVRKQR
FT                   RVLVVEHHDVFAGLLVDEVFGMQRFSQLSLIPQTPQEIDQRMVPFLRGQFIREQAWLIF
FT                   SPWALVQSADFMDLAS"
FT   gene            526901..528943
FT                   /locus_tag="Psyr_0491"
FT   CDS_pept        526901..528943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0491"
FT                   /product="chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35561"
FT                   /db_xref="GOA:Q4ZZ61"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35561.1"
FT                   /translation="MSSTDRSREGARSRTQIILLFVALIVFIMLLFANFAYLNTQSNYD
FT                   KQYIGHAGELRVLSQRIAKNATEAAAGKTQAFKLLADARNDFDVRWGYLRKGDPATGLP
FT                   AAPELIRDELRTVQRDWEGLRKSTDVILASEQTVLSLHQVAATLAETIPQLQAEYEKVV
FT                   ESLLQSRAPAAQVVVAQRQALLAERILGSVNTVLAGDETAVQAADAFGRDASQFGRVLN
FT                   GMLEGNATLRISQVEDRDARARLAEIAELFEFVSGSVDEILETSPELYQVREASGNIFN
FT                   TSQTLLDETSVLANSLENLAKRRTVNTVGGYVLGLLALASIILIGLVMVRETNRQLRET
FT                   AQKSERNQTAIMRLLDEIENLADGDLTVTASVTEDFTGAIADSINYSIDQLRELVVTIN
FT                   LTAEQVAAAVTETQATAMQLSAASEHQALQISAASTAINDMAASIDQVSTNASESSAVA
FT                   ERSVTIANKGNEVVQNTIHGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLIDDIADQT
FT                   NILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSSATKQIETLVRAIQNDTNEAVIS
FT                   MEQTTSEVVRGARLAQDAGVALGEIEGVSRVLAELIESITDAAHQQAESAGQISQIMTV
FT                   IQQTTSQTTSGTSATAESIGNLAKMASEMRRSVSGFALPSSKKAG"
FT   sig_peptide     526901..527017
FT                   /locus_tag="Psyr_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.571 at
FT                   residue 39"
FT   misc_feature    526943..527011
FT                   /locus_tag="Psyr_0491"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    527822..527890
FT                   /locus_tag="Psyr_0491"
FT                   /note="1 of 2 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            528991..534969
FT                   /locus_tag="Psyr_0492"
FT   CDS_pept        528991..534969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0492"
FT                   /product="Response regulator receiver:CheW-like
FT                   protein:ATP-binding region, ATPase-like:Hpt"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35562"
FT                   /db_xref="GOA:Q4ZZ60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35562.1"
FT                   /translation="MADRHDYVALEWLKGEIAETLRQARQALDGFIEDPANAAAMAECL
FT                   NLVHQVHGSLQMIEFYGAALLAEEIEQLALAVQQNRVSHPIESEQLLIQAMSQLPVYLE
FT                   RIHSARRDLPLVVLPLLNDLRSARGESLLSETSLFAPQLVVVPALDEQELARRNTPELP
FT                   NLLRKLRQTLQAALAGLMREQGVQTQLGYMAKVFARLEQLCEDAPLGALWRIASALVET
FT                   MLNGNFTNSPALRSLLKDADKELKRLAEQGVTGINQPAPEELLKSLLFYIAKSDSLAPK
FT                   MLDLKDQYALADALPGNDVVNEERARMAGPDRDAMRSVIVALCEGLVRVKERLDVFVRG
FT                   DRQHVSELNALLPPLRQIADTLAVLGFGQPRKVIIDQLSVVLGLAQGQREPSDAALMDV
FT                   AGALLYVESTLAGMAGSHEQVSREESRLPTTDLTQIHQLVIREARTVLQQAKDVILDYI
FT                   DGAWDRQRLDPLCALIVQVRGALAMIPLARAASLLAACNEYIQEHLLVDETRPTWVQLD
FT                   CLADTITGIEYYLERMLEDHQAPGDQVLDMAQQSLARLGYTPAADTLDVPLLEEVITQD
FT                   ELLELDDRKALVSPTQTIAQVLASPVSAVNPPARNVPASLLPPSAGEEAVDDELRDVFL
FT                   EEADEVLDALREYLPRWFTSLGSDGHWDSTALTEVRRAFHTLKGSGRMVRALILSELAW
FT                   AVENLLNRVLEGDVLPGLEVQQLMTEVQALLPSVIRDFAEGAQCQRDDVDLLAARAHAL
FT                   ANGLEPPMLPAADDHVPGQPVADEPLDPQLLEIFRQEALGHLNTLGRFLDNAEQSASPA
FT                   ISDAVLRALHTLKGSAHMAGVLPIAELASPLDQLVREYKANLIDIGSPELALLRSAEPL
FT                   LHKGLEQLDSTPLADIPGAAPLIEAALAMLNDRLTVVLRESDSGLRIKRNPTLLAGFLA
FT                   EGMDIVLDAENLLQRWRQHPGERQELSALLDELTTLGHGAHLADLPQVDELCEALLDLY
FT                   GAVEESSLAVSERFFDVAENAHEALINMLDQVAAGQDVEPRPECVRALNQLLDQALDPS
FT                   ATGLVKSDGHRTLSVTELNAATAQLASEAGHTEVAGPDDEIVEIFLEEAVDILDSAGQA
FT                   LQRWLADPENPAPLASLQRDLHTLKGGARMAEVAEVGDLAHELENLYEGLIDRRFNHSP
FT                   TLAALLNESHDHLAILLEQLYRQEALSDPSALIEALRSCRTLESAGPEVQASPAAHEDL
FT                   PEHDAELREVFLEEGFDIMESSGAALARWQADPHNMLEVENLLRDLHTLKGGARMVEIA
FT                   PIGDLAHELETLYEGLSAGSLQPAPLMIGLLQSGQDVLADMLDAVRNEKPLPDASLLIE
FT                   SIRRLATDEPSGAQLAAQDPEVHPESVVAVAPVAEGEVERSGPEMVKVPAEQLEDLVNL
FT                   AGETSIFRGRIEQQIIDSQIALVEMETTIERMRDQLRRLDMETQGRILSREQVQTERLG
FT                   YEEFDPLEMDRHSQLQQLSRALFESASDLMDLKETLGARARDAETLLSQQARVNTQLQE
FT                   GLMRTRMVPFERLVPRLRRVVRQVASELHKKVHFEVGNADGEMDRNVLERMVAPLEHML
FT                   RNAVDHGLESTEKRIAAGKPEQGHISLELMYEGGDMVIELSDDGSGVDLAAVRRKAIKR
FT                   GMIHPDADLSDHEVLPFILQAGFSTSEIITQISGRGVGMDVVHAEVKQLGGSMVIDSVP
FT                   GKGTRFRIRLPISVSVNRALMVTCGEEQYAVPLNTVDGIVRVMANELDGYYQTSPPRYQ
FT                   YGGRSYELRYLGELLGSSPPRLAGQLQPLPVLLVHLQDQWVAVQVDALAGSREIVVKSL
FT                   GPQFSRVQGISGATILGDGQVVLILDLMAQIRNLQGLPFRGLMAPAYHEVEHARPLLVM
FT                   VVDDSVTVRKVTSRLLERHGMHVLTAKDGVDAMTLLQEHTPDIMLLDIEMPRMDGFEVA
FT                   SQIRQDEQLKDLPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESIAYWSQAHV
FT                   "
FT   gene            534962..535432
FT                   /locus_tag="Psyr_0493"
FT   CDS_pept        534962..535432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0493"
FT                   /product="CheW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35563"
FT                   /db_xref="GOA:Q4ZZ59"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35563.1"
FT                   /translation="MSEGTFQTSRLTSLTGLLVPLSDRHLLLPNVAVAELIDYQDCSAE
FT                   PDAPEWYLGPIIWRELTLPLLSFEAACGGRTRVGGRARIVVLNALGGRNDVRFIALLTQ
FT                   GIPRSCKVDSQLSYVDVPLAELELAAVQIGETIARIPDLEGLEQWLVDAGLS"
FT   gene            complement(535554..537017)
FT                   /locus_tag="Psyr_0494"
FT   CDS_pept        complement(535554..537017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0494"
FT                   /product="Protein of unknown function UPF0061"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35564"
FT                   /db_xref="GOA:Q4ZZ58"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35564.1"
FT                   /translation="MKALDELIFDNRFARLGDAFSTSVLPEPIDAPQLVVASQSALALL
FT                   DLAPEQADLPLFAEIFSGHKLWSEAEPRAMVYSGHQFGSYNPRLGDGRGLLLGEVYNDA
FT                   GEHWDLHLKGAGRTPYSRMGDGRAVLRSSIREFLASEVLHALGIPSSRAGCVVSSSTPV
FT                   WRETQEHAAMVLRLAQSHVRFGSLEYFFYTKQPEQLKTLAEHVLTMHYPHCQEQPEPYL
FT                   AMFREIVERNAELIAKWQAYGFCHGVMNTDNMSILGITFDFGPFAFLDDFDEHFICNHS
FT                   DHEGRYSFSNQVPIAQWNLSALAQALTPFISVDALREAIGLFLPLYQAHYLDLMRRRLG
FT                   LTVAHEQDEQLVSQLLKLMQNSGVDYTLFFRRLGDQPAAEALRTLRDDFVDIKGFDGWA
FT                   QAYQARIALENNGTEQERQTRMHAVNPLYILRNYLAQNAIAAAEKGDYAEVRRLHQVLC
FT                   TPFTEQPGMQGYAQRPPDWGKHLEISCSS"
