(data stored in ACNUC1104 zone)

EMBL: CP000076

ID   CP000076; SV 1; circular; genomic DNA; STD; PRO; 7074893 BP.
XX
AC   CP000076;
XX
PR   Project:PRJNA327;
XX
DT   04-JUL-2005 (Rel. 84, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 14)
XX
DE   Pseudomonas protegens Pf-5, complete genome.
XX
KW   .
XX
OS   Pseudomonas protegens Pf-5
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RC   Erratum:[Nat Biotechnol. 2006 Apr;24(4):466]
RP   1-7074893
RX   DOI; 10.1038/nbt1110.
RX   PUBMED; 15980861.
RA   Paulsen I.T., Press C.M., Ravel J., Kobayashi D.Y., Myers G.S.,
RA   Mavrodi D.V., DeBoy R.T., Seshadri R., Ren Q., Madupu R., Dodson R.J.,
RA   Durkin A.S., Brinkac L.M., Daugherty S.C., Sullivan S.A., Rosovitz M.J.,
RA   Gwinn M.L., Zhou L., Schneider D.J., Cartinhour S.W., Nelson W.C.,
RA   Weidman J., Watkins K., Tran K., Khouri H., Pierson E.A., Pierson L.S.III.,
RA   Thomashow L.S., Loper J.E.;
RT   "Complete genome sequence of the plant commensal Pseudomonas fluorescens
RT   Pf-5";
RL   Nat. Biotechnol. 23(7):873-878(2005).
XX
RN   [2]
RP   1-7074893
RA   Paulsen I.T., Press C., Ravel J., Kobayashi D., Myers G.S., Mavrodi D.,
RA   DeBoy R.T., Seshadri R., Ren Q., Madupu R., Dodson R.J., Durkin S.,
RA   Brinkac L.M., Daugherty S.C., Sullivan S.A., Rosovitz M., Gwinn M.L.,
RA   Zhou L., Nelson W.C., Weidman J., Watkins K., Tran K., Khouri H.M.,
RA   Pierson E., Pierson L.III., Thomashow L., Loper J.;
RT   ;
RL   Submitted (13-MAY-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-7074893
RA   Paulsen I.T., Press C., Ravel J., Kobayashi D., Myers G.S., Mavrodi D.,
RA   DeBoy R.T., Seshadri R., Ren Q., Madupu R., Dodson R.J., Durkin S.,
RA   Brinkac L.M., Daugherty S.C., Sullivan S.A., Rosovitz M., Gwinn M.L.,
RA   Zhou L., Nelson W.C., Weidman J., Watkins K., Tran K., Khouri H.M.,
RA   Pierson E., Pierson L.III., Thomashow L., Loper J.;
RT   ;
RL   Submitted (16-FEB-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-7074893
RA   Paulsen I.T., Press C., Ravel J., Kobayashi D., Myers G.S., Mavrodi D.,
RA   DeBoy R.T., Seshadri R., Ren Q., Madupu R., Dodson R.J., Durkin S.,
RA   Brinkac L.M., Daugherty S.C., Sullivan S.A., Rosovitz M., Gwinn M.L.,
RA   Zhou L., Nelson W.C., Weidman J., Watkins K., Tran K., Khouri H.M.,
RA   Pierson E., Pierson L.III., Thomashow L., Loper J.;
RT   ;
RL   Submitted (29-JUN-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [5]
RC   Protein update by submitter
RP   1-7074893
RA   Paulsen I.T., Press C., Ravel J., Kobayashi D., Myers G.S., Mavrodi D.,
RA   DeBoy R.T., Seshadri R., Ren Q., Madupu R., Dodson R.J., Durkin S.,
RA   Brinkac L.M., Daugherty S.C., Sullivan S.A., Rosovitz M., Gwinn M.L.,
RA   Zhou L., Nelson W.C., Weidman J., Watkins K., Tran K., Khouri H.M.,
RA   Pierson E., Pierson L.III., Thomashow L., Loper J.;
RT   ;
RL   Submitted (10-SEP-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [6]
RC   Protein update by submitter.  Full manual curation provided with this
RC   update.
RP   1-7074893
RA   Loper J.E., Davis E.W., Hartney S.L., Shaffer B.T., Hassan K.A.,
RA   Brinkac L.M., Durkin A., Paulsen I.T.;
RT   ;
RL   Submitted (21-JUL-2011) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 89ebaac337eaeb5868549dfc68ed1fe9.
DR   BioSample; SAMN02604012.
DR   EnsemblGenomes-Gn; EBG00001037552.
DR   EnsemblGenomes-Gn; EBG00001037553.
DR   EnsemblGenomes-Gn; EBG00001037554.
DR   EnsemblGenomes-Gn; EBG00001037555.
DR   EnsemblGenomes-Gn; EBG00001037556.
DR   EnsemblGenomes-Gn; EBG00001037557.
DR   EnsemblGenomes-Gn; EBG00001037558.
DR   EnsemblGenomes-Gn; EBG00001037559.
DR   EnsemblGenomes-Gn; EBG00001037560.
DR   EnsemblGenomes-Gn; EBG00001037561.
DR   EnsemblGenomes-Gn; EBG00001037562.
DR   EnsemblGenomes-Gn; EBG00001037563.
DR   EnsemblGenomes-Gn; EBG00001037564.
DR   EnsemblGenomes-Gn; EBG00001037565.
DR   EnsemblGenomes-Gn; EBG00001037566.
DR   EnsemblGenomes-Gn; EBG00001037567.
DR   EnsemblGenomes-Gn; EBG00001037568.
DR   EnsemblGenomes-Gn; EBG00001037569.
DR   EnsemblGenomes-Gn; EBG00001037570.
DR   EnsemblGenomes-Gn; EBG00001037571.
DR   EnsemblGenomes-Gn; EBG00001037572.
DR   EnsemblGenomes-Gn; EBG00001037573.
DR   EnsemblGenomes-Gn; EBG00001037574.
DR   EnsemblGenomes-Gn; EBG00001037575.
DR   EnsemblGenomes-Gn; EBG00001037576.
DR   EnsemblGenomes-Gn; EBG00001037577.
DR   EnsemblGenomes-Gn; EBG00001037578.
DR   EnsemblGenomes-Gn; EBG00001037579.
DR   EnsemblGenomes-Gn; EBG00001037580.
DR   EnsemblGenomes-Gn; EBG00001037581.
DR   EnsemblGenomes-Gn; EBG00001037582.
DR   EnsemblGenomes-Gn; EBG00001037583.
DR   EnsemblGenomes-Gn; EBG00001037584.
DR   EnsemblGenomes-Gn; EBG00001037585.
DR   EnsemblGenomes-Gn; EBG00001037586.
DR   EnsemblGenomes-Gn; EBG00001037587.
DR   EnsemblGenomes-Gn; EBG00001037588.
DR   EnsemblGenomes-Gn; EBG00001037589.
DR   EnsemblGenomes-Gn; EBG00001037590.
DR   EnsemblGenomes-Gn; EBG00001037591.
DR   EnsemblGenomes-Gn; EBG00001037592.
DR   EnsemblGenomes-Gn; EBG00001037593.
DR   EnsemblGenomes-Gn; EBG00001037594.
DR   EnsemblGenomes-Gn; EBG00001037595.
DR   EnsemblGenomes-Gn; EBG00001037596.
DR   EnsemblGenomes-Gn; EBG00001037597.
DR   EnsemblGenomes-Gn; EBG00001037598.
DR   EnsemblGenomes-Gn; EBG00001037599.
DR   EnsemblGenomes-Gn; EBG00001037600.
DR   EnsemblGenomes-Gn; EBG00001037601.
DR   EnsemblGenomes-Gn; EBG00001037602.
DR   EnsemblGenomes-Gn; EBG00001037603.
DR   EnsemblGenomes-Gn; EBG00001037604.
DR   EnsemblGenomes-Gn; EBG00001037605.
DR   EnsemblGenomes-Gn; EBG00001037606.
DR   EnsemblGenomes-Gn; EBG00001037607.
DR   EnsemblGenomes-Gn; EBG00001037608.
DR   EnsemblGenomes-Gn; EBG00001037609.
DR   EnsemblGenomes-Gn; EBG00001037610.
DR   EnsemblGenomes-Gn; EBG00001037611.
DR   EnsemblGenomes-Gn; EBG00001037612.
DR   EnsemblGenomes-Gn; EBG00001037613.
DR   EnsemblGenomes-Gn; EBG00001037614.
DR   EnsemblGenomes-Gn; EBG00001037615.
DR   EnsemblGenomes-Gn; EBG00001037616.
DR   EnsemblGenomes-Gn; EBG00001037617.
DR   EnsemblGenomes-Gn; EBG00001037618.
DR   EnsemblGenomes-Gn; EBG00001037619.
DR   EnsemblGenomes-Gn; EBG00001037620.
DR   EnsemblGenomes-Gn; EBG00001037621.
DR   EnsemblGenomes-Gn; EBG00001037622.
DR   EnsemblGenomes-Gn; EBG00001037623.
DR   EnsemblGenomes-Gn; EBG00001037624.
DR   EnsemblGenomes-Gn; EBG00001037625.
DR   EnsemblGenomes-Gn; EBG00001037626.
DR   EnsemblGenomes-Gn; EBG00001037627.
DR   EnsemblGenomes-Gn; EBG00001037628.
DR   EnsemblGenomes-Gn; EBG00001037629.
DR   EnsemblGenomes-Gn; EBG00001037630.
DR   EnsemblGenomes-Gn; EBG00001037631.
DR   EnsemblGenomes-Gn; EBG00001037632.
DR   EnsemblGenomes-Gn; EBG00001037633.
DR   EnsemblGenomes-Gn; EBG00001037634.
DR   EnsemblGenomes-Gn; EBG00001037635.
DR   EnsemblGenomes-Gn; EBG00001037636.
DR   EnsemblGenomes-Gn; EBG00001037637.
DR   EnsemblGenomes-Gn; EBG00001037638.
DR   EnsemblGenomes-Gn; EBG00001037639.
DR   EnsemblGenomes-Gn; EBG00001037640.
DR   EnsemblGenomes-Gn; EBG00001037641.
DR   EnsemblGenomes-Gn; EBG00001037642.
DR   EnsemblGenomes-Gn; EBG00001037643.
DR   EnsemblGenomes-Gn; EBG00001037644.
DR   EnsemblGenomes-Gn; EBG00001037645.
DR   EnsemblGenomes-Gn; EBG00001037646.
DR   EnsemblGenomes-Gn; EBG00001037647.
DR   EnsemblGenomes-Gn; EBG00001037648.
DR   EnsemblGenomes-Gn; EBG00001037649.
DR   EnsemblGenomes-Gn; EBG00001037650.
DR   EnsemblGenomes-Gn; EBG00001037651.
DR   EnsemblGenomes-Gn; EBG00001037652.
DR   EnsemblGenomes-Gn; EBG00001037653.
DR   EnsemblGenomes-Gn; EBG00001037654.
DR   EnsemblGenomes-Gn; EBG00001037655.
DR   EnsemblGenomes-Gn; EBG00001037656.
DR   EnsemblGenomes-Gn; EBG00001037657.
DR   EnsemblGenomes-Gn; EBG00001037658.
DR   EnsemblGenomes-Gn; EBG00001037659.
DR   EnsemblGenomes-Gn; EBG00001037660.
DR   EnsemblGenomes-Gn; EBG00001037661.
DR   EnsemblGenomes-Gn; EBG00001037662.
DR   EnsemblGenomes-Gn; EBG00001037663.
DR   EnsemblGenomes-Gn; EBG00001037664.
DR   EnsemblGenomes-Gn; EBG00001037665.
DR   EnsemblGenomes-Gn; EBG00001037666.
DR   EnsemblGenomes-Gn; EBG00001037667.
DR   EnsemblGenomes-Gn; EBG00001037668.
DR   EnsemblGenomes-Gn; EBG00001037669.
DR   EnsemblGenomes-Gn; EBG00001037670.
DR   EnsemblGenomes-Gn; EBG00001037671.
DR   EnsemblGenomes-Gn; EBG00001037672.
DR   EnsemblGenomes-Gn; EBG00001037673.
DR   EnsemblGenomes-Gn; EBG00001037674.
DR   EnsemblGenomes-Gn; EBG00001037675.
DR   EnsemblGenomes-Gn; EBG00001037676.
DR   EnsemblGenomes-Gn; EBG00001037677.
DR   EnsemblGenomes-Gn; EBG00001037678.
DR   EnsemblGenomes-Gn; EBG00001037679.
DR   EnsemblGenomes-Gn; EBG00001037680.
DR   EnsemblGenomes-Gn; EBG00001037681.
DR   EnsemblGenomes-Gn; EBG00001037682.
DR   EnsemblGenomes-Gn; EBG00001037683.
DR   EnsemblGenomes-Gn; PFL_0119.
DR   EnsemblGenomes-Gn; PFL_0120.
DR   EnsemblGenomes-Gn; PFL_0121.
DR   EnsemblGenomes-Gn; PFL_0122.
DR   EnsemblGenomes-Gn; PFL_0123.
DR   EnsemblGenomes-Gn; PFL_0178.
DR   EnsemblGenomes-Gn; PFL_0324.
DR   EnsemblGenomes-Gn; PFL_0356.
DR   EnsemblGenomes-Gn; PFL_0575.
DR   EnsemblGenomes-Gn; PFL_0576.
DR   EnsemblGenomes-Gn; PFL_0735.
DR   EnsemblGenomes-Gn; PFL_0736.
DR   EnsemblGenomes-Gn; PFL_0737.
DR   EnsemblGenomes-Gn; PFL_0738.
DR   EnsemblGenomes-Gn; PFL_0739.
DR   EnsemblGenomes-Gn; PFL_0840.
DR   EnsemblGenomes-Gn; PFL_0841.
DR   EnsemblGenomes-Gn; PFL_0849.
DR   EnsemblGenomes-Gn; PFL_1252.
DR   EnsemblGenomes-Gn; PFL_1253.
DR   EnsemblGenomes-Gn; PFL_1428.
DR   EnsemblGenomes-Gn; PFL_1461.
DR   EnsemblGenomes-Gn; PFL_1759.
DR   EnsemblGenomes-Gn; PFL_1760.
DR   EnsemblGenomes-Gn; PFL_1761.
DR   EnsemblGenomes-Gn; PFL_1762.
DR   EnsemblGenomes-Gn; PFL_1763.
DR   EnsemblGenomes-Gn; PFL_1764.
DR   EnsemblGenomes-Gn; PFL_1841.
DR   EnsemblGenomes-Gn; PFL_2042.
DR   EnsemblGenomes-Gn; PFL_2050.
DR   EnsemblGenomes-Gn; PFL_2051.
DR   EnsemblGenomes-Gn; PFL_2052.
DR   EnsemblGenomes-Gn; PFL_2053.
DR   EnsemblGenomes-Gn; PFL_2054.
DR   EnsemblGenomes-Gn; PFL_2055.
DR   EnsemblGenomes-Gn; PFL_2080.
DR   EnsemblGenomes-Gn; PFL_2081.
DR   EnsemblGenomes-Gn; PFL_2082.
DR   EnsemblGenomes-Gn; PFL_2084.
DR   EnsemblGenomes-Gn; PFL_2119.
DR   EnsemblGenomes-Gn; PFL_2765.
DR   EnsemblGenomes-Gn; PFL_3425.
DR   EnsemblGenomes-Gn; PFL_3465.
DR   EnsemblGenomes-Gn; PFL_3560.
DR   EnsemblGenomes-Gn; PFL_3739.
DR   EnsemblGenomes-Gn; PFL_3989.
DR   EnsemblGenomes-Gn; PFL_3990.
DR   EnsemblGenomes-Gn; PFL_3991.
DR   EnsemblGenomes-Gn; PFL_4141.
DR   EnsemblGenomes-Gn; PFL_4142.
DR   EnsemblGenomes-Gn; PFL_4143.
DR   EnsemblGenomes-Gn; PFL_4144.
DR   EnsemblGenomes-Gn; PFL_4145.
DR   EnsemblGenomes-Gn; PFL_4402.
DR   EnsemblGenomes-Gn; PFL_4403.
DR   EnsemblGenomes-Gn; PFL_4404.
DR   EnsemblGenomes-Gn; PFL_4405.
DR   EnsemblGenomes-Gn; PFL_4495.
DR   EnsemblGenomes-Gn; PFL_4501.
DR   EnsemblGenomes-Gn; PFL_4502.
DR   EnsemblGenomes-Gn; PFL_4503.
DR   EnsemblGenomes-Gn; PFL_4658.
DR   EnsemblGenomes-Gn; PFL_4753.
DR   EnsemblGenomes-Gn; PFL_4976.
DR   EnsemblGenomes-Gn; PFL_5164.
DR   EnsemblGenomes-Gn; PFL_5179.
DR   EnsemblGenomes-Gn; PFL_5245.
DR   EnsemblGenomes-Gn; PFL_5246.
DR   EnsemblGenomes-Gn; PFL_5247.
DR   EnsemblGenomes-Gn; PFL_5248.
DR   EnsemblGenomes-Gn; PFL_5249.
DR   EnsemblGenomes-Gn; PFL_5300.
DR   EnsemblGenomes-Gn; PFL_5301.
DR   EnsemblGenomes-Gn; PFL_5302.
DR   EnsemblGenomes-Gn; PFL_5303.
DR   EnsemblGenomes-Gn; PFL_5596.
DR   EnsemblGenomes-Gn; PFL_5598.
DR   EnsemblGenomes-Gn; PFL_5599.
DR   EnsemblGenomes-Gn; PFL_5600.
DR   EnsemblGenomes-Gn; PFL_5602.
DR   EnsemblGenomes-Gn; PFL_5603.
DR   EnsemblGenomes-Gn; PFL_5604.
DR   EnsemblGenomes-Gn; PFL_5605.
DR   EnsemblGenomes-Gn; PFL_5606.
DR   EnsemblGenomes-Gn; PFL_5665.
DR   EnsemblGenomes-Gn; PFL_6234.
DR   EnsemblGenomes-Gn; PFL_6285.
DR   EnsemblGenomes-Gn; PFL_6286.
DR   EnsemblGenomes-Gn; PFL_6287.
DR   EnsemblGenomes-Gn; PFL_6288.
DR   EnsemblGenomes-Gn; PFL_6289.
DR   EnsemblGenomes-Gn; PFL_6290.
DR   EnsemblGenomes-Gn; PFL_6291.
DR   EnsemblGenomes-Gn; PFL_6292.
DR   EnsemblGenomes-Gn; PFL_6294.
DR   EnsemblGenomes-Gn; PFL_6296.
DR   EnsemblGenomes-Gn; PFL_6297.
DR   EnsemblGenomes-Gn; PFL_6301.
DR   EnsemblGenomes-Gn; PFL_6302.
DR   EnsemblGenomes-Gn; PFL_6307.
DR   EnsemblGenomes-Gn; PFL_6309.
DR   EnsemblGenomes-Gn; PFL_6310.
DR   EnsemblGenomes-Gn; PFL_6311.
DR   EnsemblGenomes-Tr; EBT00001638934.
DR   EnsemblGenomes-Tr; EBT00001638935.
DR   EnsemblGenomes-Tr; EBT00001638936.
DR   EnsemblGenomes-Tr; EBT00001638937.
DR   EnsemblGenomes-Tr; EBT00001638938.
DR   EnsemblGenomes-Tr; EBT00001638939.
DR   EnsemblGenomes-Tr; EBT00001638940.
DR   EnsemblGenomes-Tr; EBT00001638941.
DR   EnsemblGenomes-Tr; EBT00001638942.
DR   EnsemblGenomes-Tr; EBT00001638943.
DR   EnsemblGenomes-Tr; EBT00001638944.
DR   EnsemblGenomes-Tr; EBT00001638945.
DR   EnsemblGenomes-Tr; EBT00001638946.
DR   EnsemblGenomes-Tr; EBT00001638947.
DR   EnsemblGenomes-Tr; EBT00001638948.
DR   EnsemblGenomes-Tr; EBT00001638949.
DR   EnsemblGenomes-Tr; EBT00001638950.
DR   EnsemblGenomes-Tr; EBT00001638951.
DR   EnsemblGenomes-Tr; EBT00001638952.
DR   EnsemblGenomes-Tr; EBT00001638953.
DR   EnsemblGenomes-Tr; EBT00001638954.
DR   EnsemblGenomes-Tr; EBT00001638955.
DR   EnsemblGenomes-Tr; EBT00001638956.
DR   EnsemblGenomes-Tr; EBT00001638957.
DR   EnsemblGenomes-Tr; EBT00001638958.
DR   EnsemblGenomes-Tr; EBT00001638959.
DR   EnsemblGenomes-Tr; EBT00001638960.
DR   EnsemblGenomes-Tr; EBT00001638961.
DR   EnsemblGenomes-Tr; EBT00001638962.
DR   EnsemblGenomes-Tr; EBT00001638963.
DR   EnsemblGenomes-Tr; EBT00001638964.
DR   EnsemblGenomes-Tr; EBT00001638965.
DR   EnsemblGenomes-Tr; EBT00001638966.
DR   EnsemblGenomes-Tr; EBT00001638967.
DR   EnsemblGenomes-Tr; EBT00001638968.
DR   EnsemblGenomes-Tr; EBT00001638969.
DR   EnsemblGenomes-Tr; EBT00001638970.
DR   EnsemblGenomes-Tr; EBT00001638971.
DR   EnsemblGenomes-Tr; EBT00001638972.
DR   EnsemblGenomes-Tr; EBT00001638973.
DR   EnsemblGenomes-Tr; EBT00001638974.
DR   EnsemblGenomes-Tr; EBT00001638975.
DR   EnsemblGenomes-Tr; EBT00001638976.
DR   EnsemblGenomes-Tr; EBT00001638977.
DR   EnsemblGenomes-Tr; EBT00001638978.
DR   EnsemblGenomes-Tr; EBT00001638979.
DR   EnsemblGenomes-Tr; EBT00001638980.
DR   EnsemblGenomes-Tr; EBT00001638981.
DR   EnsemblGenomes-Tr; EBT00001638982.
DR   EnsemblGenomes-Tr; EBT00001638983.
DR   EnsemblGenomes-Tr; EBT00001638984.
DR   EnsemblGenomes-Tr; EBT00001638985.
DR   EnsemblGenomes-Tr; EBT00001638986.
DR   EnsemblGenomes-Tr; EBT00001638987.
DR   EnsemblGenomes-Tr; EBT00001638988.
DR   EnsemblGenomes-Tr; EBT00001638989.
DR   EnsemblGenomes-Tr; EBT00001638990.
DR   EnsemblGenomes-Tr; EBT00001638991.
DR   EnsemblGenomes-Tr; EBT00001638992.
DR   EnsemblGenomes-Tr; EBT00001638993.
DR   EnsemblGenomes-Tr; EBT00001638994.
DR   EnsemblGenomes-Tr; EBT00001638995.
DR   EnsemblGenomes-Tr; EBT00001638996.
DR   EnsemblGenomes-Tr; EBT00001638997.
DR   EnsemblGenomes-Tr; EBT00001638998.
DR   EnsemblGenomes-Tr; EBT00001638999.
DR   EnsemblGenomes-Tr; EBT00001639000.
DR   EnsemblGenomes-Tr; EBT00001639001.
DR   EnsemblGenomes-Tr; EBT00001639002.
DR   EnsemblGenomes-Tr; EBT00001639003.
DR   EnsemblGenomes-Tr; EBT00001639004.
DR   EnsemblGenomes-Tr; EBT00001639005.
DR   EnsemblGenomes-Tr; EBT00001639006.
DR   EnsemblGenomes-Tr; EBT00001639007.
DR   EnsemblGenomes-Tr; EBT00001639008.
DR   EnsemblGenomes-Tr; EBT00001639009.
DR   EnsemblGenomes-Tr; EBT00001639010.
DR   EnsemblGenomes-Tr; EBT00001639011.
DR   EnsemblGenomes-Tr; EBT00001639012.
DR   EnsemblGenomes-Tr; EBT00001639013.
DR   EnsemblGenomes-Tr; EBT00001639014.
DR   EnsemblGenomes-Tr; EBT00001639015.
DR   EnsemblGenomes-Tr; EBT00001639016.
DR   EnsemblGenomes-Tr; EBT00001639017.
DR   EnsemblGenomes-Tr; EBT00001639018.
DR   EnsemblGenomes-Tr; EBT00001639019.
DR   EnsemblGenomes-Tr; EBT00001639020.
DR   EnsemblGenomes-Tr; EBT00001639021.
DR   EnsemblGenomes-Tr; EBT00001639022.
DR   EnsemblGenomes-Tr; EBT00001639023.
DR   EnsemblGenomes-Tr; EBT00001639024.
DR   EnsemblGenomes-Tr; EBT00001639025.
DR   EnsemblGenomes-Tr; EBT00001639026.
DR   EnsemblGenomes-Tr; EBT00001639027.
DR   EnsemblGenomes-Tr; EBT00001639028.
DR   EnsemblGenomes-Tr; EBT00001639029.
DR   EnsemblGenomes-Tr; EBT00001639030.
DR   EnsemblGenomes-Tr; EBT00001639031.
DR   EnsemblGenomes-Tr; EBT00001639032.
DR   EnsemblGenomes-Tr; EBT00001639033.
DR   EnsemblGenomes-Tr; EBT00001639034.
DR   EnsemblGenomes-Tr; EBT00001639035.
DR   EnsemblGenomes-Tr; EBT00001639036.
DR   EnsemblGenomes-Tr; EBT00001639037.
DR   EnsemblGenomes-Tr; EBT00001639038.
DR   EnsemblGenomes-Tr; EBT00001639039.
DR   EnsemblGenomes-Tr; EBT00001639040.
DR   EnsemblGenomes-Tr; EBT00001639041.
DR   EnsemblGenomes-Tr; EBT00001639042.
DR   EnsemblGenomes-Tr; EBT00001639043.
DR   EnsemblGenomes-Tr; EBT00001639044.
DR   EnsemblGenomes-Tr; EBT00001639045.
DR   EnsemblGenomes-Tr; EBT00001639046.
DR   EnsemblGenomes-Tr; EBT00001639047.
DR   EnsemblGenomes-Tr; EBT00001639048.
DR   EnsemblGenomes-Tr; EBT00001639049.
DR   EnsemblGenomes-Tr; EBT00001639050.
DR   EnsemblGenomes-Tr; EBT00001639051.
DR   EnsemblGenomes-Tr; EBT00001639052.
DR   EnsemblGenomes-Tr; EBT00001639053.
DR   EnsemblGenomes-Tr; EBT00001639054.
DR   EnsemblGenomes-Tr; EBT00001639055.
DR   EnsemblGenomes-Tr; EBT00001639056.
DR   EnsemblGenomes-Tr; EBT00001639057.
DR   EnsemblGenomes-Tr; EBT00001639058.
DR   EnsemblGenomes-Tr; EBT00001639059.
DR   EnsemblGenomes-Tr; EBT00001639060.
DR   EnsemblGenomes-Tr; EBT00001639061.
DR   EnsemblGenomes-Tr; EBT00001639062.
DR   EnsemblGenomes-Tr; EBT00001639063.
DR   EnsemblGenomes-Tr; EBT00001639064.
DR   EnsemblGenomes-Tr; EBT00001639065.
DR   EnsemblGenomes-Tr; PFL_0119-1.
DR   EnsemblGenomes-Tr; PFL_0120-1.
DR   EnsemblGenomes-Tr; PFL_0121-1.
DR   EnsemblGenomes-Tr; PFL_0122-1.
DR   EnsemblGenomes-Tr; PFL_0123-1.
DR   EnsemblGenomes-Tr; PFL_0178-1.
DR   EnsemblGenomes-Tr; PFL_0324-1.
DR   EnsemblGenomes-Tr; PFL_0356-1.
DR   EnsemblGenomes-Tr; PFL_0575-1.
DR   EnsemblGenomes-Tr; PFL_0576-1.
DR   EnsemblGenomes-Tr; PFL_0735-1.
DR   EnsemblGenomes-Tr; PFL_0736-1.
DR   EnsemblGenomes-Tr; PFL_0737-1.
DR   EnsemblGenomes-Tr; PFL_0738-1.
DR   EnsemblGenomes-Tr; PFL_0739-1.
DR   EnsemblGenomes-Tr; PFL_0840-1.
DR   EnsemblGenomes-Tr; PFL_0841-1.
DR   EnsemblGenomes-Tr; PFL_0849-1.
DR   EnsemblGenomes-Tr; PFL_1252-1.
DR   EnsemblGenomes-Tr; PFL_1253-1.
DR   EnsemblGenomes-Tr; PFL_1428-1.
DR   EnsemblGenomes-Tr; PFL_1461-1.
DR   EnsemblGenomes-Tr; PFL_1759-1.
DR   EnsemblGenomes-Tr; PFL_1760-1.
DR   EnsemblGenomes-Tr; PFL_1761-1.
DR   EnsemblGenomes-Tr; PFL_1762-1.
DR   EnsemblGenomes-Tr; PFL_1763-1.
DR   EnsemblGenomes-Tr; PFL_1764-1.
DR   EnsemblGenomes-Tr; PFL_1841-1.
DR   EnsemblGenomes-Tr; PFL_2042-1.
DR   EnsemblGenomes-Tr; PFL_2050-1.
DR   EnsemblGenomes-Tr; PFL_2051-1.
DR   EnsemblGenomes-Tr; PFL_2052-1.
DR   EnsemblGenomes-Tr; PFL_2053-1.
DR   EnsemblGenomes-Tr; PFL_2054-1.
DR   EnsemblGenomes-Tr; PFL_2055-1.
DR   EnsemblGenomes-Tr; PFL_2080-1.
DR   EnsemblGenomes-Tr; PFL_2081-1.
DR   EnsemblGenomes-Tr; PFL_2082-1.
DR   EnsemblGenomes-Tr; PFL_2084-1.
DR   EnsemblGenomes-Tr; PFL_2119-1.
DR   EnsemblGenomes-Tr; PFL_2765-1.
DR   EnsemblGenomes-Tr; PFL_3425-1.
DR   EnsemblGenomes-Tr; PFL_3465-1.
DR   EnsemblGenomes-Tr; PFL_3560-1.
DR   EnsemblGenomes-Tr; PFL_3739-1.
DR   EnsemblGenomes-Tr; PFL_3989-1.
DR   EnsemblGenomes-Tr; PFL_3990-1.
DR   EnsemblGenomes-Tr; PFL_3991-1.
DR   EnsemblGenomes-Tr; PFL_4141-1.
DR   EnsemblGenomes-Tr; PFL_4142-1.
DR   EnsemblGenomes-Tr; PFL_4143-1.
DR   EnsemblGenomes-Tr; PFL_4144-1.
DR   EnsemblGenomes-Tr; PFL_4145-1.
DR   EnsemblGenomes-Tr; PFL_4402-1.
DR   EnsemblGenomes-Tr; PFL_4403-1.
DR   EnsemblGenomes-Tr; PFL_4404-1.
DR   EnsemblGenomes-Tr; PFL_4405-1.
DR   EnsemblGenomes-Tr; PFL_4495-1.
DR   EnsemblGenomes-Tr; PFL_4501-1.
DR   EnsemblGenomes-Tr; PFL_4502-1.
DR   EnsemblGenomes-Tr; PFL_4503-1.
DR   EnsemblGenomes-Tr; PFL_4658-1.
DR   EnsemblGenomes-Tr; PFL_4753-1.
DR   EnsemblGenomes-Tr; PFL_4976-1.
DR   EnsemblGenomes-Tr; PFL_5164-1.
DR   EnsemblGenomes-Tr; PFL_5179-1.
DR   EnsemblGenomes-Tr; PFL_5245-1.
DR   EnsemblGenomes-Tr; PFL_5246-1.
DR   EnsemblGenomes-Tr; PFL_5247-1.
DR   EnsemblGenomes-Tr; PFL_5248-1.
DR   EnsemblGenomes-Tr; PFL_5249-1.
DR   EnsemblGenomes-Tr; PFL_5300-1.
DR   EnsemblGenomes-Tr; PFL_5301-1.
DR   EnsemblGenomes-Tr; PFL_5302-1.
DR   EnsemblGenomes-Tr; PFL_5303-1.
DR   EnsemblGenomes-Tr; PFL_5596-1.
DR   EnsemblGenomes-Tr; PFL_5598-1.
DR   EnsemblGenomes-Tr; PFL_5599-1.
DR   EnsemblGenomes-Tr; PFL_5600-1.
DR   EnsemblGenomes-Tr; PFL_5602-1.
DR   EnsemblGenomes-Tr; PFL_5603-1.
DR   EnsemblGenomes-Tr; PFL_5604-1.
DR   EnsemblGenomes-Tr; PFL_5605-1.
DR   EnsemblGenomes-Tr; PFL_5606-1.
DR   EnsemblGenomes-Tr; PFL_5665-1.
DR   EnsemblGenomes-Tr; PFL_6234-1.
DR   EnsemblGenomes-Tr; PFL_6285-1.
DR   EnsemblGenomes-Tr; PFL_6286-1.
DR   EnsemblGenomes-Tr; PFL_6287-1.
DR   EnsemblGenomes-Tr; PFL_6288-1.
DR   EnsemblGenomes-Tr; PFL_6289-1.
DR   EnsemblGenomes-Tr; PFL_6290-1.
DR   EnsemblGenomes-Tr; PFL_6291-1.
DR   EnsemblGenomes-Tr; PFL_6292-1.
DR   EnsemblGenomes-Tr; PFL_6294-1.
DR   EnsemblGenomes-Tr; PFL_6296-1.
DR   EnsemblGenomes-Tr; PFL_6297-1.
DR   EnsemblGenomes-Tr; PFL_6301-1.
DR   EnsemblGenomes-Tr; PFL_6302-1.
DR   EnsemblGenomes-Tr; PFL_6307-1.
DR   EnsemblGenomes-Tr; PFL_6309-1.
DR   EnsemblGenomes-Tr; PFL_6310-1.
DR   EnsemblGenomes-Tr; PFL_6311-1.
DR   EuropePMC; PMC1287665; 16269724.
DR   EuropePMC; PMC1352262; 16391073.
DR   EuropePMC; PMC1828831; 17261523.
DR   EuropePMC; PMC1855914; 17277060.
DR   EuropePMC; PMC2168197; 17905875.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2813009; 20008172.
DR   EuropePMC; PMC3156334; 21949494.
DR   EuropePMC; PMC3165259; 21705548.
DR   EuropePMC; PMC3390384; 22792073.
DR   EuropePMC; PMC3510223; 23209661.
DR   EuropePMC; PMC3807495; 23995634.
DR   EuropePMC; PMC4103555; 22972385.
DR   EuropePMC; PMC4525061; 26300869.
DR   EuropePMC; PMC4796923; 26405829.
DR   EuropePMC; PMC4888284; 27257541.
DR   EuropePMC; PMC6588701; 31227753.
DR   GOA; Q4KIF8.
DR   InterPro; IPR003728; Ribosome_maturation_RimP.
DR   InterPro; IPR028989; RimP_N.
DR   InterPro; IPR028998; RimP_C.
DR   InterPro; IPR035956; RimP_N_sf.
DR   InterPro; IPR036847; RimP_C_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00485; K_chan_RES.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01670; P17.
DR   RFAM; RF01671; P18.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01681; P4.
DR   RFAM; RF01683; P6.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02144; rsmX.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000076.
DR   SILVA-SSU; CP000076.
DR   StrainInfo; 493739; 0.
DR   UniProtKB/Swiss-Prot; Q4KIF8; RIMP_PSEF5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7074893
FT                   /organism="Pseudomonas protegens Pf-5"
FT                   /strain="Pf-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:220664"
FT   gene            101..1642
FT                   /gene="dnaA"
FT                   /locus_tag="PFL_0001"
FT   CDS_pept        101..1642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PFL_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95419"
FT                   /db_xref="GOA:Q4KKT0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKT0"
FT                   /protein_id="AAY95419.1"
FT                   /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRVLELLDEHGNGMAPVLSLLIGSKRSSAPRAAPNAPLAAAASQALQA
FT                   AAANAAPAAAPAPAPAPTSAPAKKAAAQKAAEVSEEPSRDSFDPMAGASSQQAPVRAEQ
FT                   RTVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGL
FT                   GKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLID
FT                   DIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAV
FT                   EPPELETRVAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRD
FT                   ITIELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMA
FT                   LSKELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
FT   gene            1681..2784
FT                   /gene="dnaN"
FT                   /locus_tag="PFL_0002"
FT   CDS_pept        1681..2784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PFL_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95420"
FT                   /db_xref="GOA:Q4KKS9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKS9"
FT                   /protein_id="AAY95420.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLPNDALIDIKVDEQKLVVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTCQLEQSRLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   AGIIRAVATDGHRLAMCSMQADIGQPDRHQVIVPRKGILELARLLTEPDGNVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRG
FT                   IRLQLANGQLKIQANNPEQEEAEEEVGVEYNGGSLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDSNSSALVQESDNDDSAYVVMPMRL"
FT   gene            2805..3908
FT                   /gene="recF"
FT                   /locus_tag="PFL_0003"
FT   CDS_pept        2805..3908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PFL_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P13456; match to
FT                   protein family HMM PF02463; match to protein family HMM
FT                   TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95421"
FT                   /db_xref="GOA:Q4KKS8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKS8"
FT                   /protein_id="AAY95421.1"
FT                   /translation="MSLSRVSVTAVRNLHPVTFSPSPRINLLYGANGSGKTSVLEAIHL
FT                   LGLARSFRSARLLPVIQYEQLACTVFGQVELAQGGHSSLGISRDRQGEFQIRIDGQNAR
FT                   SAAQLAEILPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFMSTWQRLQKALRQRN
FT                   SWLRHGTLDAASQAAWDRELCQASAEIDEYRRAYIKALKPVFERTLGELLQLEGLTLSY
FT                   YRGWDKDRELSEVLATALHRDQQMGHTQAGPQRADLRLRLGGHNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQARRGQCIYLVDDLPSELDEQHRRALCRLLEDLRCQVFITCVDHELLR
FT                   EGWQTETPVALFHVEQGRITQTHDHRE"
FT   gene            3913..6330
FT                   /gene="gyrB"
FT                   /locus_tag="PFL_0004"
FT   CDS_pept        3913..6330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PFL_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95422"
FT                   /db_xref="GOA:Q4KKS7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKS7"
FT                   /protein_id="AAY95422.1"
FT                   /translation="MSEENTYDSTSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDISIIIHPDESITVRDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSEELILTVRRSGKIWEQTYVHGVPQERMKIVGDSE
FT                   TTGTQIHFKPSAETFKNIHFSWDVLAKRIRELSFLNSGVGIVLKDERSGKEELFKYEGG
FT                   LRAFVEYLNTNKTAVNQVFHFNIQREDGIGVEIALQWNDSFNENLLCFTNNIPQRDGGT
FT                   HLVGFRSALTRNLNNYIEQEGLAKKHKVATTGDDAREGLTAIISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQEMGKYFSDFLLENPNEAKLVVGKMIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKTQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QLPELIERGYIYIAQPPLYKVKKGKQEQYIKDDDAMEDYMTQSALEDASLHLNEEAPGI
FT                   SGEALERLVNDFRMVMKTLKRLSRLYPQELTEHFIYLPAVTMEQLSDHAAMQDWLAKYD
FT                   ARLRTSEKSGLVYKASLREDRERNVWLPEVELISHGLSNYVTFNRDFFGSNDYKTVVSL
FT                   GAQLSTLLDEGAYVQRGERKKAVTEFKEALDWLMAESTKRHTIQRYKGLGEMNPDQLWE
FT                   TTMDPSMRRMLKVTIEDAIGADQIFNTLMGDAVEPRRDFIESNALAVSNLDF"
FT   gene            6669..7193
FT                   /locus_tag="PFL_0005"
FT   CDS_pept        6669..7193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95423"
FT                   /db_xref="GOA:Q4KKS6"
FT                   /db_xref="InterPro:IPR025361"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKS6"
FT                   /protein_id="AAY95423.1"
FT                   /translation="MDTSTAQFHKIIFKLTVDADGYPPVEYESMWGIQRGADVYQLDNT
FT                   PYYLYGVSKGDWVLTRAEAHERIATGVVRQSGHSTLRVFAERESERSEIVQYLRSLGAR
FT                   CTVTRGLSLFTVDIAPEVSFCAIDQYLASISDDQHVAYEDACLQHEAIEPARLSECSSL
FT                   ASLECVTWRDH"
FT   gene            7345..7830
FT                   /locus_tag="PFL_0006"
FT   CDS_pept        7345..7830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95424"
FT                   /db_xref="GOA:Q4KKS5"
FT                   /db_xref="InterPro:IPR025361"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKS5"
FT                   /protein_id="AAY95424.1"
FT                   /translation="MDDENQEISIRVVAGQNSRGPVYEPLHVRRIDEDSYEILYSPGLA
FT                   LNLAKGDIISIKDPQAPAVVLKRGGNFCIHIYSDHIPEEHIMALAADVASELGGMLDGR
FT                   YKGNLTLSVPARSGMDNIALFFNRFRETTGSEWYYANIYKNLDDTDDETLLDWWLAL"
FT   gene            7812..8147
FT                   /locus_tag="PFL_0007"
FT   CDS_pept        7812..8147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD16972.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95425"
FT                   /db_xref="GOA:Q4KKS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKS4"
FT                   /protein_id="AAY95425.1"
FT                   /translation="MVAGPMNERQQLICERYDLAPQAPEPMIALAIGSLAQSPIYGTRV
FT                   ELPENGTVSWFIHCGEHSTAVDFYQPLCAEHLLELLPEVIDYLYLPSGTRFIIDRAGYE
FT                   DVWRDPE"
FT   gene            complement(8175..8903)
FT                   /locus_tag="PFL_0008"
FT   CDS_pept        complement(8175..8903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0008"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95426"
FT                   /db_xref="GOA:Q4KKS3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKS3"
FT                   /protein_id="AAY95426.1"
FT                   /translation="MRVAILDDEPAELARVEQTLREIPGPGEQPWTLHSFERGEDLLRQ
FT                   LRRETFDLLILDWQVPDLSGLSLLRWTREHMDSPPAAIMLTSRDAESDIVQALNTGADD
FT                   YLSKPFRPNELKARVNAVLRRHGLQRNHSEEVQSFNDLSFDDAELTVTRAGAPISLTER
FT                   EYRLARCLFANLGRPLSREYLYERFWTHEEIVSSRPLDTHIYRLRNKLGLTADRGWQLL
FT                   TIYGYGYRLESVASPEEQGS"
FT   gene            9819..10817
FT                   /locus_tag="PFL_0009"
FT   CDS_pept        9819..10817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G83141"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95427"
FT                   /db_xref="GOA:Q4KKS2"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKS2"
FT                   /protein_id="AAY95427.1"
FT                   /translation="MNDLCPFPSTGRPQVARVALLLAGLILPLCAAQAAAPRLPYIDDN
FT                   QQCRGQPLPATVEHLTGEAWKLDAKGREVLLQEGMSIDEKEGVRTSPSAFVSLSLGDGS
FT                   RVVLPSSSQVTLQLNNQYAIPQVVLEQGQIESYVIKRTSDHDRFQIVTPVGVLGVRGTH
FT                   FRVRNDDQQSLVEVLNGQVAVNREEDAPQPGPRRPRQRPVDKPAGPVPGEVQVMARQGL
FT                   RIQKQGELKPVELLSAPRLLGQAGQTGALPVWQLILQPLPGASRYRAQVATDKDFLNIK
FT                   QEQFSSTPQVNFTGLQAFFYHVRLSAFDEHGLEGETGVYDIFYYPRTTRVE"
FT   gene            10836..13154
FT                   /locus_tag="PFL_0010"
FT   CDS_pept        10836..13154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0010"
FT                   /product="CHASE domain/sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF05226"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95428"
FT                   /db_xref="GOA:Q4KKS1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR017181"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKS1"
FT                   /protein_id="AAY95428.1"
FT                   /translation="MSVWRRRAEGREPTQAQRLFRGLVREWLWVSLILLPLTAVLSLSH
FT                   GLALNNLFYDNLRRFTPLPVDPRILLVTIDDYSLQQLGRWPWPRAIHGQLLDRLSAAEA
FT                   KGVLFDVILSEPGSTVENDTRLAAALCRAGNVFLPVLRQGVARYGQDIEEIPPVPLLRN
FT                   CARGLGHINAEADADGTVRSVYLREGPMLAPRAQLTWLLYQLTEAEPAFPHMPGPGEPR
FT                   VAQGWLRSNPVRIPFISADAGFPSVPYVSVLRGEVPPELLRDRLILVGSTAPGLGDRYV
FT                   TPQSGSQGTTPGVEIQANLLNGLLQHRSVVALGQWSGMLLSMALTAVLLGLLLWRPRHA
FT                   LWITLGCMGLGLAGSVLMLRLGYWWSPVASLLGMLLAYLIWNWRRLSVILAYFGWELAR
FT                   LDSEPKVLPERRRSQAPAGDVLQGQIVALEQALSRTRDTRRFIADGLEYLPVATLISDP
FT                   DGKILLANRNAREVFAHSLVGEGLIAQLAALGYPGLTEPALYPRLEQLPAVEFRDVQQR
FT                   SLRMELAPLLPVDSDTAIGWLLSLTDLSVERDAEQQRSVLLRFLSHDLRAPHSAILALL
FT                   DVQRHQPATPRQVYGQIEQQVRRALALTEAFVQLAKAESEAYQFEPSMFAMLVLDAFDQ
FT                   ATTLAQLKDIHLEHDLDDEAEGLVLADQSLLTRALFNLLENAIKYSPVESRVSVRVSCT
FT                   PGWLRCEISDEGRGIDAADLPQLFGQYQRFASAKGIDGLGLGLSMVKAVVDRHQGRISC
FT                   QSVVGRGSCFILELPLLEE"
FT   gene            complement(13335..14105)
FT                   /locus_tag="PFL_0011"
FT   CDS_pept        complement(13335..14105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0011"
FT                   /product="putative acylhomoserine lactone synthase HdtS"
FT                   /note="identified by similarity to GB:AAG30826.1; match to
FT                   protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95429"
FT                   /db_xref="GOA:Q4KKS0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKS0"
FT                   /protein_id="AAY95429.1"
FT                   /translation="MSILQAIRTFFFYLLLGTSSLLWCSLSFFIAPFLPFKARYRFINV
FT                   YWCRCALWLTKVFLNIRVEVKGAENVPERPCVIVSNHQSTWETFFLSAYFEPLSQVLKR
FT                   ELLYVPFFGWAMAMLRPIAIDRDNPKAALKQVASKGDELLKDNVWVLIFPEGTRVPHGQ
FT                   IGKFSRSGSALAVNADLPVLPVAHNAGKFWPKTGWAKRPGTITVTIGAPMYAEGSGPRA
FT                   IAELNDRVAAWNEQAQRDMGSLPPLATSTDKVAV"
FT   gene            complement(14189..14722)
FT                   /gene="gmhB"
FT                   /locus_tag="PFL_0012"
FT   CDS_pept        complement(14189..14722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="PFL_0012"
FT                   /product="putative D,D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by similarity to SP:P63228; match to
FT                   protein family HMM TIGR01656; match to protein family HMM
FT                   TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95430"
FT                   /db_xref="GOA:Q4KKR9"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKR9"
FT                   /protein_id="AAY95430.1"
FT                   /translation="MKLLILDRDGVINHDSDAYIKSVQEWIPLPGAIEAIAQLSKAGWT
FT                   VAIATNQSGIARGYYDLATLDAMHARLRELVAEQGGEVGLIVYCPHGPDEGCACRKPKP
FT                   GMLRTIAEHYQAELTGLWFVGDSLGDLEAAKAVDSQPVLVKTGKGEKTLGKTLPVGTLI
FT                   FDDLAAVAAELIHN"
FT   gene            complement(14740..16794)
FT                   /gene="glyS"
FT                   /locus_tag="PFL_0013"
FT   CDS_pept        complement(14740..16794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PFL_0013"
FT                   /product="glycine--tRNA ligase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by similarity to SP:P00961; match to
FT                   protein family HMM PF02092; match to protein family HMM
FT                   PF05746; match to protein family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95431"
FT                   /db_xref="GOA:Q4KKR8"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKR8"
FT                   /protein_id="AAY95431.1"
FT                   /translation="MSAQDFLVELGTEELPPKALNTLAEAFLAGIEKGLQSAGLSFQAK
FT                   HVYAAPRRLAVLITQLATQQPDRSINLDGPPRQAAFDAEGNPTQAALGFAKKCGVELSE
FT                   IDQSGPKLRYSQSIKGKPTASLLPTIVEDSLNDLPIPKRMRWAARKEEFVRPTQWLVML
FT                   LGDEVIDCTILAQKAGRDSRGHRFHHPQSVRITAPANYLADLRAAYVLADANERRELIS
FT                   KRTAELATLQEGTAIVPADLLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQK
FT                   YFCLLDVDGKLLPRFITVANIESKDPRQIIEGNEKVVRPRLTDAEFFFKQDKKQKLEDF
FT                   NLRLQNVVFQEKLGSVYDKAERISKLAAFIAPRIGGDAQRAARAGLLSKCDLATEMVGE
FT                   FPEMQGIAGYYYALNDGEPEDVALALNEQYMPRGAGAELPSTVTGAAVAIADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGVLRILIEKKFDLDLNDAVAFAVSAFGSKVKAAGLAD
FT                   QVLEFIFDRLRARYEDEGVDVATYLSVRALKPGSALDFDQRVQAVQAFRKLPEAAALAA
FT                   VNKRVSNLLSKIEGNVPTTIEAKYFDNANEFSLYSAIQQADQAVQPMAAARQYSETLAR
FT                   LAALREPVDAFFEAVMVNAEDAKVRANRYALLARLRGLFLGVADISVLS"
FT   gene            complement(16791..17744)
FT                   /gene="glyQ"
FT                   /locus_tag="PFL_0014"
FT   CDS_pept        complement(16791..17744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PFL_0014"
FT                   /product="glycine--tRNA ligase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by similarity to SP:P00960; match to
FT                   protein family HMM PF02091; match to protein family HMM
FT                   TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95432"
FT                   /db_xref="GOA:Q4KKR7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKR7"
FT                   /protein_id="AAY95432.1"
FT                   /translation="MSQPTPAVRTFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSL
FT                   KHVGLDPLVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGIECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVEKLF
FT                   ELFDFYESEAKRLIELDQPLPLPSYEMVLKASHTFNLLDARRAISVTARQQYILRVRTL
FT                   ARSVAQAYLLARAKLGFPMATPDLRDEVLAKLEAAQ"
FT   gene            17826..18389
FT                   /gene="tag_2"
FT                   /locus_tag="PFL_0015"
FT   CDS_pept        17826..18389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag_2"
FT                   /locus_tag="PFL_0015"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="identified by similarity to SP:P05100; match to
FT                   protein family HMM PF03352; match to protein family HMM
FT                   TIGR00624"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95433"
FT                   /db_xref="GOA:Q4KKR6"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKR6"
FT                   /protein_id="AAY95433.1"
FT                   /translation="MPRCFWCSEDPLYMAYHDQEWGVPLRDGQRLFELLLLEGFQAGLS
FT                   WITVLKKREHYRQVLFGFDVQRVAQMSDAEIDDLMQDPGIIRNRLKLNAARRNAQAWLE
FT                   LEDPVAFLWAFVGGVPKINHFNDRSEVPAVTPEAEAMSRGLRKAGFTFVGPTICYALMQ
FT                   ASGMVMDHTLDCDRYAILADARLE"
FT   gene            18432..19319
FT                   /locus_tag="PFL_0016"
FT   CDS_pept        18432..19319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0016"
FT                   /product="putative lipid A biosynthesis lauroyl
FT                   acyltransferase"
FT                   /note="identified by similarity to SP:P24187; match to
FT                   protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95434"
FT                   /db_xref="GOA:Q4KKR5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKR5"
FT                   /protein_id="AAY95434.1"
FT                   /translation="MDKFKGALLVGALRLFALLPWRAVQAVGAAIGWIMWKTPNRSREV
FT                   VRINLAKCFPQMDPAERERLVGQSLKDIGKSLTESACAWIWPAERSIALVREVEGLEVL
FT                   KDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDELLRKQRVQLGNR
FT                   VAASTKEGILSVIKEVRKGGAVGIPADPEPAESAGIFVPFFATQALTSKFVPNMLAGGK
FT                   AVGVFLHALRLPDGSGYKVILEAAPEDMYSTDTETSCAAMSKVVERYVGAYPSQYMWSM
FT                   KRFKKRPPGEARWY"
FT   gene            19392..19631
FT                   /locus_tag="PFL_0017"
FT   CDS_pept        19392..19631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07238"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95435"
FT                   /db_xref="GOA:Q4KKR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKR4"
FT                   /protein_id="AAY95435.1"
FT                   /translation="MSDHRKSFRIKISHESIGECLGQTRNLSASGVYVQSPALARLPKG
FT                   AVVYGQVQGLPVTAPRVRMEVVQVDAEGIALRYL"
FT   gene            complement(19803..20120)
FT                   /locus_tag="PFL_0018"
FT   CDS_pept        complement(19803..20120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0018"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719; match to protein
FT                   family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95436"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKR3"
FT                   /protein_id="AAY95436.1"
FT                   /translation="MLESLEKMLAKGVDNALLRFGLGKGYLDQGDFAKAAEHLQRCVAF
FT                   DPKYSAAWKLLGKACQGQGDLPAARQAWEQGLEAARGHGDKQAEKEMTVFLKKLDRQSQ
FT                   G"
FT   gene            complement(20245..21618)
FT                   /gene="trkA"
FT                   /locus_tag="PFL_0019"
FT   CDS_pept        complement(20245..21618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PFL_0019"
FT                   /product="Trk system potassium uptake protein TrkA"
FT                   /note="identified by similarity to SP:P0AGI8; match to
FT                   protein family HMM PF02080; match to protein family HMM
FT                   PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95437"
FT                   /db_xref="GOA:Q4KKR2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKR2"
FT                   /protein_id="AAY95437.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGERLRDLGDRLDI
FT                   RTVQGRASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAHTLFHTPTKIARVREAAY
FT                   LTRAGLFDNDAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVAVKAYYGG
FT                   PLVGQQLRQLREHMPNVDTRVAAIFRRDRPIMPKGDTVIEADDEVFFIAAKAHIRAVMS
FT                   EMRRLEESYKRIVIAGGGQIGERLAEAIESRYQVKIIEMNPARCRYLSDTLDSTVVLQG
FT                   SASDRDLLLEENIADADIFLALTNDDEANIMSSLLAKRLGAKKVMTIINNPAYVDLIQG
FT                   GDIDIAISPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEAIAHGDAKSSKVIGRAIE
FT                   NIGLPPGTTIGAIIRDEEVLIAHDDTVIEAGDHVILFLVDKKHIRDVEKLFHVGLSFF"
FT   gene            complement(21641..22966)
FT                   /gene="rsmB"
FT                   /locus_tag="PFL_0020"
FT   CDS_pept        complement(21641..22966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="PFL_0020"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P36929; match to
FT                   protein family HMM PF01029; match to protein family HMM
FT                   PF01189; match to protein family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95438"
FT                   /db_xref="GOA:Q4KKR1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKR1"
FT                   /protein_id="AAY95438.1"
FT                   /translation="MNPRLAAAKALTAVLNGKASLNSSLPIQLDKVEARDRGFTQDLAF
FT                   GTARWQPRLSALAAKLLQKPFKAADADVEALLLVGLYQLLYARVPAHAAIGETVGCADK
FT                   LKKPWAKALLNAVLRRAQRESETLLAELEHDPVVRTAHPRWLQKSLKAFWPEQWEAICA
FT                   ANNAHPPMILRVNRRHHSRDAYLKLLSEAGVAAKACVYSQDGIVLDEALDVRSLPGFAE
FT                   GWISVQDEAAQLAAELLELAPGQRVLDACCAPGGKTCHILEVQPALAGVVAVDLEAKRL
FT                   VRVRENLDRLGLDAQLIAADGRDTQAWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQ
FT                   PEDIAALAQLQGELLDAMWQALEVGGILLYATCSTLPTENTEVIEAFLARTPGARELDI
FT                   GGQLGQPAAGLKQPHGRQLLAQEGGHDGFYYAKLIKIAAARG"
FT   gene            complement(22963..23922)
FT                   /gene="fmt"
FT                   /locus_tag="PFL_0021"
FT   CDS_pept        complement(22963..23922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PFL_0021"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by similarity to SP:O85732; match to
FT                   protein family HMM PF00551; match to protein family HMM
FT                   PF02911; match to protein family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95439"
FT                   /db_xref="GOA:Q4KKR0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKR0"
FT                   /protein_id="AAY95439.1"
FT                   /translation="MTEPLRIVFAGTPEFAAEHLKALLDSPYQIVAVYTQPDRPAGRGQ
FT                   KLMPSPVKQLALENDIPVLQPPTLRNAEAQAELAALKPDLMVVVAYGLILPQAVLDIPR
FT                   LGCINSHASLLPRWRGAAPIQRAVQAGDAQSGVTVMRMEAGLDTGPMLLKVSTPISAED
FT                   TGGSLHDRLAEMGPPAVLQAIEGLAAGTLEGEVQDDSLATYAHKLNKDEARIDWSRPAV
FT                   ELERLVRAFNPWPICHSSLNGEALKVLAATLAEGKGAPGEILGASKDGLIVACGEQALC
FT                   LTRLQLPGGKALNFSDLFNSRREKFAIGTVLGQTADAQ"
FT   gene            complement(23992..24498)
FT                   /gene="def_2"
FT                   /locus_tag="PFL_0022"
FT   CDS_pept        complement(23992..24498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def_2"
FT                   /locus_tag="PFL_0022"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95440"
FT                   /db_xref="GOA:Q4KKQ9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKQ9"
FT                   /protein_id="AAY95440.2"
FT                   /translation="MAILNILEFPDPRLRTIAKPVAVVDDEVRQLVDDMFETMYEAPGI
FT                   GLAATQVNVHKRVVVMDLSEDRSEPRVFINPEFEALTDEMDQYQEGCLSVPGFYENVDR
FT                   PQRVKIKALDRDGQPYELIAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEKQ
FT                   HRQQA"
FT   gene            24652..25662
FT                   /locus_tag="PFL_0023"
FT   CDS_pept        24652..25662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95441"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKQ8"
FT                   /protein_id="AAY95441.2"
FT                   /translation="MRKSLFALLLAGWTAIGQAQVQLRDSYPQHYRVQPGDTLWSVASL
FT                   YLQQPWQWRELWPAGFAGQIFPGDRLQLVRNDGPPRLQLERPAAPPTVKLAPQARRLPP
FT                   APIPSIPLQAISSFLLDNRIVDQPGALERAPYIVAGEGERVLGGMGDRLFARGRLDPEQ
FT                   PVYELFRQGKVYRDPLSQELLGVNADAIGSARVVASEGDLATLALQSSNQEVRLGDRLL
FT                   AADTSGLPGSFSPSAPQRPVEGLIIDVPRGVTQIGALDVVTLNRGRRDGLLEGNVLAVI
FT                   KTGETVRDRQTGEPLKIPDEAAGWLMVFRSYDRLSYGLVLKATRSLAVLDKVRNP"
FT   gene            25750..26856
FT                   /gene="dprA"
FT                   /locus_tag="PFL_0024"
FT   CDS_pept        25750..26856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="PFL_0024"
FT                   /product="DNA protecting protein DprA"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95442"
FT                   /db_xref="GOA:Q4KKQ7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKQ7"
FT                   /protein_id="AAY95442.2"
FT                   /translation="MSNSMSGSISPAELEARLRLHVLPELGPMRFQRLLQAFGCASKAL
FT                   RAPASAWRSLDLPPACSEARRSPQVRDGARRALAWIDSQAQHLLMWDQPGYPPLLAQLE
FT                   DAPPLLFVAGDPSILERPQLAMVGSRRASRPGLDTAGAFSRSLARAGFVITSGLALGID
FT                   GAAHQAALDVGGRTVGVLGTGLENFYPQRHRALARAMIDQGSAVVSEFPLDTPARAEHF
FT                   PRRNRIISGLALGVLVVEASVASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIR
FT                   DGAVLVESVQHILETLAGWQNLPPSASLPTAACTHPLLALLHAAPHSSEALASASGWPL
FT                   PRVLAALTELEIEGRAVDENGRWYARLS"
FT   gene            26911..27468
FT                   /locus_tag="PFL_0025"
FT   CDS_pept        26911..27468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0025"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="identified by match to protein family HMM PF01300;
FT                   match to protein family HMM TIGR00057"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95443"
FT                   /db_xref="GOA:Q4KKQ6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKQ6"
FT                   /protein_id="AAY95443.1"
FT                   /translation="MVSSWRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEEAVDRLLA
FT                   IKSRSVDKGLILIADNIHQFDFLFEDFPDTWIDRMSSTWPGPNTWLVPHQNLLPEWVTG
FT                   VHDTVALRVSDHPLVRELCSLVGPLISTSANPQGRPAARTRLRIEQYFRGQLDLVLSGS
FT                   LGGRKNPSLIRDLATGKVVRPS"
FT   gene            complement(27533..28510)
FT                   /gene="qor_2"
FT                   /locus_tag="PFL_0026"
FT   CDS_pept        complement(27533..28510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor_2"
FT                   /locus_tag="PFL_0026"
FT                   /product="NADPH:quinone reductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="identified by similarity to SP:P28304; match to
FT                   protein family HMM PF00107; match to protein family HMM
FT                   PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95444"
FT                   /db_xref="GOA:Q4KKQ5"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKQ5"
FT                   /protein_id="AAY95444.1"
FT                   /translation="MAKRIQFRAHGGPEVLEYVDYQPAEPGPQQVRVSNKAIGLNFIDT
FT                   YFRSGLYAPPALPSGLGAEGAGVVEAVGSAVTRFKVGDRVAYGSGPLGAYSDVHVLPEA
FT                   NLVRLPDAISFEQAAGVMLKGLTVQYLLRQTYELQGGETVLFHAAAGGVGSLACQWAKA
FT                   LGVKLIGTVSSPEKAAIAKALGAWETIDYSHEDVARRVLELTGGKKCPVVYDGVGKDTW
FT                   LTSLDCLAPRGLMVSFGNASGAVDGVNLGILSAKGSLYVTRPTLASYANNAENLQRMAD
FT                   DLFGMIASGKLKIEIGQRFALVDAAKAHIELSARRTTGSTVLLP"
FT   gene            28678..29595
FT                   /gene="hemF"
FT                   /locus_tag="PFL_0027"
FT   CDS_pept        28678..29595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PFL_0027"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /note="identified by similarity to SP:P36553; match to
FT                   protein family HMM PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95445"
FT                   /db_xref="GOA:Q4KKQ4"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKQ4"
FT                   /protein_id="AAY95445.1"
FT                   /translation="MTTRTEAVKAYLLDLQDRICAALETEDGGARFIEDAWTRPAGGGG
FT                   RTRVIGDGAVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVP
FT                   TSHANVRFFIAEKEGEEPVWWFGGGFDLTPYYGNIDDCVHWHRVAERACAPFGADVYPR
FT                   YKAWCDSYFHIKHRNEPRGIGGLFFDDLNEWDFDTSFAFMRAIGDAYIEAYLPIVQRRK
FT                   AAAYTAQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKA
FT                   EPGSEEARLTEYFLQDRDWLAASN"
FT   gene            29689..30510
FT                   /gene="aroE"
FT                   /locus_tag="PFL_0028"
FT   CDS_pept        29689..30510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PFL_0028"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by similarity to SP:P15770; match to
FT                   protein family HMM PF01488; match to protein family HMM
FT                   PF08501; match to protein family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95446"
FT                   /db_xref="GOA:Q4KKQ3"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKQ3"
FT                   /protein_id="AAY95446.1"
FT                   /translation="MDQYVVFGNPIGHSKSPLIHRLFAQQTGQQLEYNTLLAPLDDFTG
FT                   TARSFFAHGRGANVTVPFKEEAYRLCDSLTERAQRAGAVNTLSKQADGRLLGDNTDGAG
FT                   LVRDLKVNAGVSLKGKRILVLGAGGAVRGALEPLLAEQPEALVIANRTVEKAELLAELF
FT                   ADLGPVSASGFDWLQESVDLIINATSASLSGELPPIAGSLIEAGKTVCYDMMYAKEPTP
FT                   FCRWASEQGAALVLDGLGMLAEQAAEAFYLWRGVRPDSGPVLAELRRQLAQ"
FT   gene            complement(30626..32194)
FT                   /locus_tag="PFL_0029"
FT   CDS_pept        complement(30626..32194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0029"
FT                   /product="inorganic anion transporter, SulP family"
FT                   /note="identified by match to protein family HMM PF00916;
FT                   match to protein family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95447"
FT                   /db_xref="GOA:Q4KKQ2"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKQ2"
FT                   /protein_id="AAY95447.1"
FT                   /translation="MAWPDRQSLLPLLSWLPRQTRASVGRDLLVGLSGAILALPQSIAY
FT                   ALIAGLPPEYGLYAAIVPVLIACLWGSSWHLICGPTAAISIVLYASVSPLAVPASEDYI
FT                   TLILLLTLLAGVFQWLLGMLRFGALVNFVSHSVVLGFTLGAAVVIALGQLPNLLGLELP
FT                   NQATALNSLSQLLQHLGEVDRPSLLLGLGTLALGVAFKLLAPRWPGLLLSLVFSALVVW
FT                   LLPGVFGHVQLVSAFVGRLPPFSPLPLDLELILRLLPSAVAVGMLGLVTSLSIARSLSA
FT                   RSEQLLDANQEVRAQGLSNMVGAFFSGYLSSGSFTRSGLSYEAGACSPLAGVFSALWVA
FT                   LFAVAGAGLIAHIPIPAMAGSILLICWGLVDHRGIRALFRVSRAEFVVMSLTCVATLLL
FT                   ELQTAIYAGVLASLFFYLKRTSQPRVQQSSEGDEDILRVGGSIFFGASHYLQVRMQRCH
FT                   APRLVIDARQINFIDYSGVEMLHQEARRLRRQERSLILRRARQAVKEELIKLEGPERCP
FT                   IHFED"
FT   gene            complement(32295..33212)
FT                   /locus_tag="PFL_0030"
FT   CDS_pept        complement(32295..33212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0030"
FT                   /product="choline ABC transporter, periplasmic
FT                   choline-binding protein"
FT                   /note="identified by match to protein family HMM PF04069;
FT                   match to protein family HMM TIGR03414"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95448"
FT                   /db_xref="GOA:Q4KKQ1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKQ1"
FT                   /protein_id="AAY95448.1"
FT                   /translation="MQRLSTALTLGLLALGSASAWADSCETVKMADPGWSDIAATNAIT
FT                   GFLLDGMGYKAKIDTLAVPITFGGLKDGRVDVFLGNWMPAQQGFHDKFVANGDVTQLAK
FT                   NLEGTEFTLAVPDYVWEAGVHDFADLDKFADKFDKKLYGIGSGAPANLSLQEIIKSNQF
FT                   NLGQWKLIESSEQAMLAEVSRATKKQRFITFLGWTPHPMNVQLKMRYLTGGEKYFGASG
FT                   SVYTLTRKGYAQACPNVGKLLGNLRFTQEMENSIMAAVVNSKLSNTEAAKAWIKAHPAV
FT                   LEQWLEGVRTIDDKEALAAVKSRL"
FT   gene            complement(33230..34744)
FT                   /gene="betC"
FT                   /locus_tag="PFL_0031"
FT   CDS_pept        complement(33230..34744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betC"
FT                   /locus_tag="PFL_0031"
FT                   /product="choline-sulfatase"
FT                   /EC_number="3.1.6.6"
FT                   /note="identified by similarity to SP:O69787; match to
FT                   protein family HMM PF00884; match to protein family HMM
FT                   TIGR03417"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95449"
FT                   /db_xref="GOA:Q4KKQ0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKQ0"
FT                   /protein_id="AAY95449.1"
FT                   /translation="MKRKNILFIMADQMAAPLLPFYGPSPIKLPHLSRLAAQGVVFDAA
FT                   YCNSPLCAPSRFTLVSGQLPSRIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMHFC
FT                   GPDQLHGYEERLTSDIYPADYGWAVNWDQPDVRPSWYHNMSSVLQAGPCVRTNQLDFDE
FT                   EVVFKAQQYLFDHVREAGDQPFCLTVSMTHPHDPYTIPRAFWDLYRDDQIPLPQTPPQS
FT                   ELDPHSQRLLKVYDLWDKPLPVDKIRDARRAYFGACSYIDSNVGKLLQTLEDTGLADDT
FT                   LIVFSGDHGDMLGERGLWYKMHWFEMAARVPLLICAPGQFTASRVSAAVSTADLLPTLV
FT                   ELAGGRVEPDLPLDGRSLVPHLQGQGGHDEVFGEYMAEGTIGPLMMIRRGAYKFIYSED
FT                   DPCLLFDLHHDPQERFDLGQSPEHRPLFAAFLAEARAKWDIPRIHQQVLASQRRRRLVA
FT                   EALSRGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARYPQPCQNQ"
FT   gene            34859..35809
FT                   /locus_tag="PFL_0032"
FT   CDS_pept        34859..35809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0032"
FT                   /product="putative choline sulfate-utilization
FT                   transcription factor"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466; match to protein
FT                   family HMM TIGR03418"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95450"
FT                   /db_xref="GOA:Q4KKP9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKP9"
FT                   /protein_id="AAY95450.1"
FT                   /translation="MYEALCDLSLDLLRVFEAAARLRSFTAAAVELGTTQPAISQQIKR
FT                   LEEQLGVRLFDRIYRGIELTESAALLLDQVQAGLQSIDAGLSALSQQHQHEVLQVATDF
FT                   AFAAYWLMPRLHRFHEANPQVDVSLVTSERSHSMLRSDIDVAVLFGDGRFRQGESHWLF
FT                   SEEVFPVCSPLLLKDRAAPLPAPSLLELPLLHLRGEGSNHWFDWSGVFRELGLAGAPAP
FT                   GQLRFDNYTLLIQAAIGGQGVAIGWRHLVDDLLEQGLLCRPIAESALSAYGYYVVLPQR
FT                   KRRGPLIQRFVDWLMSEQAGSAQSLKGLALPSIAR"
FT   gene            complement(35806..36450)
FT                   /locus_tag="PFL_0033"
FT   CDS_pept        complement(35806..36450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95451"
FT                   /db_xref="GOA:Q4KKP8"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKP8"
FT                   /protein_id="AAY95451.1"
FT                   /translation="MVKLVLYGAMSSLGSALMAESLRRQHEVIAILDDLTALAPRPGLR
FT                   AKGGDLFDPDRVKQSVAGSSAVICLLDAPDLPGSTTPGQAPDPVNQVRAVDALIEGMQG
FT                   AGIRRLMLVGEFSVLDNPPSSTSLPHHAAQEILDALRSSALDWTLINAPRGVAGLGIEH
FT                   FNQVGDSLEPGLAEPLRRLNGVAIGISDELRLNLHLREHVSFIATQPQAAT"
FT   gene            36554..36880
FT                   /locus_tag="PFL_0034"
FT   CDS_pept        36554..36880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0034"
FT                   /product="DOPA 45-dioxygenase family protein"
FT                   /note="identified by match to protein family HMM PF08883"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95452"
FT                   /db_xref="GOA:Q4KKP7"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKP7"
FT                   /protein_id="AAY95452.1"
FT                   /translation="MQRIKGYHAHVYFDASTIDQARALCERAAQLFELKMGRVHERPVG
FT                   PHPDWSCQLAFGPEVFAQVVPWLALNRQGLVVFLHPDTGDDLLDHTDHAIWMGAMRPLD
FT                   LRGF"
FT   gene            complement(36936..37379)
FT                   /locus_tag="PFL_0035"
FT   CDS_pept        complement(36936..37379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95453"
FT                   /db_xref="GOA:Q4KKP6"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKP6"
FT                   /protein_id="AAY95453.1"
FT                   /translation="MKMPKRLIAGAAVLMLSASPLLQVMADERGGYDRGGPQQGHWDNR
FT                   GNEHRGPGDDRHGGPPRDFGPVRQTIRDNHGYFVRGAPPPPGIHLVRGQPLPRGYYGER
FT                   LEPRALSRLPVYPGYEWRRMGGDIVLIAVGTGIVYEILDGVLY"
FT   gene            complement(37501..38313)
FT                   /gene="trpA"
FT                   /locus_tag="PFL_0036"
FT   CDS_pept        complement(37501..38313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="PFL_0036"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00290;
FT                   match to protein family HMM TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95454"
FT                   /db_xref="GOA:Q4KKP5"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKP5"
FT                   /protein_id="AAY95454.1"
FT                   /translation="MSRLQTRFAQLKEQNRAALVTFVTAGDPNYDTSLAILKGLPAAGA
FT                   DVIELGMPFTDPMADGPAIQLANIRALGAKQNLAKTLQMVREFREGNSDTPLVLMGYFN
FT                   PIHHYGVPRFIADAKAAGVDGLIVVDMPPEHNSELCDPAQAAGIDFIRLTTPTTDDARL
FT                   PKVLDGSSGFVYYVSVAGVTGAGAATLEHVEEAVARLRRHTDLPISIGFGIRTPEQAAA
FT                   IARLADGVVVGSALIDHIASAESSEQAVDGVLSLCAALSEGVRKARVS"
FT   gene            complement(38313..39533)
FT                   /gene="trpB"
FT                   /locus_tag="PFL_0037"
FT   CDS_pept        complement(38313..39533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="PFL_0037"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00263"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95455"
FT                   /db_xref="GOA:Q4KKP4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKP4"
FT                   /protein_id="AAY95455.1"
FT                   /translation="MTQSQLRNGPDDNGLFGAFGGRYVAETLMPLILDLAREYEKAKED
FT                   PEFLKELAYFQRDYVGRPSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQIL
FT                   LARRMGKKRIIAETGAGMHGVATATVAARFGLDCVIYMGTTDIERQQANVFRMKLLGAE
FT                   VIPVVAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETRE
FT                   QMQAQEGRLPDSLVACIGGGSNAMGLFHPFLDDKSVEIIGVEAAGYGIETGKHAASLNG
FT                   GVPGVLHGNRTFLLQDDDGQIIDAHSISAGLDYPGIGPEHAWLHDIGRVEYTSVTDDEA
FT                   LAAFHQCCRLEGIIPALESAHALAEVFKRAPNLPKDHLMVVNLSGRGDKDMQTVMHHMQ
FT                   QSQQEKH"
FT   gene            39681..40574
FT                   /gene="trpI"
FT                   /locus_tag="PFL_0038"
FT   CDS_pept        39681..40574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpI"
FT                   /locus_tag="PFL_0038"
FT                   /product="HTH-type transcriptional regulator TrpI"
FT                   /note="identified by similarity to SP:P34818; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95456"
FT                   /db_xref="GOA:Q4KKP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKP3"
FT                   /protein_id="AAY95456.1"
FT                   /translation="MSRDLPPLNALRAFEATARLNSVSQAAEQLHVTHGAVSRQLKVLE
FT                   EHLGLSLFVKEGRGLKLTDAGIRLRDASSEAFERLRDVCAELTQGSADAPFVLGCSGSL
FT                   LARWLIPRLGRLNADLPDLRLHLSAGEGDLDPRRPGLDALLVFAEPPWPADMQVYELAS
FT                   ERIGPVLSPRYAGYPRLRQAPAGVLASEALLHTTSRPQAWPSWARRNDLNPETLKYGQG
FT                   FEHLYYLLEAAVAGLGVAIAPQPLVAEDLLAGRLVAPWGFSDTPGQLALWLPKRAADGR
FT                   ARQLAQWLENELRQQL"
FT   gene            complement(40571..40897)
FT                   /locus_tag="PFL_0039"
FT   CDS_pept        complement(40571..40897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05957"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95457"
FT                   /db_xref="GOA:Q4KKP2"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKP2"
FT                   /protein_id="AAY95457.1"
FT                   /translation="MANTSLRKASLESMEAEISSLLKSLESLKDDASDESRKTLKALKS
FT                   NAESALKHSRSLLSDAYEEVKVKTRETGIATRDYAQEHPWTTAGVAVGAIGLLAAYLLC
FT                   KRGD"
FT   gene            41056..41271
FT                   /locus_tag="PFL_0040"
FT   CDS_pept        41056..41271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07311"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95458"
FT                   /db_xref="GOA:Q4KKP1"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKP1"
FT                   /protein_id="AAY95458.1"
FT                   /translation="MTDHHTYKKVELVGSSPNSIEDAINNALAEAHKSIKHLEWFEVTE
FT                   TRGHIKDGKAAHFQVTLKVGFRIANS"
FT   gene            41406..41630
FT                   /locus_tag="PFL_0041"
FT   CDS_pept        41406..41630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06649"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95459"
FT                   /db_xref="GOA:Q4KKP0"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKP0"
FT                   /protein_id="AAY95459.1"
FT                   /translation="MKKLVLAAALLSLAGTALAAGKPCEELKSEIAAKIDANGATHYSL
FT                   EVVDKGAAADGKVVGSCEAGTKEIVYKRG"
FT   gene            complement(41691..42692)
FT                   /locus_tag="PFL_0042"
FT   CDS_pept        complement(41691..42692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0042"
FT                   /product="luciferase family oxidoreductase, group 1"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00296;
FT                   match to protein family HMM TIGR03558"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95460"
FT                   /db_xref="GOA:Q4KKN9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN9"
FT                   /protein_id="AAY95460.1"
FT                   /translation="MKPLSAVKYSTLDLVPVRENGSPGQSLRNSLDLAQHVEKLGYTRF
FT                   WVAEHHNMDGIASSATSVLIGYLAGGTSTIRVGSGGVMLPNHAPLVIAEQFGTLESLYP
FT                   GRIDLGLGRAPGSDQMTARALRRERSGSADDFPEDVAELMAYLGPRTPEQRVIAMPGTG
FT                   TNVPVWLLGSSLFSAQLAGERGLPYAFASHFAPRYMHEAIRVYRNHFKPSAVLDKPYVM
FT                   LGVPLVAADTDEQADYLATSVYQRILALMRGQSLVQRKPVQSMDGLWLPHEKEAVASFL
FT                   GLAMVGSPAKIRAKLQVLIEQTGADELIFTCDLYEHADRLHSYELLSQVMKG"
FT   gene            42933..43364
FT                   /gene="osmC"
FT                   /locus_tag="PFL_0043"
FT   CDS_pept        42933..43364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PFL_0043"
FT                   /product="peroxiredoxin OsmC"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by similarity to SP:P0C0L2; match to
FT                   protein family HMM PF02566; match to protein family HMM
FT                   TIGR03562"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95461"
FT                   /db_xref="GOA:Q4KKN8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN8"
FT                   /protein_id="AAY95461.1"
FT                   /translation="MSIKKKASAHWEGDLKTGIGSISTETGVLREAPYGFKARFEGGKG
FT                   TNPEELIGAAHAGCFSMAFSMILGEAGLKADSIDTQAEVTLDQVDGGFAITAVHLILKA
FT                   KIPGASQQQFDELSKKAKEGCPVSKVLNAKISLDATLLS"
FT   gene            43521..43754
FT                   /locus_tag="PFL_0044"
FT   CDS_pept        43521..43754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06649"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95462"
FT                   /db_xref="GOA:Q4KKN7"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN7"
FT                   /protein_id="AAY95462.1"
FT                   /translation="MKRFALAVVSCALATSALAAPKPCEELKAEIEAKIQAQGVPSYTL
FT                   EIVTNDEVHDNNMVVGSCENGTRKIIYQKNDR"
FT   gene            complement(43761..44180)
FT                   /locus_tag="PFL_0045"
FT   CDS_pept        complement(43761..44180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0045"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95463"
FT                   /db_xref="GOA:Q4KKN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN6"
FT                   /protein_id="AAY95463.1"
FT                   /translation="MRPFLLFLALGTLSACTTPLPGVDPQQAWIDLATPTPGGKLVMAE
FT                   RLDNQRLDDGRFFQVSPGSHELMVRFDFEVFAGGMGMNNDPQERLCYLSLRYDHFQAGQ
FT                   RYRLEARNLGFTPSARLYNAQREIVAEERMINCVP"
FT   gene            complement(44223..44636)
FT                   /locus_tag="PFL_0046"
FT   CDS_pept        complement(44223..44636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0046"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95464"
FT                   /db_xref="GOA:Q4KKN5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN5"
FT                   /protein_id="AAY95464.1"
FT                   /translation="MRVLLLTTGLLTLGGCAGLPDPDPAQAWVDLAPPRDTHLQALEVD
FT                   AKNIDDPRYFQVQPGSHELTLRYQFAVQPSNIGPDAEPLWRDCQLNVKFKDFGAGQRYQ
FT                   VQAGNIGFHPWARLYDEQHTLLDKARPAGCQRS"
FT   gene            44696..45805
FT                   /locus_tag="PFL_0047"
FT   CDS_pept        44696..45805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95465"
FT                   /db_xref="GOA:Q4KKN4"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN4"
FT                   /protein_id="AAY95465.1"
FT                   /translation="MTRPCSSHGLLDPLLRFLFPALMLLLLNGCSSVGYYSQLASGQLQ
FT                   LLRARVPVAQVVADPSRDASLRAHLAQSQQARRFASEHLHLPDNRSYRLYVDIGRPYVV
FT                   WNVFATPEFSLNPQTHCFPIAGCVAYRGYYSQGAARGEAALQQLKGMDVAIGGVEAYST
FT                   LGWFDDPIISSMMHWGDERLATLIFHELAHQRFYVKDDTEFNESYATFVEQEGTRQWRA
FT                   YRGLAPLSDGELRQRDQFTQLVLDTRKRLEQLYALPLPAEQMRQRKAAEFERMRSEYRQ
FT                   LRDSQWAGSKRYDAWINTPLNNARLLPFGLYDQWVPAFAALFRQVKGDWPAFFAAVETL
FT                   GRLPAEERKAALIRLQDTVALAPAPASGL"
FT   gene            complement(45834..46484)
FT                   /locus_tag="PFL_0048"
FT   CDS_pept        complement(45834..46484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0048"
FT                   /product="HAD hydrolase, family IA, variant 1"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95466"
FT                   /db_xref="GOA:Q4KKN3"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN3"
FT                   /protein_id="AAY95466.1"
FT                   /translation="MHYQTVLFDLDGTLTDPREGITRSIQFALGKLGIDEPDLSKLEHF
FT                   IGPPLLQAFMQFYGFDEARAWEAVNFYRERFKVTGLYENRVFDGVTPLLETLGGQGRQL
FT                   YIATSKPWVFAREIARHFDFAKHFKVIYGSELDGTRTDKVELIAHLLEQEQLDPASTLM
FT                   IGDRKHDLIGARRNGLDAAAVGYGFGSHEELTAEAPAYHFQTLGELHQAFLPR"
FT   gene            complement(46513..47058)
FT                   /locus_tag="PFL_0049"
FT   CDS_pept        complement(46513..47058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95467"
FT                   /db_xref="GOA:Q4KKN2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN2"
FT                   /protein_id="AAY95467.1"
FT                   /translation="MAIRSYQNHTPNLGERAFVDHSAVVIGDVEIGADSSVWPLTVIRG
FT                   DMHRIRIGARTSVQDASVLHITHAGPFNPDGFPLLIGDDVTIAHKVMLHGCSIGNRVLI
FT                   GMGSIVMDGAVVEDDVIVGAGSLVPPGKRLESGFLYVGSPVKQARPLTDKERAFFTYSA
FT                   ANYVKLKDLHLAEGYDRP"
FT   gene            47161..49212
FT                   /gene="prlC"
FT                   /locus_tag="PFL_0050"
FT   CDS_pept        47161..49212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PFL_0050"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.15.5"
FT                   /note="identified by similarity to SP:P27298; match to
FT                   protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95468"
FT                   /db_xref="GOA:Q4KKN1"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN1"
FT                   /protein_id="AAY95468.2"
FT                   /translation="MSVNNPLLQPYDLPPFSAIRAEHVQPAIEQILADNRAAIADILKT
FT                   QATQPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYEACLPALSAYSTEMG
FT                   QNRELFQAFDALAKSPEAAGFDVAQKTILEHSLRDFRLSGIDLPPEQQKRYAEVQSKLS
FT                   ELGSRFSNQLLDATQAWTKHITDEAALAGLTDSAKAQMAAAAQAKDLEGWLITLEFPSY
FT                   YAVMTYAQDRALREEVYAAYSTRASDQGPNAGQNDNGPVMEEILDLRQELAKLLGFASF
FT                   SELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLEQLKAYAAEQGCPDLQSWDSGFYG
FT                   EKLREQRYSVSQEALRAYFPIDKVLSGLFAIVQRLYGIEIAEQKGFDTWHPDVRLFEIK
FT                   ENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTLDGVLQSPVANLVCNFTPAVSGKPA
FT                   LLTHDEVTTLFHEFGHGLHHLLTRVEHAGVSGINGVAWDAVELPSQFMENWCWEPEGLA
FT                   LISGHYESGEPLPQDLLQKMLAAKNFQSGLMMVRQLEFSLFDFELHATHGDGRSVLQVL
FT                   ETVRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGVLNS
FT                   ATGRAFREAILARGGSQEPMVLFVDFRGRAPSIDALLRHSGLSEDAAA"
FT   gene            49209..49487
FT                   /locus_tag="PFL_0051"
FT   CDS_pept        49209..49487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09526;
FT                   match to protein family HMM TIGR02443"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95469"
FT                   /db_xref="GOA:Q4KKN0"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKN0"
FT                   /protein_id="AAY95469.1"
FT                   /translation="MSDAPVKTKKRFIAGAVCPACSEQDKLMMWSEDDVPHRECVACGY
FT                   SDTLNEQGLSVPKELGTRVNSATPKVADIKVQSVQFFPNPKLKKKTD"
FT   gene            complement(49607..50266)
FT                   /locus_tag="PFL_0052"
FT   CDS_pept        complement(49607..50266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0052"
FT                   /product="dual specificity phosphatase, catalytic domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00782;
FT                   match to protein family HMM PF03162"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95470"
FT                   /db_xref="GOA:Q4KKM9"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKM9"
FT                   /protein_id="AAY95470.2"
FT                   /translation="MSSIRFIPALCLSLLALLAGPQVQAAEAPSRRPDQWAQPVEKQYN
FT                   LYQMSPTLYRSALPDKGAVPLLQQLKVATVINFLPESDASWLSAPGINQVQLPYRTNHV
FT                   DDADVLKALRAIQSAEAQGPVLMHCKHGSDRTGLMSAMYRVVIQGWSKEEALNEMTQGG
FT                   YGDSSHFKDGIRYMMQADVDKLRTALANGDCSTSVFATCSVKSWFETVSATKPLSN"
FT   gene            50560..51315
FT                   /locus_tag="PFL_0053"
FT   CDS_pept        50560..51315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0053"
FT                   /product="gluconate 2-dehydrogenase subunit 3"
FT                   /EC_number="1.1.99.3"
FT                   /note="identified by similarity to SP:O34213"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95471"
FT                   /db_xref="GOA:Q4KKM8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKM8"
FT                   /protein_id="AAY95471.1"
FT                   /translation="MSDQDRDNPRREFLRKSLTLIPVVTVASTGLGGSLLAAASETAIA
FT                   ATPATPGKQPAGSGQGYEPGYFTAEEWAFIKAAVERLIPADEMGPGALEAGVPEYIDRQ
FT                   MNTPYAAGALWYMQGPFKADAAPEMGWQSKLVPKDIYRLGIAATDAWCKELKGQTFAAQ
FT                   DSATRDDLLKQLEAGTPQFDAVPAKLFFNLLLQNTKEGFFSDPIHGGNKGLVGWTLIGF
FT                   PGARADFMDWVERNEQYPFPAVSIRGERA"
FT   gene            51318..53102
FT                   /locus_tag="PFL_0054"
FT   CDS_pept        51318..53102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0054"
FT                   /product="gluconate 2-dehydrogenase flavoprotein"
FT                   /EC_number="1.1.99.3"
FT                   /note="identified by similarity to GB:AAC45885.1; match to
FT                   protein family HMM PF00732"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95472"
FT                   /db_xref="GOA:Q4KKM7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKM7"
FT                   /protein_id="AAY95472.1"
FT                   /translation="MATVMKKVDAVIVGFGWTGAIMAKELTEAGLNVLALERGPMQDTY
FT                   PDGNYPQVIDELTYSVRKKLFQDISKETVTIRHSVNDVALPNRQLGAFLPGNGVGGAGL
FT                   HWSGVHFRVDPIELRMRSHYEERYGKNFIPKDMTIQDFGVSYEELEPFFDYAEKVFGTS
FT                   GQAWTVRGQLVGDGKGGNPYAPDRSDHFPLESQKNTYSAQLFQKAANDVGYKPYNLPSA
FT                   NTSGPYTNPYGAQMGPCNFCGFCSGYVCYMYSKASPNVNILPALKPLPNFELRPNSHVL
FT                   RVNLDSSKTRATGVTYVDGQGREIEQPADLVILGAFQFHNVRLMLLSGIGKPYDPITGE
FT                   GVVGKNFAYQNMATIKAYFDKDVHTNNFIGAGGNGVAVDDFNADNFDHGPHGFVGGSPM
FT                   WVNQAGSRPIAGTSNPPGTPAWGSAWKKATADYYTHQVSMDAHGAHQSYRGNYLDLDPV
FT                   YRDAYGLPLLRMTFDWQENDIKMNRFMVEKMGKIAEAMNPKAIALLGKKVGEHFNTASY
FT                   QTTHLNGGAIMGTDPKTSALNRYLQSWDVHNVFVPGASAFPQGLGYNPTGLVAALTYWS
FT                   ARAIREQYLKNPGPLVQA"
FT   gene            53115..54419
FT                   /locus_tag="PFL_0055"
FT   CDS_pept        53115..54419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0055"
FT                   /product="gluconate 2-dehydrogenase cytochrome c subunit"
FT                   /EC_number="1.1.99.3"
FT                   /note="identified by similarity to SP:O34215; match to
FT                   protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95473"
FT                   /db_xref="GOA:Q4KKM6"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKM6"
FT                   /protein_id="AAY95473.1"
FT                   /translation="MKALVIATLALLGSAAANAAEADQQALVQQGEYLARAGDCVACHT
FT                   AKDGKPFAGGLPMETPIGVIYSTNITPDKTGIGDYSFEDFDKAVRHGVAKGGSTLYPAM
FT                   PFPSYARVSDADMQALYAYFMKGVAPVARDNQDSDIPWPLSMRWPLSIWRWMFAPSVET
FT                   PAPAAGSDPVISRGAYLVEGLGHCGACHTPRALTMQEKALSASGGSDFLSGSAPLEGWI
FT                   AKSLRGDHKDGLGSWSEEQLVQFLKTGRSDRSAVFGGMSDVVVHSMQYMTDADLTAIAR
FT                   YLKSLPANDPKDQPHQYDKQVAQALWNGDDSKPGAAVYIDNCAACHRTDGHGYTRVFPA
FT                   LAGNPVLQSADATSLIHIVLKGGTLPATHSAPSTFTMPAFAWRLSDQEVADVVNFIRSS
FT                   WGNQASAVKPGDVAALRNGDLQSTSNDDLGQVTSH"
FT   gene            55021..56079
FT                   /locus_tag="PFL_0057"
FT   CDS_pept        55021..56079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0057"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95475"
FT                   /db_xref="GOA:Q4KKM4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKM4"
FT                   /protein_id="AAY95475.1"
FT                   /translation="MFNPLPPRGRGTASNPHNRFAPNRSVAEDDGWYQEVPLTQGTEVR
FT                   FETAKSIITRNSSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGLDFETKLIAK
FT                   SNTAALLEQQLSKPGYRCAPINLGSNTDPYQPIEREQQLTRRTLEVLLRYRHPVTIVTK
FT                   GSLILRDLDLLSELARQRLVAVMISLTTLDDELKRILEPRAAAPKARLRAIRVMRGAGI
FT                   PVGVLCSPMIPMINDSELESLLSEAHAAGAQSAAYMMLRLPLEVAPLFEEWLAAHYPQR
FT                   AAHVLSLIRQSRGGELYDSRFGARMRGEGPFADLLAQRFAKALKRLGLNRREGFDLDCS
FT                   AFCPPGGQMSLL"
FT   gene            56323..57057
FT                   /gene="cah"
FT                   /locus_tag="PFL_0058"
FT   CDS_pept        56323..57057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="PFL_0058"
FT                   /product="carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95476"
FT                   /db_xref="GOA:Q4KKM3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKM3"
FT                   /protein_id="AAY95476.2"
FT                   /translation="MSDKDKQPLAASAPAPTEVAETADAALQHIVDGFLHFHHEVFPQQ
FT                   EELFKKLATAQRPRAMFIACADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVS
FT                   TAIEYAVLALGVHHIIVCGHSDCGAMRAVLNPQSLEKMPTVKAWLRHAEVARTMVHENC
FT                   DCADESSSMHVLTEENVIAQLQHLRTHPSVASRMANGQLFIHGWVYDIETSSIKAYDAD
FT                   KGCFLPLDGSHPIPVATPKARF"
FT   gene            57149..58684
FT                   /locus_tag="PFL_0059"
FT   CDS_pept        57149..58684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0059"
FT                   /product="inorganic anion transporter, SulP family"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95477"
FT                   /db_xref="GOA:Q4KKM2"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKM2"
FT                   /protein_id="AAY95477.1"
FT                   /translation="MRAAQLKSVLPRELLASVVVFLVALPLCMGIAIASGLPPAKGLIT
FT                   GIIGGLVVGWLAGSPLQVSGPAAGLAVLVFELVRQHGVAMLGPILLLAGLLQLLAGRLR
FT                   LGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMLDAAPQASGLDNLVGFPQALAQALPSL
FT                   GWQAGLLGLATIAVMWGWDKWRPQALRFIPGALLGVGLATLASLLLALPVKRVEVPANL
FT                   AEAIDWLRPADLLNLADPNLLIAAFAVAFIASAETLLSAAAVDRMHSGQRSDFDRELSA
FT                   QGVGNMLCGLLGALPMTGVIVRSSANVQAGAQTRYSTIFHGLWLLGFVLVLSSVLQSIP
FT                   VASLAGVLVYTGFKLVDLKVFRGLGRYGRMPMLTYAVTALAIVFSDLLTGVLIGFALTL
FT                   AKLAFKASRLKISLIDLAEEGEMELRLVGAATFLKVPALTRVLATIPPATTVHVPLSNL
FT                   SYIDHACLELLEDWNRANSAKGSRLVIETRGLKRRLEGRLTTTSGVGAAAARG"
FT   gene            58930..59466
FT                   /locus_tag="PFL_0060"
FT   CDS_pept        58930..59466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAY96265"
FT                   /db_xref="GOA:Q4KKM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKM1"
FT                   /protein_id="AAY96265.1"
FT                   /translation="MVHRFVQLVGEGFADQLVGDEVGDSHVQGDQRTAEMLDVQVVDLF
FT                   HQTVGQIGFIQQAVEADVAIHDGRRLEEELLGDLQHRLDLRLDAGFPGYRVGGVQKVWN
FT                   LVDIGADKTGHDALGVDFGQLDGGVQVRQLALQLTGQEAGTGFVLLGQFDLLAQCGGVH
FT                   ENSREQGQLNRENIS"
FT   gene            59792..60919
FT                   /gene="ctaC"
FT                   /locus_tag="PFL_0061"
FT   CDS_pept        59792..60919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaC"
FT                   /locus_tag="PFL_0061"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by similarity to SP:P08306; match to
FT                   protein family HMM PF00034; match to protein family HMM
FT                   PF00116; match to protein family HMM PF02790; match to
FT                   protein family HMM TIGR02866"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95478"
FT                   /db_xref="GOA:Q4KKM0"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKM0"
FT                   /protein_id="AAY95478.1"
FT                   /translation="MMRHPHVWMGLLLWSVFSQAQAAWTVNMTPGATEISHAVFDLHMT
FT                   IFWICVVIGVIVFGAMFWSMIVHRRSVGQVPAKFHESTTVEILWTIIPFLILVAMAVPA
FT                   TATLIKMYDTSEPDVDIQITGYQWKWHYKYLGQDVEFFSNLATPADQIHNQSTKGEHYL
FT                   LEVDQPLVLPVGAKVRFLVTAADVIHSWWVPAFAVKRDAIPGFVNEAWTRVDKPGIYRG
FT                   QCAELCGKDHGFMPIVVEVKSQADYDTWMGERKAEAAKLKELTSKEWTLDELVARGDKI
FT                   YHTTCVACHQAEGQGLPPMFPALKGSKIATGPKEAHLSLVFHGKPGTAMAAFGKQLSEV
FT                   DIAAVVTYERNAWGNNKGDMVTPKEVLALKQAESK"
FT   gene            61002..62597
FT                   /gene="ctaD"
FT                   /locus_tag="PFL_0062"
FT   CDS_pept        61002..62597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="PFL_0062"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by similarity to SP:P31833; match to
FT                   protein family HMM PF00115; match to protein family HMM
FT                   TIGR02891"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95479"
FT                   /db_xref="GOA:Q4KKL9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKL9"
FT                   /protein_id="AAY95479.1"
FT                   /translation="MSAVIDDHGHAGHDDHAHGPAKGLMRWVLTTNHKDIGTLYLWFSF
FT                   CMFLLGGSFAMVIRAELFQPGLQIVEPAFFNQMTTMHGLVMVFGAVMPAFVGLANWMIP
FT                   LMIGAPDMALPRMNNFSFWLLPAAFLLLISTLFMPGGGPNFGWTFYAPLSTTYAPESVT
FT                   FFIFAIHLMGVSSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLA
FT                   GVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIPTFS
FT                   RKPLFGYTSMVYATGAIAFLSFIVWAHHMFVVGIPLVGELFFMYATLLIAVPTGVKVFN
FT                   WVSTMWQGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYQDTYFVVAHFHYVL
FT                   VPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFVGMNMAFFPMHFVGLAGMPRRI
FT                   PDYNLQFADFNMVSSIGAFTFGATQIFFLFIVIKCIRGGKAAPAKPWEGAEGLEWSIPS
FT                   PAPYHTFVTPPEVK"
FT   gene            62697..63254
FT                   /gene="ctaG"
FT                   /locus_tag="PFL_0063"
FT   CDS_pept        62697..63254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaG"
FT                   /locus_tag="PFL_0063"
FT                   /product="putative cytochrome c oxidase assembly protein"
FT                   /note="identified by similarity to SP:P56940; match to
FT                   protein family HMM PF04442"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95480"
FT                   /db_xref="GOA:Q4KKL8"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKL8"
FT                   /protein_id="AAY95480.1"
FT                   /translation="MAEVTLKKLVTRLLLVVVAMFVFGFALVPIYDVMCKALGINGKTG
FT                   GQYADQGQQVDVSRQVRVQFLSTNAIDMVWDFYPKSDDIVVHPGAVNEMIFIARNPSDH
FT                   PMSAQAIPSISPSSAAMYFHKTECFCFTQQVLQPGEKIEMPVRFIVDRDMPKDVKHLTL
FT                   AYTLFDITARHPPVAVAAKNGG"
FT   gene            63288..64175
FT                   /gene="ctaE"
FT                   /locus_tag="PFL_0064"
FT   CDS_pept        63288..64175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="PFL_0064"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by similarity to SP:P06030; match to
FT                   protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95481"
FT                   /db_xref="GOA:Q4KKL7"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKL7"
FT                   /protein_id="AAY95481.1"
FT                   /translation="MATHEHYYVPAQSKWPIIATVGMFVTVVGLGTWFNDLKAARPESH
FT                   GPLIFFVGGLLLAYMLFGWFGAVVKESRAGLYSAQLDRSFRWGMSWFIFSEVMFFMAFF
FT                   GALFYVRHMSGPWLGGEGHKGIAHMLWPNFEFVWPLLNNPDPKLFPSPKGTISPWGLPL
FT                   LNTILLVSSSVTVTIAHHALKKGHRGALKIWLALTVLLGCAFLGFQAEEYIHAYHELGL
FT                   TLGSGIYGATFFMLTGFHGAHVTIGTLILFVMLMRIMRGHFDAEHQFGFEAASWYWHFV
FT                   DVVWIGLFVFVYVL"
FT   gene            complement(64182..64385)
FT                   /locus_tag="PFL_0065"
FT   CDS_pept        complement(64182..64385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95482"
FT                   /db_xref="GOA:Q4KKL6"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKL6"
FT                   /protein_id="AAY95482.2"
FT                   /translation="MLKAAIVLMLIATVVSLFSGLFFLVKDDSSSKRLVTSLSIRVALA
FT                   VVTVGLIAWGFFSGQLVSHAPW"
FT   gene            64456..65196
FT                   /locus_tag="PFL_0066"
FT   CDS_pept        64456..65196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95483"
FT                   /db_xref="GOA:Q4KKL5"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKL5"
FT                   /protein_id="AAY95483.2"
FT                   /translation="MKGFRPGIGPTLVVLLLLPVLVALGFWQLGRGEQKRQLLASYAER
FT                   RAAEPVALFELLASEDPAFRRVRLHGHFDADHSLLLDNRLHDGKVGVELLQPFLDQASG
FT                   RWLLVNRGWLPWPDRRTPPVFSTPQQSLSLDAWVYVSPGAAFQLHADPSGASWPRLITA
FT                   VGPQALWAELGRSGFDHEVRLESGPGAYLTEWPVVAMGPEKHQAYAVQWFAMALALFAL
FT                   YLYFGWHNTREKRHGNGHESTQHL"
FT   gene            65252..65752
FT                   /locus_tag="PFL_0067"
FT   CDS_pept        65252..65752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95484"
FT                   /db_xref="GOA:Q4KKL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKL4"
FT                   /protein_id="AAY95484.1"
FT                   /translation="MVIGPMILATGMYKLQFWVPESRSYHGELIGNGQTRAQIGVQAEE
FT                   DRWQVLVTAPGECAVDCQQLVYLARQIQIALGRDASRASHALASARPLSAEYEAKLQRE
FT                   YPQLQRYPLDLATFTKGANDKEAPQLWIVDPHSNLVLRYDARVKGKDLLNDLRHLLKLS
FT                   NIG"
FT   gene            65763..66842
FT                   /locus_tag="PFL_0068"
FT   CDS_pept        65763..66842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0068"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /note="identified by match to protein family HMM PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95485"
FT                   /db_xref="GOA:Q4KKL3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKL3"
FT                   /protein_id="AAY95485.1"
FT                   /translation="MAKPGFRLALFATLLALIVVLLGAYTRLTHAGLGCPDWPGCYGFI
FT                   SVPKGEAQLAHAELHFPDTPVEAHKGWNEMIHRYFAGTLGLLIVLLAARAWTHRRHPGQ
FT                   PLKLPLFLLAVVFAQAAFGMWTVTLKLWPQVVTAHLLGGFATLSLLFLLTLRLSGVLPA
FT                   LIVPRRLQYWATAGLVLVIGQIALGGWVSSNYAAVACIDLPTCHGQWWPNMDFANGFHL
FT                   TQHIGPNYLGGQLDSDARTAIHMTHRVGAVLVTLVLLGLAWQLRQTGMTRLAGLVLVAL
FT                   GAQVSLGLSNVFFHLPLPVAVAHNAGGAALLLTLVLVNYHARTSLVRARDRLPLGWRLS
FT                   PRKQMAGPITIKGEMPWRL"
FT   gene            66830..67732
FT                   /gene="cyoE_2"
FT                   /locus_tag="PFL_0069"
FT   CDS_pept        66830..67732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE_2"
FT                   /locus_tag="PFL_0069"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95486"
FT                   /db_xref="GOA:Q4KKL2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKL2"
FT                   /protein_id="AAY95486.1"
FT                   /translation="MATLISERQHPQAIWRDYLELTKPKVVVLMLITSLVGMFLATRAG
FT                   VPWTVLVFGNLGIALCAGGAAAVNHVVDRRIDALMARTHKRPLAEGRVSPRAALAFALL
FT                   LALAGQALLLTFTNPLTAWLTLASLLGYAVVYTGFLKRATPQNIVIGGLAGAAPPLLGW
FT                   VAATGHMSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGEHYTKVHIL
FT                   LYTFALLAVSLLPYVIHMSGVLYLVCALALGGRFLQWAWVLYRGTRPHAAINTFKYSIY
FT                   YLFLLFIALLVDHYLLLNL"
FT   gene            67729..68364
FT                   /locus_tag="PFL_0070"
FT   CDS_pept        67729..68364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0070"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95487"
FT                   /db_xref="GOA:Q4KKL1"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKL1"
FT                   /protein_id="AAY95487.1"
FT                   /translation="MTRTQKTVFILVALVALVLGLTVNKVLSGKGQGDPTALIDAGIIL
FT                   LPQNRTLPAVKMVDQDGQPVVIDELKGKWSLLFFGYTFCPDICPTTLAQLRQIKSELPK
FT                   DAVDKLQVVLVSVDPNRDTPQQLKQYLGYFDKDFKGLTASSVEDLQKLANAVSIPFIPA
FT                   DTSKPNYTVDHSGNLAVIGPDGTQRGFIRAPLNNQKLVAQLPVMLQRK"
FT   gene            complement(68548..69321)
FT                   /gene="metQ2"
FT                   /locus_tag="PFL_0071"
FT   CDS_pept        complement(68548..69321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ2"
FT                   /locus_tag="PFL_0071"
FT                   /product="D-methionine ABC transporter, periplasmic
FT                   methionine-binding lipoprotein MetQ"
FT                   /note="Protein identified by sequence similarity to MetQ in
FT                   E. coli. (Swiss-Prot: P28635); identified by match to
FT                   protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95489"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKL0"
FT                   /protein_id="AAY95489.1"
FT                   /translation="MKKLLVAFAAVAAFSAHAAETLTVAATPVPHAEILEFVKPALAKE
FT                   GVDLKVKVFTDYVQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTKLVNVAGVHVEPLGA
FT                   YSSKYKQLSELPGGATVVIPNDATNGGRALLLLDKAGLIKLKDSNNILATIKDITENPK
FT                   DLKFRELEAATIPRVLTQVDLALINTNYALEAKLDPSKDALVIEGKDSPYVNILVARPD
FT                   DKDSDAMNKLVAALHSPEVKQFILEKYKGAIVPAF"
FT   gene            complement(69381..70046)
FT                   /gene="metI2"
FT                   /locus_tag="PFL_0072"
FT   CDS_pept        complement(69381..70046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI2"
FT                   /locus_tag="PFL_0072"
FT                   /product="D-methionine ABC transporter, permease protein
FT                   MetI"
FT                   /note="identified by similarity to SP:P31547; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95488"
FT                   /db_xref="GOA:Q4KKK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKK9"
FT                   /protein_id="AAY95488.1"
FT                   /translation="MDTFFANIDWLEIWLATGDTLMMLGGSLLFTVLLGLPLGVLLFLC
FT                   SPRQLLEQKSLYALLSLVVNILRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPLVVGA
FT                   TPFFARLVETALREVDRGIIEATQSMGASTRQIITNALLPEARPGIFAAITVTAITLVS
FT                   YTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVLLLVLVQVLQTVGDKLVVHFSRK"
FT   gene            complement(70046..71053)
FT                   /gene="metN2"
FT                   /locus_tag="PFL_0073"
FT   CDS_pept        complement(70046..71053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN2"
FT                   /locus_tag="PFL_0073"
FT                   /product="D-methionine ABC transporter, ATP-binding protein
FT                   MetN"
FT                   /EC_number="3.6.3.-"
FT                   /note="Identified by sequence similarity to
FT                   Swiss-Prot:P30750 (MetN in E. coli); identified by match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95490"
FT                   /db_xref="GOA:Q4KKK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKK8"
FT                   /protein_id="AAY95490.1"
FT                   /translation="MIEFQNVHKTYRVAGKDIPALHPTSLRVENGQVFGLIGHSGAGKS
FT                   TLLRLINRLENPSGGTIVVDDEDVTALDASGLRRFRQQVGMIFQHFNLLSSKTVADNVA
FT                   LPLTLAGELSRSDIDRRVAELLDRVGLADHAKKYPAQLSGGQKQRVGIARALATKPKIL
FT                   LCDEATSALDPQTTASVLQLLAEINRELNLTIVLITHEMDVIRRVCDQVAVMDAGVIVE
FT                   QGPVADVFLHPKHPTTRRFVQEDEQIDENEQRDDFAHVPGRIVRLTFQGDSTYAPLLGT
FT                   VARETGVDYSILAGRIDRIKDTPYGQLTLAITGGDMEAAFARFTAADVHMEVLR"
FT   gene            71323..73461
FT                   /gene="katE"
FT                   /locus_tag="PFL_0074"
FT   CDS_pept        71323..73461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katE"
FT                   /locus_tag="PFL_0074"
FT                   /product="catalase HPII"
FT                   /EC_number="1.11.1.6"
FT                   /note="identified by similarity to SP:P21179; match to
FT                   protein family HMM PF00199; match to protein family HMM
FT                   PF06628"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95491"
FT                   /db_xref="GOA:Q4KKK7"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKK7"
FT                   /protein_id="AAY95491.1"
FT                   /translation="MSTKKPDTPKSQMAGTDTLDRGNSNSKLKSLETFRSDATGQALRT
FT                   NQGVKIADNQNTLKAGARGPSLLEDFIMREKITHFDHERIPERIVHARGVGAHGYFQSY
FT                   DNHSALTKAGFLRDPGKKTPVFVRFSTVQGPRGSGDTVRDVRGFAVKFFTDEGNFDLVG
FT                   NNMPVFFIQDAIKFPDFVHAVKPEPHNEIPTGGSAHDTFWDFVSLQPESAHMVIWAMSD
FT                   RAIPKSLRAMQGFGVHTFRLINAQGRSSFVKFHWRPTVGTCSLVWDEAQKLAGKDTDFH
FT                   RRDLWESIEAGDYPEWEFGVQIIAEEDEHNFDFDILDPTKLIPEELVPITPLGKMVLNR
FT                   NPDNYFAETEQVAFCPGHIVPGIDFSNDPLLQGRLFSYTDTQISRLGGPNFHELPINRP
FT                   LAPFHNSQRDAMHRITLDKGRASYEPNSIDGGWPRETPPAAEDGGFESYNERIDAHKIR
FT                   QRSESFSDHFSQARLFYKSMSKHEQEHIIAAYSFELGKVEREWIRERQVNEILANIDLQ
FT                   LAARVAENLGLAAPKKATVAERKTSLSRSPALSQANLLPGNIKTRKVAILAANGVDGAA
FT                   IDALKKALKAEGAHAKLLGPTSAPVTTADGKSLPVDASMEGLPSVAFDAVFVPGGAQSI
FT                   KALSGNGVALHYLLEAYKHLKAIALHGDARELLHSLRLEADEGLIVGADAKALKAFIAA
FT                   IAQHRVWSREEKAKAIPA"
FT   gene            complement(73518..74237)
FT                   /locus_tag="PFL_0075"
FT   CDS_pept        complement(73518..74237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0075"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95492"
FT                   /db_xref="GOA:Q4KKK6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKK6"
FT                   /protein_id="AAY95492.1"
FT                   /translation="MKPFASRYLLLVAFSLLLGACQSTPPAATEVPDARATAIAQLEQN
FT                   IASSELATAEDQLSALQAQTPDDPQLVQYQRQLAEAYLQRSQIVLQKGDVNAAATALSR
FT                   ARALMPKAPALTGGVNNAIAHARKAELDKAEAALKAAEARPAAKLIDPTAESTTVALNV
FT                   TDIRKLRHQLDALAADVVNYQCDVSIQIPRTEDYPWLSTLLGKRVKKLDPDFEQKISRQ
FT                   IVRHVPAQMVLTPRKAQ"
FT   gene            complement(74275..75063)
FT                   /gene="znuB"
FT                   /locus_tag="PFL_0076"
FT   CDS_pept        complement(74275..75063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="PFL_0076"
FT                   /product="high-affinity zinc ABC transporter, permease
FT                   protein ZnuB"
FT                   /note="identified by similarity to SP:P39832; match to
FT                   protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95493"
FT                   /db_xref="GOA:Q4KKK5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKK5"
FT                   /protein_id="AAY95493.1"
FT                   /translation="MADFLLYALLAGLALAVVAGPLGSFVVWRRMAYFGDTLSHAALLG
FT                   VALGFLLDVSPAVAVTVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFM
FT                   HEVRIDLMAYLFGDLLAISPGDLAWILGGSAAVLLLLVALWRPLLAITVHEELARVEGL
FT                   PVASLRLALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGM
FT                   LAVCGGLALSWFKDTPAGPSIVVTAATLFLLSFVLPRRGV"
FT   gene            complement(75056..75841)
FT                   /gene="znuC"
FT                   /locus_tag="PFL_0077"
FT   CDS_pept        complement(75056..75841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="PFL_0077"
FT                   /product="high-affinity zinc ABC transporter, ATP-binding
FT                   protein ZnuC"
FT                   /note="Identified by similarity to znuC from E. coli
FT                   (SP:P0A9X1); identified by match to protein family HMM
FT                   PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95494"
FT                   /db_xref="GOA:Q4KKK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKK4"
FT                   /protein_id="AAY95494.1"
FT                   /translation="MSNALIRLEQVGVTFAGQNVLENIQLSVEPGQIVTLIGPNGAGKT
FT                   TLVRAVLGLLKPDTGSVWRKPKLRVGYMPQKLHVDPTLPLSVLRFLRLVPGVDRTRALA
FT                   ALKEVGAEQVIDSPVQSISGGEMQRVLLARALLREPELLVLDEPVQGVDVAGQAELYSL
FT                   ITRLRDRHGCGVLMVSHDLHLVMSTTDQVVCLNRHVCCSGHPEQVSGDPAFVELFGKNA
FT                   PSLAIYHHHHDHAHDLHGSVVTQPASGHAHVHGENCKHG"
FT   gene            complement(75841..76323)
FT                   /gene="np20"