FT   gene            complement(537156..537905)
FT                   /locus_tag="Psyr_0495"
FT   CDS_pept        complement(537156..537905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0495"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35565"
FT                   /db_xref="GOA:Q4ZZ57"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35565.1"
FT                   /translation="MKHLLTFVLASQSAVVEYRPGFSFSGPFMNDAASTLPRTLGESIT
FT                   TELRRMLVEGELVPGQRLSEAALAESLDISRNTLREAFRVLTREGLLTHEPNRGVTVAK
FT                   PDMASIIDIYRIRRFIECGAIAQAYPQHPGVLHMRNAVEAGVQAREAKDWIAVGTANMM
FT                   FHKAIVELSDSPRLVTFYAQISAELRLAFGLLNNPELLHSPYLDMNAAVLGRLDAGKTD
FT                   EATRMLEDYLVQSERTILAAFERSRNR"
FT   gene            538075..539307
FT                   /locus_tag="Psyr_0496"
FT   CDS_pept        538075..539307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0496"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35566"
FT                   /db_xref="GOA:Q4ZZ56"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35566.1"
FT                   /translation="MTQTANEFTKARRASLIAAIFMMATSAIGPGFLTQTATFTATLGA
FT                   AFAFGILASILIDFVVQLNVWRIVTLTRMRAADLANAAIPGSGYLLAVLVIFGGLVFSL
FT                   GNIAGAGLGLNALTGLDPKWGGALSALIAIAIFSSHRAGIAMDRIMMVLGTLKVCLILF
FT                   AAFASHPPLGEALRQTVLPDMVDFAAITTIVGGTVGGYITYAGAHRLLDRGTVGVENID
FT                   VVSKAALTGILVTGVVRYILFLAILGVVASGVVIDVSGKGANPAAQAFTAAAGNFGLIM
FT                   FGLVLWAAGISSVIGASYTSMSFITVFSKRITERARNLATVGFILITVVVYVMWGKPPA
FT                   ALLVFAGGFNGLILPLGLSIFMYVGWRRSDMMDGYHYPRWLLVLGVLTCLLSWYMAFKS
FT                   VGPIFAFINAA"
FT   sig_peptide     538075..538185
FT                   /locus_tag="Psyr_0496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.356 at
FT                   residue 37"
FT   misc_feature    538108..538176
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    538204..538272
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    538333..538401
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    538444..538503
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    538522..538590
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    538633..538692
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    538780..538848
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    538891..538959
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    539020..539079
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    539107..539175
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    539212..539265
FT                   /locus_tag="Psyr_0496"
FT                   /note="1 of 11 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            539323..540087
FT                   /locus_tag="Psyr_0497"
FT   CDS_pept        539323..540087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0497"
FT                   /product="LamB/YcsF"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35567"
FT                   /db_xref="GOA:Q4ZZ55"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35567.1"
FT                   /translation="MPAIDLNSDLGESFGAWSMGDDEAILDVVSSANVACGFHAGDPAG
FT                   ILRTLEAAAARGVAIGAHVAYPDLVGFGRRNMDIPSDQLTADVIYQIGALQGLARSAGT
FT                   RVSYVKPHGALYNTIAGDQRQAAAVIQALLRIDPALKLVCLANSPLLDWAREAGLSCVA
FT                   EAFADRAYTAQGTLVSRSRPGAVLHDAELIAERMLRLVREDVIEAEDGREISLQADSIC
FT                   VHGDSPGAVNIARILKNRLHDAGVTVRAFNRG"
FT   gene            540090..540884
FT                   /locus_tag="Psyr_0498"
FT   CDS_pept        540090..540884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0498"
FT                   /product="Protein of unknown function DUF1445"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35568"
FT                   /db_xref="GOA:Q4ZZ54"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35568.1"
FT                   /translation="MNSLQLAREAASAARTRYRQGFVAPTAGEAPGLTQCNMITLPREW
FT                   AYDFLLFAQRNPQACPVLDVTEPGSHTTLLAEQADLRTDLPLYRVWRDGQLAEELSDVS
FT                   HIWAQHTDLVSFLIGCSFTFETDLMHAGIDVRHISEGCNVPMYRSNRVCRPAGRLQGNM
FT                   VVSMRPIAADRVAEAARITGRYPGVHGAPVHVGEPELLGINDLANPDFGDAVTIRPGEI
FT                   PVFWACGVTPQAVVMASRVPFAISHAPGHMFITDIPDSYYHV"
FT   gene            540894..542498
FT                   /locus_tag="Psyr_0499"
FT   CDS_pept        540894..542498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0499"
FT                   /product="Urea amidolyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35569"
FT                   /db_xref="GOA:Q4ZZ53"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35569.1"
FT                   /translation="MRFYPANLDALLVELSNLDETLALFESLQQMPIAGVEEIVPAART
FT                   LLVHFRPSAIGFEALATQIASRDIRGKAREAGKLIEIPVHYNGEDLADVARELDISVEE
FT                   VIKRHTSSDYNVAFCGFAPGFAYLSGGAGFVVPRRSTPRTRIPAGAVALAGGFSGIYPQ
FT                   ASPGGWQIIGVTTSTMWDLGRDEPALLQPGYRVRFQDAGPLPETRVQVAAPVRPQATTV
FT                   SEDYLQIETPGLQTLFQDLGRPGRAGQGVSASGALDRGALRAANRAVGNDPATACLEIL
FT                   MGGLTFTCQGQTVVAITGAQVSVEVLTAEGQKLRPLLYAPFSLQNGDQVSIGSPTAGLR
FT                   NYLAVRGGFIHEPVLGSLSTDTLAQVGPAALAAGDRLGFTRRTGGLSVSTAEQPAFEMP
FT                   RSDEVITLDVVMGPRSDWFSAEAQQLLAQQTWLVTPQSNRIGIRLAGEQSLQRAVDGEL
FT                   PSEGTTVGAIQVPPSGQPVLFLADHPLTGGYPVIGAVATYHLDKAGQIPVNARIRFNPL
FT                   SAFEPVRPATSDETKNR"
FT   gene            542495..544228
FT                   /locus_tag="Psyr_0500"
FT   CDS_pept        542495..544228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0500"
FT                   /product="biotin carboxyl carrier protein / biotin
FT                   carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35570"
FT                   /db_xref="GOA:Q4ZZ52"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35570.1"
FT                   /translation="MKKVLIANRGEIAVRIARACRDYGVASVAVYADADIDALHVRQAD
FT                   EAYGLQGERPTDTYLNIEKLLAVAARAGADAVHPGYGFLSERAEFARAVIDAGLIWIGP
FT                   DPATIDALGDKVQARRIALKVGAPLVAGTEDPVNDASEVVAFAEQHGLPIAIKAAFGGG
FT                   GRGLKVAWKLDEVSELYESAVREALTAFGRGECFVERFLDRPRHIEAQIIADRHGRVVV
FT                   VGTRDCSLQRRNQKLIEEAPAPYLNDELRQRIHESARAVCAEAGYVGAGTVEFLLSGDG
FT                   TLSFLEVNTRLQVEHPVTEETSGVDLVIEQLRVADGLPLSFDGTPVPRGHSFEFRINAE
FT                   DAGNGFLPTPGSITLFQPPSGPGVRLDTGVAEGSRVSPNFDSMIAKLIVTGATREQAIS
FT                   RARRALAEFKVEGVATVLPFHRAVMDHADFTAANTFAVHTRWIETDFAEHVTIAPRNAE
FT                   PVDPGVLRTFVEIDGKRHELGLPAELLAGMSLNAAAPADASQPVADAPDPHAVLTPVAG
FT                   NLHAWAVEDGATVEKGQVIAIMEAMKMETSILAPCAGTVQIGKEPGGYLEAKVVIGRVE
FT                   A"
FT   gene            complement(544287..547691)
FT                   /locus_tag="Psyr_0501"
FT   CDS_pept        complement(544287..547691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0501"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35571"