FT                   /locus_tag="PFL_0078"
FT   CDS_pept        complement(75841..76323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="np20"
FT                   /locus_tag="PFL_0078"
FT                   /product="transcriptional regulator np20"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95495"
FT                   /db_xref="GOA:Q4KKK3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKK3"
FT                   /protein_id="AAY95495.1"
FT                   /translation="MPKTPLASRPHDHSHCVHSALSEADALCARQGLRLTALRRRVLEL
FT                   VWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRIASLNAFVGCNHPE
FT                   HAHQGQFLICRECHAAIELEQKSISDAIISSARDVGFVVEGQTVEVVGLCSGCQGA"
FT   gene            76381..77310
FT                   /gene="znuA"
FT                   /locus_tag="PFL_0079"
FT   CDS_pept        76381..77310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="PFL_0079"
FT                   /product="high-affinity zinc ABC transporter, periplasmic
FT                   zinc-binding protein ZnuA"
FT                   /note="identified by similarity to SP:P39172; match to
FT                   protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95496"
FT                   /db_xref="GOA:Q4KKK2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKK2"
FT                   /protein_id="AAY95496.1"
FT                   /translation="MSIVPRLFRLFVAFTFSLFAIGSAQAEVRVLTSIKPLQLIAAAVL
FT                   DGVAVPEVLLPPGASPHNYALRPSDVRKVQSVDLLYWIGPDMEGFLPRVLKGRSLPSVA
FT                   VQDLPGMRLRHFAEDSHSHAEDADEHDHDHRPGTLDAHLWLSPINARVIATRMAADLSA
FT                   ADPANAARYQNNLKAFSERLDALDARLKARLAGIAGKPYFVFHEAFDYFEDAYGLKHAG
FT                   VFSVAAEVQPGAQHVAAMRARLQQVGKTCVFSEPPLRPRLAETLVAGLPVKLAELDALG
FT                   GYTPATAQGYEQVLEKLGNDLAGCLEQL"
FT   gene            complement(77402..78352)
FT                   /gene="thrB"
FT                   /locus_tag="PFL_0080"
FT   CDS_pept        complement(77402..78352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="PFL_0080"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="identified by similarity to SP:P29364; match to
FT                   protein family HMM PF01636; match to protein family HMM
FT                   TIGR00938"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95497"
FT                   /db_xref="GOA:Q4KKK1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKK1"
FT                   /protein_id="AAY95497.1"
FT                   /translation="MSVFTPLARPELETFLAPYGLGRLLDFQGIAAGSENTNFFISLEQ
FT                   GEFVLTLVERGPVQEMPFFIELLDVLHQANLPVPYALRTTDGVALRELAGKPALLQPRL
FT                   AGKHIKQANAQHCAQVGELLGHLHVATKDHMIKRKTDRGLDWMQEEGRQLLSHLAPTAQ
FT                   DLLQRALDEIAAQKVKILALPRANIHADLFRDNAMFEGTHLTGLIDFYNACSGPMLYDV
FT                   AIALNDWCSDDEGVLDGQRARALLGAYAALRPFTAAEAELWPTLLRVACVRFWLSRLIA
FT                   AESFAGQDVLIHDPMEFQQRLAQRQQVSIALPFAL"
FT   gene            complement(78418..78705)
FT                   /locus_tag="PFL_0081"
FT   CDS_pept        complement(78418..78705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95498"
FT                   /db_xref="GOA:Q4KKK0"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKK0"
FT                   /protein_id="AAY95498.1"
FT                   /translation="MRTLNRLLLTGLIAIAPLAAIAAEDAPSADPEVTIRTEGDKTIQE
FT                   YRQNGFLYAIKITPKGGKPYFLVRADGSDGNFIRSDQPDMLIPSWKIFEW"
FT   gene            78780..81569
FT                   /gene="polA"
FT                   /locus_tag="PFL_0082"
FT   CDS_pept        78780..81569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="PFL_0082"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P00582; match to
FT                   protein family HMM PF00476; match to protein family HMM
FT                   PF01367; match to protein family HMM PF01612; match to
FT                   protein family HMM PF02739; match to protein family HMM
FT                   TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95499"
FT                   /db_xref="GOA:Q4KKJ9"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKJ9"
FT                   /protein_id="AAY95499.1"
FT                   /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSKGLPTGAVKGVLNMLKS
FT                   LRKQYPDSPFAVVFDAKGGTFRDDMYAEYKANRPSMPDDMRVQIEPLHASVIALGFPLL
FT                   CVEGVEADDVIGTLARSSAAADRPVVISTGDKDMAQLVDGHITLVNTMSGSSMDVEGVK
FT                   EKFGVAPEQIIDYLALMGDSSDNIPGVPGIGPKTASGLLVGVNGGLKELYEQLDIVPTL
FT                   PIRGAKTLPAKLEEHKEMAFLSYQLATIKVDVPLDVGLDDLHLGEPDREKLVELYSLLE
FT                   FKSWLDELQRDAKRVELSGAEATPAAVPPQAVEQAPLELQYETILDQERFDAWLEKLKG
FT                   AKLIAFDTETTGIDAQQAQLVGLSFSVKAGEAAYVPLTHSYMGAPAQLDRDSVLLALKP
FT                   LLEDPKLLKVGQHAKFDMNILANCAIGGDQANGITVRGVAFDTMLESYVLNSTATRHDM
FT                   DSLAQKYLDHSTVSFQDIAGKGAKQLTFDQIPLEQAGPYAAEDADVTLRLHQVLFDKLS
FT                   AIPSLASVLTDIEMPLVPVLARIERQGALVDDKLLGVQSIELGDKMVALEREAFEIAGE
FT                   EFNLGSPKQLGSILYDKLGLPVLKKTAKGQPSTAEEVLAKLAEDDYPLPRVLMQYRSMS
FT                   KLKSTYTDRLPEQINPRTGRIHTSYHQAVASTGRLSSSDPNLQNIPVRTAEGRRIRQAF
FT                   IAPPGYKLLAADYSQIELRIMAHLSRDEGLLNAFRNNLDVHTATAAEVFKVELKDVTSD
FT                   QRRSAKAINFGLIYGMGAQKLGKDIGVDTKQAKAYIDTYFARYPGVREYMDRTRAQAAD
FT                   QGYVETIFGRRLYLPEINSNKPQERAGAERTAINAPMQGTAADIIKKAMVAVDNWLASS
FT                   GLDARVILQVHDELVLEVREDLVDQVREEIRGHMSGAATLDVPLLVEVGVGNNWDEAH"
FT   gene            complement(81985..82626)
FT                   /gene="ysxC"
FT                   /locus_tag="PFL_0083"
FT   CDS_pept        complement(81985..82626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ysxC"
FT                   /locus_tag="PFL_0083"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR03598"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95500"
FT                   /db_xref="GOA:Q4KKJ8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKJ8"
FT                   /protein_id="AAY95500.2"
FT                   /translation="MQLKNPILGLCQQATFMLSAAKVDQCPDDEGFEVAFAGRSNAGKS
FT                   SALNTLTHASLARTSKTPGRTQLLNFFKLDDDRRLVDLPGYGYAKVPIPLKQHWQRHLE
FT                   AYLGSRESLKGLILMMDIRHPMTDFDLLMLDWAVASGMPMHILLTKADKLTYGAAKNTL
FT                   LKVQSQIRKGWGEAVTIQLFSAPKRMGLEEAYTVLAGWMELADKGAEAEA"
FT   gene            83154..83759
FT                   /locus_tag="PFL_0084"
FT   CDS_pept        83154..83759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0084"
FT                   /product="cytochrome c4"
FT                   /note="identified by similarity to SP:Q52369; match to
FT                   protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95501"
FT                   /db_xref="GOA:Q4KKJ7"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKJ7"
FT                   /protein_id="AAY95501.1"
FT                   /translation="MNKLLVSLLLTLGITGVAHAAGDAAAGQAKAAVCGACHGPDGNSM
FT                   APNFPKLAGQGEKYLNKQLHDIKSGKRQVLEMTGLLTNLSDQDLADIAAYFASQKGSVG
FT                   AADPKVVARGEELFRGGKLDQGMPACTGCHSPNGAGNAAAGFPHLGGQHAQYVAKQLTD
FT                   FREGNRTNDGDTLVMRSIAGKLSNKDIEAVSSYIQGLH"
FT   gene            83957..84586
FT                   /gene="dsbA"
FT                   /locus_tag="PFL_0085"
FT   CDS_pept        83957..84586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="PFL_0085"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /note="identified by similarity to GB:AAO13005.2; match to
FT                   protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95502"
FT                   /db_xref="GOA:Q4KKJ6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKJ6"
FT                   /protein_id="AAY95502.1"
FT                   /translation="MRNLILSAALVTASLFGVTAQAAEPLEAGKQYVELSSAVPVAVPG
FT                   KIEVVELFWYGCPHCYAFEPTINPWAEKLPADVNFVRIPAMFGGIWNIHGQLFITLEAM
FT                   GVEHKVHKAVFEAIHGGKKLATPEEMAEFLAGEGVDKDKFLSTYNSFAVKGKVEDAKKK
FT                   AQAYQITGVPTMVVNGKYRFDLGTAGGPEGALSVADQLIAKERAAK"
FT   gene            84599..85477
FT                   /locus_tag="PFL_0086"
FT   CDS_pept        84599..85477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0086"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95503"
FT                   /db_xref="GOA:Q4KKJ5"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKJ5"
FT                   /protein_id="AAY95503.1"
FT                   /translation="MPRWSSERIVGLHDPQVNEHHLASSGLPADSRLRLLSFNIQVGIS
FT                   TERYRHYLTRGWQHLLPHHGRADNLQKIGNLLGDFDLVALQEADGGSLRSGYVNQVEHL
FT                   AQLGAFPYWYQQLNRNLGRLAQHSNGVLSRLRPWAIEDHPLPGPKGRGAILVRFGEGPE
FT                   ALVVVMMHLALGARTRTRQLAYIRELIGGYKHQVLMGDMNTHASDLLEHSPLRDLSLLA
FT                   PQLQATFPSWRPQRCLDHILLSPSLTLERVEVLAQPISDHLPVAVEIRLPGSLTADALP
FT                   ALSPAPRGTDE"
FT   gene            85474..87657
FT                   /locus_tag="PFL_0087"
FT   CDS_pept        85474..87657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0087"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95504"
FT                   /db_xref="GOA:Q4KKJ4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKJ4"
FT                   /protein_id="AAY95504.1"
FT                   /translation="MSDDANRWKEKYLKSIEQQEKLERRWAARLDLLRRGLVRSTLAAE
FT                   GTDRAVDQCMKEMREVVRTDDMDAGLAALLPRLEKAVLDSEQRRETRVEQMSSALTALV
FT                   SQLQSLPLPREVSRPLKAFAKQLDGRVGQAREIPLLLGELSSLQGKALSQLETPAEPDR
FT                   PSLLQRLFGSREASETPAPAEEAVATNPPLPAAAAEAHPQAEEAPAPEDGAREHYQTPT
FT                   QALPEAVSAPAAPAPAQPEVQLEPEPGAQPVASDEPEVAAVPAPAPVVAFVPPVLVQEA
FT                   PAEPVPAIEVEPQATISPVAEPQAPVDPGVVAASDSPPAPVAEAALNPDELVPLPTVSP
FT                   AVLLDSLPLPAVMAEALAAIDPEQSEHDVLYALPDSPEPSYSSVAKHIEHTLLGLLDDL
FT                   SLPERHRPQAEAMRDRLQHGLNWYELLPILDDLAVLMLAITDSGQHEFETYLKQLNERL
FT                   EAFQSNLQAASDGHADSSSAARAMDSQIREQVDGLQSSVQEAADLDDLKQVLESHLEGL
FT                   LGTMDHHQKQRDEREREVAARLQSLAERVSSMEQEAQGYREHLEEQRQKALIDPLTGLP
FT                   NRAAWSERLEHEVGQWQQHGNSLLLAMLDLDHFKRINDNYGHLAGDKVLKIIANVLRKR
FT                   LRGSDFIARFGGEEFVLLLPNTPWPVGVRIVEALRAAIEACPFHFKGEPVTITVSVGLS
FT                   AFKAGDRSDLVIKRADQALYRAKDAGRNRVEAG"
FT   gene            87759..88538
FT                   /gene="amiD"
FT                   /locus_tag="PFL_0088"
FT   CDS_pept        87759..88538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiD"
FT                   /locus_tag="PFL_0088"
FT                   /product="N-acetylmuramoyl-L-alanine amidase AmiD"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by similarity to SP:P75820; match to
FT                   protein family HMM PF01471; match to protein family HMM
FT                   PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95505"
FT                   /db_xref="GOA:Q4KKJ3"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKJ3"
FT                   /protein_id="AAY95505.1"
FT                   /translation="MKLLALALSLLILAGCASGPRIDTSHPSVNYDQRAQFIIVHYTSA
FT                   SLERSLALLTHGQVSSHYLIGDDKSATIYKLVDEQYRAWHAGDSQWQGRTWLNSSSIGI
FT                   EIVNPGFRDGPSGRLWYPYSEAQIQNLIVLLKDISKRNNISPRHIIGHSDIAPMRKLDP
FT                   GPLFPWKRLAEAGLGLWPDAQAVARQQAFFTVSPPSIGWYQQQLAQLGYATPQTGELDK
FT                   ATRNVLAAFQMHYRPGRFDGTPDAESAAILMVLNQTK"
FT   gene            88615..90234
FT                   /locus_tag="PFL_0089"
FT   CDS_pept        88615..90234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0089"
FT                   /product="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95506"
FT                   /db_xref="GOA:Q4KKJ2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKJ2"
FT                   /protein_id="AAY95506.1"
FT                   /translation="MPAAREPLRTWFHRPWTLAMLAAVLSAVILLLGSAGLAMHQVQQR
FT                   ESEQMNAQGQRFLERLEQLFGQLREGLDVLEAQPLRECNADLIAALQQVSYSYRFIYEA
FT                   AYRDATHTCSNWPRQNLLPAARPPDIRGPTYSYWLNTSTQPNENLAALMLGRGNFRVAT
FT                   SRGHLTDVVDLPPGGSLMVVVDHGARAIPVLGPARAWPPAQPWRGGRDGPLQVTPDLLI
FT                   YRMPTRNPEYQLVLITPRASLQGEVLDGWWWLLPSSLVLALFIGGLVYQLVRQRQSLGA
FT                   ELQGALRRGELQVLYQPIFDLSSRLCVGAEALLRWRRPDGTLTSPDLFIPLAENTGQIR
FT                   QITDFVLQRLLEQLGHVLRANPQLYISVNLAACDVMVPRIGMVMARLLATHRVAARQIA
FT                   FEVTERGLIDVVVARNNLQALRDVGHQVLIDDFGTGYCSLAYLQSLPVDCLKIDKAFID
FT                   ALGHDAASSGVAPHIIRMAHALKLKVIAEGIEFEDQALLLSSEGVSFGQGWLFAHALSA
FT                   LQFTELITRGRRLVARRVDDEA"
FT   gene            complement(90239..92023)
FT                   /gene="kinB"
FT                   /locus_tag="PFL_0090"
FT   CDS_pept        complement(90239..92023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kinB"
FT                   /locus_tag="PFL_0090"
FT                   /product="alginate biosynthesis sensor protein KinB"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to SP:O34206; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF00989; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   PF08448; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95507"
FT                   /db_xref="GOA:Q4KKJ1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKJ1"
FT                   /protein_id="AAY95507.1"
FT                   /translation="MKLAMKLRTRLFLSISALITVALLGLVLGLVSVMQMASTQESLIR
FT                   NNFITLDLGLKLRQTLGDQLIIMLGKQPDRAALETSRQHYLELLDEGIAHDRQTQVQSG
FT                   FQQARSDYLSFYQAFERNSTASGLHDNNELTERFNALRGGLINEHKRALDNISQVEQQA
FT                   RNRAWLVAGLLGLVALAVLIIGFVTAHAIARRFGGPIEALAKAADKIGEGNFDVTLPIS
FT                   AAAEMNLLTRRFGIMAEALRQHQATNVDELLAGQQRLQAVLDSIDDGLLMIDRQGRLEH
FT                   LNPVAQRQLGWDQERLGQGLGSALQRPELDEQLQLVLRGGNLERAPDDLDIEVDGESRL
FT                   LTYSLTPVSHTQGHILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAFGL
FT                   LQERLHFPEESRETDLLNTVNEEMQRLMQLINDLLNFSRYQNGLQKLTLAPCPLEELLV
FT                   QAQGRFSEQAQQQGIDLLLEIQAPLPRLHADRAQLERVLDNLIDNALRHTASEGQIRLQ
FT                   ARRHGERVIVSVEDNGEGIAYGQQGRIFEPFVQVGRKKGGAGLGLALCKEIVQLHGGRM
FT                   GVYSRPGQGTQFYLALPL"
FT   gene            complement(92034..93380)
FT                   /gene="algB"
FT                   /locus_tag="PFL_0091"
FT   CDS_pept        complement(92034..93380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algB"
FT                   /locus_tag="PFL_0091"
FT                   /product="alginate biosynthesis transcriptional regulatory
FT                   protein AlgB"
FT                   /note="identified by similarity to SP:P23747; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00158; match to protein family HMM PF02954; match to
FT                   protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95508"
FT                   /db_xref="GOA:Q4KKJ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKJ0"
FT                   /protein_id="AAY95508.1"
FT                   /translation="MESAPENQGRILLVDDESAILRTFRYCLEDEGYTVATANSAAQAD
FT                   ALLQRQVFDLCFLDLRLGEDNGLDVLAQMRTQAPWMRVVIVTAHSAVDTAVDAIQAGAA
FT                   DYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEVRKPKDGLDSHSPAMKVVLETARQ
FT                   VASTDANILILGESGTGKGELARAIHGWSKRAKKSCVTINCPSLTAELMESELFGHSRG
FT                   AFTGASESTLGRVNQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADV
FT                   RILAATNLNLEDMVRDGRFREDLLYRLNVITLHLPPLRERSEDILTLADRFLARFVKEY
FT                   SRPARVFSDEAREALLNYRWPGNIRELRNVVERASIICPQERVEISHLGMAEQPTNNAP
FT                   RIGAALSLDELEKAHIGAVLATSDTLDQAAKTLGIDASTLYRKRKQYNL"
FT   gene            93822..94106
FT                   /locus_tag="PFL_0092"
FT   CDS_pept        93822..94106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95509"
FT                   /db_xref="GOA:Q4KKI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKI9"
FT                   /protein_id="AAY95509.1"
FT                   /translation="MNRQRLAQLRIAPLHLQQGLFAVLALLVTLIAGQQFQRWQDSQAP
FT                   APRMPVHHFTQTHFSSVSSQLNDQAPMQLMAVDQAQPVADAPRQERWVF"
FT   gene            94188..94352
FT                   /locus_tag="PFL_0093"
FT   CDS_pept        94188..94352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07043"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95510"
FT                   /db_xref="GOA:Q4KKI8"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KKI8"
FT                   /protein_id="AAY95510.1"
FT                   /translation="MLSWAITFLIIAIVAAVLGFGGIAGTATGIAKILFVVFLVMFIAS
FT                   FFFGRRGRG"
FT   gene            94355..94822
FT                   /locus_tag="PFL_0094"
FT   CDS_pept        94355..94822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0094"
FT                   /product="inhibitor of vertebrate lysozyme family protein"
FT                   /note="identified by match to protein family HMM PF08816"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95511"
FT                   /db_xref="GOA:Q4KKI7"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKI7"
FT                   /protein_id="AAY95511.2"
FT                   /translation="MSLSLKTLTAALLLGASALASAANDGQARANQLLGSDPQFRETWQ
FT                   GVVHKEERLPEWVMNLSGDAPQQMNAMTEDGDQYLVGPLCETAQSCQNQRLIVAFSFDK
FT                   KHAYAMLVDVPAGLPVDKSPTRHANYRFLGKPDDGMQALLQEQLRKDPNWY"
FT   gene            95568..96899
FT                   /gene="gltP"
FT                   /locus_tag="PFL_0095"
FT   CDS_pept        95568..96899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="PFL_0095"
FT                   /product="glutamate/aspartate:proton symporter"
FT                   /note="identified by similarity to SP:P21345; match to
FT                   protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95512"
FT                   /db_xref="GOA:Q4KKI6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKI6"
FT                   /protein_id="AAY95512.1"
FT                   /translation="MKKAKLSLAWQILIGLVLGIAIGALLNHFSAEKAWWISNVLQPAG
FT                   DIFIRLIKMIVIPIVISSLIVGIAGVGDAKKLGRIGLKTIIYFEIVTTIAIVVGLLLAN
FT                   LFHPGAGIDMSTLGTVDISKYQATAAEVQHEHAFIETILNLIPSNIFAAMARGEMLPII
FT                   FFSVLFGLGLSSLQSDLREPLVKMFQGVSESMFKVTHMIMNYAPIGVFALIAVTVANFG
FT                   FASLLPLAKLVILVYVAIAFFAFVILGLIARLFGFSVIKLMRIFKDELVLAYSTASSET
FT                   VLPRVIEKMEAYGAPKAICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSISQQL
FT                   LLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRVMDMARTALNVIG
FT                   NALAVLVISRWEGMYDDAKGQRYWNSLPHWRSKEKLPAGEASKG"
FT   gene            97076..98305
FT                   /locus_tag="PFL_0096"
FT   CDS_pept        97076..98305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0096"
FT                   /product="transporter gate domain protein"
FT                   /note="identified by match to protein family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95513"
FT                   /db_xref="GOA:Q4KKI5"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKI5"
FT                   /protein_id="AAY95513.1"
FT                   /translation="MLNGLWLGFFIVATVSALAQWLVGGNAGIFAAMVESIFAMAKLSV
FT                   EVMVLLFGTLTLWLGFLRIAEKAGIVEWLAKVLGPLFKRLMPEVPPGHPALGLITLNFA
FT                   ANGLGLDNAATPIGLKAMRALQELNPSATTASNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAADPTLVFLPILLATSASTLVGLLSVAVMQRLRLWDPVVLAYLVPGALALGAFMALL
FT                   ATLSATALASLSSILGNLTLFGLIMLFLVVGALRKVKVYEAFVEGAKEGFDVAKSLLPY
FT                   LVAMLCAIGVLRASGALDFGLDGIRHLVEWAGWDTRFVDALPTALVKPFSGSAARAMLI
FT                   ETMQTQGVDSFPALVAATIQGSTETTFYVLAVYFGAVGIQRVRHAVGCALLAELAGVVA
FT                   AIAVCYWFFG"
FT   gene            complement(98378..99007)
FT                   /locus_tag="PFL_0097"
FT   CDS_pept        complement(98378..99007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0097"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95514"
FT                   /db_xref="GOA:Q4KKI4"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKI4"
FT                   /protein_id="AAY95514.1"
FT                   /translation="MKRAYRLLAPLGLSAALALTGACSILPKGEPLDIYRLPVSQAGAT
FT                   APNQALPWSLQLLKPQAGDALNSARIAVIPQGNLISSYKASRWSDPAPILLRNRLLDGF
FT                   QRDGRVQLLSTDDSNLQTDLALGGDLQAFQTEYQGNAAQVVIRLDARLIRGYDQKILAS
FT                   RRFEVRQALAETGVPAVVTGFGQAGDALTRQVVDWAVGQGNRALKH"
FT   gene            complement(99004..99942)
FT                   /locus_tag="PFL_0098"
FT   CDS_pept        complement(99004..99942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0098"
FT                   /product="mammalian cell entry related domain protein"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95515"
FT                   /db_xref="GOA:Q4KKI3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKI3"
FT                   /protein_id="AAY95515.1"
FT                   /translation="METRAHHVLIGLFTVIVVAGALLFGLWLAKSSVDSAFQDYQIVFN
FT                   EAVSGLSKGSSVQYSGIKVGDVVNLRLDPKDPRRVLAQIRLGSETPIKEDTQAKLALTG
FT                   ITGTSIIQLSGGTPQSPTLKGKDGELPTIIASPSPIARLLNNSNDLMTGVNLLLHNANR
FT                   MFSPDNVARVSSTLDNLQKTSASIAEQRDDLRQLMQQLGSISKQTGAMLEQTTALMRNA
FT                   NGLLNDQGKQMFGSAEHAMRSLEQSSATLNKLLSDNQDSLNNGMQGLNGLAPAVRELRE
FT                   TLSSLRAITRRLEANPGGYLLGNEKNKEFTP"
FT   gene            complement(99944..100747)
FT                   /locus_tag="PFL_0099"
FT   CDS_pept        complement(99944..100747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0099"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95516"
FT                   /db_xref="GOA:Q4KKI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKI2"
FT                   /protein_id="AAY95516.1"
FT                   /translation="MSRPPRAPAKAVIEVRGLCNRFGKQSVHENLDLDVYQGEILGVVG
FT                   GSGSGKSVLLRSIVGLRQPSEGSVRVFGQDLPSLPEQQRSLIERRFGVLFQKGALFTSL
FT                   TVTENVALPLIEHAGLSRADAEHLAAVKLALAGLPLSAADKYPASLSGGMIKRAALARA
FT                   LALDPDILFLDEPTAGLDPVGAAAFDQLILTLRDALGLSVFLVTHDLDTLYTITDRVAV
FT                   LAQKKVLVADAIDIVAETDDEWIHQYFHGPRGRAAYQAATQTNEG"
FT   gene            complement(100744..101892)
FT                   /locus_tag="PFL_0100"
FT   CDS_pept        complement(100744..101892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02405;
FT                   match to protein family HMM TIGR00056"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95517"
FT                   /db_xref="GOA:Q4KKI1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKI1"
FT                   /protein_id="AAY95517.1"
FT                   /translation="MTSSVTPGTAQLDLAHSPAQLRIGGDWTLAHYSDLKRLSQSLDGR
FT                   YDSSTHIDLNGLGALDTAGASLLVELLGAERLGQSAEHPDCTLSAADRALLHTVYTSLN
FT                   DFCVPVKEPEISVSVQLLSRIGSAVYTVWQDTLKVLGFIGLILETLARGLLRPKRWRIT
FT                   PVVAHIEQTGLDAAPIVALLTFLVGAVVAFLGATVLANFGASIFTVDLVAFSFLREFGV
FT                   LLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLGLDPVELLVLPRVLALLVSLPMLTF
FT                   LAMLSGIVGGAVVCALSLDISPAMFLSLLHSDIGVKHFLLGLVKAPIFAFLIAAIGCLE
FT                   GFKVSGSAESVGAHTTSSVVQSIFVVIVIDAVAALFFMEMGW"
FT   gene            complement(101947..103002)
FT                   /locus_tag="PFL_0101"
FT   CDS_pept        complement(101947..103002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0101"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95518"
FT                   /db_xref="GOA:Q4KKI0"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKI0"
FT                   /protein_id="AAY95518.1"
FT                   /translation="MIPPMPNLTLLIQRILELMKRYPGIIALGGFISGVGSFILVDRQQ
FT                   SLASWIAVILLVSWVWLMLENSLTQLFTKVFKREIPQPLLRYATQMIHQESLFFVLPFF
FT                   FITTSWNSGQLVFTGLLGAAALISITDPLYYKWLAPRRWLFLALHTLTLFAALLTALPL
FT                   ILHLTTAQSFKLALGIAMLLSFPSLASILPIRSLRSALTVLAITLAIGSTGWLLRSWVP
FT                   PATLWLTEDAISTQLQDRTPGDSLEQISTAQVSSTGLYAYTAINAPRGLDERIYHVWQF
FT                   NGSEVDRVALDIHGGRKEGYRAWSHKQNFPANPAGDWQVRVITEDGQVIGVLRFEITAP
FT                   DQDAAKTGEAK"
FT   gene            complement(103170..104552)
FT                   /locus_tag="PFL_0102"
FT   CDS_pept        complement(103170..104552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0102"
FT                   /product="peptidase, M16 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00675;
FT                   match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95519"
FT                   /db_xref="GOA:Q4KKH9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH9"
FT                   /protein_id="AAY95519.1"
FT                   /translation="MRCLLFACLLLGSAQGWALDRFQVEGYTLPNGLQLLLKPGSERGH
FT                   VAIRLVVGVGLDDFACADKELPHLLEHLLFSGVDDSGEGGLEERMQALGGEWNAYTSNA
FT                   DTTFVIEAPARNQRKVLDLLLSLLTHTRLDDNAVAAAKQVVEREGGGHYSHLQRWLDRQ
FT                   DLGHKAGNQLAVELGLKCAERAEVGNLTLAQLEQVRKDWYAPNNMTLIVVGELDRLLPA
FT                   YLERTYGALEPVEPSEHPDLPQIQGTAAPERTLVHGWVGQSAQLHWLFPEPVLDQQHDE
FT                   TFDLLKDYLDWALYRQLRLEHELSYGPWSDREVFGGVGFLSLNADLERDDLPQARQVVE
FT                   QLKARLLKDGLDPATFARLKQAAIDRQAWAVQGNSALADYYWSALGDFDNGRFSDPAKR
FT                   LKAVSLEQANLALRQLLQQPGYLRIEQPLLSDEQLLWLIGGLLSLILLGSFGVYLLRRR
FT                   AR"
FT   gene            complement(104609..106267)
FT                   /locus_tag="PFL_0103"
FT   CDS_pept        complement(104609..106267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0103"
FT                   /product="Na/Pi-cotransporter II-like protein"
FT                   /note="identified by similarity to SP:P0AF44; match to
FT                   protein family HMM PF02690; match to protein family HMM
FT                   TIGR00704; match to protein family HMM TIGR01013"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95520"
FT                   /db_xref="GOA:Q4KKH8"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH8"
FT                   /protein_id="AAY95520.1"
FT                   /translation="MLTLLNLLSAVALLIWGTHIVRTGILRVYGSNLRHVIGQNMARRP
FT                   LAFIAGILVTAMVQSSNATAMLVTSFVGQGLMALTPALATMLGADVGTALMARVLTFDL
FT                   SWLSPLLIFLGVIFFLSRKQTRAGQLGRVGIGLGLIILALQLIVEAAAPITHAQGVKVL
FT                   FASLTGDILLDALMGAVFAMVSYSSLAAVLLTATLAGAGVISLPVAIGLVIGANIGSGV
FT                   LAFLSTSMQNAAGRQVALGSLLYKLIGLLLIIPVLDPLAHWMDSLDFSPQEVVIGFHLL
FT                   YNTARCLLLLPTVGPMARLCAWLLPERPQENGRARPRHLDPTALATPSLALANAARETL
FT                   RIGDLIDSMLEAMRDALQGKQTAITQELRALSDDVEALYSAIKLYLAQMPREDLSDQDS
FT                   RRWAEIIELAFNLKLASDLIERMLRKVQQQKTSQRRSFSEVGLEELTGLHAQLIANLRL
FT                   GLSVFLSADPESARQLLREKRRFRAQERRLAHAHVSRLQRKIVQSIETSSLHLELIADM
FT                   KRLNSLFCSSAYVVLETSDTGALEVEEMADITHSP"
FT   gene            complement(106484..107251)
FT                   /locus_tag="PFL_0104"
FT   CDS_pept        complement(106484..107251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0104"
FT                   /product="membrane protein, TerC family"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95521"
FT                   /db_xref="GOA:Q4KKH7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH7"
FT                   /protein_id="AAY95521.1"
FT                   /translation="MEWLTNPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQAR
FT                   TRIFGLALAMVTRILLLLSITWVMRLTADLFVVFGQGISGRDLILFFGGLFLLWKSSQE
FT                   MYHALEGEDETIDEPKGKGGNFLYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMVAAII
FT                   VAVLVMMLAAGTISEFIDKHPSLKMLALSFLLVVGTVLIAEAFEVHVPKGYVYFAMAFS
FT                   LAVEAINIKMRTAIAKKKKQQDPVKLRKDVPGQ"
FT   gene            complement(107319..108626)
FT                   /gene="citN"
FT                   /locus_tag="PFL_0105"
FT   CDS_pept        complement(107319..108626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citN"
FT                   /locus_tag="PFL_0105"
FT                   /product="citrate transporter"
FT                   /note="identified by similarity to SP:P42308; match to
FT                   protein family HMM PF03600; match to protein family HMM
FT                   PF03606; match to protein family HMM TIGR00784"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95522"
FT                   /db_xref="GOA:Q4KKH6"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH6"
FT                   /protein_id="AAY95522.1"
FT                   /translation="MLTFLGFAMVITFMFLIMTKRLSALIALIIVPILFALFGGFAPKI
FT                   GPMMLEGITKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKLVKGDPLKVSVGTAVL
FT                   ALVVSLDGDGATTYMICVAAMLPLYSRIGMSPRIMAGLIILAGGVMNMTPWGGPTARAA
FT                   SALHVDPSDIFVPMIPAMLAGVVAILAIAYMYGKRERARLGELHLAGDEIDHSEISVSQ
FT                   YPDARRPKLIWFNGALTFALMCTLIAGLLPLPVLFMVAFSIAMIVNYPCLQQQKDRVAA
FT                   HAGSVLAVVGLIFAAGIFTGILSGTGMVDAMSKSLLAVIPEALGPYLAVITALVSMPFT
FT                   FFMSNDAFYYGVLPVLAEAASHYGITAVEMARASIVGQPVHLLSPLVPSTYLLVALAGI
FT                   EFGDHQRFTLKWAVLVCLCIMFAALLMGIFPLFSTL"
FT   gene            108946..109347
FT                   /locus_tag="PFL_0106"
FT   CDS_pept        108946..109347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:H82962; match to
FT                   protein family HMM PF04828"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95523"
FT                   /db_xref="GOA:Q4KKH5"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH5"
FT                   /protein_id="AAY95523.1"
FT                   /translation="MRELHTGGCHCGRLRYQFSGPLRDIAHCHCSICRRVSGGLVTTWI
FT                   TLPASAFEWLEGVPARYDSSGSCARYFCGNCGAHLALITHLSPDSIDVTIATLDHPERA
FT                   PADRHIWTDSRLPWLHLDEHLPQEPQETL"
FT   gene            complement(109459..111420)
FT                   /locus_tag="PFL_0107"
FT   CDS_pept        complement(109459..111420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95524"
FT                   /db_xref="GOA:Q4KKH4"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH4"
FT                   /protein_id="AAY95524.1"
FT                   /translation="MKPLLAWLLAGTLALLCGTAQADLQLRLKADGLSPAQQHASQALL
FT                   DEAMQALPPRFIQQLDRTIDVGWTDRMPDNAYGEASLVSELDLNRALLPSLTDGSAATQ
FT                   KTSRPHGTVRREMLATVLHELTHIYDRARLWPGAERSLIQRCTRKNSTSGLIGLPDECR
FT                   GQNDRRFTLSDDPRLLDLAGWPQYVGRRGEREQHNRQVARSPDIYEITNPKEFVAVNME
FT                   YFLLDPSYACRRPTLYRYYQEHFGWAPAAKDSCAKSFAFLNAGNDFAKTPLGQVDPERV
FT                   YAVDYLLAEANQNWVSRWGHSMLRLVICAPGRPRGPDCRLDLDQHLVLSYRAFVGDVQL
FT                   SSWDGLVGKYPSRLFVLPLSQVIDEYTKTELRSLASVPLKLSRSEIEEVVEHAAEMHWS
FT                   YDGNYYFLSNNCAVESLKLLRSGSNNKQLIGLDSIMPNGLLEVLKGRGLADTSVLDDPR
FT                   EALRLGYRFDSFRDRYQAMFEVIKKRLPIKQASVEDWLSLSAEERRHWFDQADLRTSAA
FT                   LLLLEQASYRRQLLLAQDEVKQRYLGARELKNGGMEQANKTLQQILANSGFLSRPAELL
FT                   GSGGYGLPQPAEWQRLESESSQRQKQLQSLTGDLDKEVRALLEPARAAEIAANEANLKL
FT                   VGEHLRTLHKAAGGLELP"
FT   gene            complement(111417..111737)
FT                   /locus_tag="PFL_0108"
FT   CDS_pept        complement(111417..111737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN65784.1; match to
FT                   protein family HMM PF09498; match to protein family HMM
FT                   TIGR02448"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95525"
FT                   /db_xref="GOA:Q4KKH3"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH3"
FT                   /protein_id="AAY95525.1"
FT                   /translation="MRSPLIAATLGLLLLADVAQAHTLVATSNIIVRASGRTIDFTSDT
FT                   TTSIRDSKVVREAHDDAASFVASNGDIRGAQLEAAFNALRTQLPEARDASDQVLAEAIL
FT                   AL"
FT   gene            complement(111765..112073)
FT                   /locus_tag="PFL_0109"
FT   CDS_pept        complement(111765..112073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09498;
FT                   match to protein family HMM TIGR02448"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95526"
FT                   /db_xref="GOA:Q4KKH2"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH2"
FT                   /protein_id="AAY95526.1"
FT                   /translation="MGLFRISLSAPVLIAACWAGSVQAFDLTTQSLVVTVYATGQVTSA
FT                   PFDHKLLLAAQDDAAAFVATDGQLRGARLESALEYLRQDPAKLHASDLELAQAILVQ"
FT   gene            complement(112177..112494)
FT                   /locus_tag="PFL_0110"
FT   CDS_pept        complement(112177..112494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09498;
FT                   match to protein family HMM TIGR02448"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95527"
FT                   /db_xref="GOA:Q4KKH1"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH1"
FT                   /protein_id="AAY95527.1"
FT                   /translation="MSRLRLLSAAALLALAANAHATSLIVTTDAIVGALKATTDATSDA
FT                   TSSLRDNKIVRAARDDAASFVATDGAIRGVKLESAFAHIRQQAPQLQASDAQLAQAILA
FT                   I"
FT   gene            complement(113134..113349)
FT                   /locus_tag="PFL_0111"
FT   CDS_pept        complement(113134..113349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95528"
FT                   /db_xref="GOA:Q4KKH0"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKH0"
FT                   /protein_id="AAY95528.1"
FT                   /translation="MERTLSSELFFEDKAEKTQASLPLRVIANLMLWQRRISSRHQLAR
FT                   LDSRLLADAGISEAQRYEELSKPFWR"
FT   gene            complement(113669..115162)
FT                   /locus_tag="PFL_0112"
FT   CDS_pept        complement(113669..115162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0112"
FT                   /product="succinate CoA transferase"
FT                   /EC_number="2.8.3.-"
FT                   /note="identified by similarity to SP:P38946; match to
FT                   protein family HMM PF02550; match to protein family HMM
FT                   TIGR03458"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95529"
FT                   /db_xref="GOA:Q4KKG9"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG9"
FT                   /protein_id="AAY95529.1"
FT                   /translation="MYRDRIRLPSLLDKVMSAADAAALIEDGMTVGMSGFTRAGEAKAV
FT                   PHALAERAKVTPLKISLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINAGEVM
FT                   FIDQHLSETVEQLRNQQLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQVIVE
FT                   INLAHNPNLEGLHDIYIPTYRPTRTPIPLVKVDDRIGSTAIPIPADKIVAIVITNQSDS
FT                   PSTVSTPDSETQGIANHLIDFLKQEVDAGRMSNKLGPLQAGIGNIANAVMCGLIESPFE
FT                   NLTMYSEVLQDSTFDLIDAGKLSFASGSSITLSSRRNADVFGNLERYKDKLVLRPQEIS
FT                   NHPEVVRRLGIIGINTALEFDIYGNVNSTHVCGTRMMNGIGGSGDFARNAHLAIFVTKS
FT                   IAKGGAISSVVPMVSHVDHTEHDVDILVTEIGLADLRGLAPRERARVIIDNCVHPSYRD
FT                   ALNDYFTKACALGGHTPHILRDALSWHINLEETGKMLVE"
FT   gene            complement(115342..116778)
FT                   /gene="pntB"
FT                   /locus_tag="PFL_0113"
FT   CDS_pept        complement(115342..116778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="PFL_0113"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /EC_number="1.6.1.1"
FT                   /note="identified by similarity to SP:P07002; match to
FT                   protein family HMM PF02233"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95530"
FT                   /db_xref="GOA:Q4KKG8"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG8"
FT                   /protein_id="AAY95530.1"
FT                   /translation="MSMNLVTTLYLIASVCFIQALKGLSHPTTSRRGNLFGMLGMALAV
FT                   LTTVGLIYKLGAELATAGIGYVIVGLLIGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVVEPQSLGIVKHLGDAIPAGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGAPVQFAGQHKLNLVLGLATLGLGVTFMVTGNLGAFTLMLALAFVMGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVLLGGFGNTADAGGPAGSKEARPVKSGSADDATFLLTNADTVIIVPGYGLAVARAQHA
FT                   LKELTEKLTHRGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINSEFGQADV
FT                   VLVLGANDVVNPAAKNDPKSPIAGMPILEAFKAKTIIVNKRSMASGYAGLDNELFYLDK
FT                   TMMVFGDAKKVIEDMVKAVE"
FT   gene            complement(116778..117101)
FT                   /gene="pntAB"
FT                   /locus_tag="PFL_0114"
FT   CDS_pept        complement(116778..117101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAB"
FT                   /locus_tag="PFL_0114"
FT                   /product="NAD(P) transhydrogenase, alpha subunit part 2"
FT                   /EC_number="1.6.1.1"
FT                   /note="identified by similarity to SP:Q59764"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95531"
FT                   /db_xref="GOA:Q4KKG7"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG7"
FT                   /protein_id="AAY95531.1"
FT                   /translation="MEELISPGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAIS
FT                   AIVIVGAMLAAALTVTPLGKTMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAVKEE
FT                   VQK"
FT   gene            complement(117117..118238)
FT                   /gene="pntAA"
FT                   /locus_tag="PFL_0115"
FT   CDS_pept        complement(117117..118238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAA"
FT                   /locus_tag="PFL_0115"
FT                   /product="NAD(P) transhydrogenase, alpha subunit part 1"
FT                   /EC_number="1.6.1.1"
FT                   /note="identified by similarity to SP:Q60164; match to
FT                   protein family HMM PF01262; match to protein family HMM
FT                   PF05222"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95532"
FT                   /db_xref="GOA:Q4KKG6"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG6"
FT                   /protein_id="AAY95532.1"
FT                   /translation="MHIGVPLETQTGETRVAATPETIKKLIGQGHKVTVQSGAGINASV
FT                   VDSAYEAAGATIGNANDAFGAELILKVVAPSDSELALIKSGTVLVGMLNPFSNETIAKL
FT                   AERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHYYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAVGVGGYARPMPASWMQRQAQAVHERAKQADIVITTALIPGRKAPTLLSADTVAQMKP
FT                   GSVVIDLAAAQGGNCPLTVADQVVVEHGVTIVGPTNLAGAVAADASALYARNLLDFLKL
FT                   VFTKEGQFEVNLEDDIVAACLMCRDGQVIRKNA"
FT   gene            complement(118690..119589)
FT                   /gene="gcdR"
FT                   /locus_tag="PFL_0116"
FT   CDS_pept        complement(118690..119589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcdR"
FT                   /locus_tag="PFL_0116"
FT                   /product="transcriptional regulator GcdR"
FT                   /note="identified by similarity to GB:ABM69269.1; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95533"
FT                   /db_xref="GOA:Q4KKG5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG5"
FT                   /protein_id="AAY95533.2"
FT                   /translation="MRRKIPSTTALISFEAAARHESFTKAAQELSLTQGAVCRQIASLE
FT                   EFLGLELFRRSRRGVKLTEAGLSYSRRVATQLDAVERDTLSVMGQQGANVIELAVVPTF
FT                   GTQWLLPRLKDFQQQHPEVTVNLTNRTRPFLFADTPFDAAIYFGDADWSGTQSHWLMGE
FT                   NPMPVCSPAMLGKQQELSAEAIAELPLLQQTTRPYAWRQWFNSQQLNIPRDMTGPRYEL
FT                   FSMLAQAAMHDMGIALIPPFLIQRELAEKRLVIANPQALSSIKAYYLMIPERKVESASL
FT                   RAFRDWLVNQANSYNLEK"
FT   gene            119749..120930
FT                   /gene="gcdH"
FT                   /locus_tag="PFL_0117"
FT   CDS_pept        119749..120930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="PFL_0117"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.6"
FT                   /note="identified by similarity to SP:Q92947; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770; match to protein family HMM PF02771; match to
FT                   protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95534"
FT                   /db_xref="GOA:Q4KKG4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG4"
FT                   /protein_id="AAY95534.1"
FT                   /translation="MGGKASFNWIDPLLLDQQLTEEERMVRDSAEQFAQDKLAPRVLEA
FT                   FRHEKTDPAIFREMGEVGLLGATIPEQYGGSGLNYVCYGLIAREVERVDSGYRSMMSVQ
FT                   SSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGAMITRARKVDGGYS
FT                   LTGSKMWITNSPIADVFVVWAKDDAGDIRGFVLEKGWKGLSAPAIHGKVGLRASITGEI
FT                   VMDNVFVPEENIFPDVRGLKGPFTCLNSARYGISWGALGAAEFCWHTARQYTLDRQQFG
FT                   RPLAATQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKSLDIA
FT                   RMARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFY"
FT   gene            120944..122164
FT                   /locus_tag="PFL_0118"
FT   CDS_pept        120944..122164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0118"
FT                   /product="CoA-transferase, family III"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95535"
FT                   /db_xref="GOA:Q4KKG3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG3"
FT                   /protein_id="AAY95535.1"
FT                   /translation="MGALSHLRVLDLSRVLAGPWSGQILADLGAEVIKVERPGNGDDTR
FT                   AWGPPFLKDAYGENTTEAAYYLSANRNKQSVTIDFTRPEGQQLVRELAAKSDIVIENFK
FT                   VGGLAAYGLDYESLKAVNPRLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPE
FT                   GDEGAGPVKVGVALTDILTGLYSTVAILAALAHRDQGGGGQHIDMALLDVQVACLANQA
FT                   MNYLTTGVAPKRLGNAHPNIVPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDP
FT                   RFATNKLRVANRAVLIPLIRQATVFKTTAEWVSQLELAGVPCGPINDLAQVFADPQVVA
FT                   RGLAVELPHALAGMVPQVASPIRLSQTPVEYRNAPPLLGEHTAEVLQRVLGMRVEAVDA
FT                   LRHSRVV"
FT   gene            122825..124342
FT                   /gene="rrsA"
FT                   /locus_tag="PFL_0119"
FT   rRNA            122825..124342
FT                   /gene="rrsA"
FT                   /locus_tag="PFL_0119"
FT                   /product="16S ribosomal RNA"
FT   gene            124473..124549
FT                   /locus_tag="PFL_0120"
FT   tRNA            124473..124549
FT                   /locus_tag="PFL_0120"
FT                   /product="tRNA-Ile"
FT   gene            124560..124635
FT                   /locus_tag="PFL_0121"
FT   tRNA            124560..124635
FT                   /locus_tag="PFL_0121"
FT                   /product="tRNA-Ala"
FT   gene            124869..127769
FT                   /gene="rrlA"
FT                   /locus_tag="PFL_0122"
FT   rRNA            124869..127769
FT                   /gene="rrlA"
FT                   /locus_tag="PFL_0122"
FT                   /product="23S ribosomal RNA"
FT   gene            127899..128014
FT                   /gene="rrf"
FT                   /locus_tag="PFL_6292"
FT   rRNA            127899..128014
FT                   /gene="rrf"
FT                   /locus_tag="PFL_6292"
FT                   /product="5S ribosomal RNA"
FT   gene            128126..128244
FT                   /gene="rrfA"
FT                   /locus_tag="PFL_0123"
FT   rRNA            128126..128244
FT                   /gene="rrfA"
FT                   /locus_tag="PFL_0123"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(128398..129579)
FT                   /locus_tag="PFL_0124"
FT   CDS_pept        complement(128398..129579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0124"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="identified by match to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95536"
FT                   /db_xref="GOA:Q4KKG2"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG2"
FT                   /protein_id="AAY95536.1"
FT                   /translation="MRAILVLLHRYMGLATAVFLLLAGLTGSVLAFHHELDEWLNPEFY
FT                   HTSGKGPVLAPGSLVDSVQAEHPRLQVWYMEYPQEAGHAALLAAVPRTDPATGQPYTER
FT                   NQVFYLDPVTAHQQGQRFWGACCFQRQNLVPFLLEFHYNLSLPGNWGLWLMGLVAIAWV
FT                   IDCFVALLLTLPRGRPFWHKWSTAWKIKGGHAYRLNFDLHRAAGLWLWLLLLPIAISSV
FT                   AMNLPSQVFKPVMSLLSSIEPSVYEARGRVPAAELGITRLTYQQAYERALEEGQRLGLK
FT                   ETIGELYYSFEYNFYGAGFGRHDSQAHGKSWLFFHGTDGRLLGQEIAGQGTLGERFYRL
FT                   QLPIHGGRIIGTTGQVIIALLGVLIAVLALTGIYIWWRKLIARRSSKMRKNRA"
FT   gene            complement(129651..132143)
FT                   /gene="foxA"
FT                   /locus_tag="PFL_0125"
FT   CDS_pept        complement(129651..132143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="foxA"
FT                   /locus_tag="PFL_0125"
FT                   /product="TonB-dependent outermembrane ferrioxamine
FT                   receptor"
FT                   /note="Transducer; identified by similarity to SP:Q01674;
FT                   match to protein family HMM PF00593; match to protein
FT                   family HMM PF07660; match to protein family HMM PF07715;
FT                   match to protein family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95537"
FT                   /db_xref="GOA:Q4KKG1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG1"
FT                   /protein_id="AAY95537.2"
FT                   /translation="MTLRDTRPSSPCARPLCQAIRAALLCSSIGLGTVAPQVLAAASAV
FT                   DAPRHSYSVAPGNLGDALNQFARQAGITLSTTPALTQGRQSPGLQGDYSIPQGLNQLLR
FT                   GSGLEAVSQDGGSYVLRPLPQGSALTLPATEVKGFALGNALGSMEGYNATHSQIATKTS
FT                   TALLETSQSVSVVTREQIDDQGAQTVAQTMRYTPGVLTNPYGATHRYDYVAMRGFNDGS
FT                   VDNIYLDGLKSMGDSGTYSSMQVDPYFLERVDILKGPSSVLYGRSSPGGLVALTSKKPL
FT                   YEPYHQIQATVGTQGKQGLGFDFSGPLDDDKHIAYRLIGLTDKSDTQFDHAKEKRFALS
FT                   PTLSIDFSEDTSLTLQAYLQNDPDGGYHGGMPANGTLNQRNGQRISEHFFEGEPGVDGY
FT                   KRDQQSFGYQFEHRFNDTFTARQNFRYLDSKVKLDQVYAYGWTNATSNDLNRYYSGGGE
FT                   KLHSFIVDNMLQAEFLTGDVKHTLLLGADYQRRKTVVDWDQGTLQPINAFNPVYGNSTI
FT                   NYYSHTSYLRRLEQTGVYLQDLIELDKWRFSLGLRQDWVETSDENRLAEAQRPLGTEIS
FT                   DKRTKLTGRAGALYLFDNGLAPYVSYSESFNPNSYADSAGNPLPPTDGTQWEVGLKYQP
FT                   PGTDNLFTASLFRIDQENLASKLPQENFYRAVGAVRSQGLELEAHMQLTDNLKLLGSYT
FT                   FTDIQYSKSMTSTLSSATNLIENKGNSPTQAPRQMASLWADYKFDSATLDGLRLGGGVR
FT                   YVGYSWADAENTMKVPAYTLFDASIGYDLGKLGLKGVDVRLNANNLTNESYVASCASLS
FT                   YCYLGEERNVAATVSYQF"
FT   gene            complement(132243..133247)
FT                   /locus_tag="PFL_0126"
FT   CDS_pept        complement(132243..133247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0126"
FT                   /product="sigma factor regulatory protein, FecR/PupR
FT                   family"
FT                   /note="identified by similarity to SP:P23485; match to
FT                   protein family HMM PF04773"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95538"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKG0"
FT                   /protein_id="AAY95538.1"
FT                   /translation="MDNFPASLPLKPNPDHLVVKQAINWLLRLRNNGANPKLQQQCDLW
FT                   RAAHQEHELAWQRVQSLQQELTDNLRSVPGAQVALHTLEHSSQRLGRRQALKLLSGALL
FT                   LGSSAWVGKDLLGWQQWNADFATAVGEQRGFQLPDGTRLELNTDSAADLNFNAEQRLIK
FT                   LRRGEIMVSCGADHGPARPLLVESRHALLEGFDARFVVRVEDRCTRLSVTHGSVAIHAP
FT                   HTADGRSARVEAGQSYQISHGLAEPAAPLAMDVGAWADGLIVTRNMRLDDFLQEVGRYR
FT                   HGYLGCSAAVGNLRLSGVFRLEDTDKLLAILPQTLPVQLRYRTRWWVTLGPVA"
FT   gene            complement(133253..133753)
FT                   /locus_tag="PFL_0127"
FT   CDS_pept        complement(133253..133753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0127"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95539"
FT                   /db_xref="GOA:Q4KKF9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF9"
FT                   /protein_id="AAY95539.1"
FT                   /translation="MSSPEFAVQTLYSHHHGWLNRWLRQRLGNAADAADLAQDTFVRLL
FT                   QKTERLELKAPRAFLRTIARGLVIDHWRREEIERAYLETIAHLPEAETPGAEARALILE
FT                   LLESIARMLEGLKPKVRQAFLLAQCEELTHKQIAQQMGLSLRTVERYVAQALYHCYLLR
FT                   YES"
FT   gene            134068..135948
FT                   /gene="pctA_2"
FT                   /locus_tag="PFL_0128"
FT   CDS_pept        134068..135948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pctA_2"
FT                   /locus_tag="PFL_0128"
FT                   /product="chemotactic transducer PctA"
FT                   /note="identified by similarity to GB:BAA23412.1; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95540"
FT                   /db_xref="GOA:Q4KKF8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF8"
FT                   /protein_id="AAY95540.1"
FT                   /translation="MNLKFSHKILLAASGVVVLAFALFTLYNDYLQRNTIRQNLESSIQ
FT                   QAGELTSSSVQNWMSGRILVLENLAQNVAHQGQNADFPGLVDQPAFTSNFQFTYVGQAN
FT                   GTFTQRPDAKMPDGYDPRQRPWYKQAVAADKTMLTPPYMAAVGGLVVTIAMPVKKQGEL
FT                   LGVVGGDLSLETLVKIINSVDFGGLGHAFLVSADGQVIVSPDKDQVMKNLKDIYPGANV
FT                   RIENGNQEVVLNKQERILSFTPVTGLPNAEWYIGLSIDKDKAYAPLSQFRTSALIAMFI
FT                   AVAVIAVLLTLLIQVLMRPLITMGRAMQDIAQGEGDLTRRLVVESKDEFGELGSSFNQF
FT                   VERIHASISEVSSATRQVHDLSQRVMASSNASIIGSDEQSARTNSVAAAINELGAATQE
FT                   IARNAADASQHASGASEQADDGRQVVEQTIQAMTELSQKISLSCTQIETLNASTDNIGH
FT                   ILDVIKGISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAHRTQESAEEIHKMIT
FT                   SLQVGSREAVSTMNASQASSEESVEVANQAGARLVSVTQRIGEIDGMNQSVAAATEEQT
FT                   AVVETLNVDINQINLLNQQGVANLNETLKDCDALSQQASRLKQLVDSFKI"
FT   gene            complement(136014..136778)
FT                   /locus_tag="PFL_0129"
FT   CDS_pept        complement(136014..136778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0129"
FT                   /product="thioesterase domain protein"
FT                   /note="identified by match to protein family HMM PF00975"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95541"
FT                   /db_xref="GOA:Q4KKF7"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF7"
FT                   /protein_id="AAY95541.1"
FT                   /translation="MYTDTRQWTLVIKPGQATRIRLICFPQAGAAAEQMRVWSSGLADH
FT                   IELVVLNLPGHGPRRDEAPCDNWPSLLENTFTALDPWLGEPHALFGHGLGALLAYETSK
FT                   HAQERFPQQTRHLFVSGCRSPDSLPRRPLLHSLPIAAFREAILTLGASPLEMPRGQNDL
FT                   QSYERLLRNGLKLFETWYDTSSGCLDVPLTAFYGSEDPLATANLMLNWREFTGREFELI
FT                   EVAGNHFFIKSQRQRLLQVINTHLGLLGDHPA"
FT   gene            137069..137761
FT                   /locus_tag="PFL_0130"
FT   CDS_pept        137069..137761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95542"
FT                   /db_xref="GOA:Q4KKF6"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF6"
FT                   /protein_id="AAY95542.1"
FT                   /translation="MAARLALSRTLRWFCAALLLAGALLGSLHADWDFSLISRRATALY
FT                   GPLGEGQPRIDAWQHLLATQKQVPEREQLKVVNLFFNKNMRYVEDIDLWHQVDYWETPI
FT                   EALWKGAGDCEDYAIAKYFSLRHLGVSSDKLRITYVKALRQNRAHMVLTYYSSPEAMPL
FT                   VLDSLEDSIRPASERTDLLPVYSFNAEGLWLPGAKGNKRVGDTKRLSRWQDVLKKMQAE
FT                   GFPVETTN"
FT   gene            137776..139722
FT                   /gene="lapD"
FT                   /locus_tag="PFL_0131"
FT   CDS_pept        137776..139722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapD"
FT                   /locus_tag="PFL_0131"
FT                   /product="cyclic dimeric GMP binding protein LapD"
FT                   /note="identified by similarity to GB:ABA71875.1;
FT                   similarity to GB:ABI54127.1; match to protein family HMM
FT                   PF00563; match to protein family HMM PF00672; match to
FT                   protein family HMM PF00990; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95543"
FT                   /db_xref="GOA:Q4KKF5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="PDB:3PFM"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF5"
FT                   /protein_id="AAY95543.1"
FT                   /translation="MSLFKQLLIAICVFLVVAFSGSFMVSLESSRTQYVNQLRSHAQDA
FT                   ATALALSLTPNIDDPAMVELMVSSIFDSGYYASIRVVDLATEKTLVERSGIPEVGNVPQ
FT                   WFVSLIGLEPAGGDAIVSRGWEQAARVEVLSHPMFAVAKLWQSALGSLGWLLICGAVSA
FT                   VLGALLLRRQLKPLDYMVQQSHAIARREFLSLPQLPRTPELRRVVQAMNQMVEKLKALF
FT                   QEQAERSEKLRTESYQDSLTGLANRRYFEMQLHARVSNPEQASSGYLLLLRVKDLAGLN
FT                   QRLGGQRTDQLLKAVGEQLLRECDKYPETHNLVTRVRGGEFAVLAPGLVREEAIQLAQS
FT                   LDSALGNLHATGATDVASVASIGLAAFAHGDSPQAVLSLGDQALAQAEAQGDTSWACLD
FT                   QGASAQVGDDHHAWHRLLDRALSEQHFQLYFQPVVAARDTHLVLHYKVLSRLLDEQGQT
FT                   IPAGRFLPWLERFGWTSRLDLLMLEQVLRQMASHEDCLALNLSAATLADPHALNRVFEI
FT                   LRQHSDLGPRLTLEIGEEQLPEQAMLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLG
FT                   LAYLKIDGSYIRDIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELQVIREMGLYG
FT                   VQGQLFGEPAPWG"
FT   gene            complement(139816..140154)
FT                   /locus_tag="PFL_0132"
FT   CDS_pept        complement(139816..140154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95544"
FT                   /db_xref="GOA:Q4KKF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF4"
FT                   /protein_id="AAY95544.1"
FT                   /translation="MFYVQRDAQGQLIRVEAAAYAEATETLPADHHEIQTWYANEAVEV
FT                   SLKQLKQSDLEMIRVLDDLIQLLTLKGVIRITDLPAAAQAKLMDRTQAREALGGLSRLI
FT                   NDDETGLI"
FT   gene            complement(140316..155078)
FT                   /gene="lapA"
FT                   /locus_tag="PFL_0133"
FT   CDS_pept        complement(140316..155078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapA"
FT                   /locus_tag="PFL_0133"
FT                   /product="large adhesive protein"
FT                   /note="identified by similarity to GB:ABA71877.1; match to
FT                   protein family HMM PF00092; match to protein family HMM
FT                   PF00353; match to protein family HMM PF03160; match to
FT                   protein family HMM TIGR03661"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95545"
FT                   /db_xref="GOA:Q4KKF3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF3"
FT                   /protein_id="AAY95545.1"
FT                   /translation="MSSVVAIVKSIVGQVFVVSPEGIRRVLIEGDRLFVGDQVDTGPAG
FT                   AVTLELTDGRTLDLGRDTQWSGAAPDSSTDLAQATAQAAPSVAELQQAIAAGADPTTDL
FT                   EATAAGPTAAGNGGAAGGGHSFVQLEETAGRVDPTIGFPTAGLGLANSTQDNTFGGLTN
FT                   NGGLGNGNGNGSGSDSLRPATLTLGATPTITEAGGTLVYTATLTQAPLTDLTVTLSNGA
FT                   VIVISAGQTTGSVQVPLAPQDNVYIDPGQISVSVTGTTGGGGLLVTVNPTPAVTQVTDT
FT                   IDTTTVSLTADASVTEGGQITYTATLTNPAQTPVTITLSNGSVITIEAGKSSGSIDVPA
FT                   PANDVYKNGDTIEVGITKAEGGNFENLQPSPDKAVTTVTDSIDDTGLSLSATDTVAEGG
FT                   SIVYTATLTNPAGTPVTVTLSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEVTITK
FT                   ADGGNFENLVTDPAPAVTDVTDTIDTSTVSLTATPSVAEGGTVVYTASVTAPVTGSPVV
FT                   VTLSNGQTITIPVGESSASVNFTAPNDALAGGSSLSTTITKADGGNYEKLEISDKPAET
FT                   SVTDTPDTTTLSVTATDTVAEGGSIVYTATLTNAAGTPVTVTLSNGAVITIAAGATTGT
FT                   TTVAAPADDVYKDAGKVEVTITKADGGNFENLETNPTPAVTDVTDTIDTSTVSLTATPN
FT                   VAEGGTVVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSASVNFTAPNDALAGGSSLS
FT                   TTITKADGGNYEKLEVSDKPAETSVTDTPDTTTLSLSATESVAEGGSIVYTATLTNAAG
FT                   TPVTVTLSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAEGGNFENLETNP
FT                   TPAVTDVTDTIDTSTVSLTATPSVAEGGTVVYTASVTAPVTGSPVVVTLSNGQTITIPV
FT                   GESSASVNFTAPNDALAGGSSLSTTITKADGGNYEKLEISDKPAETSVTDTPDTTTLSL
FT                   SATESVAEGGSIVYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAAPADDVYKD
FT                   AGKVEATITKAEGGNFENLETNPAPAVTDVTDTIDTSTVSLTATPSVAEGGIVVYTASV
FT                   TAPVTGSPVVVTLSNGKTITIPVGESSGSVNFTAPNDALAGGSSLSTTITKADGGNYEK
FT                   LEISDKPAETSVTDTPDTTTLSLSATESVTEGGSIVYTATLTNAAGTPVTVTLSNGAVI
FT                   TIAAGATSGTATVAAPADDVYKDAGKVEATITKAEGGNFENLETNPAPAVTDVTDTIDT
FT                   STVSLTATPSVAEGGIVVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSGSVNFTAPN
FT                   DALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVTDTPDTTTLSLSATESVAEGGSIV
FT                   YTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAEG
FT                   GNFENLETNPAPAVTDVTDTIDTSTVSLTATPSVAEGGTVVYTASVTAPVTGSPVVVTL
FT                   SNGQTITIPVGESSASVNFTAPNDALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVT
FT                   DTPDTTTLSLSATESVAEGGSIVYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATV
FT                   AAPADDVYKDAGKVEATITKAEGGNFENLETNPTPAVTDVTDTIDTSTVSLTATPNVAE
FT                   GGTVVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSASVNFTAPNDALAGGSSLSTTI
FT                   TKADGGNYEKLEISDKPAETSVTDTPDTTTLSLSATESVAEGGSIVYTATLTNAAGTPV
FT                   TVTLSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAEGGNFENLETNPAPA
FT                   VTDVTDTIDTSTVSLTATPSVAEGGIVVYTASVTAPVTGSPVVVTLSNGQIITIPVGES
FT                   SASVNFTAPNDALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVTDTPDTTTLSLSAT
FT                   ESVAEGGSIVYTATLTNAAGTPVTVTLSNGAVITIAAGATTGTTTVAAPADDVYKDAGK
FT                   VEATITKAEGGNFENLETNPAPAVTDVTDTIDTSTVSLTATPSVAEGGTVVYTASVTAP
FT                   VTGSPVVVTLSNGQTITIPVGESSASVNFTAPNDALAGGSSLSTTITKADGGNYEKLEV
FT                   SDKPAETSVTDTPDTTTLSLSATESVAEGGSIIYTATLTNAAGTPVTVTLSNGAVITIA
FT                   AGATSGTATVAAPADDVYKDAGKVEATITKAEGGNFENLETNPAPAVTDVTDTIDTSTV
FT                   SLTATPSVAEGGTVVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSASVNFTAPNDAL
FT                   AGGSSLSTTITKADGGNYEKLEVSDKPAETSVTDTPDTTTLSLSATESVAEGGSIVYTA
FT                   TLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAEGGNF
FT                   ENLETNPTPAVTDVTDTIDTSTVSLTATPNVAEGGTVVYTASVTAPVTGSPVVVTLSNG
FT                   QTITIPVGESQGSVNFTAPNDALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVTDTP
FT                   DTTTLSLSATESVAEGGSIIYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAAP
FT                   ADDVYKDAGKVEATITKAEGGNFENLETNPAPAVTDVTDTIDTSTVSLTATPNVAEGGT
FT                   VVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSASVNFTAPNDALAGGSSLSTTITKA
FT                   DGGNYEKLEISDKPAETSVTDTPDTTTLSLSATESVAEGGSIVYTATLTNAAGTPVTVT
FT                   LSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAEGGNFENLETNPAPAVTD
FT                   VTDTIDTSTVSLTATPNVAEGGTVVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSAS
FT                   VNFTAPNDALAGGSSLSTTITKADGGNYEKLEISDKPAETSVTDTPDTTTLSLSATESV
FT                   AEGGSIVYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEA
FT                   TITKAEGGNFENLETNPAPAVTDVTDTIDTSTVSLTATPSVAEGGTVVYTASVTAPVTG
FT                   SPMVVTLSNGQTITIPVGESSGSVNFTAPNDALAGGSSLSTTITKADGGNYEKLEVSDK
FT                   PAETSVTDTPDTTTLSLSATESVAEGGSIIYTATLTNAAGTPVTVTLSNGAVITIAAGA
FT                   TTGTTTVAAPADDVYKDAGKVEATITKAEGGNFEKLVPNTTPAVTDVTDTIDNSTVSLK
FT                   ATPSAAEGGNVTYTATVTAPVTGSPVVVTLANGEKITIPVGETTGSVSISAPNDVLVGH
FT                   TPLTNSITNVSGGNYENLVADKTPVSTTVTDTVDTTSVSLTATGTVAEGGQITYTATLT
FT                   NAAGTPVTVTLSNGAVITIAAGATTGTTTVAAPADDVYKDAGKVEATITKAEGGNFEKL
FT                   VPNTTPAVTDVTDTIDNSTVSLKATPSAAEGGNVTYTATVTAPVTGSPVVVTLANGEKI
FT                   TIPVGETTGSVSISAPNDVLVGHTPLTNSITNVSGGNYENLVADKTPVSTTVTDTVDTT
FT                   SVSLTATGTVAEGGQITYTATLTNAAGTPVTVTLSNGSVIHIEAGKTTGTVTVPAPADD
FT                   VYIDAGKVNATITNATGGNFEKLVTDTTPAVTNVTDTLDTTSVGISGSASVTEGQTASY
FT                   TVSLTHPAQTEVTLKISYSGTATDGSDFSGVYTVKIPAGASSATFNVATIDDKITEGTE
FT                   NFTVKIDSATGGNFENLVVGSNNSVTTSIIDNDAPPVIDLDANNSSGATGADYKVTFTE
FT                   GTTGPGVSIADTDLSITDPDSTLLTGATIVLTNRQPGDSLNLGNSVNGITINANSKDGS
FT                   ITLTLSGSATLADYMQQIKNITFTNNSEDPSTTPRTITVTVTDGGNYSNVATTTVNVVA
FT                   VNDAPTATGGAVTGNEDTPLALTWSNFGVSDVDSPASSLGVKITQLPSDGKLQYLDGST
FT                   WKDVANNQTFSKADIDAGKLRFTPDANESGTNGYGGNGVGNQQADYAQIKFQPTDGQAL
FT                   GNTGTVTVDITPVADAPTLSVAGNSVNSVGLLKEVWTNLSGLGTDGSGASASTLKSVID
FT                   AAGTPNSSSLATNVQSDGNITPGTASKTSGLIYLEAGKAYTFSGTGDDSLLVTIGGKNV
FT                   ASTTWGAGGNLNGTFTPTTSGYYTIDIYHHNQSGPGSYDVNLSVNGGAAADLSNAGVPL
FT                   YTGVTDLTNAGVSVSDLHGTNGEGYYDGYKLNEGGEGGSVHLSKITTGLTDTDGSETLS
FT                   VKISGIPAGSVLSDGAGHTFTATATSGEANVTGWNLGNLTVTPPPYYNGTFNLNVTSTS
FT                   TESLGGSASTSAQIPVKVYPAVYNSVVATSGDDTVTGTDGNDIVVADIGGLTVVPGTNY
FT                   NIAFMVDSSGSMSSASITAAKNSLTSVFNTLKNSIGGSSSGTVNIFLADFDTQVNKSVS
FT                   VNLNDPNALAQLKAVLDSMTSGGGTNYEDVFKATANFFQSSQATGNSNATNLTYFITDG
FT                   KPTYYQSGEQTNPTLYGNVRLDDVVTTSNYKLGDTFSSYIDNTHYLSVNSSGSVVLQTY
FT                   TNGWGWSSKTLGTLHAQGDGTYELSNLAGSGSSTDYYTTTNSNSGFALLSGLSNVEAIG
FT                   INSGVSLNDLKPYDSDGKPQTNIDPNDLANSIIGHTEATMPGADKVSGGDGNDILFGDL
FT                   VSFNGVAGEGYQAMQAYVAKQTGVDVSKVTTSNVHQYITEHYTEFDVSGSHDGNDTLLG
FT                   GAGNDILFGQGGNDLLDGGKGNDILLGGTGNDTLIGGQGNDILIGGSGADTFVWKAGDT
FT                   GNDVIKDFKASEGDRIDLRDLLQGESASTIDNFLKITTVDGVSTLQVSSEGKLNAAGGL
FT                   ANADVTIKLEGNNWSNANINSLIAGSDPTIKIDHNNS"
FT   gene            155440..156792
FT                   /locus_tag="PFL_0134"
FT   CDS_pept        155440..156792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0134"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01844"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95546"
FT                   /db_xref="GOA:Q4KKF2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF2"
FT                   /protein_id="AAY95546.1"
FT                   /translation="MRFHLFKALPFALAASFVQAQTLPEAMQKALDVHPEIQAGVNSRL
FT                   AADYQLKAAKGGYLPRVDMLAGYGREGTDNPTTRAGTGSNHWETLNRGESSLRLQQMVF
FT                   DGFATSSEVGRQQATVNSRAYSLLGTSERTALTVAQVYLDVLTRRQFVQLAEDNLRNHE
FT                   RIYDQIKLRTQRGVGSGADLDQAEARMAQARNNLITEQTNLADAQTNYLSAVGEMPDQL
FT                   ERPASFMALLPANLDEARHQMLENSPILRSAESDIVAAEKQYDAAKSAFYPRFDAELGR
FT                   TADNDLDGQNGHNNEWQAMLRMRFNLFAGGSNKADLESKAYQSNQALDIRNNALRVLNE
FT                   ELGLAWNALNNANAQVPIAQQYVDHSTSVRTAYQKQFSLGERTLLDLLDSENELFTASR
FT                   RLAEIQNIQLFTQYRIKATMGELLKSQGVVAPMASVVQSDVKPKVQLPGMN"
FT   gene            156831..158984
FT                   /locus_tag="PFL_0135"
FT   CDS_pept        156831..158984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0135"
FT                   /product="type I secretion system ATPase"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR03375"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95547"
FT                   /db_xref="GOA:Q4KKF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF1"
FT                   /protein_id="AAY95547.1"
FT                   /translation="MESEVSVQLSHDPRGMHDDPLLDGLLTLCFLHQKPASAAMLTTGL
FT                   PLPSQRLSAELLPRAAARAGLQGRVLRRKLEQIPAIAMPALLLLKDGRSAVLLGWQGED
FT                   QARLLLSESDGGEVCVDRQLLADDYSGQVFFAQPQHKFDVNHGSLIPRARSWFRDTLKR
FT                   SRWLYADAIAASLLINIIAMAAPLFVMNVYDRVVPNQATSTLWVLSIGIIGAYIFDLIL
FT                   KGLRSLCLDLAGKKTDLIISATLFERIVGMAMKYRPARVGSFAQNIHEFQSLRDFLASL
FT                   TLTSLIDLPFTLLIFLVIAILGGHLVWIPVLAFPIALCIGYALQKPLVATMEKTMALGA
FT                   ERQSSLIETLAGLDAVKVNNAESERQYQWEQTIGTLSRLELRVKMLSSLAMNITLLIQQ
FT                   LAGVIMIIFGVYQIIDGNLSMGGLIACYMLSGRALSPLASLSGLLTRYQQARVTMTSVD
FT                   QMMELPQERNFDERPLSRSVLQGAIECRQLSFTYPGQQNPALKNINLMIKPGEKVGIIG
FT                   RSGSGKSSLAKLLVGLYQPDSGALLVDGVDIRQIDVSELRHNIGYVPQDIQLLAGTLRD
FT                   NLTSGARYVEDELVLQAAELAGVHEFARLHPQGYELQVGERGQNLSGGQRQNVALARAL
FT                   LLNPQILLLDEPTSAMDNTGEERLKQRLEAVVQSKTVVLVTHRASLLSLVDRLLVVDRG
FT                   QILADGPKAVVMEALKKGQISVA"
FT   gene            158974..160341
FT                   /locus_tag="PFL_0136"
FT   CDS_pept        158974..160341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0136"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01843"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95548"
FT                   /db_xref="GOA:Q4KKF0"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKF0"
FT                   /protein_id="AAY95548.1"
FT                   /translation="MLLKSGFKDSIRRYFKGTDSLQGQPLPEVNKALIEDAPRVIRLTI
FT                   WGIIAFFLFLVLWANFAVIDEVTKGEGKAIPSSKLQKIQNLEGGIVSELYVKEGQIVEA
FT                   GAPLIRLDDTRFQSNVGETETVRLSMLLRVERLSAEVDERELNFPAEAVKEAPGQAASE
FT                   KSLYQSRRQQLHDEIGGLQEQLIQKQQELREFTSKQAQYRQQLGLQRQEIAMSEPLVAQ
FT                   GAVSPVEVLRLKRAEVETRGQLDATTLAIPRAESAIKEVQRKIDETRGKFRSEALTQLN
FT                   EARTELNKASATGKALEDRVSRTLVTSPVRGIVKQLMVNTIGGVIQPGSDMVEIVPLDD
FT                   TLLVEAKIRPQDIAFLHPGQEAVVKFSAYDYTIYGGLKARLEQIGADTITDEDKKTTYY
FT                   MIKLRTDRSHLGTDEKPLLIIPGMVASVDIITGKKSILSYLLKPIIRARAEALHER"
FT   gene            160625..161512
FT                   /locus_tag="PFL_0137"
FT   CDS_pept        160625..161512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0137"
FT                   /product="taurine dioxygenase, TauD/TfdA family"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95549"
FT                   /db_xref="GOA:Q4KKE9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE9"
FT                   /protein_id="AAY95549.1"
FT                   /translation="MSASASAASIAAQAFEIRPLNGAVGAEIVGLDLSRPVNDQDFARI
FT                   HRAHLDHHVVVFRDQRISPEQQIAFSRRFGVLQIHVLKQFLLAGHPEILIVSNIIENGQ
FT                   SIGLGDAGKFWHSDLSYKELPSLGSMLHAQELPAEGGDTLFANMHQAWDNLPEALRKAV
FT                   EGRSAAHSYTARYSETKFEGNWRPTLTPEQLAQVAEVVHPVVRTHPENGRKALFVSEGF
FT                   TTRIVGLPEDESAQLLAELYAHSVLPDNIYRHQWQPHDLVFWDNRSLIHLAAGCPSHLR
FT                   RKLYRTTIQGDAPY"
FT   gene            161540..162577
FT                   /locus_tag="PFL_0138"
FT   CDS_pept        161540..162577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0138"
FT                   /product="putative ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95550"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE8"
FT                   /protein_id="AAY95550.1"
FT                   /translation="MSLSIPFIPRLGRLATAIGLGFSLLAGSLAAPAPAQAEGEIRIAE
FT                   QFGIVYLLLNVVRDQNLIEKHGKEQGVDIKVDWTQLSGGAAVNDALLSGSIDIAGAGVG
FT                   PLLTIWDRTHGRQNVKAVASLGNFPYYLVSNNPKVKTIADFTEKDRIAVPAVGVSVQSR
FT                   FLQYAAAKQWGDKEFNRLDKYTIAVPHPDATAALIAGGTELTGHFSNPPFQDQALENPN
FT                   VHVVLNTYDLLGPNSPTVLFATEKFRNDNPKTYKAFVEALAEAAEFAQHDKGAAADTYL
FT                   RVTKAKIDRAALLKIIDNPQFEFSVTPKNTYPLAEFLYRVGAIKNKPESWKDYFFQDAK
FT                   PLQGS"
FT   gene            162583..163443
FT                   /locus_tag="PFL_0139"
FT   CDS_pept        162583..163443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0139"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95551"
FT                   /db_xref="GOA:Q4KKE7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE7"
FT                   /protein_id="AAY95551.1"
FT                   /translation="MNALLPGHTASNRAAIAQALLAVEQVSLEYRTPQRVVRATHQVSF
FT                   EVDPADRFVLLGPSGCGKSTLLKAVAGFIQPCEGEIRLQGQRVSQPGPDRIVVFQEFDQ
FT                   LPPWKTVKQNVMFPLLASKTLGRREAEERALEYLEKVGLAAFADAYPHTLSGGMKARVA
FT                   IARALAMQPKILLMDEPFAALDALTRRKMQEELLRLWEEVRFTLLFVTHSIEEALVVGN
FT                   RILLLSPHPGRVRAEVHSHQYDLQSLGGVAFQQTARRIHRLLFDEGQSPETETELDFAD
FT                   IRIAY"
FT   gene            163477..164343
FT                   /locus_tag="PFL_0140"
FT   CDS_pept        163477..164343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0140"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95552"
FT                   /db_xref="GOA:Q4KKE6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE6"
FT                   /protein_id="AAY95552.1"
FT                   /translation="MSHSSPAREEYEVVLQPLLQVPLERELPLGQRLWQQGWLRKSLIL
FT                   VLLALLWEAVARYQNNDLLLPSFLQTASALYQGLLSGELLGKVGISLVVLLKGYLIGIV
FT                   LAFALTTLAVSTRLGRDLLSTLTSMFNPLPAIALLPLALLWFGLGQNSLIFVLVHSVLW
FT                   ALALNTYAGFLGVSETLRMAGRNYGLKGLRLVLFILIPAALPSILAGLKIGWAFAWRTL
FT                   IAAELVFGATSGKGGLGWYIFQNRNELYTDKVFAGLAVVILIGLLVENLIFDTLERITV
FT                   KRWGMQR"
FT   gene            164559..165485
FT                   /locus_tag="PFL_0141"
FT   CDS_pept        164559..165485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0141"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95553"
FT                   /db_xref="GOA:Q4KKE5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE5"
FT                   /protein_id="AAY95553.1"
FT                   /translation="MQLPDMNLLVALDALLDEGSVVGAARRMNLSPAAMSRTLTRIRDA
FT                   LGDPVLVRAGRGLVPTPKALELRSQVRDVVEQAALVFRSADKVDLGSLQRRFNVRANDF
FT                   FVGVYGGRLIDTLERQAPLCELRFVPEGDGDDEALREGRIDLRISNTRPLTPEVKVQNL
FT                   FTTAFVGLVREGHPLLDEDITAERFAAFPHISMSRRGIARGPIDAALAEQGLERRVPLI
FT                   APSFHAAMFMLPDSDLILPVPQETLLSVSRLGLRLRSFVLPISLPTLVLTQAWHPRYDK
FT                   DPAHKWFRETLRTSCQATWQEAQPTSS"
FT   gene            165662..167206
FT                   /locus_tag="PFL_0142"
FT   CDS_pept        165662..167206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0142"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95554"
FT                   /db_xref="GOA:Q4KKE4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE4"
FT                   /protein_id="AAY95554.1"
FT                   /translation="MSSLAVAAPASVEAASKPAAIAPPVFGPRIIIGLVGVLLAVLVSG
FT                   LNEMVTKIALADIRGALFIGYDEGTWLVACYTATSVAAMAFAPWCSVTFSLRRFTLCAI
FT                   GLFTLLGVLCPFAPNYESLLLLRTLQGLAGGALPPMLMTVALRFLPANVKLYGLAGYAL
FT                   TATFGPSLGTPLAALWTEYVGWQWAFWQVVLPCLLAMAAVAYGLPQDPLRLERFKQFNW
FT                   RGLLLGFPAICMLVIGILQGNRLDWFESPLICVLLAGGLVLLVLFMINEWSQPIPFFKL
FT                   QMLGIRNLSFALLTLAGVLVVLTAVIIIPSAYLAQVQGYRPLQTAPVMLVMALPQLLAL
FT                   PLVAALCNLRWVDCRWVLGIGLGMLVLSCLGGTHLTSAWIRDDFYVLQLLQIFGQPMAV
FT                   LPLLMLSTGSITPMEGPFASAWFNTVKGLAAVIATGVLDVLTTRRLHFHSTMLVDSLGN
FT                   SPLVDDGVAGLARRLHQQAVVLTSADLYYCMAGLAAVLILLIFWLPTRIYPPRAPT"
FT   gene            167221..168291
FT                   /locus_tag="PFL_0143"
FT   CDS_pept        167221..168291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0143"
FT                   /product="auxiliary transport protein, membrane fusion
FT                   protein family"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95555"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE3"
FT                   /protein_id="AAY95555.1"
FT                   /translation="MTTQNKHKIAIAVAAVAALGVLAYLALPGLFGRAGEQTTNDAFIA
FT                   ADYTLVAPRVAGFIKEVLVEDNQQVKAGQLLALIDDRDLRAAAQAADAETLVAKAQLQN
FT                   ARATLDRQSSVIAQAQAALSAAQAERAFAEHELNRYNHLAGVGAGTVQNAQQARTRIDQ
FT                   ASARLATATAALAAERKQVEILTAQRDAAEGGLKRAQAALEMASYELSYTRIVAPVDGM
FT                   VGERAVRVGAYVTPGSKILAVVPLQQAYVLANFQETQLTAMHAGQVVEVRVDSLGGETL
FT                   HGRVESLAPATGVTFAAVKPDNATGNFTKVVQRIPVKILLEPNQPLAERLRVGMSVEAS
FT                   VDTHSSATSAREVTQR"
FT   gene            168288..169769
FT                   /locus_tag="PFL_0144"
FT   CDS_pept        168288..169769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0144"
FT                   /product="efflux transporter, outer membrane factor
FT                   lipoprotein, NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95556"
FT                   /db_xref="GOA:Q4KKE2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE2"
FT                   /protein_id="AAY95556.1"
FT                   /translation="MSRERSRHRRSHGLRTLLALSLLSLAACNVGPDFRRPQATQVQAW
FT                   SAPAQAAASQAVDSAMQERWWEVFNDPQLSALSHRVLSDNLDLQLATSRLQQSRAARQV
FT                   ITAERYPSTSANGGYGRKRNSAEGLNDPSGNNGKSAFNLWEAGFSASWELDFWGRVRRE
FT                   TEAADATLEVAENDRRGVLLSVLAETAQDYIQLRGVQSTRAVTEQNLEVARHSLKLSQL
FT                   RLADGVATDLDVAEAAAQVATIEAQLPELQQRQAQLINALSLLLGEPPQALHQELASDA
FT                   PVPQPPSQVAIGLPSQLAERRPDIRQAEARLHAATASIGVAKGDFYPRITLSGNFGSQA
FT                   LQLADFGSWSSRQFGIGPQFSLPLFDGGRLRGMLQLREAQQQEAALAYQQTVLRAWHEI
FT                   DDQLTRYNASQLRRDSLAEAVRQNQIALRTAQQQYIEGVVDFVNVLTVQGALLATQEQL
FT                   VESSAGVSLAMVGLYKALGGGWQSVYPLQAASQPG"
FT   gene            169840..170349
FT                   /locus_tag="PFL_0145"
FT   CDS_pept        169840..170349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0145"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95557"
FT                   /db_xref="GOA:Q4KKE1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE1"
FT                   /protein_id="AAY95557.2"
FT                   /translation="MQATTDGNAQLHRLYQDHHGWLQGWLRKRLGDREHAADVAQDTFL
FT                   RLLLSGRFPGQQESRSYLAQIARNLVVDQWRRARIERAYLESIAHLPEPQTPSLESRAL
FT                   ILETLMQIDAMLDRMPDKVRQAFVMSQFEGLGYAQIAERLEVSVSSVQKYMTRAIQACY
FT                   QVLYAE"
FT   gene            170346..171299
FT                   /locus_tag="PFL_0146"
FT   CDS_pept        170346..171299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0146"
FT                   /product="sigma factor regulatory protein, FecR/PupR
FT                   family"
FT                   /note="identified by similarity to SP:P23485; similarity to
FT                   PIR:S46356; match to protein family HMM PF04773"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95558"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKE0"
FT                   /protein_id="AAY95558.1"
FT                   /translation="MKPHQAPIAPSVVEQASEWLMLHWGGELSAQQRSAFDAWQQADPE
FT                   HQRAWQRLQQLQQTLQGVPEHSTHVLLAKAPDQQRRAALKLLGLLLVAGGSGYLVQDSQ
FT                   PWRAAFAGQRSATGEIRHLTLSDGSRLDLNSASAVDLLFSASERRIRLIQGEILLTSGH
FT                   DPSRPLIVETPAGDIQALGTRFAVRELDGGTRVDLYEGALRISPRHAQALQLNAGERLW
FT                   FDAGRVSARQVAQVNASSWSEGRLIAERQPLGQFVAELSRYRPGVLRCDEQVAGLLLTG
FT                   VFPLADSDAVLAALERSLPVRAHAVTRYWVTLKPRG"
FT   gene            171398..173863
FT                   /locus_tag="PFL_0147"
FT   CDS_pept        171398..173863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0147"
FT                   /product="TonB-dependent outermembrane ferrichrome
FT                   receptor"
FT                   /note="Transducer; identified by match to protein family
FT                   HMM PF00593; match to protein family HMM PF07660; match to
FT                   protein family HMM PF07715; match to protein family HMM
FT                   TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95559"
FT                   /db_xref="GOA:Q4KKD9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD9"
FT                   /protein_id="AAY95559.1"
FT                   /translation="MPYQTAASILTLGATARRRAFVALLAVAPVLPGIVQAEPGSQSQA
FT                   RDYQIAPGNLDQVLNRFASAAGILLSVDASMTAGKHSQGLQGRYEVAQGLHQLLAGTGL
FT                   QATQSGASWGLQPVAQGAALELGPTRIGATQVDENAWGAVPGIVAKRSATGSKTDSALV
FT                   EIPQTINVIGAKEISARGAQSVTEALLYTPGMTGGGFSDRVKIFDEPTSRGFSPTPLYL
FT                   DGLHLPYGGGSTGGALQIEPYSLERIEVLKGPASVLYGQNQPGGIVNMVSKRPTETPVH
FT                   QLKVEAGSYDHKSIALDLGGPLDEQGQFLYRLTGLASDSQDAIDYVQRQRQFIAPSLTW
FT                   RPDDDTQLTVFAQFQKDNDVPEAQGLPSVGTVFANPNGKIDRDLFLGEPGVNAYDRDQF
FT                   VVGYEFSHRLNDVWTLKQNARYADVDDRYRAPLHGYKFVTNPKTGLDDQRYMTRYGVDW
FT                   KQHNKVFGVDNIAQAEFDTGPFNHTVLVGLDYYHFNSKYHGKYDYNPPILDMFTPTYGQ
FT                   SLNFGNAYQWDNTIIQTGLYVQDQIKYEKWVLVLGGRNDWAETDNKAPLGGAHTNVKNQ
FT                   SFTGRGGLVYLFDNGLAPFVSYSESFLPLSGTSFQRSAFEPSTGKQYEVGVKFQPPGQE
FT                   SFVQVSAYQLDQENILTTDLANPGFSIQSGAVRSRGIELEAKASLSESLDVIASASRND
FT                   IKYTKDNDGREGRHPAGMPPLTAALWLNYTILGDTPLAGLGAGVGARYVKGSYGTDYDG
FT                   AFQIPSYTVYDAGLTYDLEKSPLQLKGVKLALNVKNLTDKTYVANCTSIWDCYYGEGRT
FT                   MVSSLTYDW"
FT   gene            complement(173960..174706)
FT                   /locus_tag="PFL_0148"
FT   CDS_pept        complement(173960..174706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM86803.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95560"
FT                   /db_xref="GOA:Q4KKD8"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021488"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD8"
FT                   /protein_id="AAY95560.1"
FT                   /translation="MGPVAALLLVGKRLGYGLLPLWLCWATPASAAVDAADYDAFWLWS
FT                   GVKTQPVLGQARTLYLLQGQISRSRRHPASGVQLIAQGLPVSRLRQEQVWVVYRAHTLA
FT                   WPEPLYDQLLGQVRRWQATGTQVVGIQIDFDSSTHDLERYGHFLRNLRQRLPAHYRLSI
FT                   TGLMDWGSNADPQAIGQLKGVVDEVVVQTYQGRRSIPNYASYLPRLDRMGLPYKVGLIQ
FT                   GGEWQEPQALRDSPWFKGYVVFLQNP"
FT   gene            complement(174676..176868)
FT                   /locus_tag="PFL_0149"
FT   CDS_pept        complement(174676..176868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95561"
FT                   /db_xref="GOA:Q4KKD7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD7"
FT                   /protein_id="AAY95561.1"
FT                   /translation="MRKLLLSALTLTALCAGQAQASSDDICSPSWSLYSNRLDGCSNLP
FT                   FLSPGNDSRVNLRLLLADQGSLPLAPRALTQDELGMGYGPVPFMHYRLHPAQPELDPDT
FT                   GNPPKPGPSPATEQLDSLLQAVGLRRDSKEAAGNGFLSGEGSRCRSNSDASALAFVEQL
FT                   DQAPLSPEERQALAEARVQLLASCDWNASEMSKLLPANLNSAAAKAFAGYLQAAADFYS
FT                   GRFNEAGNGFAALKDNPQPWLAETAAYMSPRTLLNLAQQNAFDEWSMVNLEHVDKPVLQ
FT                   QAGAGFEAYLKTYPQGRYAVSAKGLIRRVHWLTGDTQALAEDYAWQLTQAPGTPRNMPL
FT                   DDLVEEVDYKLLSLPEDHFKAPLLLAVKDLMRMRDAPSAPLTRDALQQQKALFASQPAL
FT                   FDYLQAAFSLYVEKQPAAALKQLPSQVPAQLDYLSFSQQTLRGLALQAQQDWKGAEALW
FT                   LQLLPLAQQPLQREQLELALAYSYERSGQLAKVFADDSPIKTAQVRAILLRQVASPQLL
FT                   RQQAQKAESPAERNAARFILLYKDLTRGQYAAFGKDFEQLPPTLPDASLAASLGYIYLD
FT                   TPPLQDFHWDGPQPEEEKPDYRCPSLLETAALLQRDPKAPAGLLCLGEFMRFSGFDRMP
FT                   LDTPPPAQNLGGTQDTFPGKPFSRLDGYQVVINNPKASRDDRAYALYRAINCYASSGHN
FT                   NCGGAGVEPAVRKAWFRQLKTKLGDTQWAQSLRYYW"
FT   gene            177195..178805
FT                   /locus_tag="PFL_0150"
FT   CDS_pept        177195..178805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0150"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95562"
FT                   /db_xref="GOA:Q4KKD6"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD6"
FT                   /protein_id="AAY95562.1"
FT                   /translation="MDFRRAPELIGRLQEQAVVPREQGVQRLMRLALEYWLLPVLLLAA
FT                   AVRFYDLTAAAIWGDEGSSLVLSQYSLSEIWFHAARDVHPPLYFMLLRGWIELFGDGIF
FT                   SIRTFSALPGIVTVGLGMWLVALLATRRAAILAGVLLALLPTAVRYSQEVRMYALLGLL
FT                   LLGATLALVYWLRQPSRPGYLVSYALLMTLAFYTHYFTAFCVLAHWLYLAVSGVRAEGG
FT                   GRLVTRPAWWLANAAIVLLFLPWVPELLDLLRHMDELKANGDVGWEPVVTWSSLPAMVW
FT                   QLLIQDEGDNLPGALFVGMPLLLLAVCSVLAWRDGAPARFGGLLASFTLLPLLLVFAVS
FT                   FASPVFIERYLTAYALGLPMIMAVLIDRWLKTARLVALALLLGFVGLEAVGLKNNIDVD
FT                   ANDQISVMVDYVNRHYVAGDRIVISDMLWYLSYVYYNRTDAQPMLYTPPLPGGTSSRPN
FT                   AYGFGTLIDHPDQVYLDQLSALSVGSGRYWLVGSDDQSEEFAPLPQGWHKVGQFAAGGT
FT                   RARLFVLCGSAAGASCAGQ"
FT   gene            178915..179376
FT                   /locus_tag="PFL_0151"
FT   CDS_pept        178915..179376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0151"
FT                   /product="putative YbaK/prolyl-tRNA synthetases associated
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF04073"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95563"
FT                   /db_xref="GOA:Q4KKD5"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD5"
FT                   /protein_id="AAY95563.1"
FT                   /translation="MRMARTVQRSLEQAACEFDLVSHPHSASSLETARVAGVPAERVAK
FT                   SVILDDHHGHYLMAVLPASRHLDLGKVRGSGEWQVTRESTLAHLFNDCERGAVPALGES
FT                   YGLDVVIDPLLTRQKDIYLEAGNHHNLVHMSMAQYLKLVPHAEVCEVSH"
FT   gene            179391..179636
FT                   /locus_tag="PFL_0152"
FT   CDS_pept        179391..179636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95564"
FT                   /db_xref="GOA:Q4KKD4"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD4"
FT                   /protein_id="AAY95564.1"
FT                   /translation="MEAPTHSLPALFKQLGLADDPVSIERFIATHSPLKPELHLADAFF
FT                   WSESQADFLRTEVLDDADWAEVVDQLDVLLRKGRGG"
FT   gene            179701..179946
FT                   /locus_tag="PFL_0153"
FT   CDS_pept        179701..179946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0153"
FT                   /product="prevent-host-death family protein"
FT                   /note="identified by match to protein family HMM PF02604;
FT                   match to protein family HMM TIGR01552"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95565"
FT                   /db_xref="GOA:Q4KKD3"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD3"
FT                   /protein_id="AAY95565.1"
FT                   /translation="MQSILADKAVSVSELKKNPSAVLSGAQGGPVAVLNHNRVMGYMVP
FT                   AEVFEALMERLDDLELAEIIRERSHETPVPVSLDDL"
FT   gene            179936..180217
FT                   /locus_tag="PFL_6236"
FT   CDS_pept        179936..180217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_6236"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_6236"
FT                   /db_xref="EnsemblGenomes-Tr:AEK81700"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:F9XXF1"
FT                   /protein_id="AEK81700.1"
FT                   /translation="MTYSLEFLPSAHKEWNKLGHTLREQFKKKLAERLEVPRIPADALH
FT                   GLPDCYKIKLKASGYRLVYQVIEERVVVCVVAVGKRERGTVYEQARKR"
FT   gene            180360..180788
FT                   /locus_tag="PFL_0154"
FT   CDS_pept        180360..180788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0154"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by similarity to SP:P0A8W2; match to
FT                   protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95566"
FT                   /db_xref="GOA:Q4KKD2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD2"
FT                   /protein_id="AAY95566.1"
FT                   /translation="MNISSGMVVASRHWRRICQTTLVNFGISEACAVPLLMIGRLGEGV
FT                   RQVTVAQAAGMESPSLVRLLDQLCSAGYVCRSEDPHDRRAKCLSLTDTGRELVQAVESE
FT                   LVRLRHEVLEGIGSADLEAALRVIRAFESASHVPVLPS"
FT   gene            180785..182872
FT                   /locus_tag="PFL_0155"
FT   CDS_pept        180785..182872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0155"
FT                   /product="putative fusaric acid resistance domain protein"
FT                   /note="identified by match to protein family HMM PF04632"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95567"
FT                   /db_xref="GOA:Q4KKD1"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD1"
FT                   /protein_id="AAY95567.1"
FT                   /translation="MKGFFTGMPPARDWFYGVRTFAASMIALYIAMLMQMPRPYWAMAT
FT                   VYIVSSPYVGPTSSKALYRAIGTFLGAAAAVLFVPMFVQSPYLLVVIIALWTGILLFLS
FT                   MHLRTANNYALMLAGYTLPLIALPVVDNPLGVWDVAEARTEEIFLGIVCAAVIGSMFWP
FT                   RRLAPVFVDSAAKWFADAALYSQRFLARNVQPEEVSGLRASMVGTFNTLELMIGQLPHE
FT                   GARPQTVRNTKELRGRMINLLPVVDALDDALYALERRTPELVAQFAPLLAKADEWLQGT
FT                   ARDASVERWQALRDELEALQPSPEALDDRRQLLMSNALYRLGEWIDLWQDCRSLQHAIQ
FT                   SESQAPWRAVYRHWRLGRLTPFLDRGLMLYSAGSTVLAIIVASVLWILLGWTDGGSAVI
FT                   LAAVACSFFASMDDPAPQIYRFFFWTAMSVLFASLYLFLILPNLHDFPMLVLAFAVPFI
FT                   CVGTLTVQPRFYLGMLLTIVNTSSFISIQGAYDADFLSFANSNLAGPMGLLFAFVWTLI
FT                   ARPFGSELAAKRLTRFSWRDIVSLSEPATLAEHRHMGAQMLDRLMQHLPRLAMTGQDTG
FT                   IALRELRVALNMLDLLAYAPRVQGVAQSLLRQVVAEVGEYFKACLKAGERLPAPSGLLM
FT                   TLDRTRRALGSQGLQGDHETRLHLLHALSGLRLALLPGVEFVATGELEEPLPHGIDGAP
FT                   L"
FT   gene            182869..183078
FT                   /locus_tag="PFL_0156"
FT   CDS_pept        182869..183078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN65810.1; match to
FT                   protein family HMM PF07869"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95568"
FT                   /db_xref="GOA:Q4KKD0"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKD0"
FT                   /protein_id="AAY95568.1"
FT                   /translation="MIGDLDISGVFLPTLLVLMGITYGLYLLVHGVLTRLHFYRLVWHR
FT                   ALFNVGLYALLLGAVDSLSRYLMT"
FT   gene            183075..183965
FT                   /locus_tag="PFL_0157"
FT   CDS_pept        183075..183965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0157"
FT                   /product="auxiliary transport protein, membrane fusion
FT                   protein family"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95569"
FT                   /db_xref="GOA:Q4KKC9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC9"
FT                   /protein_id="AAY95569.1"
FT                   /translation="MKKPLLTIGRVVLTLLVVTFAVVVVWRMVMYYMFAPWTRDGHIRA
FT                   DIVQIAPDVSGLIQQVQVRDNQLVQRGQVLFSIDQDRFKLALRQAKAALADRQETLAQA
FT                   QREAKRNRGLGNLVPREQLEESQSREARAQSALAEAQVAVDSAQLNLDRSVVRSPVDGY
FT                   VNDRAPRTQEFVTAGRPVLSVVDSNSFHIDGYFEETKLDGIHVGQAVDIRVIGDRARLR
FT                   GHVESIVAGIEDRDRSSGSNLLPNVNPAFSWVRLAQRIPVRIAFDDVPADFRMIAGRTA
FT                   TVSILDDQAKQEPGQ"
FT   gene            183962..185410
FT                   /locus_tag="PFL_0158"
FT   CDS_pept        183962..185410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0158"
FT                   /product="efflux transporter, outer membrane factor
FT                   lipoprotein, NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95570"
FT                   /db_xref="GOA:Q4KKC8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC8"
FT                   /protein_id="AAY95570.1"
FT                   /translation="MNNGARLALAGLGLLLSACQMVGPDYQVPGDAAVQRKDLQGQLSA
FT                   KGANVVSAPVPADWWRLYQDPRLDQLVQQALASNTDLRVAAANLARARAQVDEAQAAGG
FT                   WSGGVKAGVERLQESGEAFLLPEKVPVANVGNLSISTSYQFDLFGTLQRGIEAAQANAD
FT                   ATQAAADTARITLVADVVRAYTQVCAANEEREIAEHSLSLQAQSTELTQRLRDAGRGDE
FT                   TQVTRSQTQFKSLRAELPRYEAARQSGLFRLSMLLAKPLDQLPAGTDSCAQLPHITQLL
FT                   PVGDGAALLKRRPDVRQAERQLAAATARIGVATGALYPDISIGATVGTVGILDNLGKPS
FT                   TNRWGFGPLISWTVPANGARERIHEAEAASQGALAHFDGVVLNAIRETQTGLAQYSAQL
FT                   QRRDALADAEQSAQLAADQTHRFFQAGRASFLADLQATRTYTDMRAQLAAANTQVAMSQ
FT                   IDLFLALGGGWESGRTQGPEHAKP"
FT   gene            185449..186267
FT                   /locus_tag="PFL_0159"
FT   CDS_pept        185449..186267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95571"
FT                   /db_xref="GOA:Q4KKC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC7"
FT                   /protein_id="AAY95571.1"
FT                   /translation="MQRAFQPIKACDGHGDSNNEKPLCSGLLVRALRPGAAVCHLLLRH
FT                   HAGPSDRQGPGVPRQRQRVDRGDGHRCGGLGLLSGPENQEKTARTEQDPGGHLGHQGGL
FT                   APGRNRIRPLLLGQLLATGADLRRSHGRTHRHPAGKEPGGPEEAVHAAGQASRGRSPLA
FT                   EQCPGAVGCRHRHGAGALPAGFLRPTGRIPGQQRGDRPGFRGPGVHLERSAQELRSSAR
FT                   CLGNRILLKAPSPGPVTAAAAGLRQPLPWPSPRAPRFFTFKDWARPSRQW"
FT   gene            186363..187865
FT                   /locus_tag="PFL_0160"
FT   CDS_pept        186363..187865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06097"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95572"
FT                   /db_xref="GOA:Q4KKC6"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC6"
FT                   /protein_id="AAY95572.2"
FT                   /translation="MNKSAGVLLGIVVAVGAISAGGAWYTGTKLEGVLQQQVIESNKEL
FT                   QAALIGYDATATLELVSLERGVFSSNARYRLKTQGEVFNGGLELMIADHIEHGPLPFSR
FT                   LIRLKWLPVMASSHYELENNGQTDKWFAATKGAAPFKGVVNVGYDLSAEGTLDFAPMEL
FT                   ALDELNNLKFSGLNATFSVGDNRRKAKVDGYMDSLSLFLSSPDKAPLKLEINGLTLASN
FT                   LQKSSFDYFLGQNTLELSGLKATFGDKQSVLTLKHFEQKTFSEETGSTVAGRADYRVGE
FT                   IAFDGKTVGSAEMLWSMKSLDSQGMLDLVQVYQNVLQPYQKAATEASAEGEPAPELQMS
FT                   DAEQVKVRAAVNKVLEAKPQIALESLAFKTAGGESRFSLSLDLAKPQSLELPPAELGKQ
FT                   LVSQLDAKLSLSKPMVADIAALQAQVEGQTDAKLIAEQSAATAEMLSAMALSTQLAKLE
FT                   GNDVVSALHYANNEVNFNGQKMTVEQFIGLVMSKLGGVGAQQ"
FT   gene            188141..190627
FT                   /gene="pgaA"
FT                   /locus_tag="PFL_0161"
FT   CDS_pept        188141..190627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgaA"
FT                   /locus_tag="PFL_0161"
FT                   /product="biofilm PGA synthesis protein PgaA"
FT                   /note="identified by similarity to SP:P69434; match to
FT                   protein family HMM PF00515; match to protein family HMM
FT                   PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95573"
FT                   /db_xref="GOA:Q4KKC5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023870"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC5"
FT                   /protein_id="AAY95573.1"
FT                   /translation="MQRTVHPARRYGLRPLFRLALCSQLLWPGLAFADAAYDQLIIQAR
FT                   AGSYAPALNHLRQVPADRLNNGLVSDHLQIASWAGLDAEVVKVYETQGRNRVLPAQALA
FT                   ATARAYRNLKQWDNATQVYRLALQRDPQNADLQLGLALTQADAGQPAEAVARAKALVAA
FT                   KPDDPNRRLALGYALTRANQPYDALAAYDQAFIRAGDKPEVIREYIYALQRARLPEPAL
FT                   RLARQHPGLIDPVIQRRIQADLAAERVRLSELASRSEKERFVVADRALADYDTLFAAWG
FT                   KDPQAQDDLTRWRIDRLGALKSRARTAEVISEYEQLTAAGVAIPPYALRWVAASYLDQR
FT                   QPEIAADLYRRVFSAPDGDADHRLEDTTALYYALLESERPEEALKLANDLADSVPQRIQ
FT                   LTGQTVGDPNDDWVDAQLLAAQAGADGTAGADLPGTEQRLETLAGQAPGNISVRLAQAD
FT                   LYRVRDWPRLSESLLKETESVAPRDVSLEVSQGHTAQDLQEWRQLDALTDDVVERFPES
FT                   RQVQRLAREREVHDMAELRVMTYGGKSYGGGSNGAGAVSGSRDFGIESRLYTPPIAEDW
FT                   RLFGGIGYAMGDFSEGIGNHRWQVLGVERRTRDMTLEAEVSNHSYGYGDKTGARVSLAR
FT                   DIDDHWQYGGSLDYLSANTPLRALNSDISANGGSAFLRWRANESREWKLSLSPSHFSDG
FT                   NNRFEALLTGREGVYRSPKVQVDLGLEVGASHNTLEDTPYYNPEADLSVLPTVTVNHVL
FT                   YHRYQTSWSQQFQAGAGTYSERGYSTGAVGLLSYGQRYSWNDVFDIGGVLSVINRPYDG
FT                   DRETDLRLAVDLTYRF"
FT   gene            190642..192639
FT                   /gene="pgaB"
FT                   /locus_tag="PFL_0162"
FT   CDS_pept        190642..192639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgaB"
FT                   /locus_tag="PFL_0162"
FT                   /product="biofilm PGA synthesis lipoprotein PgaB"
FT                   /EC_number="3.-.-.-"
FT                   /note="identified by similarity to SP:P75906; match to
FT                   protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95574"
FT                   /db_xref="GOA:Q4KKC4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR023854"
FT                   /db_xref="InterPro:IPR032772"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC4"
FT                   /protein_id="AAY95574.1"
FT                   /translation="MRLINRCILLLGALVLSACSQPAADFLAPAQRPLPNTEAPWPKNH
FT                   VLGIAYHDIEDRDPDQRVVAVRTERMIEQLAWLRENGYRPVTVDQILAARNGGPELPAK
FT                   AILLTFDDGYSSFYTRVLPVLRSYHWPAVLAPVGTWIDTPADQPVNFAGELRPRSQFLT
FT                   WAQVREISRSGLVEIAAHTDHSHLGILANPQGNLQPAAATRRFDAASGRYESEADFQAR
FT                   MRQDVTAISNKILAVAGYRPRIWVWPYGTADGSTLQVVDSQGFKLALTLDDGLDTLDNL
FT                   MSSPRFLVVSDPDGMHFSNSIVGAETAAPMRVVHVDLDNVYDPDPKQQEVNLGKLVQRM
FT                   ADLGANTVFLQAFADPKGDGLVQSLYFPNRHLPMRADLFDRVAWQLRTRAHVKVYAWMP
FT                   VLSFALDARLPRVTRWDPATGQSTIDPKQYQRLSPFDPTVRRQIGDLYEDVARMTSVDG
FT                   ILFHDDAVLSDFEDASPGALRAYAAQGLPGSMAALRDDPATLQRWTRFKSRYLIDFTHE
FT                   LAAKVRAIRGPQVQTARNLFAEPIINPQSETWFAQNLDDFLVSYDWTAPMAMPLMEGQS
FT                   QRHSGPWLEALVDQVRARPGALQRTVFELQARDWARKPASDLSAQQLADWMGRLKRQGA
FT                   TNFGYYPDNFLENSPDLKTLRPALSNKWSP"
FT   gene            192643..193992
FT                   /gene="pgaC"
FT                   /locus_tag="PFL_0163"
FT   CDS_pept        192643..193992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgaC"
FT                   /locus_tag="PFL_0163"
FT                   /product="biofilm PGA synthesis N-glycosyltransferase PgaC"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by similarity to SP:P75905; match to
FT                   protein family HMM PF00535; match to protein family HMM
FT                   PF03142"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95575"
FT                   /db_xref="GOA:Q4KKC3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC3"
FT                   /protein_id="AAY95575.2"
FT                   /translation="MVDRIFALVVLALVLGVPLGLIFVLTGEFLMDFVFYYPLFMSALW
FT                   IAGGLYYWLHWERHWPWSDDTLPPPLAGEPLISILIPCYNEGDNVADTIHAALAQQYPN
FT                   IEVIAINDGSKDNTAEVLDRLAAQDPRLRVLHLAQNQGKAVALRMGAVAAHSEYLVCID
FT                   GDALLAPNTAAYLVAPMLDNPRLGAVTGNPRIRTRSTLVGRVQVGEFSSIIGLIKRTQR
FT                   VFGKVFTVSGVIVAFRRTALHRVGYWSPDMITEDIDISWKLQLDHWYVFFEPRALCWIL
FT                   MPETLRGLWKQRLRWAQGGAEVLFKNIRGIWEWRHRYLWTLLFDYCLSTGWAFTFLLSV
FT                   IFWALGKFIVMPEAIAVHTIVPPAFTGLVLAMVCLTQFAVSILIDRRYEKDLWKTMFWV
FT                   VWYPLVFWFISLFTTLVSFPRVLFGEHQKRARWVSPDRGIKPIDDEEEVR"
FT   gene            193992..194516
FT                   /gene="pgaD"
FT                   /locus_tag="PFL_0164"
FT   CDS_pept        193992..194516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgaD"
FT                   /locus_tag="PFL_0164"
FT                   /product="putative biofilm PGA synthesis protein PgaD"
FT                   /note="identified by similarity to SP:P75904"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95576"
FT                   /db_xref="GOA:Q4KKC2"
FT                   /db_xref="InterPro:IPR023829"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC2"
FT                   /protein_id="AAY95576.1"
FT                   /translation="MKIIRTRQRPFMVIVDVVLTVLAWVGLLYLLVRGLIPLLDSHEGP
FT                   RIEAGMLDALTTLQFYAWVAVLNAVLLISWARYRQRRNKSYPPRLPAPVVDDKRLSETF
FT                   KLNDATFAQMRQPGTMIVHNDEEGGISHVTTQFYRILPEDQQHPPLRVEPPPRVIHLRS
FT                   EGDEGKKTGED"
FT   gene            195002..195319
FT                   /locus_tag="PFL_0165"
FT   CDS_pept        195002..195319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95577"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC1"
FT                   /protein_id="AAY95577.1"
FT                   /translation="MSLSTLGMRLCCALSCLLLFSALHSAVVAPMPGTTFNLGAQSFIR
FT                   GYKDPSLNGDSGYCWRNDLRWTRPMGNHLVTGVSFTHSLERPEALSERETPTHFRLDFY
FT                   L"
FT   gene            195347..204481
FT                   /locus_tag="PFL_0166"
FT   CDS_pept        195347..204481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0166"
FT                   /product="adhesin/hemagglutinin, HecA family"
FT                   /note="identified by similarity to GB:AAO56709.1; match to