FT                   /db_xref="GOA:Q4ZZ51"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35571.1"
FT                   /translation="MRPVSMFSLRSFCAAALFALCLSSFPALAADPPSSAAVQQSLDKI
FT                   ADRKLPDAEQKALQQVLEQTLAFLNSKQDSEQKLEALKQQLAQAPKQTSENQRELARLK
FT                   ESKVVPVAQRYGGLDVPQLEQLLSQRSTQQSDLQSELNDANSLAITAQTRPERAQTEIS
FT                   ANQTRIQQINAILKNGKDNGKPLSADQRNLLNAELASINALNLLRRQELAGNSQLQDLG
FT                   NSQHDLLTEKVARQEQEIQDLQTLINDKRRAQSQKTVADLSLEAQKSGGSSLLATESAA
FT                   NLKLSDYLLRGTDRLNELTQQNLKTKQQLDNLTQTDQALSEQINVLSGSLLLSKILYKQ
FT                   KQALPHLELDKGLADEIANIRLYQFDINQQREQMSTPTAYVEKLLATQPPENVTPQLRR
FT                   TLLDLAITRSDLLERLNRELSALLNESITLQLNQKQLTSTAQGLRATLDEQMFWIPSNK
FT                   PLDVEWFQNIWPRLQKQVATLPWTSSLSELSDGLTQRPLLFLPLLLLIGILTWRRKALY
FT                   QKLNRLHADIGHFKRDSQWKTPLALLINVLLAMPVALGLALCGYALQIDARGQNANLGE
FT                   ALLQIALAWLVFYTAYRVLAPSGVAQLHFRWETAQVEFLRGWVRRLGLVVLALVAVVAV
FT                   AEHQPAALADDVLGIGVVLTCYALMTWLLGRLLISSPTHHNASLFRKTVGVLFTALPVA
FT                   LFLAVCFGYYYTALKLSDRLIDTLYLMMIWLMVEATFVRGLSVAARRLAYQRALAKRQA
FT                   ARENGDSDIPVEEPKLDIEQVNQQSLRLIRLALLAGFVGALYLVWAELITVFAYLDNII
FT                   LYEYTSGTGANMSMVPISLSDFLGAGVIIVITFVLAGNLPGLLEVLVLSRMNLAQGSAY
FT                   ATTTLLSYTIAGVGFVTTLSTLGVSWDKLQWLVAALSVGLGFGMQEIFANFISGIMILF
FT                   ERPVRIGDTITIGALSGTVSKIRIRATTITDFDRKDIIVPNKTFITGQLINWSLTDTVT
FT                   RVTLKLGVDYGSDLDLVRSLLLQAARENPRVLKEPEPIVYFLNFGESTLDHELRMHVRD
FT                   LGDRNPVLDEINRFINREFKKQHINISFRQMEIYLKNTQGLEYKLVPAEPSDKGNAPTG
FT                   KTTLQPVNTTVTPATKDAPEPPELRLD"
FT   misc_feature    complement(544926..544991)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(545022..545087)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(545109..545174)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(545274..545339)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(545481..545546)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(545577..545642)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(545682..545747)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(545784..545840)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(545904..545960)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(546006..546071)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(546159..546215)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(547605..547670)
FT                   /locus_tag="Psyr_0501"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(547715..549511)
FT                   /locus_tag="Psyr_0502"
FT   CDS_pept        complement(547715..549511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0502"
FT                   /product="potassium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35572"
FT                   /db_xref="GOA:Q4ZZ50"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR023729"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35572.1"
FT                   /translation="MVSFRPSRCNSVFYGVPPLDATTINSLFLIGALLVAASILVSSLS
FT                   SRLGIPILVIILAVGMVAGVDGGGIIFDNYATAYLVGNLALAVILLDGGLRTRVASFRV
FT                   ALWPALSLATVGVLITTVLTGMMAAWLFNLSVIQGLLIGAIVGSTDAAAVFSLLGGKGL
FT                   NERVTASLEIESGSNDPMAVFLTVTLIGMLASGQTGLHWGLLGHLIQEFGIGSFIGLGG
FT                   GWILLQLVNRINLAAGLYPILVIAGGLAIFALTNAIHGSGFLAVYLCGLVLGNRPIRSR
FT                   HGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIAIPALGLALWMILVARPLSVMVGLL
FT                   PFKAFHDREKAFIAWVGLRGAVPIILAVFPLMAGLPNAQLYFNLAFFIVLVSLLLQGTS
FT                   LPWMAKLLKVTVPPDPAPISRAALEVHVTSEWELFVYRLGAEKWCIGAALRELKMPEGT
FT                   RIAALFRGQQLLHPSGSTTLEVGDLLCVIGHEHDLPALGKLFSQAPQRGLDLRFFGDFV
FT                   LEGDARLGEVAALYGLKLDGIDPGMPLSQFIVQKNRGEPVVGDQVEWNGTIWTVAVMDG
FT                   NKIQKVGVKFPEGTRPGPGLFL"
FT   misc_feature    complement(548306..548371)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(548393..548458)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(548519..548575)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(548591..548641)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(548735..548800)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(548822..548887)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(548900..548965)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(549038..549103)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(549134..549199)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(549221..549286)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(549299..549364)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(549386..549451)
FT                   /locus_tag="Psyr_0502"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            549707..552841
FT                   /locus_tag="Psyr_0503"
FT   CDS_pept        549707..552841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0503"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35573"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35573.1"
FT                   /translation="MDDEFAAHYDFDDADRAGDDDSDAAFRKRVDEDFSVSDYFRLNPI
FT                   NLQSPAALAARDVAQECQSRWGVEIDPDDTLIATLYIEDPRLYPAPHRANVVHSMTLTQ
FT                   ALLRNWQQKGNGNWFDHLGHLQPHSDGGFDCQVVDEKLLASDCVAYEAIYRKTSPQRYD
FT                   ATTQLGINAEAFKQYIWDHNLQSGYIAYLKQFWHAHGEDYNLMLKAGLFKAAWLQADEN
FT                   TLKAEHKAMVLEALGLPGDQGWKTLSFDDFVAAPIATRVTISELLVHGYSAVDIMVIRS
FT                   ADSPTVLLYIPGNSSPIHAFKNADELKEWVALMCRDPGKRRSLEAHFSAADDLDGFFYS
FT                   GVATALKGFAVYPKLLDSATGAWNPRKLVQFGEPLQPWPFSHFKTRVRAKSEIDALQKI
FT                   RSHGDYWKEEASSGLSECVSVLGGVAIVFPELMPVVAGLSLALVGLGVDAAVNGHTLEE
FT                   RQAGLGRIAFGVLNALPILGEEGEAVEAGVETGLVDETGGGYEVPGASTEIDPVIDIEP
FT                   APVFRPEPPALRSLDKKMRRLLRALEAPQELPGLASGEVAGIYPLEGKRYIELHDRAFR
FT                   VEWVPQEKQYRIRSAADPRVWGPYVKTVDTGYWDLDLKLGLRGGESFDGTQLPPASEAE
FT                   SVVVPVVPGEPKIEVQRWAPKLQVELPMDGISIEEVLSQSRGTVIEKYFVQVRGEKTNV
FT                   YYDPDIRCWRTDPSDRDGLVWLDRDGVWNRGSKDTFQKLEANLPQSQRFEFYTFPRVPS
FT                   LPADAKPISRIVHHIWMGERTPGADLLEKMLSNMRTSPDLRFQLHIDIDDPAADQQLFD
FT                   YFFEQPQMHISRLKEEAFYPDFLSGENGEAFNYFRHSDNRNYAAASDILRYRLIDEYGG
FT                   IYVDCDDTINVPFAKFPLKAGPNDVLLGRELQAEHLGYKGPGNSHFGSHPNNPVLKQML
FT                   KEIKVRFDSEKQINEAFFSTRRPYIDRTDDATKAASKARMTPYMTRISDLTGPKLMSDV
FT                   LRRLRPDCFDLLARSYLPPDQVLSVIYEAYLKDTVDFYFPFKATAKITPGSANEW"
FT   gene            552941..555589
FT                   /locus_tag="Psyr_0504"
FT   CDS_pept        552941..555589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0504"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35574"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35574.1"
FT                   /translation="MTSLTQEDVMSPPPSQASKTDQQLLRERAQQFVLDYPDLHDLAYI
FT                   AASKIILQHTHRMFNPEKVYWHRFGSASSSPRTFTGWQHSGKPVQSMTLIELLIKHFSA
FT                   HDQEASDELSLYGGFYTDGPDHGFFDERNEVPMLPQDVLNDMWTLDFSSLYSRRMERFW
FT                   NTHSDNFCILAKAQYLVAAGHCLRKGQLSPDDFKQVTRVVIADPLQTPTLKALQEPLPL
FT                   PPGVSVHTLDIDGIKAHDLLRIVIAGGREVIYWPDAEQPFMAFDSERALYHWLKEQFMG
FT                   EQAAKAMTGHFLRGEASRTQDGARFARAVSDLLAHDWRADVRLINQSQAPIAGDPFVYL
FT                   RDVARQAMSADAREILTSNTDLLKQIWIGYLSAFLRAFGGLAPLSWPVALTLVGASLAN
FT                   TGLNIDQAVNGKTPAQRKAGVLGAILNTLYLLFNLPLLMSIRVAPQPLQVTTTDVASIS
FT                   SEALEGGSVLADPLDNMEGNLLLDTLTPSAEEGRLRGVYTLGNGETWIKLAHLPYRVMF
FT                   NEQQQCWMVVNPDNPFAFIGSKPVRLNAEGKWTLMASPGLQGGSPMDVQIPSGSASAPV
FT                   GKPYATVGSSFWDRYLQTDIFNEQHFAETALARQKQVMSIWDATPEDVLESDSSPDGNE
FT                   VYRDPWQGKHRVFKLGDDDYYAANITLYTQDDAQFNRFLRTGESLGRNQVRAIERLADD
FT                   IHVVGYNNDVELYRGGSGDRGTSGAVFRSGQIKVGDVLVNTDVTSFSENPYVVSAFASS
FT                   RAGAPASAMLGPVTFDDTSVVFVLPKGRYLRATPVAPFSASPDEAESIFLPGCYFQIDS
FT                   IEEVSGEFYRIMKVQMQEVDRPIQGRALYDMRTGEPFSREQYALKLGTDAKVLVDRFFP
FT                   QNPMTDLFSPR"
FT   gene            complement(555612..557414)
FT                   /locus_tag="Psyr_0505"
FT   CDS_pept        complement(555612..557414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0505"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35575"
FT                   /db_xref="GOA:Q4ZZ47"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35575.1"
FT                   /translation="MSESLLSSRNLAFELYEVLDAEGLTRRERFAEHSRETFDAALGTA
FT                   RVIAEKYFAPHNRKADENEPRYEKGEAILIPEVKPAVDAFIAAGFLNASRDFDVGGMQL
FT                   PTLLSQACFAHFQAANVGTTSYPFLTMGAANLIESFGSDEQKQRFLQPMIEGRFFGTMA
FT                   LTEPHAGSSLSDIRTRAEPADNGTYRLRGNKIFISGGDHSLSENIVHLVLAKLPDAPGG
FT                   VKGISLFIVPKFLVNEDGSLGKRNDVLLAGLFHKMGWKGTTSTALNFGDNGECVGYLVG
FT                   KPHHGLSYMFQMMNEARIGVGLGAVMLGYAGYLYSLDYARDRPQGRLPDSKSPESTPVP
FT                   IIQHADVRRMLLTQKAYVEGAFDLCLYASRLFDDTQTGETEDVRKHAHELLDLLTPVVK
FT                   SWPSEFCLKANELAIQVLGGHGYTREYPVEQYYRDNRLNPIHEGTHGIQSLDLLGRKLA
FT                   QNGGTGLKQLLRLIANTCERAQAHESLVELRQPLEQLIARLQAVTLGLLGDLAQGRITS
FT                   TLANSALYLKAFGHTVIGWRWLEQAIRAEEGLGKGNSADSDFYHGKLQAARYFLTWEVP
FT                   GCHHELTILENRDDTCLAMRDDWF"
FT   gene            complement(557685..561587)
FT                   /locus_tag="Psyr_0506"
FT   CDS_pept        complement(557685..561587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0506"
FT                   /product="L-proline dehydrogenase /
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35576"
FT                   /db_xref="GOA:Q4ZZ46"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR024090"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35576.1"
FT                   /translation="MKAAAHSIDRTPHWLIKQAIFNYLEKLESGATLLELDGAAGKDNE
FT                   DRGELAEEAGLQCFLDFAESIQPQSVLRAAITSAYRRPEPEVVPMLLEQARLSAPVAEA
FT                   TNKMAASIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVALMCLAEALLRIPDKGTRD
FT                   ALIRDKISNGNWQPHLGNSPSLFVNAATWGLLLTGRLVATHNEAGLTSSLSRIIGKSGE
FT                   PMIRKGVDMAMRLMGEQFVTGETIGEALANASRFEAKGFRYSYDMLGEAALTEHDAQKY
FT                   LASYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQYERVMDELYPRLLSLTLL
FT                   AKQYDIGLNIDAEEADRLELSLDLLERLCFEPQLTGWNGIGFVIQAYQKRCPYVIDYVI
FT                   DLARRSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYIACARKLLAAP
FT                   EVIYPQFATHNAHTLAAIYQIAGQNYYPGQYEFQCLHGMGEPLYEQVVGKVADGKLNRP
FT                   CRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADHSISIQELVADPVSQIERMATQE
FT                   GGFGLPHPRIPLPRDLYGTERANSSGIDMANEHRLASLSSALLATAHNDWKAAPMLGCP
FT                   ASAGTLSAALNPSDLRDVVGHVQEASLQDVDNAIQCALSAGPIWQATPPVERAAILERA
FT                   ADLMEAEIQPLMGLLVREAGKTFANAIAEVREAVDFLRYYAVQARNDFTNDGHRPLGPV
FT                   VCISPWNFPLAIFSGQVAAALAAGNPVLAKPAEQTPLIAAQAVRLLLEAGIPEGVVQLL
FT                   PGRGETVGAGLVGDERVKGVMFTGSTEVARLLQRNVAGRLDSQGRPIPLIAETGGQNAM
FT                   IVDSSALTEQVVIDVVSSAFDSAGQRCSALRVLCLQEDSADRVIEMLKGAMAENRLGNP
FT                   ERLSVDIGPVIDAEAKAGIEKHIQAMRDKGRTVYQVAIADSAELKRGTYVMPTLIELES
FT                   FDELQREIFGPVLHVVRYKRKELGLLIDQINASGYGLTLGVHTRIDETIAKVIDNVNAG
FT                   NVYVNRNIVGAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLSTRPQDAIEKSFVRSDALS
FT                   APDTRLREVLGKPLQALKAWAASNQQSDLDALCSQYAEQSQSGITRQLAGPTGERNSYA
FT                   ILPREHVLCLADDENDLLIQLAAVLAVGSSAVWPETDIGKPLRARLPKDVQARIKLIPD
FT                   WAKDEVIFDAVLHHGDSDQLRAICQQIAQRSGAIVGVNGLSHGETNVPLERLVIERALS
FT                   VNTAAAGGNASLMTIG"
FT   gene            562015..563574
FT                   /locus_tag="Psyr_0507"
FT   CDS_pept        562015..563574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0507"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35577"
FT                   /db_xref="GOA:Q4ZZ45"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35577.1"
FT                   /translation="MCRISVAIPFGIGCQHKNNAKAELMSVSNPTLITFVIYIAAMVLI
FT                   GLMAYRSTNNLSDYILGGRSLGSVVTALSAGASDMSGWLLMGLPGAIYMSGLSESWIAI
FT                   GLIIGAYLNWLFVAGRLRVQTEHNGDALTLPDYFSSRFEDNSGLLRIISAIVILVFFTI
FT                   YCASGIVAGARLFESTFGMSYETALWAGAAATIAYTFVGGFLAVSWTDTVQATLMIFAL
FT                   ILTPVIVLLATGGVDTTFLAIEAKDPTSFDMFKNTTFIGIISLLGWGLGYFGQPHILAR
FT                   FMAADSVKSIASARRISMAWMILCLGGTVAVGFFGIAYFSAHPEVAGPVTENPERVFIE
FT                   LAKLLFNPWIAGVLLSAILAAVMSTLSCQLLVCSSALTEDFYKAYLRKGASQVELVWVG
FT                   RAMVLLIAIIAILLAANPENRVLGLVSYAWAGFGAAFGPVVLISVLWKGMTRNGALAGV
FT                   IMGAATVVLWKQFSTMGLYEIIPGFILASISIVVFSLIGKPASASMQTRFLAAEQDFKA
FT                   NR"
FT   misc_feature    562093..562161
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    562282..562350
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    562459..562527
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    562570..562638
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    562672..562740
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    562783..562851
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    562912..562980
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    563062..563130
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    563191..563259
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    563287..563355
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    563374..563427
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    563437..563505
FT                   /locus_tag="Psyr_0507"
FT                   /note="1 of 12 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(563658..564329)
FT                   /locus_tag="Psyr_0508"
FT   CDS_pept        complement(563658..564329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0508"