FT                   protein family HMM PF05594; match to protein family HMM
FT                   PF05860; match to protein family HMM TIGR01731; match to
FT                   protein family HMM TIGR01901"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95578"
FT                   /db_xref="GOA:Q4KKC0"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="InterPro:IPR033806"
FT                   /db_xref="InterPro:IPR040559"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKC0"
FT                   /protein_id="AAY95578.1"
FT                   /translation="MDVRQLAFLARQPSATLQARDTFWGLSKRGLAFILANVMFWQPVV
FT                   AMADGIVVNGSGTTLGQAGNGVPIVNIATPNGSGLSHNKFSDYNVGQQGVILNNATGRT
FT                   QETQLGGIILGNPNLGGRAANVILNEVYGGSPSQLKGYTEVAGQAAHVIVANPYGVTCN
FT                   GCGFINTPKATLTTGKPVIENGQLQRYQVDQGSVAIEGAGLNASNIDQFEIITRSAKLN
FT                   AEIQARHLAVIAGANDVDAKTLSATARTANPADAPQLAIDSSALGGMYAGAIKLVGTEA
FT                   GVGVKLDGKLIASGGDIQLDADGQLRMADATAEKGAVAIKAGSLEAQGAVYAGSELKVR
FT                   TRGDLSSQKTLAARDSIQLDSGGQLSNQGIIEAGVNADNSRNANGDISLNARDLDNRGK
FT                   SIVASRDLTLNTAQTLDNRGGTLSGQRQVKVSAGALDNSHQGKLLSAERLQLDAEQVRN
FT                   GQGGLIKSQQSLDATLGHLGNSGGELSSQGSSTLVLAGMDNLTGVVLAQQTLEITGTAE
FT                   LDNQGGLLSGWQGLTLNGTGLNNSNKGTVSSLKGGVEVTLSDALNNSQGGALVSQQALD
FT                   VKAASLDNSHQGVISSAGEQSLKLRDLLDNSQGGSIDSAATLTLQAMTLGNNGGTLDAA
FT                   GDLTFTGTDLDNGTGTFTGKTAVTLNLLGALNNTHGKLASGGPLRIERAGQIDNRGGQM
FT                   ASQGLLSLFAASLDNRNRGTLMANDPLTLTLDGALQNGGDGLIYSQTGGLHVQAGSLTN
FT                   GKGTLQSQGALNLSTGDIDNQSGRILARNGNLNIGAGHLDNRGGVLSSVQGSMIADLRG
FT                   ALKNGYDPSNNRQGGVTQAQRLTLKALAGIDNDGGRISAQSGDALLTTGDFDNRNGGLY
FT                   AKGLVKVSGGHFDNSGNNGQIAGQQINFDLSGALNNHKGIIESDSSLTIKAASLDNQTG
FT                   QLRALGDGGDTRLELGGLFDNRDGSLETANQNLAFDAGSFNNRGGSVLHSGNGLFGLSM
FT                   ANLEDVGGRLKTAGQLTLEGERWTNSSSIQAGKLTVNVNHLTQARTGQLLAGNGLIGSG
FT                   VNWINDGLIGSDAGVNIDLSGHYSSKGRLSSFGQLDLKAAQVDLADSASIAGGGNTTVS
FT                   VFGQLNNAGRLSAAAGLTLNASGINNQGTLGAAQNLTLTTGGLLNDHGLVFSGDDMGLR
FT                   VDTLTNSYGNVYSLGHLTIDRDGQGALASRIANRSGTLQSDGSMTLAASTLENMRDVLA
FT                   TNNGGIYTARIGEVACIEGYNAGDCGGKRNHVWEIVQREKFEVTEASAASSIAAGVNLN
FT                   INAGDLLNQSSSISAAGNLMATVNNLTHSGVETGETETTRVFMSARTKNASAWYNVANA
FT                   VTNRYWFQSADYTPDDLGGLEGALAGFIGMTEREWVGLGTTKKLAGGDQSYAAVIQAGG
FT                   AVSIKAGNGFDSSVVRPGYTYVGSGARTDTQVPGTAFATRISLSPQLPPDLTQQQVNPL
FT                   ALPGFSLPAGQNGLFRLSGQSSSAAQAPAQIAGLPDAANLTRPHKYLIETNPVLTDLKQ
FT                   FMSSDYLLSSLGYNPDDSAKRLGDGFYEQKLIQQAVQARTGQRFIDGQNSDEQLFKYLM
FT                   DNAIQSRQQLNLSVGVTLTSEQVAALTHDIVWLESHEVNGEQVLVPVLYLAQAKNRLAP
FT                   NGALIAGNDVNLIAGQDLNNVGTLRATNNLSAQAGQNLINSGLVEAGNRLDLLAGNDLV
FT                   NKAGGIIAGRDVSLAATWGDVINERTLTSHQSSNGSYAQQRDFVDNAARVEAANSLVIS
FT                   AGRDINNNGGVLKSGADTSLKAGRDVNLSAVEQVVSNDRGVRYNDLSVTQNGSSLQAGR
FT                   DLAISAGRDITAIASQIEAKRDVAMTATENMSLVSAANEQHAYSKTKKVTSQEDHVQQV
FT                   GTTLVAGGNVALKAGEDLALTASRVTAGDEAYLYAGGDVNLSAGQNSDYSYYRKTKTSS
FT                   SGLSSSQKTRIDSSNSITQQGSSVSGDTVVIRAGQDIGATASDIVSTHSTSLVAGRNVE
FT                   IDSATETYEQSHSTSKKKSGLLSSGGIGFTLGSTSAQNTSSSTTENAKASTIGSVLGNV
FT                   DIQAGKDLTLKGSDVIAGKDISLVGQNVSILAAENHNKSEQTSKIKTSGLTLALSGTVG
FT                   SAVDAAYQTTKQAREEDDSRLSALQGIKAGLTGVQAWQAAQQGVGMNGDNIGQFVGISI
FT                   SLGSQQSSSKQTQEQLVSQGSSLTSGNNLSIVAAGSGTAGADGDIRVQGSQLKAGNNVL
FT                   LAAERDIQLEAAANRQKLDGKNSSSGGAIGVSLGVGPNGAGLSIFANGNKGVGKEKGTG
FT                   TTWTETTLDAGNQASLISGRDAVLKGAQVNADKITAKVGRDLTLQSLQDTDDYKSKQSN
FT                   VSGGASFTFGTMTGSASVSVSQSKIDSKYQSVQEQTGLFAGKGGYQVEVGKHTQLDGSV
FT                   IASTAETDKNRLSTGTLGWSDLKNEAEYKSQMQSASVSSGNGGADGFTSNMPSGMLIAY
FT                   NHGGSASGTTSSAISNGTLDIRDPGQQKQDIATLSRDVEHANGSISPIFDKEKEQKRLR
FT                   EVQLIGEIGTQVTDIVRTEGQLKADQEASKELEEKGIYRPGSNASKEEVEKYQTKLIAT
FT                   DAYQQIMGKYGTGGDYQRVAQAVTAALQGLAGGDIGSALAGASAPYLAQLIKKSTGDNP
FT                   ALNTMAHAVLGAAVAQAQGNSAIAGAAGAAGGELAARLITQQLYGTSDTSSLSEEQKQT
FT                   VAALSTLAAGLAGGIAKGDSAGAIAGAGAGKNAVENNHLGTGVNIFGHQLGKDQVAEFG
FT                   NELKASCGDSGGLQACLKTYDTWKETSYRQGGLETKEAQAGWEEFVEAVYTEKVLPLCK
FT                   GNAACERNVATHMAVTTVTYAGDSVGIGQAIGEATRAVNLANGNWVRVGLQVVEDASLL
FT                   ATLGSMLGVAAKGTGTSVVPRKGSVSFENGKTFESLSASEQQGLKAIQNLGYDVHVPLE
FT                   ASKKGISGLPTAEFNVQGFGKVDVYAPNNLNPKTISREIEKKVVQGQANSVVVVVPESF
FT                   SKVDMYKSAAAAFGKNKGGEPIPLKQVIFSQGEKTIQLDRQAINSLLGR"
FT   gene            complement(205065..205427)
FT                   /locus_tag="PFL_0167"
FT   CDS_pept        complement(205065..205427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0167"
FT                   /product="putative DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95579"
FT                   /db_xref="GOA:Q4KKB9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKB9"
FT                   /protein_id="AAY95579.1"
FT                   /translation="MAENITGFAERLRSLRKQKNLSQTELGQLAELHYTHIGRYERGTS
FT                   RPSGDTLKRLADALDVSSDYLLEGASDDAAKAKFEDRELLRQFQEVEQIPEEDKKVVKT
FT                   LLDAFLIKKHLQTLTR"
FT   gene            complement(208815..209081)
FT                   /locus_tag="PFL_0168"
FT   CDS_pept        complement(208815..209081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95580"
FT                   /db_xref="GOA:Q4KKB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKB8"
FT                   /protein_id="AAY95580.1"
FT                   /translation="MNRYISLTGHDCLIPSLLIDTQAPIDVLHDAAAFRIRAATQLLEN
FT                   FAAETLRSEPVLLQELTLVCSILLRDGCDLLDVTSRRLQPQMT"
FT   gene            209342..209620
FT                   /locus_tag="PFL_0169"
FT   CDS_pept        209342..209620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04365"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95581"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKB7"
FT                   /protein_id="AAY95581.2"
FT                   /translation="MYVAWDEAKNHANMLKHGIDFNDAVLMFQRPVLSLRDERLDYGEE
FT                   RWASLGWIRTLVGVVVHTERRGHAVRIISARKATKREAKYYVQRIEN"
FT   gene            209598..209846
FT                   /locus_tag="PFL_0170"
FT   CDS_pept        209598..209846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95582"
FT                   /db_xref="GOA:Q4KKB6"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKB6"
FT                   /protein_id="AAY95582.1"
FT                   /translation="MSNGSKTDWDRLAKTDDQGIDTSDIPELDDDFFRRAEVHLPGKKA
FT                   VTIRLDADVLEWFKGQGAGYQTRINQLLRQYMQAHRD"
FT   gene            210070..210630
FT                   /locus_tag="PFL_0171"
FT   CDS_pept        210070..210630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0171"
FT                   /product="putative conserved hypothetical protein
FT                   TIGR00481"
FT                   /note="identified by match to protein family HMM PF01161;
FT                   match to protein family HMM TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95583"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKB5"
FT                   /protein_id="AAY95583.1"
FT                   /translation="MSRFASRNTWLAVGAALLCLHLPVQAQERFTLNIPGVSDDRLFTT
FT                   GNASDAKGCGGHNNSPALNWTAGPTGTLSYAIVMHDPDGAKGQGVDHWVHYGIKPTTRQ
FT                   IPAGAGNKPNLEGLAGLNSRNGTSYMGPCPPVGDSAHHYIIQIYALDLPPEALPAGLTR
FT                   AQLLEKINGHVLRNSSVVRRYSR"
FT   gene            210719..212467
FT                   /pseudo
FT                   /locus_tag="PFL_0172"
FT                   /note="von Willebrand factor type A domain protein; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00092"
FT   gene            212505..213086
FT                   /locus_tag="PFL_0173"
FT   CDS_pept        212505..213086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0173"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95585"
FT                   /db_xref="GOA:Q4KKB3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKB3"
FT                   /protein_id="AAY95585.1"
FT                   /translation="MSAAQSTSDASSDETLLARYRAGDPAAFEVLYQRHRQGLYRFVLS
FT                   LCGKAELADEVYQETWLSLIRSTSQPQGRASFRTWLYQIARNRLIDHWRKHGQRNPLHD
FT                   SYDEQLHGEADQAPGPEQQLSLCRDQQRIEAALQDLPEDQREVFLLRAHGDLELPEIAS
FT                   LTQAPLETVKSRFRYALKKLRRLLAEEVLT"
FT   gene            213083..213766
FT                   /locus_tag="PFL_0174"
FT   CDS_pept        213083..213766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95586"
FT                   /db_xref="GOA:Q4KKB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKB2"
FT                   /protein_id="AAY95586.1"
FT                   /translation="MTDARQTPTPEEQMLAHIRQHSTQEPPAHLDALILATARREAPAP
FT                   RPSLWQRWMQACLRPRYQLAFASLFGVALVIGLLRPSPEHYPQEQAFVPAPAPAPAAPM
FT                   ARQAAPRSAELAGALSVPEPAAPTPIAPAAPVGSFAAAPEMEASADAAPPAMAKPRAES
FT                   SKLAKRMSAPVAPRAIKRLNEQLQTVLRLWDEGQNRAAAELLLQLQETYPQEDLDARLQ
FT                   ALRRQ"
FT   gene            213839..214024
FT                   /locus_tag="PFL_0175"
FT   CDS_pept        213839..214024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95587"
FT                   /db_xref="GOA:Q4KKB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKB1"
FT                   /protein_id="AAY95587.1"
FT                   /translation="MAPRIDRIAAMLNCPIKGAELRQAIKESRKDFGLEEGEDLDQQAD
FT                   DEDDQAAPHSDAVEEE"
FT   gene            complement(214043..214507)
FT                   /locus_tag="PFL_0176"
FT   CDS_pept        complement(214043..214507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95588"
FT                   /db_xref="GOA:Q4KKB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKB0"
FT                   /protein_id="AAY95588.1"
FT                   /translation="MKSNFEVALEREEVLQFFRGQGQYLTRDGDWDEHLYCINWPGIFA
FT                   YLRDNADGAQQLSASFERYAYSVEESIEDCFGLRENLFCYYSTRARWAPESVDLLGQLP
FT                   EPCRRRIVQRLSWYRWQVENHARLLPERARRMTADGACAEFIELPATPYA"
FT   gene            complement(214491..215342)
FT                   /locus_tag="PFL_0177"
FT   CDS_pept        complement(214491..215342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95589"
FT                   /db_xref="GOA:Q4KKA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA9"
FT                   /protein_id="AAY95589.1"
FT                   /translation="MLRHPLHNQPFEPQIRDWVTWFMGYDMPPALDAELNRYNPNDPDD
FT                   REYLVRHYGLMRHGSRENFRHRQRLVEVLQAALDDPDYDFEQIWEPIEDDYEYDQWPSN
FT                   WPGVIDNSRDLFQRLLNAARERWQEDLVRAQLPSLAECRAIPHRERFGGDWLFGIDNPE
FT                   AWRAEFDVTATPYDLETQGPQFQGEQLSLHLSGELPRLSVPASWPVIEAATHCSFVLKV
FT                   QGISELAVSGTRFDGRMRTQLTRLDPGYHLRLEIGFDCVIECVALSVSIADVKGTPDEK
FT                   QL"
FT   gene            complement(215506..215582)
FT                   /locus_tag="PFL_0178"
FT   tRNA            complement(215506..215582)
FT                   /locus_tag="PFL_0178"
FT                   /product="tRNA-Arg"
FT   gene            complement(216206..216418)
FT                   /locus_tag="PFL_0179"
FT   CDS_pept        complement(216206..216418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95590"
FT                   /db_xref="GOA:Q4KKA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA8"
FT                   /protein_id="AAY95590.1"
FT                   /translation="MEWPTAEGGGTGYSIENRLTEQERPSEPAVKPQAASTQLRPQQLH
FT                   ILARQGLVHAQLGGDVGIGQVVDKL"
FT   gene            216433..216660
FT                   /locus_tag="PFL_0180"
FT   CDS_pept        216433..216660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95591"
FT                   /db_xref="GOA:Q4KKA7"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA7"
FT                   /protein_id="AAY95591.1"
FT                   /translation="MPDPMVNSQITDAVTQTNVKVVAEAPAQAIASLYQVASHSAGLSL
FT                   QNAVNSQQALNQISNAVVSKAVALIMAIGE"
FT   gene            216685..217353
FT                   /locus_tag="PFL_0181"
FT   CDS_pept        216685..217353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95592"
FT                   /db_xref="GOA:Q4KKA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA6"
FT                   /protein_id="AAY95592.1"
FT                   /translation="MAWFKKKTPPAAAADESAGAAADPGAAAVAAEPEAPSAMAGDAAS
FT                   TASAPAPDPAPSPAGPAQPSMMQTMNAHLLKQAGTPSSDSTDALNSQIVQAVQFSNAQT
FT                   FSYAPAQIAAAPDMMISQAAGLVAQSAAGYFDGVSKLALAAQAVLLKQMTENIVKENVK
FT                   GAAEDALGALVTDLLVGAAAAVAAAAGAMEADAAGVAIDKIDQSIAKYSSTLANRTPSS
FT                   "
FT   gene            217495..218052
FT                   /locus_tag="PFL_0182"
FT   CDS_pept        217495..218052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95593"
FT                   /db_xref="GOA:Q4KKA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA5"
FT                   /protein_id="AAY95593.1"
FT                   /translation="MANEEQTPMATIFGFAEKYLKRPLTQVERQVLEAFAQDKPLDMSR
FT                   AAQQSVDQARQRATELMQSDGLRTRQIIDQLAGSAAAGKADPQARELVLRQLLAAAESE
FT                   EPLSVSPPRAGLVTTAAAAAAAAALAPALSPASFPVDDPQLKAMINALVQQEVKAAVEA
FT                   RMAGLSQKVEDTLKQLTAGSGQ"
FT   gene            218166..218480
FT                   /gene="rebB_1"
FT                   /locus_tag="PFL_0183"
FT   CDS_pept        218166..218480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rebB_1"
FT                   /locus_tag="PFL_0183"
FT                   /product="RebB protein"
FT                   /note="identified by similarity to GB:AAA73405.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95594"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA4"
FT                   /protein_id="AAY95594.1"
FT                   /translation="MPLVNEQITDAVTQTNVKVVAEAPAMAMGTIYQSMAQATAILFQN
FT                   SVSAQQQQNTLAQAATNQGVMQIYSVDTTAGAAATEKVAQGGVSDNLTSLLTVLKSFQS
FT                   "
FT   gene            218535..218849
FT                   /gene="rebB_2"
FT                   /locus_tag="PFL_0184"
FT   CDS_pept        218535..218849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rebB_2"
FT                   /locus_tag="PFL_0184"
FT                   /product="RebB protein"
FT                   /note="identified by similarity to GB:AAA73405.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95595"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA3"
FT                   /protein_id="AAY95595.1"
FT                   /translation="MSTVSPQITDAVTQTNVKVVAEAPAMSMGTIYQSMGQSVAILFQN
FT                   SVSAQQQQNTLAQAATNQGVMQIYSVDTTAGASATEKVAQGGVADNLTSLLTVLKSFSS
FT                   "
FT   gene            219230..220672
FT                   /gene="gabD"
FT                   /locus_tag="PFL_0185"
FT   CDS_pept        219230..220672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="PFL_0185"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="identified by similarity to SP:P25526; match to
FT                   protein family HMM PF00171; match to protein family HMM
FT                   TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95596"
FT                   /db_xref="GOA:Q4KKA2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA2"
FT                   /protein_id="AAY95596.1"
FT                   /translation="MQLKDAQLFRQQAFIDGAWVDADNGQTIKVNNPATGEILGTVPKM
FT                   GAAETRRAIEAADKALPAWRALTAKERATKLRRWYELLIENQDDLGRLMTLEQGKPLAE
FT                   AKGEIAYAASFIEWFAEEAKRIYGDVIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVIKPASQTPFSALALVELAHRAGIPKGVLSVVTGSAGDIGGELTS
FT                   NPIVRKLSFTGSTEIGRQLMAECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAIISK
FT                   YRNNGQTCVCANRLYIQDSVYDAFAEKLKAAVAKLKIGNGLEEGTTTGPLIDEKAVAKV
FT                   QEHIADALKKGATLLAGGKSMEGNFFEPTILVNVPKDAAVAKEETFGPLAPLFRFKDEA
FT                   EVIAMSNDTEFGLASYFYARDLGRVFRVAEALEYGMVGVNTGLISNEVAPFGGIKASGL
FT                   GREGSKYGIEDYLEIKYLCLGI"
FT   gene            220850..222127
FT                   /gene="gabT"
FT                   /locus_tag="PFL_0186"
FT   CDS_pept        220850..222127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="PFL_0186"
FT                   /product="4-aminobutyrate transaminase"
FT                   /EC_number="2.6.1.19"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95597"
FT                   /db_xref="GOA:Q4KKA1"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA1"
FT                   /protein_id="AAY95597.1"
FT                   /translation="MSKTNASLMKRREAAVPRGVGQIHPIFADSAKNATVTDVEGREFI
FT                   DFAGGIAVLNTGHVHPKIIAAVTEQLNKLTHTCFQVLAYEPYVELCEKINAKVPGDFAK
FT                   KTLLVTTGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALYPNELHGVSIDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKEF
FT                   MKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGVTADLTTFAKSIAGGFPLAGVC
FT                   GKAEYMDAIAPGGLGGTYAGSPIACAAALAVMEVFEEEHLLDRCKAVGERLVTGLKAIQ
FT                   AKYPVIGEVRALGAMIAVELFENGDSHKPNAAAVAQVVAKARDKGLILLSCGTYGNVLR
FT                   VLVPLTSPDAQLDKGLAIIEECFAEL"
FT   gene            222266..223480
FT                   /locus_tag="PFL_0187"
FT   CDS_pept        222266..223480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0187"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF08668"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95598"
FT                   /db_xref="GOA:Q4KKA0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KKA0"
FT                   /protein_id="AAY95598.1"
FT                   /translation="MTAVDLPAVPRVLIAEADPWSRDLLKQVLLNVRCDARLDLCADGQ
FT                   EAMDLLSAKPYDLIIADWELPGIDGLSLLRAVRQRKRNPVQPFILLSVRSDSASVREAL
FT                   PLAPTAYLTKPLNMEGLTQRLQGLLLDAGQEVSCEVPALAPGMTLWPFLERRRDVADGA
FT                   PLLTDVQLAVKRSLNPEGLDLKVLEEEIRTDPQVTAVLIAAANSAAQHHGDGVQTLSQA
FT                   LHRLGTGQSMNLILGLTLKRSARLSDPALADYAERYWELSLHTAEYGRTLARLLDLDQE
FT                   RCYCAGLLHRLGDLALLRCLQEWKQAGGELDDQEEIGDALERFGAAYGSALRTRWRMPL
FT                   ELRELIASIYQLGGGVYSREALVMNLAAQLARLTEHEGVEEIARCKTARLLKVGLPELT
FT                   RLRKG"
FT   gene            complement(223575..224567)
FT                   /locus_tag="PFL_0188"
FT   CDS_pept        complement(223575..224567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0188"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM PF08447; match to protein
FT                   family HMM PF08448; match to protein family HMM TIGR00229;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95599"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK99"
FT                   /protein_id="AAY95599.1"
FT                   /translation="MVNKNPHTPSALPQWPEAAQTLMALMHAQGEVARLTEREQLFSSL
FT                   LVSVNAVLWAFDWDSRQVLYVSPAYERIFGRPAGLLLADCNQWRDSIYPDDLEYAERSL
FT                   AQVLEKGAVEDREYRIIDAQGQVRWLSDKCFINRNAEPGQRLIVVGIAEDITEKKQLET
FT                   ELQRLATTDVLTQSSNRRHFFECANREFEQARLQGSSLAFLLLDIDDFKVINDTYGHPE
FT                   GDIVLQRIAESGRAALRRGDLFGRIGGEEFAAVFPGCTADMARQVAERLQREIQRQNFS
FT                   HQGQTFTITVSQGLTGLLAEDESLDNLFARADSAMYEAKRQGKNRIITG"
FT   gene            complement(224784..225968)
FT                   /locus_tag="PFL_0189"
FT   CDS_pept        complement(224784..225968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0189"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95600"
FT                   /db_xref="GOA:Q4KK98"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK98"
FT                   /protein_id="AAY95600.2"
FT                   /translation="MWYEGLLGLSAWQLVAVTLLMTHVTIVAVTVYLHRYSAHRSLELN
FT                   AGLKHFFRFWLWLTTAQNTREWTAIHRKHHAKCETADDPHSPVVKGLSTVLRKGAELYR
FT                   EEAKNPETLRIYGKNCPEDWIERNLYSRYKLGGVALMAAIDLLLFGTIGITIWAIQMMW
FT                   IPFWAAGVINGLGHAVGYRNFECRDAATNLVPWGIIVGGEELHNNHHTYPNSAKLSVKK
FT                   WEFDLGWAWIKVFSFLRLARVQRVAPIAHRVEGKGHLDMDTAMAILNNRFQIMAQYRKL
FT                   VIGPLVKQELAKVDHSVRHQFHRAKRLLSRETSLLEDRHHLRIQSMLEHSQALKVIYEK
FT                   RLALQQIWVKTSSNGHDMLAAIKDWVHEAEASGIQSLRDFAHQLKTYSLRPTTA"
FT   gene            226115..228034
FT                   /locus_tag="PFL_0190"
FT   CDS_pept        226115..228034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0190"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF00990; match to protein family HMM PF08447;
FT                   match to protein family HMM TIGR00229; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95601"
FT                   /db_xref="GOA:Q4KK97"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK97"
FT                   /protein_id="AAY95601.1"
FT                   /translation="MSVSYRNGLRAALLYLLLSLVWLQFSGYLLSSFFDEFSDRAHWQL
FT                   VGGYAWAVVSAVLIFFARARLLRVLGADRWLRHQQKDRERLRQAAAVFDCTREGVLVSD
FT                   TQGQIVHVNRAFIEITGYQREEVLGRQPSLFKSGHHSAQFYQSMFDSLQKTDEWSGEIW
FT                   NRRKSGEIYPQWQTIRAIRDEQGELTHYVAVFSDISAIKDSEHELAHLAHHDPLTDLPN
FT                   RLLFTDRAEQALASAQIHKRGCAMLMIDLDHFKMINDSLGHNVGDQLLKAVAERLGGMF
FT                   GPGITLARLGGDEFAVLAESCPQLVQAAALAQRIIDGLKEPFQLGEQQVVINASIGISL
FT                   FPSDALSASQLLRNADAALFKAKSAGRNGYALYTEELTAHAQQRVEIAFELRRALDQQE
FT                   LRVYYQPVHDLKTSRLVGVEALVRWEHPERGLVSPAEFIPIAERTGMIAEIDAWVMQQA
FT                   CRQMCQWQADGVVLSFIAVNVSTRLFARSELYQQVAQVLHETGLDPAYLELEVTESAVM
FT                   DDPEVALEQMHRLRELGIRLAIDDFGTGYSSLLRLKRLPVQKLKIDQGFVAGLPFDEDD
FT                   AAISRVIIALAQSMGMQVHAEGIEQVEQARFLLEHACDLGQGYWFGRPMPAAQLVWSNA
FT                   PQIR"
FT   gene            228335..228517
FT                   /locus_tag="PFL_0191"
FT   CDS_pept        228335..228517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95602"
FT                   /db_xref="GOA:Q4KK96"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK96"
FT                   /protein_id="AAY95602.1"
FT                   /translation="MSASLRSVDGQDEATILREIQSALRDLRFGAVEITVHNAQVVQIE
FT                   RKEKFRLQQPGHKPS"
FT   gene            228689..229699
FT                   /gene="sbp"
FT                   /locus_tag="PFL_0192"
FT   CDS_pept        228689..229699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="PFL_0192"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="identified by similarity to SP:P0AG78; match to
FT                   protein family HMM PF01547; match to protein family HMM
FT                   TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95603"
FT                   /db_xref="GOA:Q4KK95"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK95"
FT                   /protein_id="AAY95603.1"
FT                   /translation="MSSIRRYALAALASAVFAGSAVAKDYELLNVSYDPTRELYQDYNA
FT                   EFVNFWKKDHPGDNVKIQQSHGGSGKQGRAVIDGLRADVVTLALAGDIDEIAKLGKTLP
FT                   ADWQKRLPDASTPYTSTIVFLVRKGNPKGIKDWGDLIKKDVSVITPNPKTSGGARWNFL
FT                   AAWAYGLKAGGSEAKAQEYVKELFKHVPVLDTGARGSTITFVNNGQGDVLLAWENEAFL
FT                   ALKEDGGADKFDIVVPSLSILAEPPVAVVDKNAEKKGNTQIAEAYLKHLYSPAGQEIAA
FT                   KNFYRPRDKDIAAKYAQQFPKLDLVTIDKDFGGWKTAQPKFFNDGGVFDQIYTAQ"
FT   gene            229850..230668
FT                   /gene="cysT"
FT                   /locus_tag="PFL_0193"
FT   CDS_pept        229850..230668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PFL_0193"
FT                   /product="sulfate ABC transporter, permease protein CysT"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02139"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95604"
FT                   /db_xref="GOA:Q4KK94"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK94"
FT                   /protein_id="AAY95604.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLIVLIPLAAMFVHAAQLTWEQ
FT                   FWAIISAPRVLAALKLSFGTALYAAIINGVIGTLLAWVLVRYSFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPTGLVGQFATDLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPREVEEAAACLGAKPWQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATSIGVLMLVVSFILLLLINLLQRRIERP"
FT   gene            230681..231553
FT                   /gene="cysW"
FT                   /locus_tag="PFL_0194"
FT   CDS_pept        230681..231553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="PFL_0194"
FT                   /product="sulfate ABC transporter, permease protein CysW"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02140"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95605"
FT                   /db_xref="GOA:Q4KK93"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK93"
FT                   /protein_id="AAY95605.1"
FT                   /translation="MSQSSISAASSANAARRGSATSRRLLIGLGWLIFALFLLLPLFIV
FT                   VSQGLKLGLGAFFDAIFEPDALSALKLTVIAVLISVPLNLVFGVSAAWCVSKYSFRGKS
FT                   ILVTLIDLPFSVSPVIAGLVYVLMFGAQGLFGPWLSDHDIQIVFALPGIVLATIFVTVP
FT                   FVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTVPNIKWGLIYGVVLCTARAMGEF
FT                   GAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFAVASLLLILALFILLLKQWSESRIN
FT                   RLRASAAEE"
FT   gene            231557..232546
FT                   /gene="cysA"
FT                   /locus_tag="PFL_0195"
FT   CDS_pept        231557..232546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="PFL_0195"
FT                   /product="sulfate ABC transporter, ATP-binding protein
FT                   CysA"
FT                   /EC_number="3.6.3.25"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00968"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95606"
FT                   /db_xref="GOA:Q4KK92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK92"
FT                   /protein_id="AAY95606.1"
FT                   /translation="MSIEVRNVSKNFNAFKALNSINLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDQGSIVFHGEDVSGHDVRDRNVGFVFQHYALFRHMSVFDNVAFGLRMKPK
FT                   NQRPSESKIAEKVHELLNMVQLDWLSDRYPEQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPASDFVYHFLGDSNRLHLGEDNHVLFRPHEVSLSRSELEDHHAAEVRDIRPLGA
FT                   TTRVTLKVEGQSELIEAEVVKDHDSLIGLARGETLFFKPKVWQKHASL"
FT   gene            complement(232688..233212)
FT                   /locus_tag="PFL_0196"
FT   CDS_pept        complement(232688..233212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06127"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95607"
FT                   /db_xref="GOA:Q4KK91"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK91"
FT                   /protein_id="AAY95607.1"
FT                   /translation="MKSLVDHLSQYAAYHRDPRNIASHFIGIPMIVVAVAVLLSRPAWS
FT                   MAGLSWSPALLLALAASVFYLRLEVRLGVLMTVLMALSVWAGQVLAAQSTGLWLSSGLG
FT                   LFVIGWVIQFIGHYYEGRKPAFVDDLSGLIVGPLFVVAELAFLLGLRHDLKQAIEQRSG
FT                   PVALRHKKAMI"
FT   gene            233315..234001
FT                   /locus_tag="PFL_0197"
FT   CDS_pept        233315..234001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0197"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95608"
FT                   /db_xref="GOA:Q4KK90"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK90"
FT                   /protein_id="AAY95608.1"
FT                   /translation="MDLHQWRECLMTGQWFSHLPASLQNSLLDSARLRRLTAGQCLFRR
FT                   GDPPCGLYAVLEGTVRVGAVSEQGKEALLSLMEAPHWFGEICLFDGQPRTHDAYAEGAC
FT                   TLLQVPQANLLQLLEQQPQYWRQFALLMSHKLRLAFINLEQLSLMPAPARVASRLLAMA
FT                   AGYGEVAQARRVLQLPQEQLALMLSLSRQTTNQILKELQHQGILRLSYGEIEILDTERL
FT                   RALTSP"
FT   gene            complement(234271..234681)
FT                   /gene="uraH_2"
FT                   /locus_tag="PFL_0198"
FT   CDS_pept        complement(234271..234681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraH_2"
FT                   /locus_tag="PFL_0198"
FT                   /product="hydroxyisourate hydrolase"
FT                   /EC_number="3.5.2.17"
FT                   /note="identified by match to protein family HMM PF00576;
FT                   match to protein family HMM TIGR02962"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95609"
FT                   /db_xref="GOA:Q4KK89"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK89"
FT                   /protein_id="AAY95609.1"
FT                   /translation="MNVLRNSLAAIGLCGLSSLALAAGNPLSVHVLNLENGLPSPGVKV
FT                   TLEQQVGQDWKPLSEGVTNEQGRIAELFPAGRALTAGEYRVVFKTGEYFRQAKRETFFP
FT                   EIPVIFEVRQTEQHYHIPLLLSPYGFSTYRGS"
FT   gene            complement(234781..235269)
FT                   /locus_tag="PFL_0199"
FT   CDS_pept        complement(234781..235269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P0AEQ1; match to
FT                   protein family HMM PF03928"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95610"
FT                   /db_xref="GOA:Q4KK88"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK88"
FT                   /protein_id="AAY95610.1"
FT                   /translation="MICKPLVLGLGLSLAGTALAALELPRHAELDLATARQLADASLAQ
FT                   CTAAVSVLDRGGNLLVAMRGDGVGPHNGPASQRKAYTALSTKTSSRLFAERARNNPEAA
FT                   NLNTLPELLLLGGGLALFAGKQLVGAIGIAGAGGAAQDEACALQAAQRVGLAAEAGRE"
FT   gene            235406..236086
FT                   /locus_tag="PFL_0200"
FT   CDS_pept        235406..236086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0200"
FT                   /product="DNA-binding heavy metal response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486; match to protein
FT                   family HMM TIGR01387"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95611"
FT                   /db_xref="GOA:Q4KK87"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK87"
FT                   /protein_id="AAY95611.1"
FT                   /translation="MRLLVVEDEAKTAHFLAKGLGESGFAVDVALNGLDGRYFIEQQEY
FT                   DLIILDVMLPGLNGWQLLQLVRQRGATPVLFLTARDAIEDRVRGLELGADDYLLKPFAF
FT                   AELLARVRTLLRRGPLREAESFSIADLEIDVLRRRVSRGGQRIALTNKEFALLHLLASR
FT                   QGEVLSRTLIASQVWNLNFDSDTNMVEVAVRRLRAKVDDPYMPKLIHTVRGVGYQLEAP
FT                   DEAL"
FT   gene            236073..237461
FT                   /locus_tag="PFL_0201"
FT   CDS_pept        236073..237461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0201"
FT                   /product="heavy metal sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR01386"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95612"
FT                   /db_xref="GOA:Q4KK86"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK86"
FT                   /protein_id="AAY95612.1"
FT                   /translation="MKRSSSIAWRLALAFAAVCALVLSVIGVFLYRSLAGEIAYRDDLA
FT                   LLGRLEQVRALLQDSDSLDALQARPRLYQNMLGNQESLLLVLRADGSTVIDINPRRQPL
FT                   PALDPIALQQAPQRTDVRLWPGPDDVPVALLAGQARGPKGEALTVVAGKVLSEREQMLA
FT                   SYRLRLYLAVGLGALLAFALGLLLLRRGLQPLRQLSEAARQIDLRSLDRRLHTNGIPAE
FT                   FHEPVQALNAMLARLEESFERLSQFSADLAHEIRTPLHNLLGSNGLALNQPRSAAEYQE
FT                   VLASNMEEFERLGRMAENLLFLARAEQADAVLDLQVLSLGGVGAQLCDYFEALADDRQL
FT                   RLENGFSGELRADQQLLQRALGNLLANAVRHADAGSLIRLRRHDEAGWCWLQVHNQGPA
FT                   IAPEHLPRLFDRFYRVDPSRAEPGDSGGLGLAIVHSIMLLHGGQVRVTSDEQATVFELG
FT                   FPLL"
FT   gene            complement(237578..238582)
FT                   /locus_tag="PFL_0202"
FT   CDS_pept        complement(237578..238582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0202"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95613"
FT                   /db_xref="GOA:Q4KK85"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK85"
FT                   /protein_id="AAY95613.1"
FT                   /translation="MTEATSLASWTRALRKQLDALDLDSAALCREAGLDPQLMDDPNAR
FT                   YPLSATTRLWHLAVQASGDPAIGLRVSRFVSPTTFHALGYALVASGSLREVFERIVRYH
FT                   QVVSDALELALTREADRYRFFLKVPEGAPQPAFEAIDAFAAIYVRTCRNRLGRDYAPLA
FT                   VQLRRPAPADPSQWHKVFRCPVQFAAVDDCLEFGLHDFDSHLDDANPELAEHNEAVLKR
FT                   TLLQLRPLTWERKVRGVIEAQLPEGEPSAERVAQALHLSLRSLQRHLADEGTRFDTLLN
FT                   ECRENLALLHLRDLECSLSEISYLLGFADASSFSRAFKRWTGMTPGQFRDGLR"
FT   gene            238682..239755
FT                   /locus_tag="PFL_0203"
FT   CDS_pept        238682..239755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0203"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95614"
FT                   /db_xref="GOA:Q4KK84"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK84"
FT                   /protein_id="AAY95614.1"
FT                   /translation="MQGISASPERMNAQQRAAHVRQVVLARGDELRRRFPLLRHQDALG
FT                   AGILAFALSGMLGSALLYVTGHLAWWACLLLNAFFASLTHELEHDLIHSMYFRKQRLPH
FT                   NLMLGLVWLARPSTINPWVRRHLHLNHHKVSGSESDIEERAITNGEPWGIARLLMVGDN
FT                   MMAAFIRLLRAPGARRKLGILVRTLAVYAPLALLHWGAWYVFLGFHGANGVAALLGSPI
FT                   QWSQDTASLMHYVDIAVVVIIGPNVLRTFCLHFVSSNMHYYGDIEPGNVIQQTQVLNPW
FT                   WMWPLQAFCCNFGSTHGIHHFVVREPFYIRQMTASVAHKVMAEMGVRFNDFGTFARANR
FT                   FTRQEREAMQPAHNARA"
FT   gene            239869..240315
FT                   /locus_tag="PFL_0204"
FT   CDS_pept        239869..240315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0204"
FT                   /product="putative pesticin immunity protein"
FT                   /note="See Y. pestis GB: CAA63439.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95615"
FT                   /db_xref="InterPro:IPR031911"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK83"
FT                   /protein_id="AAY95615.1"
FT                   /translation="MSSAVRRLIAVALMSVGSASLADSVAQGSDEALALSILKHLEVNG
FT                   FRNSLRPRHYPDGTTLGQTPYRIYEKAAGAEGTYSAVDEEQSWVYSVRVMEQGKQGIAI
FT                   CFVDQSLRGSYLAASPLRVEKNRAGHYVVVKELPNTPACRITRG"
FT   gene            complement(240502..242112)
FT                   /gene="atsA"
FT                   /locus_tag="PFL_0205"
FT   CDS_pept        complement(240502..242112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsA"
FT                   /locus_tag="PFL_0205"
FT                   /product="arylsulfatase"
FT                   /EC_number="3.1.6.1"
FT                   /note="identified by similarity to SP:P51691; match to
FT                   protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95616"
FT                   /db_xref="GOA:Q4KK82"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK82"
FT                   /protein_id="AAY95616.1"
FT                   /translation="MPQRPNFLVILADDLGFSDLGAFGGEIATPNLDALAAGGLRLTDF
FT                   HTAPTCSPTRSMLLTGTDHHIAGIGTMAEALTPELIGKPGYEGYLNDRVVALPELLREA
FT                   GYQTLMSGKWHLGLTAERAPHARGFERSFSLLPGAANHYGFEPTYDEHTPGLLKSTPAL
FT                   YIEDDRFIDELPADFYSSDAFGDKLLQYLKERDQSRPFFAYLPFSAPHWPLQAPEEIVA
FT                   KYRGRYDAGPEVLRRERLEKLQALGLVDPQVEPHPLINLNAEWNALSEELRQVSARAME
FT                   VYAAMVERMDWNIGRVVDYLRQQGQLDNTLILFMSDNGAEGALLEAFPKFGPELLTYLN
FT                   QHYDNRLENIGRANSYVWYGPAWAQAATAPSRLFKAFTTQGGIRVPALLHYPQLPLKGQ
FT                   ISHGFGTVMDITPTLLDLAGVRHPGKRWRGRDVAPLRGKSWLGFLSGETARVHDEQTVT
FT                   GWELFGRRAIRQGQWKAVYIPGPVGPATWQLYDLGQDPGEIHDLAHSQPEKLRTLLEEW
FT                   QRYVDETGVILSESPFQPD"
FT   gene            complement(242127..242942)
FT                   /gene="atsC"
FT                   /locus_tag="PFL_0206"
FT   CDS_pept        complement(242127..242942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsC"
FT                   /locus_tag="PFL_0206"
FT                   /product="sulfate ester ABC transporter, ATP-binding
FT                   protein AtsC"
FT                   /note="identified by similarity to GB:AAD31787.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95617"
FT                   /db_xref="GOA:Q4KK81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK81"
FT                   /protein_id="AAY95617.1"
FT                   /translation="MNAPLVSFTHVGKTFAVAGGEVEAIREFNLDIAEGEFVAIVGSSG
FT                   CGKSTLLRLLIGLDTEFRGQIRVDGKAVSGIGGERGIVFQEHRLFPWLTVAENIGLGLV
FT                   NEPLSAAERQQRVGEFIELVGLKDFTRAYPHQLSGGMAQRVAIARGLVASPRILLLDEP
FT                   FGALDALTRQQMQDELLAIRERAKITTVLVTHDVEEAIFLADRVVVMEPRPGRIKRVVE
FT                   VALPHPRQRSSFDFHQLREELLHELTRDELYQAPSPVQIRDLPLTFIAC"
FT   gene            complement(242939..244534)
FT                   /gene="atsB"
FT                   /locus_tag="PFL_0207"
FT   CDS_pept        complement(242939..244534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsB"
FT                   /locus_tag="PFL_0207"
FT                   /product="sulfate ester ABC transporter, permease protein
FT                   AtsB"
FT                   /note="identified by similarity to GB:AAD31786.2; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95618"
FT                   /db_xref="GOA:Q4KK80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK80"
FT                   /protein_id="AAY95618.1"
FT                   /translation="MARVSLLSLPLAAPSDGRPGWPLISQRLLPWLLPISLFALWWLAS
FT                   RNQWMSEQILPAPALVWSSALELAHGELWSHLAISLQRLFWGLLAGIAAGALLGGALGF
FT                   SRRLERLVFPTFGALSQIPTLAWIPLFMVFFGIGEVLKLVVLIKAVVVPVTLHTLVGVR
FT                   DAQPRLREAAAVLRLPPALLVRRLVLPAALPAFMAGVRLALATGWTSLLAVELLASSEG
FT                   IGYLMVWARQLFMLDIVFVCILVIGLLGVCMDRGIGWLDRRLVHWPHPATAEFRRGPRY
FT                   QGWQRLQPWLLPLALLALWQVASDQQWVDPNILPSPLAVLATTGNGLLDGSLLGGMGLS
FT                   LGRTLGGLLLGGGLGFAFGLLLGLSRFSERLLGPTLAAIRQIAIFAWVPLLTAWFGLGE
FT                   LAKWVFVALAAFFPLFIATQRSVAQLSPQLAEAAQVLRLNLWQRLRRLVLPGAAPGIFA
FT                   GLRISLIYAWLGTIGAEYFMPSNGGIGSQMISAQQLLRMDLIMAGMLLVGLTGALLNLI
FT                   GQQLELRATRWRHA"
FT   gene            244903..245925
FT                   /gene="atsR"
FT                   /locus_tag="PFL_0208"
FT   CDS_pept        244903..245925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsR"
FT                   /locus_tag="PFL_0208"
FT                   /product="sulfate ester ABC transporter, periplasmic
FT                   sulfate ester-binding protein AtsR"
FT                   /note="identified by similarity to GB:AAD31785.1; match to
FT                   protein family HMM PF09084"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95619"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK79"
FT                   /protein_id="AAY95619.1"
FT                   /translation="MNLPFKRVISLFAAPALAGLLGCLPLLAQADELKEIRIAVPDLSA
FT                   GTQHSGGGVVDVLRQQQIFEKAFADQGIKIHWNFFKGAGPVINEAFANGQVDLAYLGDL
FT                   AAIIGKSNGLDTRLLSASARGVKHYLGVVPGSGIKTLEDLKGKRVAVFRGTATQLSFDA
FT                   ALASRGLSEKDLKVVNLDFNAAVAALAAKQIDASWGSTGLSALRSKGLAELPLSTKDLG
FT                   GAGSVQSVLVGAGKFVDEHPEAVAKLLKAQQQAVEWLTQDSNKEAYIQLVSGLASYPPV
FT                   ILQDDLKDQRLSEIFPSTLDPVFLGKLQDSVDLAAKERLIRKPFKVDAWVAPQLAAAGL
FT                   "
FT   gene            complement(246077..246997)
FT                   /locus_tag="PFL_0209"
FT   CDS_pept        complement(246077..246997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0209"
FT                   /product="transcriptional regulator SftR-related protein"
FT                   /note="identified by similarity to GB:AAD31783.1; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95620"
FT                   /db_xref="GOA:Q4KK78"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK78"
FT                   /protein_id="AAY95620.1"
FT                   /translation="MDLRQLRYFIALNEHRSFVRAADAMGITQPAFSRSIQGLEQEFGC
FT                   VLVDRGNKDLRPTPEGQVVLQHALSLVQGAALLSSEVTQMTKLDAGEVRFGCGPAPAVK
FT                   LVPDAVAQFTSAHPKVRTCFAVDNWEKLSRSLNREEIEFFIADIRHFEADPNYQTQPLT
FT                   PKRGVFFCRPGHPLLAKESLSTNDMFDYPLATTLIPPGIRKLLANLSGRIDFSPTIETE
FT                   HFPALVKIVRQSNAIGVGTAEAFAEDIAQGSLALLHWRNLPQNIDSLNARCGIVSRSGF
FT                   RLSPAARKMIEVLVAVDQQTHSIAV"
FT   gene            247181..248086
FT                   /gene="atsK"
FT                   /locus_tag="PFL_0210"
FT   CDS_pept        247181..248086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsK"
FT                   /locus_tag="PFL_0210"
FT                   /product="alkylsulfatase AtsK"
FT                   /EC_number="3.1.6.-"
FT                   /note="identified by similarity to GB:AAD31784.1; match to
FT                   protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95621"
FT                   /db_xref="GOA:Q4KK77"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK77"
FT                   /protein_id="AAY95621.1"
FT                   /translation="MSNAALAVQPAVHALDIHPVAGRIGAEIRGVQLSGDLDAATVEAI
FT                   RQALVQYKVIFFRGQTHLDDQSQEAFSHLLGEPVAHPTVPVRDGTRYLMELDGAQGQRA
FT                   NSWHTDVTFVDAYPKASILRSVVAPASGGDTVWANTATAYNELSAELRELADKLWAVHS
FT                   NEYDYAGAKPDVSAEKLERYRKVFTSTVFETEHPIVRVHPESGEKSLVLGHFVKRIKGY
FT                   SQADSAHLFGLLQSHVTRLENTVRWRWSAGDVAIWDNRSTQHYAVDDYGTQDRIVRRVT
FT                   LKGDVPVGVHGQRSQTTKGL"
FT   gene            complement(248245..249861)
FT                   /locus_tag="PFL_0211"
FT   CDS_pept        complement(248245..249861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0211"
FT                   /product="sulfatase domain protein"
FT                   /EC_number="3.1.6.-"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95622"
FT                   /db_xref="GOA:Q4KK76"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK76"
FT                   /protein_id="AAY95622.1"
FT                   /translation="MSNTHPPVRNVLYIMCDQLRRDYLSCYGHPHLHTPHIDRLAAAGV
FT                   RFSRAYTQGTICGPSRMSAYTGRYVSSHQVAWNAVPLPLEELTLGDYLRPHGIRTALVG
FT                   KTHATPNLDALQRLAIDPESAQAEVLNEVGFEPYFRHDGIYPDDPVFDDKRESAPYTHY
FT                   LRDLGYQGRNPWHDWANAGAGEQGQILSGWKMRNAHLPARVAQEHSETVYTTDRAIDFI
FT                   SEQGEQPWCLHLSYIKPHWPYIAPAPYHALYGPEQVIPAVRAAPGQLSDHPVYAAFRQH
FT                   EESLNFSRDEVRLNVVPTYMGLIKQVDDQLGRLFDFLQSNGRWDDTLIVFTSDHGDFLG
FT                   DHYLGEKEFLLEPAVGVPLIVRDPRTAADSSRGTVDEHLVETIDALPTFLEALGLPGAE
FT                   HRLEGRSLIPLLHGAEPAWRRYAISEYDYAFQAPARERLGQPIDRCRMTMVRSERWKYL
FT                   AYDGLRPQLFDLHNDPQELHDLGADPAYAAVREEHLGYVLEWLRGLKRRTTISHQEIDL
FT                   RGQRFRYGEPESEKLVQIGVW"
FT   gene            complement(250103..251047)
FT                   /gene="sftR"
FT                   /locus_tag="PFL_0212"
FT   CDS_pept        complement(250103..251047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sftR"
FT                   /locus_tag="PFL_0212"
FT                   /product="transcriptional regulator SftR"
FT                   /note="identified by similarity to GB:AAD31783.1; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95623"
FT                   /db_xref="GOA:Q4KK75"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK75"
FT                   /protein_id="AAY95623.1"
FT                   /translation="MHIDLRQLRHFIALAEQRSFVAAAAAVNLSQSAFSRSIQALEHSV
FT                   GCQLVDRGRKDLAPTKQGQLLLEHARRLVSGAQQMANEISQFNGLEAGELRFGCGPAPA
FT                   AGLIPRAIGSFIGRYPKARVQFQVDDWQSLSKRLLSEEFEFFVADTRHFEADPDYLTQR
FT                   LRPRKWHFCCRAGHPLAQRESVSASELMSYPLAVTIRPPNLRKVIVDLSGKPDFTPNVE
FT                   CENSYSLLGVVMRSDAIGIVGSYSDALHNAKGELVCLKIDGLADDLEELYTRYGIVSRA
FT                   GYRLSPLAAAMIDEIKRIDEQDEDVCSLDNLAV"
FT   gene            251202..253574
FT                   /gene="sftP"
FT                   /locus_tag="PFL_0213"
FT   CDS_pept        251202..253574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sftP"
FT                   /locus_tag="PFL_0213"
FT                   /product="TonB-dependent outermembrane receptor SftP"
FT                   /note="Receptor Kahnert et al. 2002; identified by
FT                   similarity to GB:AAF02095.1; match to protein family HMM
FT                   PF00593; match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95624"
FT                   /db_xref="GOA:Q4KK74"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK74"
FT                   /protein_id="AAY95624.1"
FT                   /translation="MSPLSLASPLSPRRLKRLPLALLLAGSASWTPTWAEEAPAPQATP
FT                   AKSSANKAKADDGQLQTVTVTARRREESSQSVPTPMSVVSGQALESQRVYRIQDLQQLV
FT                   PSVNVAYMHARQSSVSIRGLGNNPASDGLEGSVGLYIDNVYLGRPGMAVFDLMDIEQLE
FT                   VLRGPQGTLFGKNTTAGVINISTRAPSFTPERSIETSLGEDGYFQTKGTISGPLTDELA
FT                   GRFSAYRTRSDGDIKNEFDGHDLNGGSRQGFRGQLLYKPNESFNLRWIGDYNEEDSSAG
FT                   TRVLYSTGPTINGTNVYESRAAAAGATLVNGSHRKVNLDNDQHVTVFQGGTSLEANWTL
FT                   PSDFTLTSVSSYRWWNFTPRNDDGLNVPASYNAGVSVQDKQWSQEFRLASPTGGFFDYV
FT                   LGAYYFGSDLDNKSFAYYGPKADIWNGAPAGALSNVTSIGNGHIQTNSFALFAQGTWHL
FT                   TERLDFTAGLRGTYEEKSAWVTRNAPLGGVAVAGAAANARRGRTGAYDSGDLNQYSTSP
FT                   SGLLNLSYRITDDLLGYATLSHGEKSGGVNLTVGSAPTAGADSLLIGTERANNAELGFK
FT                   STLWDRRLQLNANLFWTQVNGYQTNAYDDANRVQYLTNAGSVRSRGVEVESTLVPIRGL
FT                   TLNLNGSYNDVRYLSYKDAPCPPEVSLRPGAPASCDLSGHQVVGASKWIGNANGEYKWN
FT                   LDNGLEEYVTASYAFRSKAVGTVEDSEYGQIPSYAVVNLSTGLRGNYEQGQWDVSLWLK
FT                   NAFDKTYYTTLWTGGNGGYEGLLGTPRTLGVTGRYDF"
FT   gene            253641..254978
FT                   /locus_tag="PFL_0214"
FT   CDS_pept        253641..254978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95625"
FT                   /db_xref="GOA:Q4KK73"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK73"
FT                   /protein_id="AAY95625.1"
FT                   /translation="MLRLTTALPLLLSTALLASAVQAAPSVYPTGVTRYDPARAYNQYV
FT                   IFSGADKQTHLIDMNGNEVKNWPQAGFPSAIIDPQLVGGERGRVLLQLKDKEPGPLGSA
FT                   GNGLGNQSVGELDWNGKLVWQWGDQAPGGAAQQHHDQRRLSNGNTLVLANKVHKVAGFK
FT                   VPQVIDDAIYEVSPEGQVKWQWLASEHLKEFGFTPAQLKLVYGTDNPDYLHINNLSVVG
FT                   PNQWFDAGDKRFAPDNLLIDSRNANFIAILDKHSGKVVWRLGPNLSPINPKTAAKVPRP
FT                   VDQFVGQHDAHIIPAGLPGAGHLLVFDNQGTAGYPSVPLGLIAGSRVLEIDPIKNQIVW
FT                   QYSAASSRQPGWAFYSSFISSARRLPNGNTLIDEGMNGRFFQVTAGGEIVWEYVSPYLG
FT                   KAPGSEAISNWVYRALPVSYDWVPQGTPRSETAVSVPDSGLKQAGI"
FT   gene            complement(255042..255392)
FT                   /locus_tag="PFL_0215"
FT   CDS_pept        complement(255042..255392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95626"
FT                   /db_xref="GOA:Q4KK72"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK72"
FT                   /protein_id="AAY95626.1"
FT                   /translation="MAAMNTPRKWIVVPTSKDAQQRLDLDQCLPGDLEELALSPEQWAT
FT                   LSRSDLLPSLNRALGTLIDDYEDASIQGQTALATALSILTRAATAQDELLPKLIALNRL
FT                   ALERDTGLFFYF"
FT   gene            complement(255380..255817)
FT                   /locus_tag="PFL_6266"
FT   CDS_pept        complement(255380..255817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_6266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_6266"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95627"
FT                   /db_xref="GOA:Q4KK71"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK71"
FT                   /protein_id="AAY95627.2"
FT                   /translation="MSSMTLDWNAWEIEPGSIVDEQLIAQVQHRLGVEFPSLYLELVQY
FT                   AEAATPGIGGFAYDGGYTCISEFFEFGLSSQPWTLLWYASPGRVPGLAAGCLPIARDAG
FT                   GLLICLDFNSPAVAVEIFDPESASRYPVAADFKAFVELWQP"
FT   gene            complement(255913..256584)
FT                   /locus_tag="PFL_0217"
FT   CDS_pept        complement(255913..256584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0217"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95628"