FT                   /product="lyase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35578"
FT                   /db_xref="GOA:Q4ZZ44"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014895"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35578.1"
FT                   /translation="MVDLGSWNLSIPVGSPPKTIETAQLVKGYDGKYFKSKTDAIVFWS
FT                   PVTGTKTENAKYSRSELRETWSDGSLHNWVYPDADNFLNAKLEVDQVPSSGKIVIGQIH
FT                   AYESTEPLLKVEFQYKEDTKTGDIVAKVRNRYDDDESKVYTIVEGVKLNETFNYVIHLS
FT                   KGGKLSVSAKDQDWSTRISETWRDKPLYFKAGVYTQDNTGYTSEGGKATFYNLDIDHNE
FT                   S"
FT   gene            564626..566785
FT                   /locus_tag="Psyr_0509"
FT   CDS_pept        564626..566785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0509"
FT                   /product="PAS:GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35579"
FT                   /db_xref="GOA:Q4ZZ43"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35579.1"
FT                   /translation="MPTQRSSMERVPNQPDDGSSVLLVVDDYPENLVTMCAVLQRTDWH
FT                   IVTASSGIEALTVLLEQEVDLVLLDVQMPGMDGFEVARLMRGSQRTRLTPIIFLTANEQ
FT                   TQDAVQKGYANGATDYLFKPFDPNVLKPKVQTLLEQQRNRRALQQLSLELESARAFNAS
FT                   VLANVAEGILVVDEAGTISFANPAICQLLNTSVDHLRGTQVLDYIIEPKVGHWLDSGFY
FT                   QHYRKSDTYRVHDAILRTAQGTQLPVALSCAALPAEQKAMVLTVLDMSVVRDLYQQLEK
FT                   QAVTDALTGLLNRRGLYQAVESMLLRNERADKYLVVLFMDLDGFKQINDTLGHEAGDQV
FT                   LLWVAEQFKDSMRPYDVLARIGGDEFTVVIDGLDYPEQAAKIAEKLIERVSGRRQVDGV
FT                   EITLGASVGIATFPDCGSNLDGLLRAADIAMYEAKRAGRQQYRFYDQNMNGRARSRLML
FT                   EESVRTAIDGRDFSVVYQPQIHVADGRLRGFEALLRWQHPAVGEVPPALFIPLLEETRL
FT                   INRLGSWIFDQGAEQRQAWSHIFAPDMVLSVCVSPTQFCLPNLASELKRAMDRFELKPG
FT                   QIEVEITETALVNNLTHSHKQLKLLHEVGVRIALDDFGTGECSLSHLRNLQLDTLKLDR
FT                   RFVANIAGSKREAAMASSIIDLSRNLDMLVIAEGVETAEQYQWLADNGCQVMQGFLIAH
FT                   PMLPEDALRFPGHFDVAGFRQTRLL"
FT   gene            566818..567342
FT                   /locus_tag="Psyr_0510"
FT   CDS_pept        566818..567342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35580"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35580.1"
FT                   /translation="MTASSPAPLKYLQAYPQALQDQVQQLIAEDRLADYLEQRYPARHQ
FT                   VQSDKALYAYALALKQDHLRNAPAIKKVLFDNRLDLTHRALGLHTKISRVQGGKLKASN
FT                   EIRVAALFKEAPPEFLKMIVVHELAHFRESDHNKAFYQLCEHMLPGYHQLEFDLRVYLT
FT                   YRDLQAARAPC"
FT   gene            567369..567665
FT                   /locus_tag="Psyr_0511"
FT   CDS_pept        567369..567665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35581"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35581.1"
FT                   /translation="MQVSKTKSSFYRRLYVAYLIDSQIASSVPELIAATGMPRRTAQDT
FT                   ISALADLDIVCDFEQLEGGRNHAGSYRIRDWGAVDKGWIADNLPRIKAVLEYP"
FT   gene            complement(567673..568131)
FT                   /locus_tag="Psyr_0512"
FT   CDS_pept        complement(567673..568131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0512"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35582"
FT                   /db_xref="GOA:Q4ZZ40"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35582.1"
FT                   /translation="MSIKWICKHHTELSIEQLYAVLQLRAEVFVVEQQCVYLDVDGQDL
FT                   MGDTCHLMAWQEDKLVAYLRLLDPIQQGGDVTIGRVVTAPSIRSRGIGHELMEQALENA
FT                   ERKWPDQPIYLSAQAHLQGYYSRYGFNPVGEVYLEDDIPHIGMRRDLD"
FT   gene            568358..569113
FT                   /locus_tag="Psyr_0513"
FT   CDS_pept        568358..569113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0513"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35583"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35583.1"
FT                   /translation="MSQLLRAVGVLVFLLMAHVNAAEKLRLVADPWPPFTDALLLNGGL
FT                   ATDIVNTALRRAGYTTLYEQVPWARAMLGLSQGRHDVLINAWFSDERTKIGQFSAQYLL
FT                   NRIRFIKRKESPIGTLTHEQLHQYVIAVVRGYAYAPAFDSDSQLQKVPVQNFSTAIRML
FT                   AAERVDLTLEDEYVARYNLAMERDEVRDRVEFLPGSLSENSLHILVSLKNPHHDKIVAD
FT                   FDREIAAMKADGTYDELLRLHGLQQPPEL"
FT   sig_peptide     568358..568423
FT                   /locus_tag="Psyr_0513"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            complement(569076..571274)
FT                   /locus_tag="Psyr_0514"
FT   CDS_pept        complement(569076..571274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0514"
FT                   /product="Intergral membrane protein, YccS:Integral
FT                   membrane protein, YccS/YhfK"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35584"
FT                   /db_xref="GOA:Q4ZZ38"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35584.1"
FT                   /translation="MASKSLRHTFRRLWALDKFSYSVRVFIALTGSMALCWYQNEMALL
FT                   IPLFLGIIACALAETDDSWQGRLNALAVTLVCFSIAALAVELLFPYPILFVCSLALASF
FT                   CLTMLGALGERYGAIAYGTLILSVYTMIGVDQRGGEVLDFWHEPMLLVAGAAWYGLLSV
FT                   LWQMLFSNQPVQQALARLFRELGQYLKLKSTLFEPIRTLNVEARRLELAQQNGKVVAAL
FT                   NSTKEIILHRVGSGRPGSKVSRYLKLYFIAQDIHERASSSHYPYNSLADAFFHSDVLFR
FT                   CQRLLRQQGVACQALSESIQLRQPFVYDPSFAEAMEDLHASLEHLRIQSNPAWRGLLRS
FT                   LRALAANLGTLDRLISDASNPDAVADATDSSLLDRSPRNLKDVWTRLRLQMTPTSLLFR
FT                   HALRLPLALTIGYAMVHLIHPSQGYWIILTTVFVCQPSYGATRLKLGQRIIGTAIGLTV
FT                   GWVLFDLVTSPILQSMCAVLAGVVFFVNRTTRYTLSTAAITVMVLFCFNQVGDGYGLFL
FT                   PRLFDTLLGSLIAGLAVFLFLPDWQGRRLNKVLANTLTCNSIYLRQIMQQYAKGKSDDL
FT                   AYRLARRNAHNADAALSTTLANMLMEPGHFRKEADVGFRFLVLSHTLLSYLSGLGAHRD
FT                   TQLPSDVREHLIDNVGATLAASIDEIAAGLAEKKPVAVQSDAEEGLAAQLEQLPEDMDE
FT                   SQRLVQAQLALICRQLAPLRTLAAHLIKAPEVAATHAV"
FT   misc_feature    complement(569658..569714)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(569745..569801)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(569823..569888)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(570021..570086)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(570762..570827)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(570873..570923)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(570939..571004)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(571020..571076)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(571098..571148)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   misc_feature    complement(571161..571211)
FT                   /locus_tag="Psyr_0514"
FT                   /note="1 of 10 probable transmembrane helices predicted by
FT                   TMHMM2.0"
FT   gene            complement(571412..572590)
FT                   /locus_tag="Psyr_0515"
FT   CDS_pept        complement(571412..572590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0515"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35585"
FT                   /db_xref="GOA:Q4ZZ37"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35585.1"
FT                   /translation="MPVTDVVIIGAGAAGLMCAFTAAARGRKVMLIDHANKPGKKILMS
FT                   GGGRCNFTNMYTEPANFLSQNPHFCKSALARYTQWDFIAMVAKHGVPYHEKKLGQLFCD
FT                   NKSSDILEMLLEECRQAGVSLHMDTAVQQIEKTDDGYSLQTTLGTLNCQSLVIATGGLS
FT                   IPTLGATGFGYQVGKQFGHTLLPTRAGLVPFTITDQLKELCTELSGTSVDCLVSCNDTS
FT                   FRENILFTHRGLSGPAILQISSFWQPGDTVEINLLPDHDVPAWLNQQQAERPNSELKTL
FT                   LGEIFTKKMANLIAEHWFVSRPMKQYTHAELAEIAEKLASWQVVPAGTEGYRTAEVTLG
FT                   GIDTREVSSKTMESLKSPGLYFVGEVLDVSGHLGGFNFQWAWASAYAAAHYV"
FT   sig_peptide     complement(572516..572590)
FT                   /locus_tag="Psyr_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.711 at
FT                   residue 25"
FT   misc_feature    complement(572519..572569)
FT                   /locus_tag="Psyr_0515"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            complement(572766..574187)
FT                   /locus_tag="Psyr_0516"
FT   CDS_pept        complement(572766..574187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0516"
FT                   /product="ATP-dependent RNA helicase DbpA"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35586"
FT                   /db_xref="GOA:Q4ZZ36"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35586.1"
FT                   /translation="MIHYATFLFCRSTVVTNTAFNSLPLSAAMLANLESLGYAEMTPIQ
FT                   AQSLPVILKGMDLIAQAKTGSGKTAAFGIGLLNPINPRFFGCQALVMCPTRELADQVAK
FT                   EIRRLARSEDNIKVLTLCGGVSFGPQIGSLEHGAHIIVGTPGRIQQHLRKGSLVLDGLN
FT                   TLILDEADRMLDMGFYDAIADIIEQTPQRRQTLLFSATYPVGIKQLSSKFMRDPQTVKV
FT                   EALHADSQIEQIFYEISPEQRLEAVVKVLGHFRPTSCVAFCFTKQQVQEVVDHLTAKGM
FT                   SAVGLHGDLEQRDRDQVLAMFANRSTSVLVATDVAARGLDIDALDMVINVELARDSEIH
FT                   IHRVGRTGRAGEKGIAVSLVAPSESQRARAIEELQKAPLNWQQYDRLSIKEGGKLLPAM
FT                   TTLCIGSGRKDKLRPGDILGALTGEAGIAGTQVGKIAIFDFQAYVAVERSMAKQALERL
FT                   NNGKIKGKSLRVRIL"
FT   gene            complement(574465..576138)
FT                   /locus_tag="Psyr_0517"
FT   CDS_pept        complement(574465..576138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0517"
FT                   /product="Dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35587"
FT                   /db_xref="GOA:Q4ZZ35"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35587.1"
FT                   /translation="MSELIRVPDIGNGEGEVIELMVKVGDRIEADQSVLTLESDKASME
FT                   IPAPKAGVIKTMKVKLGDRLKEGDELFELEVEGEAAAAAAPAAEPAPAPAPAPAPAAAE
FT                   KPAEAAPAPAAAAEPAPAASASVQDIHVPDIGSSGKAKIIELMVKVGDSIQADQSLITL
FT                   ESDKASMEIPSPAAGVVESIEVKLDQEVGTGDLILKLKVEGAAPAAAPAPAASAPAAAP
FT                   AKAEAAAPAAPAPKAEAAPAPAAPAAPAKDGAKVHAGPAVRQLAREFGVELNAVSATGP
FT                   HGRVLKEDVQAYVKTMMQKAKEAPAGGASGGSGIPPIPEVDFSRFGEIEEVPMTRLMQL
FT                   GASGLHRSWLNIPHVTQFDQADITDLEAFRVAQKGAAEKAGVKLTVLPLLLKSCAHLLK
FT                   ELPDFNASLAPSGKAVIRKKYVHIGFAVDTPDGLLVPVIRDVDQKSLLQLAAEAAALAE
FT                   KARNKKLTANDMQGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKATIQPVWDGKAFQ
FT                   PKLMLPLSLSYDHRVINGAAAARFTKRLSELLADIRTILL"
FT   gene            complement(576281..578926)
FT                   /locus_tag="Psyr_0518"
FT   CDS_pept        complement(576281..578926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0518"
FT                   /product="2-oxo-acid dehydrogenase E1 component homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35588"
FT                   /db_xref="GOA:Q4ZZ34"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35588.1"
FT                   /translation="MQDLDPVETQEWLDALESVLDKEGEDRAHYLMTRLGELATRSGSQ
FT                   LPYAITTPYRNTIPVTHEARMPGDLFMERRIRSLVRWNALAMVVKTNIGDPDLGGHISS
FT                   FASSATLYDIGFNYFFQAPTDEHGGDLIYFQGHASPGVYARAFMEGRITEEQMTNFRQE
FT                   VDGNGLSSYPHPWLMKDFWQFPTVSMGLGPIQAIYQARFMKYLEHRGYIPEGKQKVWCF
FT                   LGDGETDEPESLGAIALAGREKLDNLIFVVNCNLQRLDGPVRGNAKIIQELEGVFRGAQ
FT                   WNVTKVIWGRFWDPLLAKDVDGILQRRMDEVIDGEYQNYKAKDGAFVREHFFNSPELKA
FT                   MVADLSDDEIWKLNRGGHDPYKVYAAYHEAVNHKGQPTVVLAKTIKGYGTGAGEAKNTA
FT                   HNTKKVDVDSLRHFRDRFDIPVKDSELEALPFYKPEEGSAEARYLSERRAALGGFVPQR
FT                   RAQSFSLPTPPLETLKAILDGSGDREISTTMAFVRILTQLVKDKEIGQRIVPIIPDEAR
FT                   TFGMEGMFRQLGIYSSVGQLYEPVDKEQVMFYREDKKGQILEEGINEAGAMSSFIAAGT
FT                   SYSSHNQPMIPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRTTLNGEGLQHED
FT                   GHSHILASTIPNCRTFDPTYGYELAVIIQDGMRRMFEEQQDVFYYLTVMNESYAQPAMP
FT                   AGVEEGIVKGMYLLEEDTKEAAHHVQLLGSGTILREVREAAKILRDEFNIGADVWSVTS
FT                   FNELRRDGLAAERNNRLHPGQKPQLSYVEECLNGRKGPVIASTDYMKLFADQIRQWVPT
FT                   KEYKVLGTDGFGRSDSRKKLRHFFEVDRHFVVLAALEALADRGDIEPKVVAEAIAKFGI
FT                   DPEKRNPLDC"
FT   gene            579311..582268
FT                   /locus_tag="Psyr_0519"
FT   CDS_pept        579311..582268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0519"
FT                   /product="Glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35589"
FT                   /db_xref="GOA:Q4ZZ33"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35589.1"
FT                   /translation="MSLPLLAEFPAILLPSISRARQMFQAALTALSEDALASFQAWPEA
FT                   RQAAFDRVCAASDFVTEQVCRDPQMLLQLADSGELERSFSAGQLRGQLADALSSVASED
FT                   ELGRNLRRQRARQQVRIIWRDLSRQANLIETCRDLSDMADASIDLAYQWLYARHCQQFG
FT                   TPTGRHSGKPQHMVILGMGKLGAVELNLSSDIDLIFGYPEGGETVGTKRALDNQEFFIR
FT                   LGQRLIKALDPVTVDGFVFRVDMRLRPYGSSGALVLSFNALEQYYQDQGRDWERYAMIK
FT                   ARVVGGDQAAGAELLAMLRPFVYRRYLDFSAIEALRTMKQLIQQEVKRKGMAENIKLGA
FT                   GGIREVEFIAQAFQLIHGGRDLSLQQRPLFKVLKTLEGQGYLPSAVTEELREGYEFLRY
FT                   TEHAIQAIADRQTQMLPDNKQDQARVALIMGFADWAAFHERLMYWRGRVAWHFRQVIAD
FT                   PDADPDDEQDEDGEVVVGGEWLPLWEESQDEEAAGRQLLQAGFVDAERALKNLANLRSS
FT                   PNLRSMQRLSRERLDAFIPRLLAQAVEHEKPDLVLERVLPLVEAVARRSAYLVLLTENP
FT                   DALRQLLTLCAASPWIAEQIARFPLLLDELLNEGRLFNPPLAPELAAELRERLIRIPED
FT                   DLEQQMEALRHFKLAHSLRVAASEISGSLPLMKVSDYLTWLAEAILDQVLALAWRYSVA
FT                   RHGTPLRPDGSLCDPGFVIVGYGKVGGIELGHGSDLDLVFIHDGDLEAETDGAKPIDTA
FT                   QFFTRLGQRVIHLLTTQTNSGQLYEVDMRLRPSGASGLLVSSLGAFARYQANEAWTWEH
FT                   QALVRARVMTGSRDVGEQFEKVRADVLGRERDLHKLRAEVSEMRAKMRDNLGTRVTAAG
FT                   RAANAFEAAVPFDLKQDAGGIVDIEFMVQYAALAWSREHPALLQYTDNIRILEGLEEAG
FT                   LLPDTDAGLLREAYKAYRSAAHRQALQKQAGVVSGDQFHAQRREVMRIWTQMGLS"
FT   gene            582398..583432
FT                   /locus_tag="Psyr_0520"
FT   CDS_pept        582398..583432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0520"
FT                   /product="Glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35590"