FT                   /db_xref="GOA:Q4KK70"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK70"
FT                   /protein_id="AAY95628.2"
FT                   /translation="MTRYLLCPLLLLACLLTGCANKLEVAIAATPAPDYYFDPQAPVLV
FT                   SINGANDAHGLNASYYLRDMVAALHGMGFKQVYTDTSLPKNHPPFRMNFTLDVGSEKVS
FT                   YRYTATDYGQVPSSTKTVCKQSTHKDKNLVCNSTPTTTWGPVGSSERTGYTTLSTFNIK
FT                   AKDQQSRRTVFLLRASSYNEDCQDAKVEDFLVQESLDNLDFRNRVQRKYTVTLPEGHSC
FT                   K"
FT   gene            complement(256660..256875)
FT                   /locus_tag="PFL_0218"
FT   CDS_pept        complement(256660..256875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95629"
FT                   /db_xref="GOA:Q4KK69"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK69"
FT                   /protein_id="AAY95629.1"
FT                   /translation="MTIIVRLDVVMAKNKIRSKELAAILGITEANLSLLKNGKVKGMKI
FT                   ETLDKLCAALDCQPGDLLEYQATEPA"
FT   gene            complement(256885..257463)
FT                   /locus_tag="PFL_0219"
FT   CDS_pept        complement(256885..257463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95630"
FT                   /db_xref="GOA:Q4KK68"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK68"
FT                   /protein_id="AAY95630.1"
FT                   /translation="MNSQINGSAQYRLRRVGLLAAILAWVMGVVELGGNAGLWIYSKDQ
FT                   VLGALLSVFAEHSPRLLEADFKLSSLSFTLLVILDFLPLLLSSFALYLTGVFFLRLSRG
FT                   ETWSDRNIRILWRVGMLWIVAPATFPMMETLQGLALSIDLPPGQRILQISAGFSSYAAY
FT                   EVVKGILLCSFSIIMRDAKVLSDEHSHYI"
FT   gene            complement(258004..258480)
FT                   /locus_tag="PFL_0220"
FT   CDS_pept        complement(258004..258480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95631"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK67"
FT                   /protein_id="AAY95631.2"
FT                   /translation="MDAATIGRWVSSLGLSHEELIARGERIETPTDKIYDEFDWLTVIV
FT                   EPGLMLDFWEDSLALEKVLIELMPLEQGRSFYRGELPAPFSRSMTHADIRELLGTPLRS
FT                   EERRPSADGQYTLNAWESYRLPEHLHPGARVGFVYSADRQIKVLSFDLLEPQRD"
FT   gene            complement(258631..259836)
FT                   /locus_tag="PFL_0221"
FT   CDS_pept        complement(258631..259836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0221"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95632"
FT                   /db_xref="GOA:Q4KK66"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK66"
FT                   /protein_id="AAY95632.1"
FT                   /translation="MQRTESTFQRWAGWALLVCLGLNLRPILSSVSPLLNEIRGATGMS
FT                   FQSSAWLTSLPVICMGLVALLGVRIEARLGERRGVSLGLLLVLLACLVRLFFGQAAALL
FT                   ATALLGGAGVALIQALVPALIKRQFQHRVALAMGVYSASLMGGGGIAALLSPQVASHFA
FT                   NWQAGLGVWLLPAMAALLLWACLPLGAGRRNGSPAPLAGLWNNRRAWLLALYFGLVNCG
FT                   YMSMVAWLPAYYLQMGWSASQSGSLLAFMTLFQVSAALLMPALAQRSSDRRPLLGISLA
FT                   AQAAGFLGLVLWPLQSPHLWVALIGFGLGACFALSLILTLDHRRDPREAGQLAAFVQGV
FT                   GFLINAVSPWLSGWLRQVTGSFVSAWWVLIVGVLAMLLLTRIFSPASYQARAQLDTAPQ
FT                   PA"
FT   gene            complement(259823..260284)
FT                   /locus_tag="PFL_0222"
FT   CDS_pept        complement(259823..260284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0222"
FT                   /product="putative guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /note="identified by similarity to SP:O34598; match to
FT                   protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95633"
FT                   /db_xref="GOA:Q4KK65"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK65"
FT                   /protein_id="AAY95633.1"
FT                   /translation="MHDDQHYLQQAVALARRNVEQGGRPFGALLVRNGRVLAEAVNEIH
FT                   LSQDPTAHAEMLAIRAASRQLGPRLDDCVIYASGQPCPMCLAAMYLCGVSRAVFAASNE
FT                   QAEPFGLSTAAIYQQLSKPLEAQRLPVLHLPQAAMSALYQDWQERHAAN"
FT   gene            complement(260313..260975)
FT                   /locus_tag="PFL_0223"
FT   CDS_pept        complement(260313..260975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0223"
FT                   /product="ankyrin repeat protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95634"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK64"
FT                   /protein_id="AAY95634.1"
FT                   /translation="MQLKRFLKRGLIAAGLFTAGVVMASDGALLEAVRKGQLQQVQQLL
FT                   EQGAALDGRGLDGSSPLLVATRDNRIDIARALIEAGADVNRKNLIQDSPYLLAGASGHN
FT                   EILKLTLAHGADLKSTNRYGGTALIPACERGHVETVRLLIEAGVELDHVNHLGWTCLME
FT                   AIVLSDGGPAHQQIVAQLIAAGADLNLPDRAGLSPLQQAERRGQGAIAKLLRDAGAA"
FT   gene            261084..261947
FT                   /locus_tag="PFL_0224"
FT   CDS_pept        261084..261947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0224"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95635"
FT                   /db_xref="GOA:Q4KK63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK63"
FT                   /protein_id="AAY95635.1"
FT                   /translation="MLDPVLLRSFVAVADSQNFTRAAERLHLTQSTVSQQVRRLEESLG
FT                   CQLLDRDQRRVVATVEGERLLAYARRILALHEEASDMLVNQRGEEVLRLGVPEDFAAER
FT                   LMPMLSRFGLDYPAVRLEVSSGLGPELLRQYRRGEFDLLLVKQMGHSDDCVDSWPEPLC
FT                   WVDSVRQPAFGRDPLPLVAFPVGGLYRQEMLHHLEVGGWPWRIAYSSASLASVCSAVAA
FT                   GLGISLLPVRVLGKGHRVLDADSGLPDIQGVRLALYAGSGLSRAGKELQEQLRAVASVK
FT                   PQVARR"
FT   gene            262459..263274
FT                   /gene="tonB2"
FT                   /locus_tag="PFL_0225"
FT   CDS_pept        262459..263274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB2"
FT                   /locus_tag="PFL_0225"
FT                   /product="TonB2 protein"
FT                   /note="See Shirley and Lamont (PMID: 19592589) for more
FT                   information.; identified by similarity to SP:Q9RMT3; match
FT                   to protein family HMM PF03544; match to protein family HMM
FT                   TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95636"
FT                   /db_xref="GOA:Q4KK62"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK62"
FT                   /protein_id="AAY95636.1"
FT                   /translation="MGNVQTAASAHEVLWRQAPSGELVDLGRPHRLPLGQLRLQRTPKG
FT                   ILRRREAIILGAAALVLHAAVIYWLSQKPTPVLPIVPPEIPPMTIEFSRPAPPVVEPPP
FT                   PQPVQPVVEPPPPVEDELAVKPPPPKPVPKPKPKPVPKPEPKPAPKPVQQTPAPPQPAA
FT                   PVAAPAPPAPPAPAPVTPASANAAYLKNPAPEYPSLAQRRGWEGTVLLRVHVLASGKPG
FT                   EIQIQKSSGRQQLDDAALAAVKRWSFVPAKQGDVAQDGWVSVPIDFKIH"
FT   gene            263330..264055
FT                   /gene="exbB2"
FT                   /locus_tag="PFL_0226"
FT   CDS_pept        263330..264055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB2"
FT                   /locus_tag="PFL_0226"
FT                   /product="TonB system transport protein ExbB2"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95637"
FT                   /db_xref="GOA:Q4KK61"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK61"
FT                   /protein_id="AAY95637.1"
FT                   /translation="MTLLASPLESIESAVIWLLVVFSVATWGLALVKGVQFARLKSQDR
FT                   KFHNQFWAASSLDSAASLSETQPGAAARVAQAGYAAIQVGEAPHAADLSQAINHQDRLE
FT                   RALRQQIVRERRSLETGLAVVASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVA
FT                   GPIGAALVATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKNSFRVLIH
FT                   PSVHKAAAQGSPQKVKEAS"
FT   gene            264057..264458
FT                   /gene="exbD2"
FT                   /locus_tag="PFL_0227"
FT   CDS_pept        264057..264458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD2"
FT                   /locus_tag="PFL_0227"
FT                   /product="TonB system transport protein ExbD2"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95638"
FT                   /db_xref="GOA:Q4KK60"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK60"
FT                   /protein_id="AAY95638.1"
FT                   /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNAIPIN
FT                   LPKTEAVAPVEQKDPLVVSIDGAGKLFINKDEIQPDLLETNLQAAKAKDPQVRVQLQAD
FT                   DGVNYGEVARAMASIERAGITKLSVITAR"
FT   gene            264881..265462
FT                   /locus_tag="PFL_0228"
FT   CDS_pept        264881..265462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95639"
FT                   /db_xref="GOA:Q4KK59"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK59"
FT                   /protein_id="AAY95639.1"
FT                   /translation="MRNESIRYLIVPGWQGSPEDHWQTHWQNSLPNSARVEQADWLTPR
FT                   REDWVAALAEAIAADDTPVILIAHSLGCITVAHWAARAPVAALRQVRGALLVAPADVER
FT                   PACAPALRNFAPIPRHLLPFPSQVVSSDNDSAVSAPRALELARDWGAEAGILAGAGHIN
FT                   VKSGHHRWEQGFAYLYRLQNRMEQHALRRA"
FT   gene            265520..266452
FT                   /locus_tag="PFL_0229"
FT   CDS_pept        265520..266452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0229"
FT                   /product="sigma-54-binding protein"
FT                   /note="identified by similarity to SP:P17899; match to
FT                   protein family HMM PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95640"
FT                   /db_xref="GOA:Q4KK58"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK58"
FT                   /protein_id="AAY95640.1"
FT                   /translation="MSAHTPFGQPLLTFPDAEKSPLSIRAKALVFVDPRSRQLREELEQ
FT                   LAPRSVSVLIRGETGTGKELLARHIHRASDRSGLFVSVNCGAISPTYADAELFGYAAGS
FT                   FSGSASSRAGWFGSANGGTLYLDEIGDLPLPIQTKLLAALENHEVTRVGAQQPSPVDVR
FT                   LVAATSIDLAQAVAAGKFHERLYRYLSEGQLELPALRERVGDIESLAEYFLGIYSQRLD
FT                   LPVPLISEAAQQALNRHSWPGNTRELENVIHFALLVSSGEEILPEHLNLPPTPSPLEQI
FT                   QQLLQQIAEIGSAVERQALHQLLQRTALT"
FT   gene            266740..267522
FT                   /locus_tag="PFL_0230"
FT   CDS_pept        266740..267522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0230"
FT                   /product="lipoprotein, NLPA family"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95641"
FT                   /db_xref="GOA:Q4KK57"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK57"
FT                   /protein_id="AAY95641.1"
FT                   /translation="MKKVLLFTALAAALSAGIAQAGEKLVVAATPVPHAEILELIKPTL
FT                   AKEGVDLEIKVFTDYVQPNVQVDQKRLDANYFQTLPYLKSFNEGKGTHLETVIGVHVEP
FT                   FGGYSKKVKTLAELKDGATIAIPNEGSNSGRALILLQKAGLIELKDPKNAVATPKDIAK
FT                   NPHNFKFKELESAMLPRVLDQVDLDMINTNYALEAGLNPAKDALIIEGSDSPYVNYLVA
FT                   RPDNKDSPAIQKLAKALTSPEVKAFIEKKYSGAVLPAF"
FT   gene            267994..268659
FT                   /locus_tag="PFL_0231"
FT   CDS_pept        267994..268659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0231"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95642"
FT                   /db_xref="GOA:Q4KK56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK56"
FT                   /protein_id="AAY95642.1"
FT                   /translation="MTLDYAFILSTLPAFLKAVGVTLQVGLIAIGTSLLVALINATLLV
FT                   FRTPYLHRLIGLYVELARNTPLLIQLFFVYFALPALGIKVSGFTAAIITMTFLGGAYLT
FT                   EVLRAGVEAVPQAQLESGRSIGLSQWQLLRYVILPQAGILSLPSLFANFIFLLKETTVV
FT                   SAVAVPEILYTTKSYIALYYKTYEMLAVLTLICVLLFLPLSLLLSRLERRLQHGQFGS"
FT   gene            268640..269299
FT                   /locus_tag="PFL_0232"
FT   CDS_pept        268640..269299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0232"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95643"
FT                   /db_xref="GOA:Q4KK55"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK55"
FT                   /protein_id="AAY95643.1"
FT                   /translation="MASSGLELLLVSLPQLARGAAQTLSISLLSIAFSTLGGVLYGVLR
FT                   SLQRKVLDVPLRIYLELFRAIPVLVWLYLLFFGFPIFFGLSIPSFTCAVLVLSLWGASE
FT                   VGEVVRGALQSLPRGQREAGLSIGLSGAQLYGYVLLPQALKRMTPPTINVYTRIIKTSS
FT                   LAVLIGVVDVIKVGQQIIERTYESVLIYGVLFLFFFFICYPLSAASRVLERRWTQA"
FT   gene            269296..270078
FT                   /locus_tag="PFL_0233"
FT   CDS_pept        269296..270078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0233"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P10346; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95644"
FT                   /db_xref="GOA:Q4KK54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK54"
FT                   /protein_id="AAY95644.2"
FT                   /translation="MSALIEFQGFNKFFGPQQVLKEVDLCVAAGEVIVILGPSGCGKST
FT                   LLRCLNGLETAHSGHLRFAGRELLSPATDWRQVRQQIGMVFQSYHLFPHMNVLDNILLG
FT                   PLKVQKREPREARAQAEALLERVGLLDKREAFPRQLSGGQQQRIAIVRSLCMNPQVMLF
FT                   DEVTAALDPEMVKEVLQVIQGLARDGMTLLIVTHEMAFARAVADRVVFMDGGRIVEQNT
FT                   PEAFFTNPQSARAQQFLEKFSFVEALPKKAPKKELELL"
FT   gene            270075..270959
FT                   /locus_tag="PFL_0234"
FT   CDS_pept        270075..270959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0234"
FT                   /product="putative amino acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /note="identified by similarity to SP:P27676; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95645"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK53"
FT                   /protein_id="AAY95645.1"
FT                   /translation="MKTAKSSLLLLPLFGLALLAGCDKSNDAPKPAATAASAAPAAGYL
FT                   DKIKARDKLIVGVFTDKPPFGFVDETGRYVGFDTDIGRQFAKDLLGDENKVEFVAVEPA
FT                   SRIPFLQSDKVDLILANMTVTPERKEAVEFTNPNLKVAVQALVPEGSAVKSLDDLASRT
FT                   TIVTTGTTADIWLTQNHPDWKLLKFEKNTESLQALANGRGDAYAQDNLILFSWSKQNPG
FT                   YRVLPQTLGEQAPIAPAVKKGNIELRDWVNAELAKLGEEKYLLKLYDQYVRKELSDDTK
FT                   PESVIVEGGKWQG"
FT   gene            complement(271089..272285)
FT                   /locus_tag="PFL_0235"
FT   CDS_pept        complement(271089..272285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0235"
FT                   /product="RecF/RecN/SMC domain protein"
FT                   /note="identified by match to protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95646"
FT                   /db_xref="GOA:Q4KK52"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK52"
FT                   /protein_id="AAY95646.1"
FT                   /translation="MLKTLAVANYRSINKLVIPLGRLNLVTGANGSGKSNLYRALRLLA
FT                   ETAQGGVVNALAKEGGLESTYWAGPEQISRRMSQGEVPIQGGPRKAARRLQLGFAGEDF
FT                   GYAISLGLPDSSGHFMLPGHSSPIASRFTLDPWIKRESIWGGPLYRSASALVDRQGPMI
FT                   RARAGRQWEVLAQHTSSGDSLFDRVGNLSSSPEVLHLREQIRGWRFYDHLRTDSQAPAR
FT                   RPQLGTRTPVLHHDGRDLAAALQTIIEVGDQQALHETISDAFPESRLEIDAVPGGLFGV
FT                   QFYQEGLLRPLSAAELSDGTLRYLLLVAALLTPRPPTLMVLNEPETSLHPDLLPALARL
FT                   IIRASQQCQVWVVSHARRLIAALQQDPECNCIVLEKQLGQTGIVGQRMLDEPAWNWPD"
FT   gene            272560..273654
FT                   /locus_tag="PFL_0236"
FT   CDS_pept        272560..273654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0236"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95647"
FT                   /db_xref="GOA:Q4KK51"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK51"
FT                   /protein_id="AAY95647.1"
FT                   /translation="MAAFNSKWIVGLTLLLLLGGCGAEKPGEKERPRVRILEVQSSDFA
FT                   PSVTLTGDVQARVQTELSFRVGGKIIQRMVDVGDRVTAQQVLAKLDPKDLQTNVDSAAA
FT                   SVFAEQARVKQAGAAFVRQQKLLPKGYTSQSEYDSAQAALRSSQSALSAAQAQLANARE
FT                   QLSYTELVAEAPGVITARQAEVGQVVQATVPIFSLARDGERDAVFNVYESLLMQPPGQE
FT                   TIHISLLDNPKVTTTGKVREVTPVVSAQSGTVQVKVVLDSLPAGMDLGSVVSATARAHG
FT                   KASVVLPWSALTKNLSEPAVWLVGEDGKTALHTVKVGRYLTGKVIISDGLKGGEKVVVA
FT                   GGQLLHPGMFVEIASQTSDQGAQP"
FT   gene            273651..274721
FT                   /locus_tag="PFL_0237"
FT   CDS_pept        273651..274721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0237"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95648"
FT                   /db_xref="GOA:Q4KK50"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK50"
FT                   /protein_id="AAY95648.1"
FT                   /translation="MKRLLPLLCASALLLGCSREEPAPEPVRPVLSFRVAPQAEESLGR
FT                   FAGTIQARYETNLGFRVPGRIANRNVDVGAEVGPGDLLATLDPTDQQNQLRAAQGDLAK
FT                   VEAQWINAQANARRQQELFDRGVGAQAQLDIAQTDLKTTGASLDQAKASVRQARDQLNY
FT                   SELRSDHGGVITAWNAEAGQVVTAGQQVVTLARPEIKEAVIDLPASLVDQLPAGVEFKV
FT                   AAQLDPSIITTATVREIEPQAQSATRTRRARLTLKDTPEAFRLGTAISVTLSSAIEPRT
FT                   EVPLTALQEVQGKTRIWVVDPQSQTVAPREVTVLSRDSASALISQGVKPGERVVSAGVN
FT                   SLKPGQKVKIDEDRAQ"
FT   gene            274718..277804
FT                   /locus_tag="PFL_0238"
FT   CDS_pept        274718..277804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0238"
FT                   /product="RND transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family, permease protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95649"
FT                   /db_xref="GOA:Q4KK49"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK49"
FT                   /protein_id="AAY95649.1"
FT                   /translation="MTPDSKGSFNLSEWAIKHQSFVWYLMFVALLMGVFSYMNLGREED
FT                   PSFTIKTMVIQTRWPGATQEETLKQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLR
FT                   DTTSAKDIPEIWYQVRKKINDIRGDFPQGLQGPGFNDEFGDVFGSIYAFTADGLSMRQL
FT                   RDYVEQVRAQIREVPNLGKVEMVGEQDEVIYLNFSTRKLAALGIDQRQVLQSLQSQNAV
FT                   TPAGVIEAGPERISVRTSGQFASEKDLATVNLRLNDRFYRLADIAEISRGYVDPSTPLF
FT                   RFNGKPAIGLAIAMKKGGNIQDFGKALHARMDQLTADLPVGVGVHKVSDQAEVVEEAVG
FT                   GFTSALFEAVIIVLVVSFISLGVRAGLVVACSIPLVLAMVFVFMEYSGITMQRISLGAL
FT                   IIALGLLVDDAMITVEMMVTRLEKGESKEQAATFAYTSTAFPMLTGTLVTVAGFVPIGL
FT                   NASSAGEYTFTLFAVIAVAMLVSWIVAVLFAPVIGIHILSTNVKPHSDEPGRIGRAFNG
FT                   GLLWAMRNRWWAIGITVLLFVASVFCMRFVQNQFFPSSDRPEILVDLNLPQNASINETR
FT                   QAVDRLEATLKDDPDIERWSTYIGEGAIRFYLPLDQQLQNPYYAQLVIVSKGLEQRTAL
FT                   TQRLQKRLREDFVGIGSYVQALEMGPPVGRPIQYRVSGKDIDQVRKHAIELATELDKNP
FT                   HIGEIIYDWNEPGKVLRIDIAQDKARQLGLSSEDVAQLMNSIVSGSTVTQVHDDIYLIN
FT                   VVGRADDNERGSPETLQNLQIVTPNGTSIPLLAFASVRYELEQPLVWRRDRKPTITIKA
FT                   AVRDAIQPTDLVKQLKPDIDHFAAQLPAGYSVATGGTVEESGKAQGPIAKVVPLMLFLM
FT                   ATFLMIQLHSVQKLFLVASVAPLGLIGVVLALVPTGTPMGFVAILGILALIGIIIRNSV
FT                   ILVTQIDEYEREGYHPWDAVLEATHHRRRPILLTAAAASLGMIPIAREVFWGPMAYAMI
FT                   GGIIVATLLTLLFLPALYVAWYKIKEPSKDTERTRPTAS"
FT   gene            complement(277979..278605)
FT                   /locus_tag="PFL_0239"
FT   CDS_pept        complement(277979..278605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0239"
FT                   /product="methyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95650"
FT                   /db_xref="GOA:Q4KK48"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK48"
FT                   /protein_id="AAY95650.2"
FT                   /translation="MKLAPDDLDSITATTLGHYQQVAEDFREGTRDHDVSQNIDALLRH
FT                   IQGSAPFTVLDFGCGPGRDLQAFTRLGHVAIGLDGCERFAQMAREDSGCEVWQQDFLKL
FT                   DLPAERFDGIFANAVLFHIPRQELPRVLKQLHASLKDGGVLFSSNPRGDNQEGWNGPRY
FT                   GAYHDLAAWQALLTDAGFVELEHYYRPAGLPREQQPWLASVWRKA"
FT   gene            complement(278758..279402)
FT                   /gene="metI1"
FT                   /locus_tag="PFL_0240"
FT   CDS_pept        complement(278758..279402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI1"
FT                   /locus_tag="PFL_0240"
FT                   /product="D-methionine ABC transporter, permease protein
FT                   MetI"
FT                   /note="identified by similarity to SP:P31547; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95651"
FT                   /db_xref="GOA:Q4KK47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK47"
FT                   /protein_id="AAY95651.1"
FT                   /translation="MWFDRLLQGILDTLLMVGVSSLIALLAGIPLAVILVTSGKGGIYE
FT                   APNLNRALGAFVNLFRSIPFLILMVALIPFTRLIVGTTYGVWAAVVPLTIAATPFFARI
FT                   AEVSLREVDHGLIEAAQAMGCRRWHIVWHVLLPEALPGIVGGFTITLVTMINSSAMAGA
FT                   IGAGGLGDIAYRYGYQRFDSQIMLTVIVLLVILVAAIQLGGDRLARVLNKR"
FT   gene            complement(279392..280516)
FT                   /gene="metN1"
FT                   /locus_tag="PFL_0241"
FT   CDS_pept        complement(279392..280516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN1"
FT                   /locus_tag="PFL_0241"
FT                   /product="D-methionine ABC transporter, ATP-binding protein
FT                   MetN"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95652"
FT                   /db_xref="GOA:Q4KK46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KK46"
FT                   /protein_id="AAY95652.1"
FT                   /translation="MSVATLQRKLPEAAPRRAGQTELHPELNRAQVRFIGLGKTYQGQQ
FT                   GPVQALHDIDLSIQRGEVFGIIGRSGAGKSSLIRTINRLEQPSSGRVLIDQVDIGDFDE
FT                   DRLVALRRRIGMIFQHFNLMSAKTVWHNVELPLKVAGVPKAERERKVRELLELVGLKDK
FT                   HRAYPAQLSGGQKQRVGIARALVHDPEILLCDEATSALDPETTQSILGLLKEINQRLGL
FT                   TIILITHEMAVIRDICDRVVVLEHGRIVEQGPVWEVFGNPQHEVSKTLLAPLQHGLPEE
FT                   LQNRLQSHPTSSDAALVLSLRFTGSSHEEPDLAALFGALGGRVRLLQGGVERIQGHALG
FT                   QLLLAVQGSSLEAAQLRQRAGQWAQQVEVLGYVV"
FT   gene            complement(280518..281327)
FT                   /gene="metQ1"
FT                   /locus_tag="PFL_0242"
FT   CDS_pept        complement(280518..281327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ1"
FT                   /locus_tag="PFL_0242"
FT                   /product="D-methionine ABC transporter, periplasmic
FT                   methionine-binding lipoprotein MetQ"
FT                   /note="identified by similarity to SP:P28635; match to
FT                   protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95653"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK45"
FT                   /protein_id="AAY95653.1"
FT                   /translation="MKTKRLRHPLKALALALGLFSSAVFAADAPLKVGTTAAFAIPLEA
FT                   AVEEAGKQGLKVELVEFTDWIAPNVSLAAGDIDVNYFQHIPFLENAKAAAGFDLVPFAP
FT                   GIINNVGLYSKKYKSFAELPQGASVAIANDPINSGRGLQLLAKAGLITLKPGVGYKATE
FT                   EDIVSNPKKIKILQVEAVQLVRAYDDADLVQGYPAYIRLAKTFDAGSALLFDGLDHKEY
FT                   VIQFVIQPKSKNDPRLIKFVDIYQHSPAVRDALDKAHGKLYQAGWEG"
FT   gene            complement(281440..282807)
FT                   /locus_tag="PFL_0243"
FT   CDS_pept        complement(281440..282807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0243"
FT                   /product="monooxygenase, NtaA/SnaA/SoxA family"
FT                   /note="identified by similarity to SP:P54995"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95654"
FT                   /db_xref="GOA:Q4KK44"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK44"
FT                   /protein_id="AAY95654.1"
FT                   /translation="MAAPQTTKKKILLNAFNMNCIGHINHGLWTHPRDNSTQYKTLEYW
FT                   TELAQLLERGLFDGLFIADIVGVYDVYQNSVDVPLKESIQLPVNDPLLLVSAMAAVTKN
FT                   LGFGLTANLTYEAPYLFARRLSTLDHLSRGRVGWNIVTGYLDSAAQAMGLKEQIEHDRR
FT                   YDQADEYLEVLYKLWEGSWEDDAVLNDREQRIYAQPEKVHKVEHQGEFYQVSGYHLCEP
FT                   SPQRTPVLFQAGSSDRGLLFAGRHAECVFISGQNKAATKAQVDKVRASAVAAGRNPGDI
FT                   KVFMGLNVIVGETEELAWKKHAEYRSHASAEAGVAHFSASTGIDFSQYEIDEPIQYVKS
FT                   NAIQSATKNLQNNDWTRRKLLDQHALGGRYFTVVGSPQQVADDLESWIAETGLDGFNLT
FT                   RIVTPESYVDFIDLVIPELQRRGSYKTAYDDGTLREKLFRQGRKLPEQHTGAAYRR"
FT   gene            complement(282807..284006)
FT                   /locus_tag="PFL_0244"
FT   CDS_pept        complement(282807..284006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0244"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF02771;
FT                   match to protein family HMM PF08028; match to protein
FT                   family HMM TIGR04022"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95655"
FT                   /db_xref="GOA:Q4KK43"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK43"
FT                   /protein_id="AAY95655.1"
FT                   /translation="MSLSQHVAVITSDEQALIVASDLAEDFKRDSALRDRERRLPHPEL
FT                   EAFSRSGLWGISVPKEYGGAGVSNVTLAKVIALIAEADASLGQIPQNHFYALEVLRVNG
FT                   SEPQKQRLYAEVLTGRRFGNALAELGTKTAHDRTTRLSRDSNGPGYRIDGRKFYATGAL
FT                   YAQRIPTSVVDEHGVQQLAFVPADAQGLDVIDDWSGFGQRTTGSGSVQFDNVWVDEADV
FT                   VPFQSAFERPTPVGPLAQILHAAIDTGIARAAYEDALRFVRTKTRPWIDSGNDKATDDP
FT                   LTIKSFGHLSIRLHATEALLERAGEFLDRAQADTNADTVAAASIAVAEVRALSTEISLA
FT                   AGSTLFELAGSQATLAEHGLDRHWRNARVHTLHDPVRWKYHAVGNYYLNQQNPPLRGTI
FT                   "
FT   gene            complement(284046..285287)
FT                   /locus_tag="PFL_0245"
FT   CDS_pept        complement(284046..285287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0245"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /EC_number="1.3.8.-"
FT                   /note="identified by match to protein family HMM PF08028;
FT                   match to protein family HMM TIGR04022"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95656"
FT                   /db_xref="GOA:Q4KK42"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK42"
FT                   /protein_id="AAY95656.1"
FT                   /translation="MSSLIEAQVQSDLDIAPLLLPARVLRNDAEALQAAHELADAARQQ
FT                   AAQRDRQRKLPWAQIEQFTRSGLGSISVPRAYGGPQVSFVTLAEVFAIISAADPALGQI
FT                   PQNQFGILGLILGCGTERQKKQLLQSVLEGWRIGNAGPERGTKNTLELKARITADADGH
FT                   VINGQKFYSTGALFAHWVAVKALNEEGRQVLAFVRRGTPGLRIVDDWSGFGQRTTASGT
FT                   ILLNDVRVDAELVLDNWRINETPNIQGAVSQLIQAAIDAGIAREAVADAIRFVRERARP
FT                   WIDANVERASDDLYVIADIGKLQIELHAAEALLRKAGQVLDQVSAAPITAESAARASIA
FT                   VAEAKVLTTEISLLASEKLFELAGSRATLAEFNLDRHWRNARVHTLHDPVRWKYHAVGT
FT                   YHLNGTLPARHSWI"
FT   gene            complement(285774..286535)
FT                   /locus_tag="PFL_0246"
FT   CDS_pept        complement(285774..286535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0246"
FT                   /product="polar amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to SP:P37774; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95657"
FT                   /db_xref="GOA:Q4KK41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK41"
FT                   /protein_id="AAY95657.1"
FT                   /translation="MIVVEKLTKQFKGQTVLNGIDLEVKEGEVVAIIGPSGSGKTTFLR
FT                   CLNFLEEPTSGRIRIGDISIDSSIPLSHQQGRIRQLRQQVGFVFQNFNLFPHRTALENV
FT                   IEGPLVVKKTPREQAVALGRALLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAMEPRV
FT                   ILFDEPTSALDPELVGEVLATIRSLAEEKRTMVIVTHEMGFARDVANRVIFFDKGVIVE
FT                   QGEAKALFANPQHERTRQFLSKFLGASHAPL"
FT   gene            complement(286540..287205)
FT                   /locus_tag="PFL_0247"
FT   CDS_pept        complement(286540..287205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0247"
FT                   /product="polar amino acid ABC transporter, permease
FT                   protein"
FT                   /note="identified by similarity to SP:P0AFT4; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95658"
FT                   /db_xref="GOA:Q4KK40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK40"
FT                   /protein_id="AAY95658.1"
FT                   /translation="MEAGLQLALESAPFLLKGAYYTVILSLGGMFFGLLLGFGLALMRL
FT                   SHLALVSWIARIYVSFFRGTPLLVQLFVIYYGLPQLGLELDPLPAALIGFSLNMAAYAC
FT                   EILRAAIGSIERGQWEAAASIGMTRAQTLRRAILPQAMRTALPPLGNSFISLVKDTALA
FT                   ATIQVPELFRQAQLITARTFEIFTMYLAAALIYWILASVLAHLQNRLEERVNRHDQES"
FT   gene            complement(287205..288002)
FT                   /locus_tag="PFL_0248"
FT   CDS_pept        complement(287205..288002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0248"
FT                   /product="polar amino acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /note="identified by similarity to SP:P0AEM9; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95659"
FT                   /db_xref="GOA:Q4KK39"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK39"
FT                   /protein_id="AAY95659.1"
FT                   /translation="MNFSVLRRNLLIGTLGLALGAGLMGQAVAGEQLQKIKDAGVINVG
FT                   LEGTYPPFSYVDENGKLTGFEVEFSEALANKLGVKVKLQPTKWDGILAALESKRLDAVV
FT                   NQVTISEERKKKYDFSIPYTVSGIQALTQKKDEGKFKTAADLGGHKVGVGLGTNYEQWL
FT                   KDNVPTAIIKTYDDDPTKYQDLRVGRIEAILVDRLAAFELIKKTKDTLVVSGEPFSRQE
FT                   AGVALRKGEPELLAAVNKAIEELRADGTLKKLSEKYFNADVTQ"
FT   gene            complement(288276..289271)
FT                   /gene="dcyD"
FT                   /locus_tag="PFL_0249"
FT   CDS_pept        complement(288276..289271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcyD"
FT                   /locus_tag="PFL_0249"
FT                   /product="D-cysteine desulfhydrase"
FT                   /EC_number="4.4.1.15"
FT                   /note="identified by similarity to SP:P76316; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   TIGR01275"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95661"
FT                   /db_xref="GOA:Q4KK38"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK38"
FT                   /protein_id="AAY95661.1"
FT                   /translation="MIKQQLARFNRLDLLRSTTALEKLERLSAWIGRDVYVKRDDSTPL
FT                   AMGGNKLRKLEYLAADALAQGADTLITAGAIQSNHVRQTAALAAKLGLGCVALLENPTG
FT                   TQDPNYLGNGNRLLLDLFDAKVELVENLDQADEQLHALAARLRSNGKKPYLVPIGGSNA
FT                   LGALGYVRAGLELAQQIEDSGLEFAAVVLASGSAGTHSGLALALSEVLPQLPVIGVTVS
FT                   RSEEDQRPKVQGLAERTAELLGVKLPDAFNVQLWDEYFAPRYGEPNAGTLAAVKLLASQ
FT                   EGLLLDPVYTGKAMAGLLDGVGRQRFDDGPLIFLHTGGAPALFAYAGAFS"
FT   gene            289461..290387
FT                   /locus_tag="PFL_0250"
FT   CDS_pept        289461..290387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0250"
FT                   /product="putative serine acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95660"
FT                   /db_xref="GOA:Q4KK37"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK37"
FT                   /protein_id="AAY95660.1"
FT                   /translation="MSERSSHWQLQTIVGQLRDARDQWRTRNGRVSGEQGGRELPSRAA
FT                   MAEILEALCGALFPMRLGPVDLREESEDFYVGHTLDAALNALLAQARLELRYVARQSGE
FT                   ADAEVNARAIRLIQDFALALPGLRVLLDTDVLAAYHGDPAARSVDEVLLCYPGILAVIH
FT                   HRLAHHLYRAGLPLLARISSEIAHSATGIDIHPGAQIGRSFFIDHGTGVVIGETAIIGE
FT                   RVRIYQAVTLGAKRFPADEDGQLQKGHPRHPIVEDDVVIYAGATILGRITIGKGSTIGG
FT                   NVWLTRSVPAGCNLTQANLQHDDGSQK"
FT   gene            290735..292735
FT                   /gene="betT"
FT                   /locus_tag="PFL_0251"
FT   CDS_pept        290735..292735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="PFL_0251"
FT                   /product="high-affinity choline transporter, BCCT family,
FT                   BetT"
FT                   /note="identified by similarity to SP:P0ABC9; match to
FT                   protein family HMM PF02028; match to protein family HMM
FT                   TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95662"
FT                   /db_xref="GOA:Q4KK36"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK36"
FT                   /protein_id="AAY95662.1"
FT                   /translation="MSAPSTSANALIRMNPPVFYFAASFILIFGVVVISMPEQAGAWLL
FT                   AAQNWAANTVGWYYMLAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGMLFAA
FT                   GISITLFFFCVSEPLTHMLQPPQGEAGTAEAARQGMQLLFLHWGLHGWGVFAFVGMALA
FT                   YFAYRHNLPLALRSALYPLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLHLNSGL
FT                   DYLFGIAHTQWIQVGLITLMMGAAIIVAVSGVDKGVRVMSDINMLLAVALLLFVLFAGP
FT                   TQHLLNTLIQNLGDYLGALPTKSFDVYAYNKPSDWLGGWTVFYWAWWIAWSPFVGLFIA
FT                   RISRGRTIREFVFGVLLIPLGFTLAWMSIFGNSAIDQVLNHGMSALGMSAIDNPSMTLY
FT                   LLLETYPWSKTVIAVTVFISFVFFVTSADSGTVVLSTLSAKGGNADEDGPKWLRVFWGA
FT                   MTALVTSALLFAGSIDSLKSAVVLTSLPFSLILLLMMWGLHKAFYLESQRRIAQLHSLA
FT                   PVAPSRRGKGGWRQRLSQAVHFPSRDEVYRFLDQTVRPAIEEVTAVFVEKGLNVVTQPD
FT                   PANDSVSLEIGHGDQHPFIYQVQMRGYFTPSFARGGMGPKELRNRRYYRAEVHLAEGSQ
FT                   DYDLMGYTKEQIINDILDQYERHMQFLHLVR"
FT   gene            complement(293055..293795)
FT                   /locus_tag="PFL_0252"
FT   CDS_pept        complement(293055..293795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0252"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95663"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK35"
FT                   /protein_id="AAY95663.1"
FT                   /translation="MTAQAAKVAIVTGASRGIGAVIARQLAKEGYAVAINYASSSEEAS
FT                   RLVVELRQAGHRAIAVKADVASASDVRRLFEETETQLGKVDVLINNAGILKVLPLAEHS
FT                   DELYEQTFAINTRGTFNTLREAAGRLNDGGRIVNFSSSTVGLNLPGYSVYIASKAAVES
FT                   LTQVFAKELRGRQITVNAVAPGPVATELFLKDKTAEQVASFARMPPLERLGQPEDIASI
FT                   ISFLASPAAAWVNGQILRANGGLV"
FT   gene            293927..294817
FT                   /locus_tag="PFL_0253"
FT   CDS_pept        293927..294817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0253"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95664"
FT                   /db_xref="GOA:Q4KK34"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK34"
FT                   /protein_id="AAY95664.1"
FT                   /translation="MDQVKGMKVFVRIYERSSFTLAADDLNLPRATLTHTLNQFEAWLG
FT                   TRLLERSTRRVRPTLDGQAYYPRCVQLLAELEEAELAFRTVEPHGRLRVDMHGTLAKHF
FT                   VIPRLGEFMQRYPQIELAISEADHFVDLVAEGVDCVLRAGNLEGSSLIARRVANLQQVT
FT                   CASPAYLARYGEPQSLDELGAHRAVNYVSRTATRSFPFEFLVEGQVREVAIDGALSVFG
FT                   AQIYGASALAGLGIIQCPRYHVARQIEQGSMREILCHTPPPAMPVSVVYPHSRHMSPRV
FT                   RVFVDWLAQVFTEAH"
FT   gene            complement(294956..296002)
FT                   /locus_tag="PFL_0254"
FT   CDS_pept        complement(294956..296002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0254"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95665"
FT                   /db_xref="GOA:Q4KK33"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK33"
FT                   /protein_id="AAY95665.1"
FT                   /translation="MSSDQAPGRKRRGAGRVTLNTVARQAGVSAITVSRYFNQPDSVSP
FT                   ERRERIAAVVAELGYVPNLVAGGLASARGRIVAMVIPNISGPIFAQTIQGFSDTLSRHG
FT                   YQLLLASSYFDARQEESAVRAFLGWSPAALVLTSHFHSPGTEKMLADTEIPVIETWDYQ
FT                   PQRQPLQIGFSHFQVGVTAARHLHAKGYRRIAFVQNSAPGDFSALERRDGYLATLAELG
FT                   LAPRVFAPDADRAPFEAGKQAMEALMGSPERPDAIIFANDNLAAGGLLAGQRAGLKIPE
FT                   ECAVLGFGDYPFAQMLLPSLSTIQPPALQIGVLAATRVLESLGVLPVAGTVQRLNLLQC
FT                   RLIERESS"
FT   gene            296208..298466
FT                   /locus_tag="PFL_0255"
FT   CDS_pept        296208..298466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0255"
FT                   /product="TonB-dependent outermembrane receptor"
FT                   /note="Receptor; identified by match to protein family HMM
FT                   PF00593; match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95666"
FT                   /db_xref="GOA:Q4KK32"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK32"
FT                   /protein_id="AAY95666.2"
FT                   /translation="MQNFLGEQHSLTQSIRGATPLRPHLGWLLAGLAALPLPAAYAAGS
FT                   GASAQDQEPTLKSVTVTATRREESLQKVPVAVSVVEGEQLERDNRNGVASIVQQVPSLN
FT                   FRTGASNKDTSLFIRGVGTISTSPGVEPTVATVIDGVVYGRPGQATLDLLDLERIEVLR
FT                   GPQGTLFGKNASAGVLNVITKAPTAETHGYIDQAYYSGNESRTRFGIGGSLIPDTLKGS
FT                   LTTLFGSYDGNVDNRHNGQEVNGYNRKGVRGKLEFTPSEDLKFTFAADYMQSHDDAPNG
FT                   VVSKALTPAFANALNPVRASSDNRDINTDTRTHVDDINKGLSGQLDWSLGDYTLTSITA
FT                   WRGWNNTQYQDGDRLGTVTAAFPGTADKGDLDYNQYSQELRLASPKGQFLEYVGGLFYM
FT                   HGKDEETYQRTLTTTTGANRGIADYSTTNDSYAVFGESTLNFTEDFRGIAGLRWTHDDL
FT                   KYDHRRVSTSATTVSGIQPGTQSSGSVDEDGWSGRLGLQYDLSATVTSYLTYSRGYKGP
FT                   AYNVFFNMQPRDTQALKPETSNTWEVGIKASSWNNRLTTNLAVFHSEYDNYQANFFDTV
FT                   AGQVVTRLINAGSVSSEGVELDYALQATQQLKFSGALAYTRARIDEFACPAGAAASCNV
FT                   NGKPLPFSPDWKSYVRADYSIPLDNGLDIELGTDYSWQSEVQYDISQNLDTRQGAYGIW
FT                   NASIALADYNDGWRVALLGKNLADKSYSPLLASGGNYIYRAVPRDDERYFGVQLRKDF"
FT   gene            298610..299938
FT                   /gene="ntaA"
FT                   /locus_tag="PFL_0256"
FT   CDS_pept        298610..299938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntaA"
FT                   /locus_tag="PFL_0256"
FT                   /product="nitrilotriacetate monooxygenase component A"
FT                   /EC_number="1.5.1.-"
FT                   /note="identified by similarity to SP:P54989"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95667"
FT                   /db_xref="GOA:Q4KK31"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK31"
FT                   /protein_id="AAY95667.1"
FT                   /translation="MSRSTRQLKLGAFLMATGHHVAAWRHPDVPAQAGLDFAVYKELAQ
FT                   IAEAARFDALFVADSLAAPTGPIASRMARSDYFEPLTLLAALAAVTERIGLIATSTTSY
FT                   NVPYHVARKFASLDHLSGGRAGWNLVTSDNAAEARNFGREEHFGHAERYRRAREFHRVV
FT                   TGLWDSWEDDAFVRDKASGEYFDPDKQHLLDHRGEFFQVKGPLNVARPPQGYPVIVQAG
FT                   SSESGRELAAQTAEVVFTAQPSMAAAQAFYADLKGRLKQYDRSTQSLKIMPGVFVVVGD
FT                   SESQAREKFEAFQDLVEPEVGVALLGRMLGNFDLSGYPLDAPLPALPLTESGQQSRQQL
FT                   LTELAGKDNLTLAQLGRRIAGGRGHYSLIGTPGQIADELQAWFEEGAADGFNVLVPHLP
FT                   GGLRDFAGGVIPELQRRGLFRTEYEGRTLRENLGLARPKNQFV"
FT   gene            300088..301125
FT                   /gene="yghZ"
FT                   /locus_tag="PFL_0257"
FT   CDS_pept        300088..301125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yghZ"
FT                   /locus_tag="PFL_0257"
FT                   /product="L-glyceraldehyde 3-phosphate reductase YghZ"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by similarity to SP:Q46851; match to
FT                   protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95668"
FT                   /db_xref="GOA:Q4KK30"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK30"
FT                   /protein_id="AAY95668.1"
FT                   /translation="MTYIAAENRYDSIPYRRVGRSGLVLPALSLGLWHNFGDSTPIDTQ
FT                   RALLRTAFDLGINHFDLANNYGPPYGSAEINFGRLLREDFKAYRDELIISSKAGWDMWP
FT                   GPYGQGGGSRKYVLASLDQSLQRLGLDYVDIFYSHRFDPDTPLEETASALATAVQQGKA
FT                   LYIGISSYSGAKTREIAALLKEWKVPLLIHQPAYNMLNRWVEKDLLDTTEELGAGVIAF
FT                   TPLAQGLLTDKYLNGIPEDARVNRPGGGSLQASHLSEANIAHVRALNEIAKNRGQSLAQ
FT                   LALAWTLRDPRVTSALIGASRPEQIVENVGALQNLSFSVEELAEIDHFAKEGRINLWEK
FT                   PSTAE"
FT   gene            complement(301221..302408)
FT                   /locus_tag="PFL_0258"
FT   CDS_pept        complement(301221..302408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0258"
FT                   /product="auxiliary transport protein, MFP family"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95669"
FT                   /db_xref="GOA:Q4KK29"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK29"
FT                   /protein_id="AAY95669.1"
FT                   /translation="MEQSTQTQNAILQAAQESEKPRKRSKRPLIAGAIALTLVAVGVGW
FT                   VLMAPSTQATDDAYIAADATSVAPRVHGLVTEVLVKDHQNVTAGQPLVRINSEEFDSRV
FT                   SLAEGDLADNQAQVALAEAALTIQDAEQRLASARVQAARTSIRTNQAESKRAGAERNRF
FT                   DTLVTTGAVARNEVEKYSTQAISAEQGLAYAQAMLQVAENDLAVTTAQRQRLQAQLQMA
FT                   KAKVVTAKARLELAQQDLRHTTIYAPMDGTVGNRQIQVGDYVQPGSRLLTLVPLHDLYV
FT                   LANFKETQTQHMYPGQSTQIKIDALPGVSITGTVESLAPGSGSTFALLPFEPGTGNFTK
FT                   IVQRVPVRIRFDANQSGLERLRPGLSVTAKVDLDDPQDRTVAGNPSSLKVSSTTR"
FT   gene            302486..304081
FT                   /locus_tag="PFL_0259"
FT   CDS_pept        302486..304081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0259"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95670"
FT                   /db_xref="GOA:Q4KK28"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK28"
FT                   /protein_id="AAY95670.1"
FT                   /translation="MTTSATDLSEAGAQPGQQSTKRKFLVFTIMAFGMFMALIDIQIVA
FT                   ASLNDVQAGLSAGPDEVSWVQTAYLIAELIMIPFSAFLAQAISTRWLFAASAAFFTLFS
FT                   VGCGMAWNIESMIVLRALQGFAGGAMVPTVFAVGFVLFEGKQRAMVPAILGMTAVLAPT
FT                   LGPTVGGLVTFYLDWRWIFFINVLPGLVICIGAALLIDVDRPDLSMLRRIDWLHFVAMA
FT                   LALGCFEYVLEEGPRKDWFSDTGIVIAAWVSLVSFGLFIERSLYSNNPIVSLVPFRDRT
FT                   FSIACLLNLVIGFGLYSSTYLVPVFLGRVRGFDSLEIGTTVFVVGIGQLVSTIIAARAS
FT                   EKVDRRLIISVGFLGLALSLWLTSRVTSNWGFDELLVPQVARGLFLMLCIVPSVNMALS
FT                   SFQGVELRQASGLFNLMRNLGGAIGIATVNTWLQDDARTQVLRLSESLGSKAVAAQELM
FT                   GQLALKIAADTPDASHAFLMAQGILGRLVGREALTLAFGDVFRLMAMMFVVALLLVPLC
FT                   KVPPAAPGAAEEEK"
FT   gene            complement(304096..305142)
FT                   /locus_tag="PFL_0260"
FT   CDS_pept        complement(304096..305142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0260"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95671"
FT                   /db_xref="GOA:Q4KK27"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK27"
FT                   /protein_id="AAY95671.1"
FT                   /translation="MDVLTLIALEGAMGSSVAITLDVLRTANQVAEVMGRPTITWKIIG
FT                   SSESVRMRNGMRLDAQPLDKVQAIEGSMLVIPGLGLENTQELDFFGCRREKRLPGLSLS
FT                   SELITRLGHADIRKLSQLVHDHHRRGQQTAASCSAVFVLGEAGVLEGHTVTTHWQLYET
FT                   FKERYPEAILDTKRMLIHDGNMITAGAGMSQMDLMLYILRNKMGNQIAELTMRYLLIDG
FT                   RPAQYHYMALSNLQTENREVLLMEKFIEDCLPNVPPLSTIAEHLRITEKTLSRRIRSAT
FT                   GKPPMAFIQKVRLQHVQSLLETTNMSIEEVAFKVGYADSTALRRLMWKNMGCTPSQLRK
FT                   TRSGPPII"
FT   gene            305433..307295
FT                   /locus_tag="PFL_0261"
FT   CDS_pept        305433..307295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0261"
FT                   /product="AMP-binding protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95672"
FT                   /db_xref="GOA:Q4KK26"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK26"
FT                   /protein_id="AAY95672.1"
FT                   /translation="MNYAVPRDYLNDVNPAISAHVAVDDLPLAEVPGIECLSSVTEVLA
FT                   YRAWRQPDAIAFIHLLDGEREEASISYAELWKRSQRLAAALQIFEPREKRVLMLFETGI
FT                   DYIVSLFGLLLAGAVAIPAFPPVGTRGLERLALICADAHPQLVLTSSRFMRSQERVNAL
FT                   LQGDLPVPQWVDPEQLAEADSSWRGQALAHGQLALLQYTSGSTSAPKGVMLTHDNLYSN
FT                   CRSASQWMGPARNRVGCSWLPPYHDMGLMGGILQPIFDAFPTVLISPGHFVQRPLRWLD
FT                   AVSRYGADVTIAPNFAFDLCVENITDEELAELDLSKLKAIYCGAEPVRQSTLARFSERF
FT                   AAAGFNPAALGPCYGLAEATVLVSGKRHDEPAFNTQVDRDQLASGTLAIVDAEDARALP
FT                   LVSSGRVAPGLRVAIVDPVSLQPVADGQIGEIWVQGDNVGAGYWGKEALSQQVFRASLP
FT                   GIHGRFMRTGDLGALHRDELFVTGRLKDLIIIAGRNLYPQDLELAVESADPRIRSNGCV
FT                   AVGIDNGQQEQLAIVAEVKRSEKLDEAQQEQLRQVITSALVSQFGVAPARIHLAPMGGI
FT                   PLTTSGKVQRQATRKALLNDTLARYGASRAAAAPTLKTATDALS"
FT   gene            307343..308200
FT                   /locus_tag="PFL_0262"
FT   CDS_pept        307343..308200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0262"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95673"
FT                   /db_xref="GOA:Q4KK25"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK25"
FT                   /protein_id="AAY95673.1"
FT                   /translation="MAWLTVATPAVGTVVALVLAWHQGIGWLEIGALASMYLLTALGVE
FT                   VGMHRFFSHHAFKAGPVITAFFGIAGSMAAQGPILFWAATHRQHHAFTDKEGDPHSPRP
FT                   LKAGFIGNIQGWWHAHLGWLFSLRKQNWSQFVPDLLRDRLIMQINQRYYLWIILGLLLP
FT                   SLACGLITRSWEGALSGLLWGGFVRIFLVDHATWCINSFAHRVGGRDHKTRDTSRNVFW
FT                   LAIPTVGGGWHNNHHAFPALAHAGLKPWQLDIGGLFIELLALCGLAWDVKRPGPTVAAE
FT                   PSES"
FT   gene            308232..309188
FT                   /locus_tag="PFL_0263"
FT   CDS_pept        308232..309188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0263"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95674"
FT                   /db_xref="GOA:Q4KK24"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK24"
FT                   /protein_id="AAY95674.1"
FT                   /translation="MDEILTNTATPEVGGVAQLSPSAARTKARIALAVMLVPLFGTLEA
FT                   IRLWFTGQVHALDFILFAVFYAVQMFGVSMGYHRYLAHRAFKTSRLMSSLMLIAGCMAA
FT                   QGPILFWVTTHRRHHTYSDQHGDPHSPNLMGQSRWQRAKGLWHAHMPWMLAPDMSSWNF
FT                   FAPDILRDRRLFFYNQTYLFWVALGVILPGVIGGLVSQSWSGAWSGLIFGGLARIFVAN
FT                   QAAWCVGSICHRYGARPFVTHDQSTNNWIVAFLTFGEGLQNNHHAFPAWYRHGVHWWEP
FT                   DLSGWTLALMGKLRLVSDLRSPSQAMIDKVRKRQASS"
FT   gene            309241..309561
FT                   /locus_tag="PFL_0264"
FT   CDS_pept        309241..309561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0264"
FT                   /product="phosphopantetheine attachment site domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95675"
FT                   /db_xref="GOA:Q4KK23"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK23"
FT                   /protein_id="AAY95675.1"
FT                   /translation="MSNFISNLLSTLSFSEKKQAAVELNEDSIKHWLVQKMGALLKIDP
FT                   SQVDTARSFESYGLDSLVAVKVAGDLEKFMEQRLSPALLFEYSSIDDLSKYLANELTTS
FT                   EV"
FT   gene            309580..311559
FT                   /locus_tag="PFL_0265"
FT   CDS_pept        309580..311559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0265"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95676"
FT                   /db_xref="GOA:Q4KK22"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK22"
FT                   /protein_id="AAY95676.1"
FT                   /translation="MAIAQMPSQKNDKFNDLLRRSQEIEGLRLTDAIPKHLYQPRVWRG
FT                   MLSFVVSYMLYIGAIVAVAHVHWMFYLPLWLVAGLGGWGLFCVAHDCGHNSFSRNRSFN
FT                   HILGHIALLPLLYPFHGWRHMHNMHHANTNNLEMDVDWRPVLRVQYDAMPWWDKLVYSS
FT                   TRTWLFWLGTVNYQRHSGFRPSMFHKLEARNEVRRSILFMVVAALIYLPTLVYFTGFTG
FT                   LFLYFIAPWLATHAWFSLTTMMHHISDETPFLTKEHWSFNSSRLLLTTDYMYPKWLLFL
FT                   THYISVHTAHHVAPIIPHYNLPEAQAALKTAFPGMVREKPMTVQDVWHVARSCHLYDPV
FT                   NGFYESFDQPAQAAGDPSPPGARAANGPLTMKQQMLRSYMGVLGSVSLETAGAKATDLF
FT                   GYTREYIKQPDKEMSPLGAQRFHIKGIPGVPHGYQWGTGNQTILLVHGWGADSRSLYSF
FT                   TRVLQRQGFKVATFDAPAHGISPGSLSTMTEFKDAVKAAIVALGDVVGIVAHSLGGIAA
FT                   TGALAELAETHRIKALCLLGSPANLPVVIQRWANGYLKLKPAVVQAMHRELWKRNGVPV
FT                   EHWDIPALGNALQLPTLVLHDLNDPIVPFCEAQQITTLMPWAKLEPVSGLGHVRILSDA
FT                   AVLEQVAQFLVENVKVAEVAQASA"
FT   gene            311597..311794
FT                   /locus_tag="PFL_0266"
FT   CDS_pept        311597..311794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0266"
FT                   /product="rubredoxin"
FT                   /note="identified by similarity to GB:BAB33291.1; match to
FT                   protein family HMM PF00301"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95677"
FT                   /db_xref="GOA:Q4KK21"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK21"
FT                   /protein_id="AAY95677.1"
FT                   /translation="MSTYAENAVAESGLWMCLICGWIYDQRLGDPDSGVPPGTAWDDIA
FT                   EDWTCPECGVSKLDFNMVKL"
FT   gene            311892..312758
FT                   /locus_tag="PFL_0267"
FT   CDS_pept        311892..312758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95678"
FT                   /db_xref="GOA:Q4KK20"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK20"
FT                   /protein_id="AAY95678.1"
FT                   /translation="MLFKGIYNGVLGLLRCSFWIESRLFPQRAAARALKMFTTPQRLRQ
FT                   HFPQTLPSATVQDLETDQGRLRCFRWTPPQVRRRVVLVHGWSGASTQWQYLIPLLLEEG
FT                   CEVLSFDCIGHGGSGGRQASLPTFVSMLDQVQKQLGPFDTVIGHSLGGAAAGYALSTPV
FT                   GKGFQRAVLVAAPADIENVVRRFAAFLWINDDVRQRMQLLVEQRYQKDMASLAVSRYGR
FT                   QVEVPVLLVHDQQDQEVPADDLQSFAEGLRHRRVLQTRGLGHLKILKDSATMEAVVEFV
FT                   CAKDGNL"
FT   gene            312755..314209
FT                   /gene="lpdA_2"
FT                   /locus_tag="PFL_0268"
FT   CDS_pept        312755..314209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA_2"
FT                   /locus_tag="PFL_0268"
FT                   /product="dihydrolipoyl dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by similarity to SP:P14218; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF00890; match to protein family HMM PF02852; match to
FT                   protein family HMM PF03486; match to protein family HMM
FT                   PF07992; match to protein family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95679"
FT                   /db_xref="GOA:Q4KK19"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK19"
FT                   /protein_id="AAY95679.1"
FT                   /translation="MSESYDVIVIGAGPGGYVAAIRAAQLGLKTVCIERYKGKDGKTAL
FT                   GGTCLNVGCIPSKALLDSSHHYYEARNGFEVHGIAISNPQMDVPAMLARKDNVVRNFNG
FT                   GIASLFKANGVALLEGHGKLLANKEVEVTAADGSTQRISAGNIILAPGSRPIDIPAAPL
FT                   AGEVIVDSTGALEFTQVPKRLGVIGAGVIGLELGSVWARLGAQVTVLEALDSFLPAVDA
FT                   QIAKEAQKILGKQGLDIRLGARVTACEVQGDSVKVSLSEAGEDKQQVFDRLIVAVGRRP
FT                   LTTDLLAADSGVHLDERGFIHVDGQCCTSVPGVFAIGDVVRGPMLAHKASEEGVMVAEG
FT                   IAGHRHPLNYDLIPSVIYTHPEIAWVGQTEQALKAEGVELNIGTFPFAASSRAMAANDT
FT                   AGLVKVIADAGTDRVLGVHVIGPGAAELVQEGAIGMEFGTSAEDLGMMVFSHPTLSEAL
FT                   HEAALAVNGQAIHIGNRKKKAPAGVK"
FT   gene            complement(314267..315106)
FT                   /gene="tauD"
FT                   /locus_tag="PFL_0269"
FT   CDS_pept        complement(314267..315106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="PFL_0269"
FT                   /product="taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="identified by similarity to SP:P37610; match to
FT                   protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95680"
FT                   /db_xref="GOA:Q4KK18"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK18"
FT                   /protein_id="AAY95680.1"
FT                   /translation="MSLTITPLSSALGAQIGGIDISQPLSIEHRDAIEQALLKHQVLFF
FT                   RNQPVTPQQQARFAACFGDLHIHPIYPNVPEQPEVLILDTAETDVRDNAIWHTDVTFLP
FT                   TPALGAVLSAKLLPEFGGDTLWASGIAAYEALSEPMKNLLQGLTATHDFTKSFPLERFG
FT                   NTTEDLARWEETRRKNPPLSHPVIRTHPVSGRKSLFVNDGFTTRINELSESESAAILQL
FT                   LFAHATRPEFTIRWRWQENDIAFWDNRVTQHYAVDDYRPQRRVMQRATILGDVPFLR"
FT   gene            complement(315368..316207)
FT                   /gene="tauC"
FT                   /locus_tag="PFL_0270"
FT   CDS_pept        complement(315368..316207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="PFL_0270"
FT                   /product="taurine ABC transporter, permease protein"
FT                   /EC_number="3.6.3.36"
FT                   /note="identified by similarity to SP:Q47539; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95681"
FT                   /db_xref="GOA:Q4KK17"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK17"
FT                   /protein_id="AAY95681.1"
FT                   /translation="MSSYEIPATATGEANPKAPQIVRRSLSTRWISVLTLVVLLALWWA
FT                   VTATGLIEPLFLPPPSAVLQKGWLLATSGYMDSTLWQHLAASLQRIGLALGFAVLTAIP
FT                   VGIAIGANRIARGVLDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAPIAI
FT                   ATATGVRTVDPAKLRAAQSLGATRAQLIRHVILPSALPDILTGVRIGLGVGWSTLVAAE
FT                   LIAATSGLGFMVQSAAQFLVTDVVVLGILVIALIAFAMEMGLRALQRKLVPWHGQSH"
FT   gene            complement(316204..316998)
FT                   /gene="tauB"
FT                   /locus_tag="PFL_0271"
FT   CDS_pept        complement(316204..316998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="PFL_0271"
FT                   /product="taurine ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.36"
FT                   /note="identified by similarity to SP:Q47538; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95682"
FT                   /db_xref="GOA:Q4KK16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KK16"
FT                   /protein_id="AAY95682.1"
FT                   /translation="MALLQLERISAQYPGAAEPVLADISLTLGPQQLLVALGPSGSGKT
FT                   SLLNLIAGFVEPSAGRIQLDGVPVQGPSAERGVVFQDDALLPWQDVLGNVAFGLELAGV
FT                   ARDKREARAREMLALVDLAGFDKRRIWQLSGGQKQRVGLARALAADPRVLLMDEPFGAL
FT                   DAFTREQMQELLLQVWRRTAKPVFLITHDIEEAVFLATDLILLAPNPGQIVERLNLDFG
FT                   QRYAAGESARAIKSDPRFIETREHVLARVFSQRSATQQQERP"
FT   gene            complement(317026..318003)
FT                   /gene="tauA"
FT                   /locus_tag="PFL_0272"
FT   CDS_pept        complement(317026..318003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="PFL_0272"
FT                   /product="taurine ABC transporter, periplasmic
FT                   taurine-binding protein"
FT                   /EC_number="3.6.3.36"
FT                   /note="identified by similarity to SP:Q47537; match to
FT                   protein family HMM PF04069; match to protein family HMM
FT                   PF09084; match to protein family HMM TIGR01729"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95683"
FT                   /db_xref="GOA:Q4KK15"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK15"
FT                   /protein_id="AAY95683.1"
FT                   /translation="MKLHFPLRLLAAASLAAASFFAQAADVTVAYQTTVDPAKVAQADG
FT                   SYEKATQAKINWRKFDNGADVIAAIASGDVQIGYLGSSPLTAAITRKVPVQTFLIATQI
FT                   GAAEALVARDGSGINSPQDLVGKKVAVPFVSTGHYSLLAALKHWNIDPSKVQILNLAPP
FT                   AIIAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAKFGAPTFDAWIVRKDFAEKHP
FT                   EIVTAFAKVTLDAYAQYRKDPQAWLANQGNVDKLVKLSGAKASDIPLLLQGNVYPLAAD
FT                   QVVSLGAPTTKAITDTAAFLKEQGKVEAVLPDYAPYVSAKFIPE"
FT   gene            complement(318173..319771)
FT                   /gene="gshA"
FT                   /locus_tag="PFL_0273"
FT   CDS_pept        complement(318173..319771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="PFL_0273"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04262;
FT                   match to protein family HMM TIGR01434"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95684"
FT                   /db_xref="GOA:Q4KK14"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KK14"
FT                   /protein_id="AAY95684.1"
FT                   /translation="MKESNLSELLNRRLALLGERANLSLLEQCLHGIERECLRVTGEGR
FT                   LAQTPHPEELGSALTNEQITTDYSESLLEFITPALKDPADTLASLDKIHRFAYSKLGNE
FT                   YLWSPSMPCPLPAEEDIPIAYYGTSNIGQLKYVYRKGLALRYGKTMQCIAGIHYNFSLP
FT                   EQLWPLLKQAEGFVGTDRDYQSSAYIALIRNFRRYSWLLMYLFGASPALDAGFLRGRSH
FT                   QLEQLDAETLYLPYATSLRMSDLGYQSKAQAGLTPCYNDLNSYTDSLRKAVATPYAPYV
FT                   EVGTHKDGEWVQLNTNILQIENEYYSNIRPKRVTYTGERPIQALMARGIQYVEVRCLDI
FT                   NPFLPLGIDIQEARFLDAFLLYCALNDSPLFENNECGNATSNFLAVVKEGRRPGLQLQR
FT                   QGQPVEMKEWAAQLLEQIAPLAALLDQSHGSDVHSKALDAQLAKVKDSSLTPSAQVLAA
FT                   MSEHKESFTQFSLRQSQAHAEYFRSQTLSKEEQAAFEEAARKSLEQQTELEQNEVGDFD
FT                   VFVGAYQASILAISN"
FT   gene            complement(319972..320355)
FT                   /locus_tag="PFL_0274"
FT   CDS_pept        complement(319972..320355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0274"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95685"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK13"
FT                   /protein_id="AAY95685.1"
FT                   /translation="MQIPAGLTESAFSQLLGCRLQRLETGEADVALELTPQLRNRGQKL
FT                   HGGAIFSLVDIAMGLACSSTHGFDQQSATIECKINYIRAVAEGEVLCRAKVIHPGRRTL
FT                   VVEADVIQGDKLVAKAQGTFAVL"
FT   gene            complement(320355..322679)
FT                   /locus_tag="PFL_0275"
FT   CDS_pept        complement(320355..322679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0275"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF09371"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95686"
FT                   /db_xref="GOA:Q4KK12"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK12"
FT                   /protein_id="AAY95686.2"
FT                   /translation="MDSINSRIAEELGVRPQQVEAAVALLDEGSTVPFIARYRKEVTGS
FT                   LDDTQLRHLEERLRYLRELDERRISILASIEEQGKLTPELARDIKLADTKTRLEDLYLP
FT                   YKQKRRTKGQIALEAGLGELADGLFNDPNLAPETEAARFVDAEKGVADVKAALEGAKYI
FT                   LMERFAEDASLLEKLRNFLKQEATISARVIAGKEEEGAKFRDYFEHDEPLKSMPSHRAL
FT                   AIFRGRNEGILSSALKVGDELPGTMHPCEGMIGQQFGIQNQNRPADKWLGEVVRWTWKV
FT                   KLYTHLETDLLGELRDGAETEAINVFAHNLHDLLLAAPAGPRATLGLDPGLRTGCKVAV
FT                   VDATGKLLDHATVYPHVPHNKWDQTLGILAALCAKHSVDLIAIGNGTASRETDKLAAEL
FT                   IKKYPAMKMTKVMVSEAGASVYSASELAAKEFPDLDVSIRGAVSIARRLQDPLAELVKI
FT                   DPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLARISGLNATLAQN
FT                   IVSHRDEHGAFKTRAALKKVARLGEKTFEQAAGFLRVMNGDNPLDASAVHPEAYPLVQR
FT                   IAADTGRDIRSLIGDSGFLKRLDPKKFTDETFGLPTVTDILQELDKPGRDPRPEFKTAE
FT                   FQDGVEDLKDLQLGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFIKDPREAVK
FT                   AGDVVKVKVMEVDIPRKRVGLSMRMGDTPGEKIDGARGSRPGSAPRSSQGNAPRKESAA
FT                   PAPSNNAMASLFANAKQLKKR"
FT   gene            323039..323779
FT                   /gene="ompR"
FT                   /locus_tag="PFL_0276"
FT   CDS_pept        323039..323779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="PFL_0276"
FT                   /product="DNA-binding response regulator OmpR"
FT                   /note="identified by similarity to SP:P03025; similarity to
FT                   GB:AAS48175.1; match to protein family HMM PF00072; match
FT                   to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95687"
FT                   /db_xref="GOA:Q4KK11"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK11"
FT                   /protein_id="AAY95687.1"
FT                   /translation="MSSTVQTAEGEKILIVDDDPGLSSLLERFFVSKGYRARAVPNTEQ
FT                   MDRLLGREVFNLVVLDLMLPGEDGLTACRRLRSANNQIPIIMLTAKGDELSRIKGLELG
FT                   ADDYLAKPFNPDELMARVKAVLRRQSAPVPGAPGSEDESVTFGDYELSLATRELKRGNE
FT                   VHMLTTGEFAVLKALVMNARQPLTRDKLMNLARGREWDALERSIDVQISRLRRMIEPDP
FT                   SKPRYIQTVWGVGYVFVPDGTATK"
FT   gene            323885..325198
FT                   /gene="envZ"
FT                   /locus_tag="PFL_0277"
FT   CDS_pept        323885..325198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="PFL_0277"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /note="identified by similarity to SP:P41406; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95688"
FT                   /db_xref="GOA:Q4KK10"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK10"
FT                   /protein_id="AAY95688.1"
FT                   /translation="MKTPLWFPQSFFSRTLWLVLIVVLFSKALTLVYLLMNEDVLVDRQ
FT                   YSHGVALTLRAYWAADESNRDQIAEAAGLIKVVGSGVPAGEQHWPYSEIYQRQMQAELG
FT                   ADTEVRLRMHAPPALWVRAPSLGDGWLKVPLYPHPLRGQKIWSVLGWFLAIGLLSTASA
FT                   WIFVSQLNQPLKRLVYAARQLGQGRSVRLPISDTPSEMTEVYRAFNQMAEDVEQAGRER
FT                   ELMLAGVSHDLRTPLTRLRLSLELMGDHTDLTDDMVRDIEDMDAILDQFLAFIRDGRDE
FT                   SVEEVDLGDLVQEVAAPYNQNEERVHLRLEPIQPFPLRRVSMKRLLNNLIGNALNHAGT
FT                   EVEVAAYVSGDTNAPYVVLSVMDRGAGIDPSELEAIFNPFTRGDRARGGKGTGLGLAIV
FT                   KRIAAMHGGNVELRNRPDGGLEARVRLPLGLLLPRDAD"
FT   gene            complement(325274..326179)
FT                   /gene="rimK"
FT                   /locus_tag="PFL_0278"
FT   CDS_pept        complement(325274..326179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="PFL_0278"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /note="identified by match to protein family HMM PF02655;
FT                   match to protein family HMM PF08443; match to protein
FT                   family HMM TIGR00768"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95689"
FT                   /db_xref="GOA:Q4KK09"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KK09"
FT                   /protein_id="AAY95689.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGTERGHEMVVVDTLRAYMNIASHK
FT                   PQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSL
FT                   QLLSRRGIGLPVTGFAHSPDDIPDLIEMVNGAPLVIKVLEGTQGIGVVLCETATAAESV
FT                   IEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIAAMKRQAKPGEFRSNLHRGGSASL
FT                   IKITPEERMTALRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIETTTGKNVAGI
FT                   IIEHIEKNGGPNMTRTKGKG"
FT   gene            complement(326176..326658)
FT                   /locus_tag="PFL_0279"
FT   CDS_pept        complement(326176..326658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05618"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95690"
FT                   /db_xref="GOA:Q4KK08"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK08"
FT                   /protein_id="AAY95690.1"
FT                   /translation="MKTFDHLTVVGLREWVALPDLGVAGLRAKIDTGASTSSLHATEIE
FT                   PFERDGEQWVRFNAHLGSVVQLRHRRCEAPLVAMKTIKSSNGQAQVRYVISTTLALGDR
FT                   VWRVEFTLACRKAMRYRLLLGSKALIDGQLVVNPGIKYVQDKPVFPVSTTSATGVA"
FT   gene            complement(326675..327454)
FT                   /locus_tag="PFL_0280"
FT   CDS_pept        complement(326675..327454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0280"
FT                   /product="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95691"
FT                   /db_xref="GOA:Q4KK07"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK07"
FT                   /protein_id="AAY95691.1"
FT                   /translation="MTDFPTSLTSPGNRCEGCQQSQPLGFDFSFAYQPIVDLRDHSVFA
FT                   HEALVRGVNGEGAGTVLGQVNDSNRYRFDQRCRTQAITLAAQLGMQSHLSINFMPNAVY
FT                   RPELCIRSTLEAARAQRFPLDRLIFETLESQHVDNYRHLTNILREYREFGFKTAIDDFG
FT                   SGYSGLNLLADFQPDLIKLDMALVRDVDQDRVRQAIIRAIVTMCAELGVTVIAEGIESA
FT                   GERDFLSDCGIYLMQGYWFAKPAFKALAEVPAAAWNS"
FT   gene            327570..327974
FT                   /gene="hslR"
FT                   /locus_tag="PFL_0281"
FT   CDS_pept        327570..327974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="PFL_0281"
FT                   /product="heat shock protein 15"
FT                   /note="identified by similarity to SP:P0ACG8; match to
FT                   protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95692"
FT                   /db_xref="GOA:Q4KK06"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK06"
FT                   /protein_id="AAY95692.2"
FT                   /translation="MAHKQEEEDKVRLDKWLWAARFYKTRALAKTAIESGKVHHRGERC
FT                   KPGKEPRVGDEYQIRAGFDERTVVVQALSIVRRGAPEAQALYAETEASIAKREAAAAQR
FT                   KAGALGVSTDGKPSKKQRRDLFKFHGSNHE"
FT   gene            complement(328013..328825)
FT                   /locus_tag="PFL_0282"
FT   CDS_pept        complement(328013..328825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0282"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95693"
FT                   /db_xref="GOA:Q4KK05"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK05"
FT                   /protein_id="AAY95693.1"
FT                   /translation="MNNPGLFQARWNLGKLVLCNLLPLALLGFWLWPTGQALCTVFDEW
FT                   LFHHLNAPLASNSTWLHIWAVASLRPFDIVVGLIMLGLLIRGDWVFKAVDVRRAFFGFL
FT                   SILILMVVIRALFSKLVAVMNWQHNSPSMVLEGAVHMSDYFPGWEKTWELKDRSSQSFP
FT                   GDHASVLLIWGLFMGIFSRSIGQFLIVWGLTLLFMMPRLVAGAHWGQDDYIGGVLLAVL
FT                   ALGWGYYTPYAARMSNFLLRLTHPLFNLLSRMPVLSRMSVVRASSLLR"
FT   gene            328924..329826
FT                   /gene="hslO"
FT                   /locus_tag="PFL_0283"
FT   CDS_pept        328924..329826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="PFL_0283"
FT                   /product="chaperonin HslO"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95694"
FT                   /db_xref="GOA:Q4KK04"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KK04"
FT                   /protein_id="AAY95694.1"
FT                   /translation="MTDLPDTDFTQRFIFDESDTRGELVALERSYAEVLAKHPYPEPVA
FT                   QLLGELMAAASLLVGTLKFDGLLILQARSEGPVPLLMIECSSEREIRGLARYDAEQIAP
FT                   DATLADLMPNGVLALTVDPTNGQRYQGIVDLDGTNLAECFTNYFVMSQQTGTRFWLYAD
FT                   GRSARGLLLQQLPADRLRDQEERDASWQHLTALASTLTADELLSLDNETVLHRLYHEEA
FT                   VRLFDVQPLRFRCSCSRERSGNALVSLGLEDAQQLVVEHGGSIEIDCQFCNERYLFDAA
FT                   DIAQLFAGAGVDTPSDTRH"
FT   gene            330006..331550
FT                   /gene="pckA"
FT                   /locus_tag="PFL_0284"
FT   CDS_pept        330006..331550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="PFL_0284"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="identified by similarity to SP:P54418; match to
FT                   protein family HMM PF01293; match to protein family HMM
FT                   TIGR00224"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95695"
FT                   /db_xref="GOA:Q4KK03"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KK03"
FT                   /protein_id="AAY95695.1"
FT                   /translation="MTQANNAVYTDLSVDDLVKEALNRGEGELADTGALVVRTGHRTGR
FT                   SPVDRFIVEEPSTQDAIAWGPINRKFPAAKFDALWDRVEAYLGERERFVSHVHVGSDPA
FT                   HYLPVKMTTETAWHNLFGRCLFINPEQYNAGGKDEWQILNAPNFVCEPERDGTNSDGTV
FT                   ILNFAAKKVLIAGMRYAGEMKKALFSVQNFLLPAADVLPMHCAANMGEEGDVTLFFGLS
FT                   GTGKTTLSADESRYLIGDDEHGWGVGVVFNIEGGCYAKCIDLSEKNEPVIWKAIQHGAV
FT                   LENVVIDPVTKKADYADDSLTQNSRAAYPRELIEKRAPKNLGGEPNAVIFLTCDLTGVL
FT                   PPVSILSEEQAAYHFLSGYTALVGSTEMGSGSGIKSTFSTCFGAPFFPRPAGEYAELLI
FT                   KRIRGFGSKVYLVNTGWTGGGYGVGKRFNIPTTRGVIAAIQSGALIGAETEHLDIVNLD
FT                   VPKAVPGVETGLLNPRNTWADKAAYDEAAKALAGLFIENFKKFDVSDAIKAAGPKL"
FT   gene            complement(331666..332532)
FT                   /locus_tag="PFL_0285"
FT   CDS_pept        complement(331666..332532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0285"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95696"
FT                   /db_xref="GOA:Q4KK02"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK02"
FT                   /protein_id="AAY95696.1"
FT                   /translation="MDVLMGLLAALLWGGTDFLVGLNVRAVGVKRAVFFSQSLGFTLMS
FT                   LLLTIFPAFLLKAMAAPLEVWLMGVVAAAFTVSGALALGKAFALGKASIVAPLVTSYGV
FT                   VTTLLSWASGEQISLLQLMCILLCVIGVILSSLHSDSKLPHSTAAGRSIFFALLSAFLY
FT                   GTSFWLQGRYTLPQLGPISMLWLGYAVGSGVMLLMVLKVADGLKIPPLKNCGLLASTSL
FT                   MNLGAFFAFSWGAMSGSVSVVTVISTLSGGIAAVLGYVFFKERLTAVQVTGVVLVLLGA
FT                   LVLHLKT"
FT   gene            complement(332561..332914)
FT                   /locus_tag="PFL_0286"
FT   CDS_pept        complement(332561..332914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95697"
FT                   /db_xref="GOA:Q4KK01"
FT                   /db_xref="InterPro:IPR010862"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK01"
FT                   /protein_id="AAY95697.1"
FT                   /translation="MQLAPGFPDDVIMRQLMQLLHEEIGLPERKTLRLNTAINLDLGCD
FT                   GADARHLLNALEEQFDIDFVDFDSYRYFQPEGYDVSLKRRAKGRGDKLPLTIGMLYRAL
FT                   KEQRWDTQELEGL"
FT   gene            333148..334305
FT                   /locus_tag="PFL_0287"
FT   CDS_pept        333148..334305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0287"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95698"
FT                   /db_xref="GOA:Q4KK00"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KK00"
FT                   /protein_id="AAY95698.1"
FT                   /translation="MAFFRLAALLWLGMLMSPVQAQSLSLQVLDAVVKDAVLADAEVQL
FT                   GQASGRTDAQGRVTLEAADSPGSELLIRKLGYADLRAKCPCQGLSYAMSPVLKDPQSLR
FT                   VVLSWSAPGEDLDAHLSYPHRLLYYATGTGPGARMNVDSTDSRGPETLTIEQPVPGDAY
FT                   VYAVHDFTNGNNPESLRLGRSQAQVFVYKGPTLMRSYRVPQNRQGNLWVVFRLTANGQL
FT                   QDIDRVLQGNEEVESRMSDLDPLLLANGKPIDEVLARDEGPVDAKSLNQKGEASYRKGD
FT                   VGSAGIYYREAIELDPGFAQAYSNLALSNRKNSRPDEAVAADRQAIALASGPSAPTIRA
FT                   SAYYDMGRIYEDAGQLVTALEHYRKAREQKANPVYDKAIERLQNR"
FT   gene            334373..335503
FT                   /locus_tag="PFL_0288"
FT   CDS_pept        334373..335503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0288"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95699"
FT                   /db_xref="GOA:Q4KJZ9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ9"
FT                   /protein_id="AAY95699.1"
FT                   /translation="MRIRVFPWLLALCLTTGVAQAAGPLVFATIDRSGWPNPLTSAADF
FT                   DIASRAEILMFSKALLATEALDDKALKQRLGVRQLDRKSVDQLRQRFWEQLLDNYRQAS
FT                   QDCDGEPFCLQVRSLGELRQLAASFTGASKAAYGAWGEASGQFHQQYLNEQLRLAALFP
FT                   AVSSEIQRMDPAERLGDELADRQFLLTFDDGPSLRDGPTDQLIEVLRAYDLHSLFFVLG
FT                   DSFQARLSQSSAGKMRELYDGQCVGVHGWEHKSHSSWNEWQSSVIRSANLANRTLTNEY
FT                   LPLFRPPYGQRRSDSAGFFKAQGVQVMLWNIDSQDWSKKVGAEAAAQRVQTLMLLWRRG
FT                   IILFHDTHAKAAQAVPALLKANQHNGVQWLDCRTLR"
FT   gene            335672..337606
FT                   /locus_tag="PFL_0289"
FT   CDS_pept        335672..337606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0289"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM TIGR00614"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95700"
FT                   /db_xref="GOA:Q4KJZ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ8"
FT                   /protein_id="AAY95700.1"
FT                   /translation="MHSTLEQVFGYPQFRLGQEAAVSAVLAGRSAAAIFPTGSGKSLCY
FT                   QLPALLLPHLTLVVSPLLALMQDQLAFLQRHGIAAASIDSAQGRDEANEVMARARSGEL
FT                   KILMISVERLKNERFRNFLQQVPISLLVVDEAHCISEWGHNFRPDYLKLPDYQRQFNIP
FT                   QALLLTATATPKVIADMQAKFAIAQQDVVTTGFYRPNLNLLVEPVRGADKRRRLVQWMS
FT                   DRAGQPSIVYVTLQKTAEQIAEHLSQQGIAAEAYHAGLPHEQRESIQRRFMEGRSHCIV
FT                   ATIAFGMGIDKSDIRNVVHFDLPKSIENYSQEIGRAGRDGQPSDCLVLANRDSLNVLEN
FT                   FVYGDTPELSGIRCVLEELQASAADGQWEFLLGPLADQSNIRQLPLKTLLVQLELRGLI
FT                   APRYAYFAEYRFKLLLETEALLARFEGERRDFVEAVINTSSRARTWATVNFDALYEQYQ
FT                   APRNRVVKALDYFQEKGWVELESKQMTEVYSLLQTDFDLAALSADLHGYFTRHEGSEIA
FT                   RIHAMLDLFATEQCLGYRLAEYFGDRQAPQRCGHCSVCHGQVARLPEPPVLPALVDKSF
FT                   DGLCGHFIHRHQQHTGDVPGAERLTRFLCGISVPLFTRLKARSIPGFAALEDYPYAAVR
FT                   AWCEAHLPG"
FT   gene            337711..338937
FT                   /locus_tag="PFL_0290"
FT   CDS_pept        337711..338937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0290"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00725;
FT                   match to protein family HMM PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95701"
FT                   /db_xref="GOA:Q4KJZ7"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ7"
FT                   /protein_id="AAY95701.1"
FT                   /translation="MNQTAFDIQRAAVIGAGTMGRGIVMCLANAGLPVLWLDNNPQMLQ
FT                   QALAAVADTYAHNVRQGRIDQAEADARVARIKPAADYPQLADVDLVIEAVYENLELKQQ
FT                   IFRQLDATLKPEAILASNTSALDIDAIAAVTQRAPQVLGLHFFSPAHIMKLLEVVRAAK
FT                   TAPAVLDAALALGQRMGKVSVVAGNCFGFIGNRMLNTYVLEARKMLLEGAFPYQVDGAL
FT                   QGFGFAMGPFRMYDVVGIDLGWRARQLDGVGQDAPEVQIDNRLCESGRFGQKSGDGYYH
FT                   YEPGSRQAEHDLQVDALVLQVSEELGYRRRDIGSEEILERCLLALVNEGAKILQEGIAQ
FT                   SAADIDRVYLNGYGFPKEQGGPMSWADAQGLEQVRQRLQHLQAEHGAHWRPAQLIEELA
FT                   AAGKGFAQA"
FT   gene            339005..339439
FT                   /locus_tag="PFL_0291"
FT   CDS_pept        339005..339439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0291"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95702"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ6"
FT                   /protein_id="AAY95702.1"
FT                   /translation="MSEPMPQRGDYRHFQPIITRWHDNDVYGHVNNVTYYSFFDTAVNT
FT                   YLIERGGLDIHDGEVVGFVVSSACDYFASIAFPERIEIGLRVGKLGNSSVQYELAVFKA
FT                   GEADACAAGRFVHVFVDRASNQPVPIPPALRAALEQLLVA"
FT   gene            complement(339621..340094)
FT                   /locus_tag="PFL_0292"
FT   CDS_pept        complement(339621..340094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0292"
FT                   /product="surface antigen protein, Rickettsia 17 kDa
FT                   family"
FT                   /note="identified by match to protein family HMM PF05433"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95703"
FT                   /db_xref="GOA:Q4KJZ5"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ5"
FT                   /protein_id="AAY95703.1"
FT                   /translation="MKFSSILLLSLGLVSGVASAGGTTEAGVGGALGGVLGSVVGQQIG
FT                   GNTGSAIGAALGGAGGSAVGADKRSRGQAAIGGALGAAGGNVVGRSMGGNTGSLIGAAA
FT                   GGGAGGALGNYMGNESAREDRDYRGRDDRRYYRDGHRGRGHAYGHRKHRHYRD"
FT   gene            complement(340394..342742)
FT                   /locus_tag="PFL_0293"
FT   CDS_pept        complement(340394..342742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0293"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM TIGR01701"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95704"
FT                   /db_xref="GOA:Q4KJZ4"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ4"
FT                   /protein_id="AAY95704.1"
FT                   /translation="MSTHNQADQKPVARYKPYKGPAGGWGALISVAQAWLTSDNALKNI
FT                   RMMLKTNQNGGFDCPGCAWGDSPESGMVKFCENGAKAVNWEATKRRVDAAFFAKHSVTS
FT                   LLEQSDYWLEYQGRLTEPMSYNAETDRYQPISWENAFSLIARHLHNLPSPDMAEFYTSG
FT                   RASNEAAYLYQLFVRAYGTNNFPDCSNMCHEASGVALAQSVGVGKGTVTFDDFEHADAI
FT                   FVWGQNPGTNHPRMLEPLREAVKRGAQVVCINPLKERGLERFQHPQSPIEMLTNGNRPT
FT                   NTAYFRPALGGDMALLRGMAKFLLQWERDAQKAGAASVFDHDFLNAHTANVLDYLGTID
FT                   DTPWEQIVEQSGLALVEIEQAARMYAKGKNVIMCWAMGITQHRHSVPTIQEIANLMLLR
FT                   GNIGKPGAGLCPVRGHSNVQGDRTMGINERPPVAFLDSLERRFQFKVPRDNGHNVVEAI
FT                   HAMLEGRSKVFMGLGGNFAQATPDSPRTFQALSNCDLTVQISTKLNRSHLAHGKDALIL
FT                   PCLGRTDIDQQAGGPQAVTVEDSFSMVHASNGQLQPLSSQMRSEPWILAGIAAATLGSR
FT                   PVDWNWLAADYGRIRDLIADTIPGFKDFNERLKHPGGFYLGNSAGARQWNTPSGRANFR
FT                   ANSLPRDLIHERTRATGQLPDLILQSMRSHDQYNTTIYGLDDRYRGVKGQRDVLFANEA
FT                   DIIRLGFKPGQKADIVSLWDDGRERRVKGFTLLAFDIPAGQAAAYYPEVNPLVPLESTG
FT                   DGSHTPTSKFIAIRLEAASDSGLIMARSA"
FT   gene            complement(343024..343911)
FT                   /locus_tag="PFL_0294"
FT   CDS_pept        complement(343024..343911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0294"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95705"
FT                   /db_xref="GOA:Q4KJZ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ3"
FT                   /protein_id="AAY95705.1"
FT                   /translation="MDLKQLKFLIALDETRHFGQAAARCHITQPTLSMRLRSLEEELDL
FT                   PLVKRGQRFEGFTAPGERVLAWARTVLTAHDGLLAEAAACRGNLVGTLRVGVVPLSSFN
FT                   PQPLLQRLHAEHPNLRFELSSLSSEQILEQLASNRLDLGVSYLERLDSENFDSLPLEPT
FT                   HMGLLYDHRHFSFGEQPLSWEALIELPLGLLTSGMHFRQSIDHNFHIRGLQPQPVLQTD
FT                   AVHQLVQMVHGGLCCAVMPLDSGLETLTEHLRLQPIADAQTLARLGLIMRRSAPRSALA
FT                   QACFALYQQSFGDS"
FT   gene            344048..344488
FT                   /locus_tag="PFL_0295"
FT   CDS_pept        344048..344488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0295"
FT                   /product="putative phospholipid-binding domain/LysM domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF04972"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95706"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ2"
FT                   /protein_id="AAY95706.1"
FT                   /translation="MSIFSFVKEAGEKLIDLLTPGNANASEQLKEHIEKVGLGNPNVHA
FT                   TVEGDKVIVSGEVASQEEKEKILLALGNISGVGSVEDQITVTGPAVVSAVFVTVKKGDT
FT                   LSAIAKVQYGDANKYNKIFEANKPLLSHPDKIYPGQVLRIPE"
FT   gene            complement(344557..345219)
FT                   /locus_tag="PFL_0296"
FT   CDS_pept        complement(344557..345219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0296"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95707"
FT                   /db_xref="GOA:Q4KJZ1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ1"
FT                   /protein_id="AAY95707.1"
FT                   /translation="MALLPWHQIDTVLLDMDGTLLDLHYDNHFWMEHLPQRYAELHGVS
FT                   RAMAELELEPLFERNAGQLQWYCLDFWSAELQLPVRELKLETAHLIALRPDADTFLAAI
FT                   KQAGKRVILITNAHRDSLSLKLERIELAPYFERLISSHDYGFPKESPQFWDALQADIRF
FT                   DPARSLFIDDTLPILRSARDFGVAQLLAVSQPDSRRGPKDTAEFAAVGDYRALIEGL"
FT   gene            345444..346010
FT                   /gene="nudE"
FT                   /locus_tag="PFL_0297"
FT   CDS_pept        345444..346010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudE"
FT                   /locus_tag="PFL_0297"
FT                   /product="ADP compounds hydrolase NudE"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P45799; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95708"
FT                   /db_xref="GOA:Q4KJZ0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJZ0"
FT                   /protein_id="AAY95708.1"
FT                   /translation="MRQKPTVLAREIVATSRLFCVEEVQLRFSNGVERTYERLVGKGAG
FT                   YGAVMIVAMLDAEHAVLVEEYCGGTDAYELSLPKGLIEPGEDVLAAAERELKEEAGFGA
FT                   RQLEHLTELSLSPGYMSQKIQVVLATDLYEERLEGDEPEPMRVDKVNLRELASLAQNPQ
FT                   FSEGRALAALYLTRDLLSQRGVFQA"
FT   gene            346022..346849
FT                   /gene="cysQ"
FT                   /locus_tag="PFL_0298"
FT   CDS_pept        346022..346849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="PFL_0298"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by match to protein family HMM PF00459;
FT                   match to protein family HMM TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95709"
FT                   /db_xref="GOA:Q4KJY9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY9"
FT                   /protein_id="AAY95709.2"
FT                   /translation="MNFPHPLLAPVAELALRAGEAILPFWRADVAVNHKADESPVTAAD
FT                   LAAHHLIVAGLTALDPSIPVLSEEDADIPQATRASWQRWWLVDPLDGTKEFISGSEEFT
FT                   VNIALIEQGRVVFGVVSMPTSGRCYLGGAGLGAWRVDRGQAPQAIQVREQPGAGEAFTV
FT                   VASRRHSSPEQERLLSGLSAALGELQLANIGSSLKFCLLAEGAADCYPRLAPTSQWDTA
FT                   AAQGVLEGAGGEVLDLSGAPFCYPPRESLLNGFFLALPAKAPWRAKLLELARS"
FT   gene            complement(346991..347446)
FT                   /locus_tag="PFL_0299"
FT   CDS_pept        complement(346991..347446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0299"
FT                   /product="putative thioesterase domain protein"
FT                   /note="identified by match to protein family HMM PF09500;
FT                   match to protein family HMM TIGR02447"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95710"
FT                   /db_xref="GOA:Q4KJY8"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY8"
FT                   /protein_id="AAY95710.1"
FT                   /translation="MNRDSRYLESILHHDIPLTRDMGLQVLDWQGQELRLHLPLEANVN
FT                   HKSTMFGGSLYCGAVLAGWGWLHLRLKEQGIDDGHIVIQEGQISYPLPVTGDAVAICAA
FT                   PDDKVWNKFLAMYQRYGRARLTLHTRVVNAGSAEDAVRFTGQYVLHR"
FT   gene            complement(347484..348890)
FT                   /locus_tag="PFL_0300"
FT   CDS_pept        complement(347484..348890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0300"
FT                   /product="sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954; match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95711"
FT                   /db_xref="GOA:Q4KJY7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY7"
FT                   /protein_id="AAY95711.1"
FT                   /translation="MSHPESLDPQLQVVLIDDDPHLRQALSQTLDLAGLKVLSLAEAQG
FT                   LAPRLERDWPGVVVSDIRMPGMDGLELLNQLHAQDPELPVLLITGHGDVPLAVQAMRAG
FT                   AYDFLEKPFASDALLDSVRRALDWRRLVLDNRSLRLALSDRQELSARLVGQSAPMLRLR
FT                   QQIGALAATRADVLILGETGAGKEVVARALHDLSGRRNGPFVAINAGALAESVVESELF
FT                   GHEPGAFTGAQKRRIGKFEFANGGTLFLDEIESMSLDVQVKLLRLLQERVVERLGGNQL
FT                   IPLDIRIIAATKEDLRQAADQGRFRADLYYRLNVAPLRIPPLRERGEDVLMLFQHFADE
FT                   ASTRHGLPPQELQPGHRALLLRHSWPGNVRELQNAAERFALGLELALDNSEPGTLAAAA
FT                   PSLIEGGLSEQVEHFEKTLIAAEMAQPHSSMRSLAEALGIPRKTLHDKLRKHGLNFADG
FT                   GANQPGDESE"
FT   gene            complement(348965..350773)
FT                   /locus_tag="PFL_0301"
FT   CDS_pept        complement(348965..350773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0301"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95712"
FT                   /db_xref="GOA:Q4KJY6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY6"
FT                   /protein_id="AAY95712.1"
FT                   /translation="MTPPLPRRPRWRSLALLALCLAPLLWPLEHLAERYYRNELTSQNR
FT                   QTLDLYVANLLGTLHRYEVLPQILGDLPALRAVLGAPDDGVTQGNANRLLKNISAQTGA
FT                   EVMYLMDTSGKTLAASNWDKHDSFVGRNFAFRPYFSEAMAGRLGRFFGLGTTSAKRGYF
FT                   FAAAVRDGERILGVLVVKVDLDHTESLWGKTPEQLLMTDHNGVVILTSRPEWRFRATRP
FT                   LSDEERQAIVAIQPYPTRDPRPLNLNPNAWLTQTQQIDETRWAVSILAPRTLIDRPVRT
FT                   VVAVGAAALLVLMLLLGLMMQRRRHYLERIAFEAKARRELEMRVAERTSDLESLNRRLK
FT                   QEVLERETAQQELVRAQDNLVQAGKLSALGTMSASISHELNQPLAAIRSYAENAEVLLD
FT                   HQRTDDARGNLKLISELTGRMASIIAHLRAFARRDHHAPESVALQPALDDALALLAKRR
FT                   RAMEVELIRDLPAATLWVEAGETRLRQVLGNLLANALDALTEKGPPRKLWLSAESTATG
FT                   VNLYIRDNGPGFCMEALGRAGEPFYTTKTRTQGLGLGLAICDTLMRAFGGELSFANHRE
FT                   GGALITLRLRAGAPGVSLQPSEDRGV"
FT   gene            complement(350808..351689)
FT                   /gene="rfbD"
FT                   /locus_tag="PFL_0302"
FT   CDS_pept        complement(350808..351689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="PFL_0302"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM TIGR01214"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95713"
FT                   /db_xref="GOA:Q4KJY5"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY5"
FT                   /protein_id="AAY95713.1"
FT                   /translation="MNAPLKILISGQHGQVSRELQQRLGDLGELVVLGREQLDLSHPEQ
FT                   IRQQVRAIRPDLIINAAAHTAVDQAQSEPDLAFAINATAPGIFAQEAFELGVPLIHYST
FT                   DYVFDGSKETPYVEDDEPNPLSVYGESKLAGERAIRLVQGQHLILRTSWVYSSHGKNFL
FT                   LTMQRLLQEKPELRVVADQIGAPTWAGTIATSTRALIERWRAGQPGAWGIYHLTAHGET
FT                   SWFGFAQAIGEQLLAMDKPCAVLEAIPSSAYPTPAPRPLNSRLDCSRLAREWGVVQPDW
FT                   HTALRECLAEQG"
FT   gene            complement(351686..352231)
FT                   /gene="rfbC"
FT                   /locus_tag="PFL_0303"
FT   CDS_pept        complement(351686..352231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="PFL_0303"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="identified by match to protein family HMM PF00908;
FT                   match to protein family HMM TIGR01221"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95714"
FT                   /db_xref="GOA:Q4KJY4"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY4"
FT                   /protein_id="AAY95714.1"
FT                   /translation="MKVIPTDLPGVLIIEPKVFGDERGFFYESFNAKAFAEATGIDAQF
FT                   VQDNHSRSQKGVLRGLHYQLQNTQGKLVRVTQGEVLDVAVDIRRSSPHFGQWVAVRLYA
FT                   QNHRQLWVPEGFAHGFVVLSDFAEFLYKTTDYYTPSAERCIRWDDPTLAIDWELDEPPQ
FT                   LSAKDQAGALLTEADLFP"
FT   gene            complement(352228..353103)
FT                   /gene="rfbA"
FT                   /locus_tag="PFL_0304"
FT   CDS_pept        complement(352228..353103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="PFL_0304"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01207"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95715"
FT                   /db_xref="GOA:Q4KJY3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY3"
FT                   /protein_id="AAY95715.1"
FT                   /translation="MIKGIVLAGGSGTRLHPITLGVSKQLLPIYDKPMIYYPISVLMLA
FT                   GIQDILIISTPQDLPQYRNLLGDGSQFGVRFSYAEQPSPDGLAQAFLIGEEFIGNDPVC
FT                   LILGDNIFHGQYFGEQLRDAAKRTRGATVFGYWVKDPERFGVIDFDSEGRALSIEEKPK
FT                   KPKSSYAVTGLYFYDNDVVQIARDVKPSPRGELEITDVNNAYLQRGDLHVERFGRGFAW
FT                   LDTGTHDSLLEASQYVQTIEHRQGLKVACLEEIAYENRWISREHLLERAAYFGKTGYGQ
FT                   YLFTLAGEAQ"
FT   gene            complement(353100..354182)
FT                   /gene="rfbB"
FT                   /locus_tag="PFL_0305"
FT   CDS_pept        complement(353100..354182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="PFL_0305"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993; match to protein family HMM TIGR01181"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95716"
FT                   /db_xref="GOA:Q4KJY2"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY2"
FT                   /protein_id="AAY95716.1"
FT                   /translation="MRILVTGGAGFIGSALVRHLLQHTEHEVLNLDKLTYAGNLESLHS
FT                   IASNSRYEFVKADIVDQATVSAVLARFQPHAIMHLAAESHVDRSIDGPSDFIQTNIVGT
FT                   YSLLEATRAYWHALPEAEKAAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASK
FT                   AASDHLVRAWQRTYGLPVLITNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQV
FT                   RDWLYVEDHARALFKVMTEGAVGETYNIGGHNEQKNIDVVRGICSLLEELAPQKPQGVA
FT                   HYADLITFVQDRPGHDLRYAIDAGKIERELGWVPEETFTSGLRKTVQWYLENLEWCRRV
FT                   QDGSYQGQRLGSTDIKDLIA"
FT   gene            354422..357340
FT                   /locus_tag="PFL_0306"
FT   CDS_pept        354422..357340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0306"
FT                   /product="phosphotransferase family/aminotransferase, class
FT                   III"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95717"
FT                   /db_xref="GOA:Q4KJY1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY1"
FT                   /protein_id="AAY95717.1"
FT                   /translation="MLLATLIHRASLPSPQVLAQQALELLESHYGLHGTLHSLGSQQDL
FT                   NYRVDSPQGRFVLKICRGDYSVLELQAQHAGLKHLQQHPELRVPRVIPATNGADLLSLE
FT                   IAGQALHVRLLDYIEGRSLTQLPHLGGELVAGLGRLCGQMDLALADFEHPGLERTLQWD
FT                   ARHAQALIGHLLPVIADPQQRAVIASAAQRAERRLHPLLEQLPVQAIHMDITDDNVVWQ
FT                   RDEARHWQVQGVIDFGDLIRTWRITDLSVTCAALLHHAEGDPLRILPAIQAYHQVNPLQ
FT                   RAELLALWPLIVARAAVLVLSGEQQVSIDPGNAYSRANLSHEWEIFQVANSVSFEFMEA
FT                   AILTAVGHALPAIGAEGFAPLLPSLVGREFALIDLGVLSPHFEAGNWEQPGIDDRLLAE
FT                   ACAAHGLAASRYGQYRLSQTRPDSAEEPSTCPLHVQLQVPPGTAVEAPFAGVLHRAEQG
FT                   LLRLDGPTLSMHLWGVEPSLQPGAALVKGQVLGAVAADGRLKVQLCRAAELDPPLFCTP
FT                   SRAPAWQALCPSPAALLGLACDAEPELDPQTLLERRDASFARSQKHYYVDPPRIERGWR
FT                   NHLIDMQGRSYLDMLNNVAVLGHGHPRMAAEAARQWSLLNTNSRFHYAAIAEFSERLLA
FT                   LAPDSMDRVFLVNSGTEANDLAIRLAWAYSGGRDMLSVLEAYHGWSVAADAVSTSIADN
FT                   PQALTSRPEWVHPVTAPNTYRGEFRGQDSTPHYLRSVDQQLHKLDEQQRQLAGFICEPV
FT                   YGNAGGISLPPGYLQQVYERVRARGGVCIADEIQVGYGRMGQFFWGFEEQGVTPDIITM
FT                   AKGMGNGQPLGAVITRREIAEALEAEGYFFSSSGGSPVSCRIGIAVLDVMQEEKLWENA
FT                   QVVGEHFRQRLEALKENHPLVGAVHGSGFYLGLELIRDHATLEPATEETTLLCERLREL
FT                   GIFMQPTGDHLNILKIKPPMVTTRQSVDFFVDMLAKVLSEEL"
FT   gene            357610..358488
FT                   /gene="aguB"
FT                   /locus_tag="PFL_0307"
FT   CDS_pept        357610..358488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguB"
FT                   /locus_tag="PFL_0307"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /EC_number="3.5.1.53"
FT                   /note="identified by similarity to GB:AAG03682.1; match to
FT                   protein family HMM PF00795; match to protein family HMM
FT                   TIGR03381"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95718"
FT                   /db_xref="GOA:Q4KJY0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJY0"
FT                   /protein_id="AAY95718.1"
FT                   /translation="MSRTVTVAATQMACSWDLEANLETAEKLVREAAAKGAQIILIQEL
FT                   FEAPYFCQKPNPDYLQLATTVDSNAAIAHFQKVARELQVVLPISFYELAGRARFNSIAI
FT                   IDADGSNLGIYRKSHIPDGPGYHEKYYFNPGDTGFKVWNTRYAKIGVGICWDQWFPECA
FT                   RSMALQGAEILFYPTAIGSEPHDQTISSRDHWQRVQQGHAGANLMPLIASNRIGNEEQD
FT                   GYDITFYGSSFIANQFGEKVQELNQTEEGILVHSFDLDELEHIRSAWGSFRDRRPNLYG
FT                   ALKTLDGSLES"
FT   gene            358494..359600
FT                   /gene="aguA"
FT                   /locus_tag="PFL_0308"
FT   CDS_pept        358494..359600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguA"
FT                   /locus_tag="PFL_0308"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="identified by match to protein family HMM PF04371;
FT                   match to protein family HMM TIGR03380"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95719"
FT                   /db_xref="GOA:Q4KJX9"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJX9"
FT                   /protein_id="AAY95719.1"
FT                   /translation="MSTLHSTPRADGFYMPAEWATQTQAWMIWPERPDNWRLGGKPAQA
FT                   AHAAVAKAIARFEPVTVAVSAAQYENARARLDVPNIRVVEMSSDDAWVRDTGPTFVINA
FT                   SGEVRGVHWGFNAWGGFEGGLYSPWNRDEQVASKVLEIERCQEYRTEGFVLEGGSIHVD
FT                   GEGTLITTEECLLNHNRNPHLSREEIEAVLREHLAVEQIVWLPDGLYNDETDGHVDNFC
FT                   CYVRPGEVLLAWTDDPQDPNYPRCQAALQVLENTRDAKGRTFKVHKMPIPGPLYATEEE
FT                   CAGVDAVEGSQERNPSVRLAGSYVNFLIVNGGIIAPSFDDPMDAQAKAILQQLFPEHEV
FT                   VMVPGRELLLGGGNIHCLTQQQPAPQRI"
FT   gene            359845..360045
FT                   /locus_tag="PFL_0309"
FT   CDS_pept        359845..360045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95720"
FT                   /db_xref="GOA:Q4KJX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJX8"
FT                   /protein_id="AAY95720.1"
FT                   /translation="MNMVSERASHPLAMNNESLQVLAQWLKSNGTRQIREPDPRRIIIE
FT                   RYPAGLLSEAELQALWDVVKG"
FT   gene            complement(360127..362226)
FT                   /locus_tag="PFL_0310"
FT   CDS_pept        complement(360127..362226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0310"
FT                   /product="TonB-dependent outermembrane receptor"
FT                   /note="Receptor; identified by match to protein family HMM
FT                   PF00593; match to protein family HMM PF07715; match to
FT                   protein family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95721"
FT                   /db_xref="GOA:Q4KJX7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJX7"
FT                   /protein_id="AAY95721.1"
FT                   /translation="MPAHFRLMPLSLGLCTLLASGFACAASTTLPMTSISAEAEADPDD
FT                   PRVKEVSTATRTSTPARYVPQAIDTIKTANVLDYGVNDLGSALSGIPNVSSGSDTRFDS
FT                   LRIRGFDASNDFYLDGIRDDSQYVRDLHNIERIEVLKGPAAVLYGRGSQGGIINRVSKL
FT                   PEFGRRSSVEVQGGSQDLRSLYADLSADPTENISLRLNLGNEDRNSFRKGVSGNRQLFA
FT                   PSMSWQLTPDLNWLVQYEYSRYNRTPDRGIPGVNGRPADVSRDTTYGDHRDYIDDKSQS
FT                   LRSKLSYELSENWQLRHTLGVFKLDSDFDNTYQTGYNATTGKVQRQRWQQDLKTRNVYN
FT                   NTELEGRFDTFGLEHRLLTGLELGSQRRDPILYNAATSGPGSQAVPAVDLYNPNPYQSH
FT                   TGRMQVSSNNHTEVESRALYVQDQLRLNDQWQLLAGLRYDNFDVQTSNRKNGLSESRES
FT                   HSVSPRLGVVWTPLEHHSFYASWSKSFSPVGGGLIGITPNAAGNGNDLSPELTRQKEVG
FT                   VKSDWLGERLSTTLAVYELELYNRRTSDPQDRSITLLTGLQRSRGIELTGTGKIVGNWY
FT                   LRGGIGLQDAVVVKDNNGFEDKRVNNVAKRNGSLFITWKPELGWYAETGLTLVGDRFAD
FT                   SSNTVALPGYGRWDALAGYRHKDWDVRAALNNIADREYYSSATSAFQIQPGDPRSLVVT
FT                   GNYRF"
FT   gene            362489..363184
FT                   /locus_tag="PFL_0311"
FT   CDS_pept        362489..363184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95722"
FT                   /db_xref="GOA:Q4KJX6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJX6"
FT                   /protein_id="AAY95722.1"
FT                   /translation="MSLATLHYIYDPLCGWCYGAKPLVQAAQAVVPVVAHAGGMMTGRN
FT                   RQPVSPQLRDYVMPHDRRIAEYTGQPFGQAYFEGLLRDETATFDSAPPIAAVLAAQAME
FT                   GRGLEFLGRLQTAHYLEGRRIADRQVLLELAQAQGFAPAAFEAAFDQAVAHELDNHIKA
FT                   SRALLAKVGGQGFPTLVLERDGRYQLLDISPWLGKPEAFADWLKTSLGADSGPHDGVVQ
FT                   ACGLDGCTP"
FT   gene            363212..363601
FT                   /locus_tag="PFL_0312"
FT   CDS_pept        363212..363601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95723"
FT                   /db_xref="GOA:Q4KJX5"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJX5"
FT                   /protein_id="AAY95723.1"
FT                   /translation="MDNLALIKSTYEGANSQENARNTAAALAPDARWTEAAGFPYAGTY
FT                   IGFEAVLEHVFKRLGSEWQDFTFKVENYVAQGDKVFAYGNYQGVYKASGKPIDVRVAHL
FT                   WTLKDGKVTHFEQFVDSHTVQLAML"
FT   gene            363840..365123
FT                   /gene="oprQ"
FT                   /locus_tag="PFL_0313"
FT   CDS_pept        363840..365123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprQ"
FT                   /locus_tag="PFL_0313"
FT                   /product="outer membrane porin OprE3"
FT                   /note="identified by similarity to GB:BAA22267.1; match to
FT                   protein family HMM PF03573"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95724"
FT                   /db_xref="GOA:Q4KJX4"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJX4"
FT                   /protein_id="AAY95724.1"
FT                   /translation="MFKQRICLVALGILSATQAMADGQADAKGFVEDSSLKVLLRNAYI
FT                   NRDYKDGNPDKAEWGQGFIGTFSSGFTQGTVGVGVDAFGLYALRLDGGKGRSGAGGIDF
FT                   FKQGDSGSAADDLAKAGAAVKFRFSNTVLTYGDQMPALPVLNYDNSRLLPESYTGTLIT
FT                   SKEIKGLELNAGHFTAESRKSAEGRDSGGLKSINVLGGSYQFTEQFKGALYASDVEDVL
FT                   KKQYVNLNYVFPLATDQSLTLDFNGYRTKLDKSFAKDLNAGGQDNKIWSLAATFATGPH
FT                   SFTVAHQRSTGDSHLGYAYGGYQKSGYVGDGGNTIYLANSYWSDFNAEDERSWQLGYGL
FT                   DFGAFGVPGLTYNVAYVRGDNITTVNSTGGSEREIFNQLKYVVQSGPAKDLSVKVRSSV
FT                   LRVSQKSYEYNKGGNELRVFVDYPINVF"