FT                   /db_xref="GOA:Q4ZZ32"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35590.1"
FT                   /translation="MKILIVGPSWVGDMVMAQTLFQCLKQRHPECEIDVLAPEWSRPIL
FT                   ERMPQVRAALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIPKR
FT                   TGWRGEFRYGLLNDVRILDKQRYPLMIERFMALAFDKGAELPRPYPRPSLRIDSTTRDA
FT                   ALSKFGLTLDRPVLALCPGAEFGESKRWPAEHYAQVADASIREGWQVWLFGSKKDHPVG
FT                   ESIRQELIPGLREESVNLSGETSLAEAIDLLSCADAVVSNDSGLMHVAAALNRPLVAVY
FT                   GSTSPGFTPPLADAVEVVRLGIECSPCFERTCRFGHYNCMRLLEPDAVTQALSRLSSTP
FT                   VEVA"
FT   gene            583435..584499
FT                   /locus_tag="Psyr_0521"
FT   CDS_pept        583435..584499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0521"
FT                   /product="Glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35591"
FT                   /db_xref="GOA:Q4ZZ31"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35591.1"
FT                   /translation="MRVLLIKTSSLGDVIHALPALTDAARALPGIRFDWVVEEGFAEIP
FT                   AWHPAVDRVIPVAIRRWRKHLWQTFRSGEWRRFKQQVREQRYDLVIDAQGLFKSAWLTR
FT                   YVEAPVAGLDRDSAREPVASRFYDRAFPVARGQHAVERLRQLFAQALGYPQPSGMGDYG
FT                   LKPLATLDDSLQAPFVLFLHGTTWDTKHWPELYWRQLAELMAARGLQVQLPWGNPAEKA
FT                   RAERIAEGLSSAHVLPKLNLAGVARVLASAQACVAVDTGIGHLAAALDVPTISLFGPTN
FT                   PGLTGAYGKSQVHLASDYPGCTPCLQKKCTYQPTADDQRRFDLKREWPMCFTRLNPERV
FT                   ASQLGTLLLAKEPG"
FT   gene            584499..585620
FT                   /locus_tag="Psyr_0522"
FT   CDS_pept        584499..585620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0522"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35592"
FT                   /db_xref="GOA:Q4ZZ30"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35592.1"
FT                   /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQQRGHQVRVYTLIWEGDV
FT                   PPGFEVLVAPVKAFFNHRRNEKLSAWMEADLAKRPVDRLIGFNKMPGLDVYYAADGCFE
FT                   DKAQNLRSPLYRKWGRYRHFADYERAVFARDSKTQVLMISEVQQPLFIKHYDTPPSRFH
FT                   LLPPGISQDRRAPPDAPDIRAGFRKEFGLADDDLLLVQIGSGFKTKGVDRSLKALAALP
FT                   AELKKRTRLFVIGQDDPKVFQLQSAALGLGDQVTFMKGRSDIPRFLLGSDLLIHPAYNE
FT                   NTGTVLLEALVAGLPVLVSAVCGYAHYIAEADCGRVLDEPFDQAQLNRYLSEMLLDNAA
FT                   RSAWSRNGLTFADTADLYSMPQHAADVILAEHY"
FT   gene            585620..586426
FT                   /locus_tag="Psyr_0523"
FT   CDS_pept        585620..586426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0523"
FT                   /product="Lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35593"
FT                   /db_xref="GOA:Q4ZZ29"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35593.1"
FT                   /translation="MKLFLAEPFKSLWAERDAFVEVEGLSGEVYRELEGRRTLRTEVDG
FT                   RGYFVKIHRGIGWGEIAKNLATAKLPVLGAGKEWDAIERLHEVGVPTMTAVAYGERGSN
FT                   PAAQHSFIVTEELAPTISLEDISLNWRSEPPEPRLKRAFIAEVARMVGMMHRAGVNHRD
FT                   CYICHFLLHTDKPVTADDFKLSVIDLHRAQTRRAITPRWRNKDLAALYFSALDIGLTRR
FT                   DKLRFLKGYFQKPLREILLKEATLLTWLDKKADKLYQRKVRYGDAL"
FT   gene            586426..587160
FT                   /locus_tag="Psyr_0524"
FT   CDS_pept        586426..587160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0524"
FT                   /product="Lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35594"
FT                   /db_xref="GOA:Q4ZZ28"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35594.1"
FT                   /translation="MAGWKLEPEYAFLEQEFGSLDAVFALQGQQLTRDPLSDVIRVERA
FT                   GVYYYVKRYVGAGKGLRRYMGKPRVKSEWQNLKRFAKWGIPTAEVVAWGLERNGAAYDR
FT                   GALITRGLPNTEDLSALAQRKDPRLADRHWVDAVSRQLAAFTRIMHDNHFTHNDLKWRN
FT                   LLVDNEGKLFFIDCPNGAFWWSFMLRYRITKDLACLDKVAKYHLSATQRLRFYLQYRQR
FT                   TRLNASDKKRIRHIVSFFEGRE"
FT   gene            587157..587936
FT                   /locus_tag="Psyr_0525"
FT   CDS_pept        587157..587936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0525"
FT                   /product="Lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35595"
FT                   /db_xref="GOA:Q4ZZ27"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027023"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35595.1"
FT                   /translation="MSVFIASADQPLLARHNLADFESLWNIRLDAVDEPNTGRGGWSSV
FT                   FRLDLDGQGFYLKRQSNYLTHTLHHPFGEPSFSREFRNISRYRKLGIPALQAVFYGERK
FT                   VDGERRAILMTRALDGWTDLDELLQQWNQMEAPQRQAILHACGQLARTLHRAGQVHGCF
FT                   YPKHIFLQAAGTGYQAQLIDLEKTRPVIFGKRDLARDLEPLLRRAPMWNEADRRELLAA
FT                   YLHATPNSLLVDAWSARLGKRGAHKRDLQHSDDKETR"
FT   gene            587936..589381
FT                   /locus_tag="Psyr_0526"
FT   CDS_pept        587936..589381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35596"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35596.1"
FT                   /translation="MRLSELKTAGRTPELPMSLTLADAAGSAELQLLTLLRVLPGQRYV
FT                   GAGVWRGRTVLAKLLVGDKAARHFQRELVGVRLLAEQGLTTPLLLADGLQDGEGGWLLF
FT                   EFLEQAPSLGDAWNAVQHLPPLADEQQAVLGEALSAIARQHAKGLWQEDLHLDNLLRHN
FT                   GQLYLIDGAGIRAEQAGTPLSRQKVLENLGVFFAQLPRSFEPFTEELLVHYLLSNAEHG
FT                   LPMEALQKQIDKVRSWRLKDFMSKTVRDCSLFSVEDSASVFRAIRREEESAMLPVLSQA
FT                   DALLDQGHLYKTGGAASVGRVEVSGRPLVIKRYNIKNFSHWLKRFWRPSRAWHSWREGN
FT                   RLKFLGIATPKPLAVQEKRFLGLRSKAWLVTEFIDGPDIIERFAPYVESGDAPEVELQA
FT                   LDRLFVQLIQARISHGDFKGHNLFWHVDRWAMIDLDAMQQHSSQSSFAAAYARDRARFM
FT                   RNWPAHSALHQLLEQRLPKLASD"
FT   gene            complement(589549..595677)
FT                   /locus_tag="Psyr_0527"
FT   CDS_pept        complement(589549..595677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0527"
FT                   /product="type III effector HopAC1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35597"
FT                   /db_xref="InterPro:IPR020972"
FT                   /db_xref="UniProtKB/TrEMBL:Q7PC42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35597.1"
FT                   /translation="MTQTPPSLDFNLSTPSPVPMTPSDTWAGASAALKRLDELRTLLAR
FT                   ELDALPQAGEALLSALDGADVSERELQIFGLLQQIDDYWTDPGETGESRRDRLLPALQR
FT                   SLHDEARVRIHERDFDSGYLACLPDSPDQEGPALAYSTVRVQLHDDEQIEMAGVLVISQ
FT                   DQGRTLLMLPGLGISGFATQAMLVATLVQWLNTPTLRDALLSNAQRQHQERLTEILQDA
FT                   DLYLEPFTAADVQLQPVVTTAPFIHAFDRLLNKQRNDIRYACEQPGTADRLKRQSLIQQ
FT                   AIDMPGLFGPAAMLELRELTNRRRQYQRNLPEWMKIASAADLQTYALHLQRYDAAHTAM
FT                   LSVLGSAASPERFAEMQLRTRLANDLGHDLDPRDLTIDTRRTLPATSETYRVKLPLTEL
FT                   ALYGLHPDDETAGSDFLDQTLITLDGQPLDAAYSDLNPAYLARVIDELDLRAVFGDFQR
FT                   QAYQQEHNQQMLRALARVRLTTLGWAAKMQGHIRPDDFAIVAALTSAATGTHDPALRVQ
FT                   QIRLNDRNVMARLLVCRKQDAQGRTQRLIMFASEAPGQQYFKAFDTDTQLLHEMVGWTA
FT                   SPAMTAWLLDQVEVAARPELAAQLTALREKPQPAKDFLQFIDHPDCETALRRFTDEQTR
FT                   VLLSEQARHTPDWYLRASRAQRRELLALERAINGALDNYQAQAHTGVQSFKDYVHQRAS
FT                   QQLGKLLGVPAGTVDPDQIVITSERETQTYTDMLLKGYNDSIDPLSTSAATDATFSGPP
FT                   GIDLSALSPAAVAGSVRGQWLADEYIALIRNTLLNSENDGYAYRRQYSVMITQLQMKAA
FT                   ALRSLLKGHVEAAQYAWLTQSLDNAHLSDPASRERYPLYPLQIHVDKPLIASGLTDVDQ
FT                   LVIPSPLLTHIETVQGCLVILPTQIRHAALLYTPQAPDGIEFRLFSDFVSSLNSEGMID
FT                   YYKDRCRIKARRTLSFFLRDMQKGNANKPPVIPRAFIADVADTCFNRPLERRLRDVEET
FT                   TTGRNDMLTKLIRVSVEIVATALTLPFPPASFAVGSLISLHDSGQALAALSAGDRERAT
FT                   NYMLSALLNGLGAGSDLLVGLKGLGGALHQLENSQHSTPVLRSFQRQPSLPRYEDLYPV
FT                   ELQEQVFLLGKPNVHGHAAIFQASHVASAPPLATGQFAAREIGGAWQPLLPLPPTAQRA
FT                   PSGLRIDLAVDISLENVPRIAEGHAKGVHAINGKYYIQLSDQAFEVQYDAYWQYWQIID
FT                   PANPFAFFGKQPVRLNDQGQWLLVERQRLRGGGLDTPGTYRPLPEQASASSSSLNTLSD
FT                   YEMPSGMRAHLDIVINKEVFDPTGAGLDVYFETYFTEVRQTFTARREQLYQDAQAFFAR
FT                   FTPPPRPTLPAYGLPGSVDTLIKHIFSHSNGLVFSEAPKSVASKRLLLLNMPLLAEQRV
FT                   EVLYIEHLLTDKHLRKLARYRQLGKKSRSGSHELKYYLQETNRGALNNASSEFDYYHLI
FT                   KAAHRYGIEVRPLSSSISYPFLGHTVLSAADDPAAAMKMSNFFGHRLINHDIEPASARR
FT                   WVALLDQKLATTHDQVPGIAEMQGAVSVQVQDIPAGRPTRIRQGAGEAHENTPSHCDFS
FT                   IAFADPTLPARPLPPATALDNTLIRELGDPTAIAEGERWAGEYGFVLDENHTWLRVEAD
FT                   DWSVDRSMTAIQQSLTDATYEMPPDTRTTLHRLANFEKKGLDMEYFFEDIELDTVRNTF
FT                   DLRRKNLQKDAASISAAQLPPRPTLPAIEPQTSTAGLLETLYRHTEGLVIGESHSSVAS
FT                   KKLIIDNLPLLSQQNVKTLYMEHLLSDLHQADLDRFLETGQMSKTLLHDLKTLDRGHHT
FT                   DPNGVYTFEQLVIRARQQGLEIRAIDCASSYHLKGIAEDEPLIRQQMMNYFASRTIRRH
FT                   QDVMGSHKWIALVGNSHSNTYQGVVPGIAELEGGIGLRVVDVAPGHSRGITLDQGELVS
FT                   GGIADDKVYIKADYRVEMEVPRPQPARLPSIEKRLSRPGMFLVQEGEGNLQTIVHRARD
FT                   TWIHRTPVLRNAEGKLYIERLRWPRIHLKPFDDIDALVAALEAMNLTRAT"
FT   gene            595978..597735
FT                   /locus_tag="Psyr_0528"
FT   CDS_pept        595978..597735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0528"
FT                   /product="Carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35598"
FT                   /db_xref="GOA:Q4ZZ24"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35598.1"
FT                   /translation="MALTILGLSGALSHDPSAALYIDGKLIAAAEEERFVRDKHAKNRM
FT                   PYESAKFCLEQAGIKPSDVDVVAIPFAPISLFGKARWHYAKRYWYAPDRALDALLMGNR
FT                   RYKRYRNKIVWCLEQLGFDPKKIKIEPVEHHLAHASSAYHCSGFTEKTAIMGIDGKGEY
FT                   ATTFFGYGENGKIHKIKEFFDPDSLGGLYGAITEFLGFEMLDGEFKVMGMAPYGDASKY
FT                   DFSRLATFENGELVINTELANVIGLRRYKENGKGFYFSPKLIEWLGPKRVGDVADEPYI
FT                   HYAASMQALFEKLALQMMDHYLGDILKETGKIAFAGGCALNVKLNQRIIARPEVKELFV
FT                   QPASGDAGTAVGAAAYVSHARGVPVEKMEHVYLGPAYSNEDVIAACARHPSKPVWRQID
FT                   NTPERIAEIMVKGNPVAWFQGRMEFGPRALGGRSIIGCPSVTGVADRINHQIKFRERWR
FT                   PFCPSMLDTVAPQMIKIDHPAPFMTFTFEVAEEWKTRVPEVVHEDGTSRAQVLKREYNP
FT                   RYYDMMKALENLTGNGVSLNTSLNRRGEPMICSPTDALNMFFGSDLEYLIMEDILVVKE
FT                   GVEAYDTLG"
FT   gene            597719..598849
FT                   /locus_tag="Psyr_0529"
FT   CDS_pept        597719..598849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0529"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35599"
FT                   /db_xref="GOA:Q4ZZ23"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35599.1"
FT                   /translation="MTRSVERHVLQFCHGYDGPFLDCARQYASLFAGKGYRVTTVFLTG
FT                   AADPDVVADCGSDEVLFMEYSSSAIRGLKLGAIRDLRKIAATRSFSFCIAHRFKPVYIA
FT                   LLATKLPVIGVHHAFGDYHRRSRKLFANLFRKRLSLLGVSDAVRDDMRSSLPKWSAERI
FT                   QTLYNRIDVEQLQGSQFSAEDARAELGLSASAWIVANVGRLHPDKDQATLLRGFAEALP
FT                   DLPENSQLVILGKGRLEEDLKALALELGIGPQVLFLGQVPDARRYFKAFDVFALSSDHE
FT                   PFGMVLLEAMVAGVPLVATSCGGAKEVVEDVGLLFPLGDVHSLAHGLVHMAGLDAEQRQ
FT                   DCAKRMLLRLRERFSDHAVRNVFWRLPQVSSLTAGA"
FT   gene            598849..599745
FT                   /locus_tag="Psyr_0530"
FT   CDS_pept        598849..599745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0530"
FT                   /product="Mig-14"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35600"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35600.1"
FT                   /translation="MLNRFKGWRERGWVQIDAAAYEQAWQRFGGSVATHPLVVARLSAF
FT                   SGIAVRYLAWEQGGEVKAAIATWGRSLALSKDELKRHGKKGLFDLGNAELILPVADDTQ
FT                   VPVRHRARYVSALNEGRISTFKPQTESLAMARTPEELSKKFRYNQRRELRLLEEAGGTV
FT                   RPVSEFSSAELASMYCDLFQRRWGFEATGARHKAEVIELLRELLIGSVVFLNDAPIAIQ
FT                   LVYRVEAPQWVSIEYVNGGVDPQTRDFSPGSVLSFVNTQSAWENARALGKSLRFSFGRA
FT                   DREYKDRWCNPVPVFQI"
FT   gene            599742..601151
FT                   /locus_tag="Psyr_0531"
FT   CDS_pept        599742..601151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0531"
FT                   /product="LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35601"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35601.1"
FT                   /translation="MSRKQQLLKRHRRNKRLALLGGLLLLIAVGVLVAWWLAPVLAVCA
FT                   WVAHEAWFADHLFYSPSDDYQYTFAADSEVPGVRLDGGTLLIDPAVQLNGDETLILALT
FT                   VKSTWLGRFLDPVVELQGQGLNDQQAFERGVCGVRYLNLTGLGEPLAAGVLKLRGRCCR
FT                   LAGTPRLWLFRQPDARKQRVMVIAPHADDAELAAFGLYSQAEEAWIITLTAGEIEAEHY
FT                   RQMGMERAEAARMKGRLRAWDSIAVARWGGVPESQCVQLGYFCLQLPAMQAAPDTPVGS
FT                   READLTDTRLFRQFNTLPLPGDNGQPTWNNLLADLRALILKARPQVVVMPHPAIDPHPD
FT                   HICAQAAVREALLGLEWQPDVVLGYANHLHDNDRWPMGDAYSGISLPPVFDATLPLVPY
FT                   SLQLSVAAQRDKAMALGMMHDLLPRMPFKRRVRRALQRVLAGRHWPAEGENEFFRKAVR
FT                   RHELFWCSRDL"
FT   misc_feature    599790..599858
FT                   /locus_tag="Psyr_0531"
FT                   /note="1 probable transmembrane helix predicted by
FT                   TMHMM2.0"
FT   gene            601182..602138
FT                   /locus_tag="Psyr_0532"
FT   CDS_pept        601182..602138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35602"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35602.1"
FT                   /translation="MKVLLLVQKEQRAILDRLYDGIAAHCECEVRWLSSAEQRNLRGYF
FT                   RREVDVSRYDRIVFFLRFKQEVRQVGFIRTIPNLVILEHDAYQNYIPCKYTGKFSAHYR
FT                   KLPWARVICSGFMVSERLRQEGFDAVFVPKGYDQSLLQLQARERDIELAFVGSTNSVAY
FT                   SGRKALLDELGQVENLLVTRTKSGEEYCDTLNRIRFFVSADVGMGEYMIKNFEAMACGC
FT                   VLLAFDQGAEENRALGFVDMHNIVLYRDIPELREKLAKLRDNVTLASEISCNGQTLVEE
FT                   RFTFHALGKAIVDAMHAPLRSMPAASWIDRLRSQLGW"
FT   gene            602170..602943
FT                   /locus_tag="Psyr_0533"
FT   CDS_pept        602170..602943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0533"
FT                   /produ