FT   gene            complement(365204..366145)
FT                   /locus_tag="PFL_0314"
FT   CDS_pept        complement(365204..366145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95725"
FT                   /db_xref="GOA:Q4KJX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJX3"
FT                   /protein_id="AAY95725.1"
FT                   /translation="MICANHWLKIPAPRDLAIHALAFPAPRTPYQMELSERLLNILKNN
FT                   PSWIGRVYESFIISAIKEFERNNPPAHSPDFDPKTNQRPYGYRHNKLFDPASEDNGETD
FT                   VADIYFGYPQPLLDACKITTDPLVEDQSWFCRTTWNGWAVEVKTKRVDKTDRPLHHLAF
FT                   AGELNTALPVARKTAWMQTRNGEELISNQLKRRWADLYVYILYQLDDGLPDFTGATGTY
FT                   ILVIPTLLLNEALRDTSEDAETIQLNKLMKILDLHHLRYFTHLTQNIPGKMLQLASEQW
FT                   QAMFAYKREGDALKRQWYENTYLPSQAKPQKQ"
FT   gene            366181..366855
FT                   /locus_tag="PFL_6267"
FT   CDS_pept        366181..366855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_6267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_6267"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95726"
FT                   /db_xref="GOA:Q4KJX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJX2"
FT                   /protein_id="AAY95726.2"
FT                   /translation="MISMFRTLLSGLCLLSVASIAHGQQATAPEQLLSDFSRCDAQFFQ
FT                   NLNTARLPTGTLSLARYGAVSAPKVMNPLQEGGRYQAFEQPLLVNGVRLVGYYNEAQSL
FT                   KSVGNLLFWGFVAEGQPKDVAAALKPLLVDNSRLKQDRSAMSRVEIRRVGDPIDQWRTE
FT                   GLAGGGVATPFGYVERILSIDIGTTSAPIAGRTTIFCSLQGTVTAPLLQVYRPDLNAHL
FT                   LD"
FT   gene            366861..367556
FT                   /locus_tag="PFL_0316"
FT   CDS_pept        366861..367556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0316"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95727"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJX1"
FT                   /protein_id="AAY95727.1"
FT                   /translation="MPSLSVRGSLLLVCALAVTGCASLQSQDQINYAHCRMVGQASKAE
FT                   KFDVVLQEADLCLEKNQLSQPMQSLVYWLKSDAYASFKRYPEAIAAKEKSIELGPKPDA
FT                   RAVLDLSRLYREAGNPQKALELVQSNLDNNLGEAGKGSGFNMPTYYHLGQTLYDLGRYR
FT                   EAAEAYSTGLLKQPDYAWAFYHRGLAYDKLGQTDDARADFAQFAKLVNQKYVEPQHQAK
FT                   LAEYKIKLP"
FT   gene            complement(367629..368603)
FT                   /locus_tag="PFL_0317"
FT   CDS_pept        complement(367629..368603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95728"
FT                   /db_xref="GOA:Q4KJX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJX0"
FT                   /protein_id="AAY95728.1"
FT                   /translation="MTRRYQALKHLQVFRLLQGHWLKNTRNTCPDTDCLESVYRAQVKM
FT                   LTSLPIPPEPAPDALRPLAPGEAYLVYDPDDWQNFTLATFNSTLPQGDQQIVDAQVIAG
FT                   VLRVVLFVGRYQQGKPVYVGTLYEYADDQPGLHPIAQDIAFAGWANPGANDQGPRYAGI
FT                   VDGQFYYREQLAGQLQQSMVYRLGSRSAPSSTQQVFQVGSNTFMHARARVEQDLNRDSS
FT                   QLSLNYDRANAGSHSENITEQKQPDAGWAIVNPTWSTTRPVLYFDNQGPRACIWRVDMR
FT                   GKELSKIVTDHDAMSARPVDIHGREAVVYLQGNQLKFAINPDD"
FT   gene            complement(368775..369161)
FT                   /locus_tag="PFL_0318"
FT   CDS_pept        complement(368775..369161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0318"
FT                   /product="cytochrome c2"
FT                   /note="identified by similarity to SP:P00083; match to
FT                   protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95729"
FT                   /db_xref="GOA:Q4KJW9"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW9"
FT                   /protein_id="AAY95729.1"
FT                   /translation="MKPIAVSILTLLLHSLLFSAPALAGDAEAGAKLFKRLCSGCHNIG
FT                   PSVRSSFGPQLNGIIDRPAGSAADYQYSTAMKSSGIVWSRDKLIQYLEDPKAVVPGTRM
FT                   IFWGLSDEEKIDNLLAYLQTFQTP"
FT   gene            complement(369241..370035)
FT                   /locus_tag="PFL_0319"
FT   CDS_pept        complement(369241..370035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95730"
FT                   /db_xref="GOA:Q4KJW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW8"
FT                   /protein_id="AAY95730.1"
FT                   /translation="MIHRDHPHSPLLHRRTRLALLLGALTTAGTSLPPVAMAADDDGWR
FT                   FNGGPYVWGAGIRGHVGHRSTGTQFIKSDFSDIARSVDMSVMLMGEARRGPYSVLADLM
FT                   YIDTDTRNRLPAGALASKLEVQSKTASGFLGGGYQVLGDDDHRLDIAGGVRVWYSSTSI
FT                   TLHGGPAGGLSGSDKATWADAMAGLRGHYAVNERFWLSAWGMAGAGQSREDWDLAALAG
FT                   WEFLPGFSAVAGYRAMGVDYRHDGFVYDIVQKGPLLGISGRF"
FT   gene            complement(370049..370876)
FT                   /locus_tag="PFL_0320"
FT   CDS_pept        complement(370049..370876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0320"
FT                   /product="putative acid phosphatase"
FT                   /note="identified by similarity to GB:BAA84942.1; match to
FT                   protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95731"
FT                   /db_xref="GOA:Q4KJW7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW7"
FT                   /protein_id="AAY95731.1"
FT                   /translation="MKKIPEPFAVTLSLAGLLWSAWALAEDAATKVTDPHFKLAPGYLE
FT                   PADLPVRLALLGAPPKPGSAALARDEEARRAALALRGSSREKLAATDAELSFPGPAKTF
FT                   SCALGTQISEKSTPHLYTLMQRTLTDAGGSTYAGKNAYNRTRPFVVHDEGTCRKDMEPL
FT                   LRTDGSWPSGHSAAGWAWGLVLAEISPARATELMTRGLAYGQSRVICDAHWQSDVDAGR
FT                   IMGAATVASLHGNPAFLADLAAAKEEVKAAQQAGLKPAEDCAAEGVALGLTQH"
FT   gene            complement(370912..371763)
FT                   /locus_tag="PFL_0321"
FT   CDS_pept        complement(370912..371763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0321"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="identified by match to protein family HMM PF06629"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95732"
FT                   /db_xref="GOA:Q4KJW6"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW6"
FT                   /protein_id="AAY95732.1"
FT                   /translation="MTLKDHSHSFRSPVVFSLGAALALMLVPPAQAAPADSGGTPSVTV
FT                   GGGLAVGPLYQGSSHYAAFPSLKLKAVMPTQDWGTFTAAFPEGLRWDLPGLAPFGVALL
FT                   VGYDPGRKERIHTLDGRDDYLRGMGNLDSTALVGAEAYWILPAGRLFVRGLQSSQRRNY
FT                   GGESLGRTAYLEAGVATTYPLSSTLTLDSTLYGTWSNENDMMARFGVTAQQAARTRFDE
FT                   YHPGGGMRDVTLKLGLTWQWQPQLALEGGIKTYALVSDARDSPLTGEKVGAGAYLDALY
FT                   RF"
FT   gene            complement(371977..373011)
FT                   /locus_tag="PFL_0322"
FT   CDS_pept        complement(371977..373011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06742;
FT                   match to protein family HMM PF06863"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95733"
FT                   /db_xref="GOA:Q4KJW5"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW5"
FT                   /protein_id="AAY95733.1"
FT                   /translation="MPDSSTACIVALTLATFASAHAQSSADATVRVNVDNFARAESDLY
FT                   MGKSVKSGGLGRFVHSREAVAIDAQDVIRMNRDTLYSSAVFDLDAGPVTVTLPEAGERF
FT                   MSMQVVNEDHYVPAVIYGPGPHTLAKEDIGTRYVFVAIRLFFDPTDRKDLEQVHALQDA
FT                   IQVSQARHGEFVVPKWDQASQKKVRDALAVLGSTLPDYNQSFGPKGRVDPVRHLIGTAT
FT                   GWGGNPSRDAIYLGAVLPHNDGKTVYRLKVEQVPVKSFWSVSVYNADGYFQKNPYDAYS
FT                   LNNLTAKKSADGSIVIQFGGCEAKVVNCLVTTPGWNYTVRLYRPSNEILSGQWRFPTPE
FT                   PVDL"
FT   gene            complement(373173..374156)
FT                   /locus_tag="PFL_0323"
FT   CDS_pept        complement(373173..374156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0323"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95734"
FT                   /db_xref="GOA:Q4KJW4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW4"
FT                   /protein_id="AAY95734.1"
FT                   /translation="MTHATPSIKLSTLQQIAPYLSMRGVSPLEFFRRYGISPQVFQYPD
FT                   AWVPRATCFHIANEMAAVAQDPFAGATVGHLIEVRSLGAWGGLILGSTNLAQACAVAAI
FT                   HTDLLHQGSDVRIVTEGRTTKLIQQFTGQHGADPKQVILGTLALLRKVPLMSGEPCAIR
FT                   VHLQNPRERGDEALEEYLGPNLHMNAKHNMIEFDRELLDTPLQPARDDAWKVTEALKST
FT                   AQAAGVLIERIADQDRSKLTAISRNIGLSSRTLQRRLKYCGIDFEDLRDETRRSEALQL
FT                   IASGKYTATEIAYMVGYSDQAHFTRAFKRWTGSSPSRYRSLLKDDR"
FT   gene            complement(374422..374497)
FT                   /locus_tag="PFL_0324"
FT   tRNA            complement(374422..374497)
FT                   /locus_tag="PFL_0324"
FT                   /product="tRNA-Thr"
FT   gene            complement(374611..375567)
FT                   /gene="gpuA"
FT                   /locus_tag="PFL_0325"
FT   CDS_pept        complement(374611..375567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpuA"
FT                   /locus_tag="PFL_0325"
FT                   /product="3-guanidinopropionase GpuA"
FT                   /EC_number="3.5.3.17"
FT                   /note="identified by similarity to GB:AAG03677.1; match to
FT                   protein family HMM PF00491; match to protein family HMM
FT                   TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95735"
FT                   /db_xref="GOA:Q4KJW3"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW3"
FT                   /protein_id="AAY95735.1"
FT                   /translation="MSKPFPQPVDAALVPRFAGIPSFMRLPLFNDPAQVQIALVGVPWD
FT                   GGTTNRAGARHGPREVRNQSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLKQ
FT                   IEGFFSQLHQAGAVPLAVGGDHLVTLPIFRALARHRPIGMVHFDAHSDTNDRYFGDNLY
FT                   THGTPFRRAIEEGLLDPKRTVQIGIRGSIYSADDEAFARDCGIRVIHMEEFADIGVEAT
FT                   LAEARRVVGDGPTYISFDVDVLDPAFAPGTGTPEIGGMTTLQAQQMIRGLRGLNLVGAD
FT                   VVEVSPPFDVGGATALVGATLMFELLCILAESIAQGS"
FT   gene            complement(375597..376982)
FT                   /gene="gpuP"
FT                   /locus_tag="PFL_0326"
FT   CDS_pept        complement(375597..376982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpuP"
FT                   /locus_tag="PFL_0326"
FT                   /product="3-guanidinopropionate transport protein GpuP"
FT                   /note="identified by similarity to GB:AAG03676.1; match to
FT                   protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95736"
FT                   /db_xref="GOA:Q4KJW2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW2"
FT                   /protein_id="AAY95736.2"
FT                   /translation="MALDYLVMAIYVLLMASLGWWGMRKVKNQDDFLVAGRRLGPALYL
FT                   GTLSAVMLGGASTIGSVRLGYSYGISGLWLVFMLGLGIIVLSLVFSRQIAQLRVFTVTQ
FT                   ILEQRYQASSRLIGGCVMVAYDLMVAVTATIAIGSITEVVFEIPRITAILCGGGLVIFY
FT                   SVIGGMWSLTLTDIIQFVIMTLGIFGVLLPMSLGQAGGLEALQANLPAGFFELGNIGLD
FT                   TILTYFLLYFFGALIGQDIWQRLFTARSESVVRYAGLGAGIYCMFYGAACALVGAAAKL
FT                   LLPDLAVAENAFAEVTRSVLPAGLRGLVVAAALAAIMSTASACLLASATVLKEDIYSRF
FT                   LTRGGENHLASSRWITLGLGAAMLLMACLVNDVIAGLSIAYNLLVGGLLVPIMGALLWR
FT                   RASARGAIACMLTGSLTVIAFMVRDGILANTPIYYGLGVSLLTFVGVSLTSRAAPALRS
FT                   AAE"
FT   gene            377181..377825
FT                   /locus_tag="PFL_0327"
FT   CDS_pept        377181..377825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95737"
FT                   /db_xref="GOA:Q4KJW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW1"
FT                   /protein_id="AAY95737.1"
FT                   /translation="MNLATPTLLAALALLGACSVKPVQPYSEPPLSVPTAQLRVITNGE
FT                   VRGDAYAGCLGDSKRLAKAGRFGSDQQANINYPQFPVQPRQIDMLPRFAPKLPAYAGAI
FT                   RRGEGAYNEIATEYRVPAGRPFLLEGGGVAAGGYGSTYSTCPEVRKVVLFEPGKSYEAY
FT                   VGLNYIPQANGETAAMCAFAVYQLLPLGKPGAVMPMAVQAKPPVDSKCPGS"
FT   gene            complement(377879..378100)
FT                   /locus_tag="PFL_0328"
FT   CDS_pept        complement(377879..378100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0328"
FT                   /product="putative formate dehydrogenase, delta subunit"
FT                   /note="identified by similarity to GB:CAA11237.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95738"
FT                   /db_xref="InterPro:IPR021074"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJW0"
FT                   /protein_id="AAY95738.1"
FT                   /translation="MSTANLIKMANQIASYFANEPDQVQAVLSVRNHMQMFWTPGMRKE
FT                   LLAWQTEQQGAELHPLVQQAVRDAGWEA"
FT   gene            complement(378097..380994)
FT                   /gene="fdsA"
FT                   /locus_tag="PFL_0329"
FT   CDS_pept        complement(378097..380994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdsA"
FT                   /locus_tag="PFL_0329"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF00384; match to protein family HMM PF01568;
FT                   match to protein family HMM PF04879; match to protein
FT                   family HMM TIGR01591"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95739"
FT                   /db_xref="GOA:Q4KJV9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJV9"
FT                   /protein_id="AAY95739.1"
FT                   /translation="MITLFDPATDIDLNAVDFGTPARDSQVQVSLNIDGRSISVPQGTS
FT                   VMRAAALMGTTIPKLCATDSLEAFGSCRMCLVEIDGMRGYPASCTTPVSEGMVVHTQTP
FT                   KLATLRRNVMELYISDHPLDCLTCSANGNCELQTVAGQVGLREVRYGYDGANHLDDQKD
FT                   TSNPYFDYDPSKCIVCNRCVRACEETQGTFALTISGRGFESRVAAAGGDNFLDSECVSC
FT                   GACVQACPTATLMEKSVVQMGQPERAVITTCAYCGVGCSFRAEMKGDQLVRMVPDKNGQ
FT                   ANHGHSCVKGRFAWGYATHPDRITKPMIRKHISDPWQEVSWDEAVSYAASELRRIQFKY
FT                   GRDSIGGITSSRCTNEETYLVQKLVRAAFGNNNVDTCARVCHSPTGYGLKQTLGESAGT
FT                   QSFDSVMQADVILVMGANPSDAHPVFGSQLKRRLREGAKLIVIDPRRIDLVDSVHARAE
FT                   LHLALRPGTNVAMLNALAHVIVTEGLVDQEFVSARCEPEAFALWSAFVSRADNSPEVLG
FT                   AICGVPAADIRAAARLYATGGNAAIYYGLGVTEHSQGSTSVMGIANLAMATGNIGREGV
FT                   GVNPLRGQNNVQGSCDMGSFPHELPGYRHISNQAVRQQFEQAWNVTLQADPGLRIPNMF
FT                   EAALGGSFKGLYCQGEDIAQSDPNTQHVTAALSAMECVVVQDIFLNETAKFAHVFLPGS
FT                   SFLEKDGTFTNAERRISRVRKVMEPLGGKADWEGTLALAAALGYPMHYSHPSEIMDEIA
FT                   RLTPTFTGVSYASLDRHGSLQWPCNDAAPDGTPTMHIDEFVRGKGRFMLTGYVPTDEKV
FT                   NGRYPLLLTTGRILSQYNVGAQTRRTDNVAWHAEDRLEIHPTDAESRGINEGDWVGIGS
FT                   RAGQTVLRARVTERVAPGVVYTTFHFPESGANVITTDNSDWATNCPEYKVTAVEVSRVY
FT                   HPSEWQKRYQAFSEEQHRLLDKRGRSRGGKAEVRR"
FT   gene            complement(380991..382550)
FT                   /gene="fdsB"
FT                   /locus_tag="PFL_0330"
FT   CDS_pept        complement(380991..382550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdsB"
FT                   /locus_tag="PFL_0330"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by similarity to GB:CAA11234.1; match to
FT                   protein family HMM PF01512"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95740"
FT                   /db_xref="GOA:Q4KJV8"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJV8"
FT                   /protein_id="AAY95740.1"
FT                   /translation="MPSLYLPCDSLARAVGADEVAKAIATQAEQRQLPLQLQRTSSRGL
FT                   YWLEPLLEVDTPDGRLGFGPVGAADVPALLDALQGDAASHPLALGRVEDLPYLKNQQRL
FT                   LFARAGITRPLSLADYRAHGGFEGLTRSIALGGEQTVAAVLDSGLRGRGGAAFPAGIKW
FT                   RTVRDTPPQQKYVVCNADEGDSGTFADRMLMEGDPFLLIEGMAIAGLAVGASYGYIYVR
FT                   SEYPQAVATLREALDIARDAGYLGANAGGSGQAFDMEVRVGAGAYICGEETALLDSLEG
FT                   KRGIVRAKPPIPALQGLFGQPTLVHNVLTLASVPLILAKGAPFYRDYGMGRSLGTMPFQ
FT                   LAGNVRHGGLVERAFGLTLRELVEGYGGGTASGRPLKAAQVGGPLGAWVPPSQFDTPLD
FT                   YEAFAAMGAMLGHGGVVVADDSLDLARMARFALQFCAEESCGKCTPCRIGSTRGVEVID
FT                   RLLAAPDQGRRDEQALILKDLCDTLQYGSLCALGGMTSYPVASALKHFPADFGLAPSEA
FT                   EQ"
FT   gene            complement(382550..383026)
FT                   /gene="fdsG"
FT                   /locus_tag="PFL_0331"
FT   CDS_pept        complement(382550..383026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdsG"
FT                   /locus_tag="PFL_0331"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by similarity to GB:CAA11233.1; match to
FT                   protein family HMM PF01257"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95741"
FT                   /db_xref="GOA:Q4KJV7"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJV7"
FT                   /protein_id="AAY95741.1"
FT                   /translation="MPDETLHLPLIHRLLERHKDSPGALLPILHQIQEELGYIPDPAIP
FT                   EIAHSLNLSQAEVRGVISFYHDFRSAPPARHILRLCRAESCQSRGAEQLAAQLRERLQL
FT                   DDHGSSADGNISLRPVYCLGACACSPALELDGQLHARLSAERLDALLDSCREDA"
FT   gene            complement(383432..384247)
FT                   /locus_tag="PFL_0332"
FT   CDS_pept        complement(383432..384247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0332"
FT                   /product="polyamine/opine/phosphonate ABC transporter, POPT
FT                   family, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95742"
FT                   /db_xref="GOA:Q4KJV6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJV6"
FT                   /protein_id="AAY95742.2"
FT                   /translation="MNTHRTALSTRLIAVVAMAFMLFPLLTVIPVSFTAKRYLSMPDGH
FT                   WSLRHYEALLSNPDWLSSIGQSLAIASATSLIATLLAVSFSLGIWYLRSRLATLLIGLV
FT                   LLPMAIPPVISALVLYFMETNLGRIAPGWGYDTLPGVVIAHVVMVVPYGVVTMLVALSQ
FT                   VDRRIELASRNLGASLMQTTFLVMLPNLKLGIFSTVLLSFALSWEEVAVTLFITSVDVN
FT                   TLPRRIWSGLRDNVDPSVAAISVLLICLTLLVLMGRLALQYAAQRRARS"
FT   gene            complement(384255..385091)
FT                   /locus_tag="PFL_0333"
FT   CDS_pept        complement(384255..385091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0333"
FT                   /product="polyamine/opine/phosphonate ABC transporter, POPT
FT                   family, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95743"
FT                   /db_xref="GOA:Q4KJV5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJV5"
FT                   /protein_id="AAY95743.1"
FT                   /translation="MSATRTARLERSLLLFPLPLLLVVFYLLPFFGVVSWSFTLPETGF
FT                   GQYQRIATDPAIHDMLLRTLRLCLTVSLLALVIGYLLAYCWVFSPPFWQRMVEICVFIP
FT                   FWISVLVRAFGWLIALRSNGVVNDSLLSLGWIDHPLQLTRNELGVVIGMLHFMIPYALF
FT                   PLLSSMRQLDQRVLLASRGLGAGALRTFWQVLLPQTLPGLLGAFIMVFVFCLGFFITPV
FT                   LLGGGQTVMIAEYVFLQMFQTSNWGLGAALSLVLLTLVSALIWLLMRITRVNRLVG"
FT   gene            complement(385102..386214)
FT                   /locus_tag="PFL_0334"
FT   CDS_pept        complement(385102..386214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0334"
FT                   /product="polyamine/opine/phosphonate ABC transporter, POPT
FT                   family, periplasmic substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95744"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJV4"
FT                   /protein_id="AAY95744.1"
FT                   /translation="MSQHHQRDCIEILIEKARGGQVSRRTFLQAMGLLAAVPLALRSGI
FT                   SWAADKPLVVVNWGGDALNAFRSAWTDSFTKSTGIPVRIDGAGPTEGAIRSQLASGRPS
FT                   WDVVDVDSYSAMTLGRDKVLQPLAYSVVQRDLVAPSLSHEHGIAGYLFSYVIAWDSQKF
FT                   GDNGPKDWTDFWNVEKFPGKRTLYKWMNGMLEAALLADGVAAEQLYPLDVPRALRKIDE
FT                   LKPHVLSFWGSGAESQQLMIEGEASMGAIWHTRATLLHEDSGGRIKWGFDHAFLNASSW
FT                   GVLKDNPAGTAPAMQFIQHALQPAGQLKLFEALGNGPSNAATQQLMSAEQREINCASEA
FT                   NMKKQIFLDTQWYADHYSSTLEQYLTHLSK"
FT   gene            complement(386300..387391)
FT                   /pseudo
FT                   /locus_tag="PFL_0335"
FT                   /note="polyamine/opine/phosphonate ABC transporter, POPT
FT                   family, ATP-binding protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00005; match to
FT                   protein family HMM PF08402; match to protein family HMM
FT                   TIGR01187"
FT   gene            complement(387541..388458)
FT                   /locus_tag="PFL_0336"
FT   CDS_pept        complement(387541..388458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0336"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by similarity to SP:P32064; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95746"
FT                   /db_xref="GOA:Q4KJV2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJV2"
FT                   /protein_id="AAY95746.1"
FT                   /translation="MRYPSITALRALDAVARLGSVTAAAQQLSLTRSAISHQIISLEQS
FT                   LGFALTERVGRGIGLTYQGQCYAREVRRILADIQDAGRRFDGLSVSGKLRISCNPGFAS
FT                   FWLCNHINGFLRQYPQVQLQVVSPRSQDDTSDAEADLFIAYGIGDWPGLLVEQIVTLRF
FT                   SPVCSPRLINAIGGLKTPLDLKDFPLIHMSDTSDWRVWLAAAGASQVNADSGITFSDAH
FT                   CAQSACIAAQGVAIGDNLLSGDALARGLLVRPFDISISALRGYFLVIDPAKAERSVVQA
FT                   FSAWLKNQLQTSAQHISDAPSGEP"
FT   gene            388742..390325
FT                   /locus_tag="PFL_0337"
FT   CDS_pept        388742..390325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95747"
FT                   /db_xref="GOA:Q4KJV1"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJV1"
FT                   /protein_id="AAY95747.1"
FT                   /translation="MSRYKEFAMDWVERHRQQLSDWHQIIWHYAEPAFREYKSSAWYVQ
FT                   LLEAEGFTVERASGGMPTAFCATFTQGQGPLLATYGEYDAVPGNCQAATTRKQPRDGLS
FT                   RFAPGHTDPHSALGISALGGALAAKATMVEFGLQGSIRFFGEPAEKLRASKPVHAAKGY
FT                   YDDLDAAISFHPTYMLPLNNTTTWDTHCGIAYAYIYSFTCEDPQNWIAADRYSPIPQNH
FT                   LAARAPGANDALVHFYTLNESLRRSTLPFTGLWSYNEAILTAGQATADNLPPHLSQIQY
FT                   LLRCDSIEQAETISQVMDNNAAAAAMATGCRWKKTWVCKSRGGLPNHIMAQATYDNLAA
FT                   VGAPQWDEEAREIAREIQRNLGLEAMERPFLPATEALIEPQECERQMRLQMPAWQNYLT
FT                   SDDYPEYTWHCPTVRLLVARPMLSAPAGTVYPDWVSNALGGIRQTIDPMIEVAAKTIAA
FT                   TLVDLLTDEALLSAAKAEFVERTGGGIGGSRWQAPLLPKDFQVPHDFRWPEYISTARGE
FT                   EWWIPARADE"
FT   gene            complement(390709..392340)
FT                   /locus_tag="PFL_0338"
FT   CDS_pept        complement(390709..392340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0338"
FT                   /product="FAD-binding domain protein"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF08031"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95748"
FT                   /db_xref="GOA:Q4KJV0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJV0"
FT                   /protein_id="AAY95748.1"
FT                   /translation="MNVIDPQSHTYETLQKGFNLRWPPSIEQGAKRIYVCTTPDEVLAA
FT                   ANTALRDGYRITVRSGGHCYEGFVSNKLSGETESLAIIDIGEMKGLKYDESQSITSPWD
FT                   SQNKKYRFMALTGNQNWDGYLSLYKQAGRTIPGGSCYSVGLGGHISGGGYGLLSRLQGL
FT                   TVDWVTGVDILVPVENSRQLKFRHVRADSPSNEDKALFTACCGAGGGNFGIIIGYYFDQ
FT                   LPQAPQQAYWIPLAYPWKELIPNFSNFLRAYWQWFSDNDAAATSPVEGVGNGGLFTLLK
FT                   LNHVDTSDHVVLAIQYTGPNGLVGGANDEPLNDFISKMNAAAGITPTLHDGFIAPNIAP
FT                   LRHPLAGRKFKGAVAEHTAMDWLYVTQMINGSGNNQRGKYKSDYQVEQFSEQACNALLT
FT                   HLTEATPDKRFSQSLVQIDSYGGAINKKGMGTTAVPQRSSLLKAQYQTYWTNAADDAVQ
FT                   LAWIRNIFNAVHGGKPKRPAYDGCYINYPDVDMKYTATGAVDPDWLNLYYGWNTPLINT
FT                   LSNLKASIDPNNLFRHEMSIPATKAE"
FT   gene            complement(392635..393846)
FT                   /locus_tag="PFL_0339"
FT   CDS_pept        complement(392635..393846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95749"
FT                   /db_xref="GOA:Q4KJU9"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU9"
FT                   /protein_id="AAY95749.1"
FT                   /translation="MPAILQGPALLSRFQALDRFLLEHQALWRPRPFNHLQLPWETAHP
FT                   ELAQWLRQRSLEDAEAAHNHPEQLQAPAPFTPLAEQARALGAVGELPIKALPAPHPRLN
FT                   VDVPGRKWQQIEAFAACLQFDRTPTHWLDWCSGKGHLGRRLLQPEQQLTCLEYDPALIE
FT                   SGEQLSRHHGLPARHLQQDVLADDTALRLHAEHSPVALHACGDLHVRLIQLASQQGCPQ
FT                   LAIAPCCYNRTRASHYQGLSTAAQASPLDLSLEDLALPMSETVTAGARVRRQRDTSMAR
FT                   RLAFDLLQRQVRGLDEYLPTPSLPSHWLDKPFADYCRDLAALKDLSTVDCQDWAALEAA
FT                   GWQRLAQVRNLELLRGLFRRPLELWLVLDRGLFLQEQGYAVRLGTFCEAPLTPRNLLLL
FT                   AERP"
FT   gene            complement(393896..394585)
FT                   /locus_tag="PFL_0340"
FT   CDS_pept        complement(393896..394585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0340"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by similarity to GB:AAG04279.1; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95750"
FT                   /db_xref="GOA:Q4KJU8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU8"
FT                   /protein_id="AAY95750.1"
FT                   /translation="MEWEVIYKWLPKFIQGATLTLELVGIAVILGLLLAIPLGIARSSK
FT                   LWYVRALPYAYIFFFRGTPLLVQLFLVYYGLAQFDAVRDSFMWPYLRDPFWCATATMTL
FT                   HTAAYIAEILRGAIQAIPPGEIEAARALGMSRPKALFYIILPRAARIGLPAYSNEVILM
FT                   LKASSLASTVTLLELTGMARTIIARNYLTVDMFFTAGVFYLLMSFILVQAFRQLERWLR
FT                   VDACQGR"
FT   gene            complement(394585..395277)
FT                   /locus_tag="PFL_0341"
FT   CDS_pept        complement(394585..395277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0341"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95751"
FT                   /db_xref="GOA:Q4KJU7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU7"
FT                   /protein_id="AAY95751.1"
FT                   /translation="MNIDLYGFGPALAAGALMTVKLALSALCLGLVLGLLGALAKTSPY
FT                   KPLRWLGETYSTIVRGVPELLWVLLIYYGTVNMMSALGEHFGNPDLALSPFLAGVIALG
FT                   LCFGAYATEVFRGAILAIPKGHREAGTALGLSKFRIFSRLILPQMWRIALPGLGNLFMI
FT                   LMKDTALVSVIGLEEIMRHAQNAVTFAKHPFTFFMVAAFMYLGLTVLAMTGMHFLEKRA
FT                   ARGFVRTT"
FT   gene            complement(395343..396095)
FT                   /locus_tag="PFL_0342"
FT   CDS_pept        complement(395343..396095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0342"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /note="identified by similarity to GB:AAG04277.1; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95752"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU6"
FT                   /protein_id="AAY95752.1"
FT                   /translation="MQSYKKILLAAAVTLAFSASAAAETLKMGIEAAYPPFNNKDASGQ
FT                   VVGFDKDIGDALCAKMKVECTVVTSDWDGIIPALNAKKFDFLISSLSITDERKQAVDFT
FT                   DPYYSNKLQFIAPKAKTDFKTDKASLKGKIIGAQRATLAGTWLEDNLGDDITIKLYDTQ
FT                   ENAYLDLTSGRLDAILADKYVNYEWLKSDAGKPYEFKGEPMVESDKIGIAVRKKDPLRE
FT                   KLNAALKEIVADGTYKKINDKYFPFSIY"
FT   gene            complement(396109..396882)
FT                   /locus_tag="PFL_0343"
FT   CDS_pept        complement(396109..396882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0343"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:O30506; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95753"
FT                   /db_xref="GOA:Q4KJU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU5"
FT                   /protein_id="AAY95753.1"
FT                   /translation="MAEATPALEIRNLHKRYGTQEVLKGISLTARDGDVISILGSSGSG
FT                   KSTFLRCINLLENPHQGQILVAGEELKLKAAKNGELVAADGKQINRLRSEIGFVFQNFN
FT                   LWPHMSVLDNIIEAPRRVLGQSKAEAIEVAEALLAKVGIADKRHAYPAQLSGGQQQRAA
FT                   IARTLAMQPKVILFDEPTSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSE
FT                   VVFLHQGLVEEQGSPQQVFENPLSARCKQFMSSNR"
FT   gene            397448..398839
FT                   /gene="gabP"
FT                   /locus_tag="PFL_0344"
FT   CDS_pept        397448..398839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="PFL_0344"
FT                   /product="GABA permease"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF03845; match to protein
FT                   family HMM TIGR01773"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95754"
FT                   /db_xref="GOA:Q4KJU4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU4"
FT                   /protein_id="AAY95754.2"
FT                   /translation="MSGTQLSNDLEQGLKPRHVTMLSIAGVIGAGLFVGSGHAIAEAGP
FT                   AVLLAYAAAGTLVVLVMRMLAEMAVASPDTGSFSTYADRAIGHWAGFTIGWLYWWFWVL
FT                   VIPLEANAAATILHAWFPNVAIWVFTLVITLLLTATNLFSVKNYGEFEFWFALIKVVAI
FT                   IGFVILGLAAICGLLPNSQVSGVSHLVDTQGFMPNGMGAVLAAMLTTMFSFMGTEIVTI
FT                   AAAESHNPGKQISKATNSVIWRIGLFYLVSIFIVVALVPWNDPSLAQVGSYQTVLDRMG
FT                   IPNAKLIVDLVVLVAVTSCLNSALYTASRMLFSLGKRGDAPAAAKRTNASGTPYWAVIL
FT                   STAAAFLAVFANYVAPAAVFEFLLASSGAIALLVYLVIAVSQLRMRHKRMAAGEKIAFR
FT                   MWLFPGLTYAVIVFIVAVLGIMLFQEEHRVEILATGLLSVIVIAAGLMVARRRKAERNG
FT                   ALALN"
FT   gene            399030..401060
FT                   /locus_tag="PFL_0345"
FT   CDS_pept        399030..401060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95755"
FT                   /db_xref="GOA:Q4KJU3"
FT                   /db_xref="InterPro:IPR027375"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU3"
FT                   /protein_id="AAY95755.2"
FT                   /translation="MKDLDMDDAEWELLDLEWHQGFAFVEGALLVEERARDVYLMLQRE
FT                   GRTPAEQACQAATEQFPASPLVEGEPLWRHRVHRHLLRDARADYYALPRYFARYGYHPL
FT                   QALPVRVCRGLQSLGHDHWRDQCRAYFCHDYGQEVIDGAQPERLALVHPVPENWPAGSV
FT                   LFSDGDKVFLGARAIASAEQQVRGTNHPAYQVISGQVCRGGVVLHQKDGSPLPIANPDG
FT                   FQMLAWRWGTDGHSVIVQAQQGSSIAYEYFYRIDNVDLATFSVLNERYAKDARRAYYLT
FT                   GKTLRYVGDFRLLNRVQSVFDAGGRILSQSEAADPYFAVDDQFVYCNGTRLRGADGPSF
FT                   RHLGFDYYADRHRVYRRSKPLDVDVESFVVAQLERGEGNYSPLLVGDRHGPLGSDGVID
FT                   DIMLQEWSAYFEAHPQLQDYWWHRLQAPSASTAQALRSIGSGFELGSQVHFHGRPINGL
FT                   DAGSFKLLDTHLCGDANGLYLIPFHRAETRVPERFSSACADHYRALGGPYLTDGQRVFC
FT                   HSVFYQVPEPMAKADLASFESCGHGWARDKGAVYYYGARKKPLDPAHTRVMGSYAFTAT
FT                   LMFAAGKPLEVEFSPEEVMVPHPDFLQLGTRKLFCGRRPVSAKRIDLASLEFVAQRYAR
FT                   DKQRFYQYDGYATLSEISAEQYHQALKKAPAGDADSESLAF"
FT   gene            401419..401739
FT                   /locus_tag="PFL_0346"
FT   CDS_pept        401419..401739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95756"
FT                   /db_xref="GOA:Q4KJU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU2"
FT                   /protein_id="AAY95756.1"
FT                   /translation="MAFTKIIFKNPNTGAIKEAPVGFSWTVFFFGFIPALFRADWKWAA
FT                   IMFLLAMFTFGLSNLVFMFIYNKLYVRDLIGAGFKAQSIASGDLNFASSRIGMEIPRLE
FT                   AA"
FT   gene            complement(401822..402232)
FT                   /locus_tag="PFL_0347"
FT   CDS_pept        complement(401822..402232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95757"
FT                   /db_xref="GOA:Q4KJU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU1"
FT                   /protein_id="AAY95757.1"
FT                   /translation="MASIDKQHKRAARAKAKAKQNRAKRTAPTSELELDPNDSRIDFES
FT                   VDLTELFVKMRDAEKTSQQALCTVFLSDPLLELVYEQEGEQGATDFILAALIEYRNWST
FT                   EADEATALAWIESEAFQADYMAASQALFSAEG"
FT   gene            402492..403217
FT                   /locus_tag="PFL_0348"
FT   CDS_pept        402492..403217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0348"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95758"
FT                   /db_xref="GOA:Q4KJU0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJU0"
FT                   /protein_id="AAY95758.1"
FT                   /translation="MHYHTPTDRLLQILVALGQSPEAMSAKELSLNLQQPLSSTYRHLK
FT                   TLLRWGLAQDNGQGRYLPGPACLQLAKKFDREGLLVTLAKPELNRLAELSQESVALMVP
FT                   SNGQAICIELVDSPQPLRCCYQKGLAQPLLLGASAKVLLAYMEPELCLSILRQQGVEEA
FT                   DFAAHLDSYGAIRAAGHAVSLSEIDLGIWGVSAPLLDSRDRLQGAISLMAPAFRAEQRS
FT                   ERLIRWTREAAQRLSARMD"
FT   gene            403236..404174
FT                   /gene="hutG_1"
FT                   /locus_tag="PFL_0349"
FT   CDS_pept        403236..404174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutG_1"
FT                   /locus_tag="PFL_0349"
FT                   /product="formimidoylglutamase"
FT                   /EC_number="3.5.3.8"
FT                   /note="identified by similarity to SP:P42068; match to
FT                   protein family HMM PF00491; match to protein family HMM
FT                   TIGR01227"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95759"
FT                   /db_xref="GOA:Q4KJT9"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJT9"
FT                   /protein_id="AAY95759.1"
FT                   /translation="MISNAPMHLWQGRIDLAEGLAARRWHQWVQPWAEQQPAGIALLGL
FT                   ACDEGVKRNQGRTGASQGPAALRAALANLAWHGTGPLYDAGDVTCTDHHLESAQKRYAE
FT                   RLGLLLEQGHLVLGLGGGHEIAFASFSGLADHLRRQQPCPRIGILNFDAHFDLRHAPQS
FT                   SSGTPFRQIAEYCRQAGMPFEYCCLGVSELSNTQALFEQARELDVRYLLDRQMQGWNLP
FT                   AVEACLDAFLDGIDVLYMTLCLDVLPASQAPGVSAPSAHGVDVQVVEHLVRRARASGKL
FT                   RVADIAELNPGLDQDQRTARVAARLLASLIH"
FT   gene            404227..405435
FT                   /gene="gltS"
FT                   /locus_tag="PFL_0350"
FT   CDS_pept        404227..405435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="PFL_0350"
FT                   /product="sodium/glutamate symporter"
FT                   /note="identified by match to protein family HMM PF03616;
FT                   match to protein family HMM TIGR00210"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95760"
FT                   /db_xref="GOA:Q4KJT8"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJT8"
FT                   /protein_id="AAY95760.2"
FT                   /translation="MPTFELDALTTLALALILLGVGAQLKKRSRWLTQLCVPAPVIGGF
FT                   GFALIVWLLRDQQLLAIKLDTAIQTPLMVAFFTTVGLGGSLGLLRRGGKILFVYLGACW
FT                   SLALLQNLVGVGAAKALGIDPLLGIMAGAVSLEGGFGAAAAFGPIAENLGAVGATTAAL
FT                   ASATFGMVAGGLLGSPLARWLIERNRLQIQADQVSTLQHLESAAQGSVAPLDAPTLLRL
FT                   LTCILLIMVLGFWIGSALNEHLGIVLPSYVGAMFVAIILRNLNDRARIIDIPDSAVSTL
FT                   GDVCLGVFLTMAMMSLKFWELEQLGLPLLVILVVQVLVMVLLCVFLLFRLFGGNYDAAV
FT                   LCAGFMGHGLGATPNAVANMGAICDHYKVFSYKAFIIVPLCGAVLIDIVAIPLITWFIN
FT                   AFA"
FT   gene            complement(405436..406413)
FT                   /locus_tag="PFL_0351"
FT   CDS_pept        complement(405436..406413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0351"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95761"
FT                   /db_xref="GOA:Q4KJT7"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJT7"
FT                   /protein_id="AAY95761.1"
FT                   /translation="MSLLSSPDLPAAGPATAEPAPGPSERFSEVAADGFRLGGFSWRHA
FT                   QADPARAVVIINAATSVRCRYYFRFADYLFANGFDVMTYDYRGIGESRPASLKGLKASW
FT                   SDWGALDFEAMLQRARREFPGQPIDVVGHSFGGCALGLAASAGVIRRAATMGAQFAYWR
FT                   DYVPAQRWRMLGKWHVLMPLLTRLYGYFPGKRLGWMEDTPAGVVRDWATPDPRYEGRPS
FT                   GRRLAAERSGQPFAQVSAPILAISVSDDPFGTVAAIERLLGYFDNSTRTHWRIRPEDIG
FT                   EVEIGHFAFFHSRFESRLWPLLLHWLQHASPAPNSPGQELTPGR"
FT   gene            complement(406463..406855)
FT                   /locus_tag="PFL_0352"
FT   CDS_pept        complement(406463..406855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95762"
FT                   /db_xref="GOA:Q4KJT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJT6"
FT                   /protein_id="AAY95762.1"
FT                   /translation="MGPPGSKVAGIRPSGRKGTALVNQKRTRVRLPHPQPGKTRSGAWF
FT                   FLLIGSVLLALTALLGWTLVSALLDGQIVTSNRAGPKLAYSQALQPTKFYIELLWQGTS
FT                   TLLLGALAVAALWIARVLMGAQKNRR"
FT   gene            406915..407256
FT                   /locus_tag="PFL_0353"
FT   CDS_pept        406915..407256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0353"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="identified by match to protein family HMM PF01817"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95763"
FT                   /db_xref="GOA:Q4KJT5"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008241"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJT5"
FT                   /protein_id="AAY95763.1"
FT                   /translation="MEVKNQMSPEQCQGMDDIRREIDALDRAVIALLGARFQYVLAASK
FT                   FKTSAATVRAEERFKAMLATRRDWAAAEGLNPDAIEKMYSDLVQHFIAEEMKHWQAAQA
FT                   PSRGAGPLA"
FT   gene            407509..407967
FT                   /locus_tag="PFL_0354"
FT   CDS_pept        407509..407967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95764"
FT                   /db_xref="GOA:Q4KJT4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJT4"
FT                   /protein_id="AAY95764.1"
FT                   /translation="MKSFSMSVLSGVIAVLLLAAPVSVRSASTSNEPIDPAGVQLEPLQ
FT                   QNGISYVSGGIGLDESRAIQQAKGYNLHMTFSVGSGNEYTSDIDVLIQNPQGHQLLSLS
FT                   GVGPIVFVQLPAGRYQVITTRKGLEQRSMVDMGVATMRDLNVHWNNGY"
FT   gene            complement(408137..408673)
FT                   /locus_tag="PFL_0355"
FT   CDS_pept        complement(408137..408673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95765"
FT                   /db_xref="GOA:Q4KJT3"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJT3"
FT                   /protein_id="AAY95765.1"
FT                   /translation="MPAFFHHDLELLNPSFDSNLVDVLSELAHLRRLRLEGDTPPAVFY
FT                   QLKTIFHVLESLGSARIEGNHTTLADYIESKVEGTAEDTDQLREVANIEKALDYIEQGH
FT                   AITEQQRGDVGDLEQIAGVGRLRGHAGQAVHQLVEDAYALIGAGQKIEQRSTEVGNGHK
FT                   IRPRRSVPAYSCHNA"
FT   gene            complement(408994..409069)
FT                   /locus_tag="PFL_0356"
FT   tRNA            complement(408994..409069)
FT                   /locus_tag="PFL_0356"
FT                   /product="tRNA-Phe"
FT   gene            complement(409175..409447)
FT                   /locus_tag="PFL_0357"
FT   CDS_pept        complement(409175..409447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0357"
FT                   /product="Fe(2+) trafficking family protein"
FT                   /note="identified by match to protein family HMM PF04362"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95766"
FT                   /db_xref="GOA:Q4KJT2"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJT2"
FT                   /protein_id="AAY95766.1"
FT                   /translation="MTRTVMCRKYQEELPGLERPPYPGAKGQDIFDHVSAKAWADWQKH
FT                   QTLLINEKRLNMMNADDRKYLQGEMDKFFSGEEYAKADGYVPPAE"
FT   gene            complement(409444..410511)
FT                   /gene="mutY"
FT                   /locus_tag="PFL_0358"
FT   CDS_pept        complement(409444..410511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="PFL_0358"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95767"
FT                   /db_xref="GOA:Q4KJT1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJT1"
FT                   /protein_id="AAY95767.1"
FT                   /translation="MRAEAFSTAVLDWYDRHGRHDLPWQQDINPYRVWVSEIMLQQTQV
FT                   STVLNYFDRFMASLPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVMAEYGGEF
FT                   PRDVEKLTELPGIGLSTAGAIASISMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQ
FT                   LWAAAERFTPHSRVNHYTQAMMDLGATLCTRSKPSCLLCPLERGCEAHMLGLETRYPIP
FT                   KPRKEVPQKRTLMPMLANREGAILLYRRPSSGLWGGLWSLPELDGLDDIQHLALQHSLE
FT                   LGQQQQMPGLVHTFSHFQLAIEPWLIRVEESALHVAEADWLWYNLATPPRLGLAAPVKT
FT                   LLKRAAEVLNAGESS"
FT   gene            complement(410508..412733)
FT                   /locus_tag="PFL_0359"
FT   CDS_pept        complement(410508..412733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0359"
FT                   /product="AsmA family protein"
FT                   /note="identified by match to protein family HMM PF05170"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95768"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJT0"
FT                   /protein_id="AAY95768.1"
FT                   /translation="MKAFGKILGLVILGLLLIIVALGFALTHLFDPNDYKDEIRQIARD
FT                   KAHIELTLNGDIGWSLFPWLGLELHDAGVATLANPSQPFADLQMLGLSVRVLPLLRREV
FT                   QMSDVRVEGLNLRLTRNKDGHGNWQDIGKAAPTDKQAETPAASTGEASQPPAGADKPAQ
FT                   PIRLDIDSLTVNNARVEYNDEQTDKQFTAESIQLSTGPIHEATNTPVKLTAFLASSQPA
FT                   VRVRTELNGELRFDRALQRYQFEDMRLSGEAAGDPLQGKTLTFAAQGQLLLDQAANVAQ
FT                   WTGLKVSLNQLRALGELKVNDLDKTPQISGGISIAQFDLARFVDSIGQTLPAMGEGSLS
FT                   KVELVSRLQGTPTSLALEDLNLKLDDSTFSGRLAIEDFDKQSLRAQLKADTFNVDRYLP
FT                   PKSAEANSAASARKAEVQSSEADAMAGAGSTPLPNAPTKGAWSTDRLLPVERLSKLDVD
FT                   ADLNFGQLTLDKLPIQNAALKASGQGGLLKLSSLRGELYNGSFDASGNLDVRQSTPQLS
FT                   LQTKINRVPVERILESQGQNPPIKGLVTLNSNLSGSGNSQKALIDSLNGTASFVINNGV
FT                   LLNANIEQQLCQGIAVLNRKNLSSTPRGKDTPFQELKGNLTLRNGVASNPDLKVRIPGM
FT                   TVNGNGDIDLRVLGMDYRVGIIVEGDLRDNPDPACQVGERFTGIELPLRCRGPLELGAK
FT                   ACRLDKDGLGQVAAKLAGDRLQQKIDEKLGDKVSPELKNALKGLFKR"
FT   gene            413076..414737
FT                   /locus_tag="PFL_0360"
FT   CDS_pept        413076..414737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0360"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95769"
FT                   /db_xref="GOA:Q4KJS9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJS9"
FT                   /protein_id="AAY95769.1"
FT                   /translation="MSTSNAAASPSAQPAFLSKERIIAKPGFNRWLVPPAALAIHLCIG
FT                   MAYGFSVFWLPLSKALGVSAPVACEPGMGFIAQIFSSQCDWPISMLGWIYTLFFIFLGC
FT                   SAAIWGGWLEHAGPRKAGVVSALCWCGGLLISALGIYTHQIWLMWIGSGVIGGIGLGLG
FT                   YISPVSTLIKWFPDKRGMATGMAIMGFGGGAMVGAPLAAALMGHFATPTSVGVWQSFLV
FT                   MAAIYFVFMIGGALAYRVPPTGWKPEGWTAPAKKAANAMITHRHVHVNVAWKTPQFRLV
FT                   WLVLCLNVSAGIGILGMASPLLQEVFAGKLLGNGLTFSQLDAGQLAQIAAIAAGFTGLL
FT                   SLFNIGGRFFWASFSDYLGRKNTYFVFFALGFALYALIPNLGHLGNIALFVAAFCIILS
FT                   MYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWAAAGVLGPVLVNYLREYQLSIGVERA
FT                   AAYDITLYILAGLLVLGFLCNLLVRPVADKYFMTDEQLAAEQALGHDKGADNSVVLEWK
FT                   ASSASLPLVIAAWLAVGIPLAWGVWVTLQKTAVLFH"
FT   gene            414975..415568
FT                   /gene="hisB"
FT                   /locus_tag="PFL_0361"
FT   CDS_pept        414975..415568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="PFL_0361"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="identified by match to protein family HMM PF00475"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95770"
FT                   /db_xref="GOA:Q4KJS8"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJS8"
FT                   /protein_id="AAY95770.1"
FT                   /translation="MAERKASVERDTLETQIKASINLDGTGKARFDIGVPFLEHMLDQI
FT                   ARHGLIDLDIESKGDLHIDDHHTVEDVGITLGQAFSKAIGDKKGIRRYGHAYVPLDEAL
FT                   SRVVIDFSGRPGLQMHVPFTRATVGGFDVDLFQEFFQGFVNHANVTLHIDTLRGTNTHH
FT                   QIETVFKAFGRALRMAVELDERMAGQMPSTKGVL"
FT   gene            415568..416206
FT                   /gene="hisH"
FT                   /locus_tag="PFL_0362"
FT   CDS_pept        415568..416206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="PFL_0362"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR01855"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95771"
FT                   /db_xref="GOA:Q4KJS7"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJS7"
FT                   /protein_id="AAY95771.1"
FT                   /translation="MQTVAVIDYGMGNLHSVAKALEHVGAGKVLITSDASVIREADRVV
FT                   FPGVGAIRDCMAEIRRLGFDALVREVSQDRPFLGICVGMQALLDHSEENEGVDCIGLFP
FT                   GQVKFFGKGLIEDGEHLKVPHMGWNEVKQAVDHPLWHNIADLARFYFVHSYYINAGNTR
FT                   QVVGSGHYGVDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW"
FT   gene            416207..416467
FT                   /locus_tag="PFL_0363"
FT   CDS_pept        416207..416467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95772"
FT                   /db_xref="GOA:Q4KJS6"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJS6"
FT                   /protein_id="AAY95772.1"
FT                   /translation="MAIKKPKPPILSLTAEQESEATHKIKRFLEDRFELELGSFEAAEV
FT                   LELFTREIAPHYYNRAIFDVQAHLKERFESIESDLWALEKN"
FT   gene            416510..417247
FT                   /gene="hisA"
FT                   /locus_tag="PFL_0364"
FT   CDS_pept        416510..417247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="PFL_0364"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide
FT                   isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="identified by match to protein family HMM PF00977;
FT                   match to protein family HMM TIGR00007"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95773"
FT                   /db_xref="GOA:Q4KJS5"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJS5"
FT                   /protein_id="AAY95773.2"
FT                   /translation="MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCR
FT                   RLHLVDLNGAFEGQPVNGEVVTAIAKRYPNLPIQIGGGIRSLETIEHYVKAGVSYVIIG
FT                   TKAVKEPEFVAEACRAFPGKVIVGLDAKDGFVATDGWAEVSSVQVIDLAKRFEADGVSA
FT                   IVYTDIAKDGMMQGCNVPFTAALAAATRIPVIASGGIHNLGDIKALLDAKAPGIIGAIT
FT                   GRAIYEGTLDVAEAQAFCDSYQG"
FT   gene            417257..418027
FT                   /gene="hisF"
FT                   /locus_tag="PFL_0365"
FT   CDS_pept        417257..418027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="PFL_0365"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF00977;
FT                   match to protein family HMM TIGR00735"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95774"
FT                   /db_xref="GOA:Q4KJS4"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJS4"
FT                   /protein_id="AAY95774.1"
FT                   /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGA
FT                   DEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSIN
FT                   TAAVFNPEFVGEAAQHFGSQCIVVAIDAKKVSGPGEAPRWEIFTHGGRKPTGLDAVEWA
FT                   KKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLADGIIE
FT                   GHASAVLAASIFHFGEYTVPEAKAYMAQRGIVVR"
FT   gene            418091..418846
FT                   /locus_tag="PFL_0366"
FT   CDS_pept        418091..418846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95775"
FT                   /db_xref="GOA:Q4KJS3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJS3"
FT                   /protein_id="AAY95775.1"
FT                   /translation="MFKRLLVVVASASLVLCGLARADEPADTSLVLLTENFPPYNMAKN
FT                   GKNFAQGENIDGIAVDIVREMFKRAGINYSLTLRFPWERIYKMALEQPGYGVFVMARLP
FT                   DREPLFKWVGPIGPDDWIMLAKAGSKITLESLEQARKYKIGAYKGDAIAETLTKQGLAP
FT                   QVVLRDQDNARKLVAGQIDLWATGDPAGRYLAKQEGISGLKTVLRFNSAELYLALNKDV
FT                   SDEVVAKLQAALDQMRQEGLVEEIMGRYL"
FT   gene            complement(418885..419691)
FT                   /locus_tag="PFL_0367"
FT   CDS_pept        complement(418885..419691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0367"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF04748"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95776"
FT                   /db_xref="GOA:Q4KJS2"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJS2"
FT                   /protein_id="AAY95776.1"
FT                   /translation="MISRCSLLLRSLQAPLLTLLCLLPLATQAAEPTAAAPKAYLSLII
FT                   DDLGQNLPRDRRVLALPGPVTTAIMPDTPHAAEFAREAHRAGKIVILHMPMDPATGPFA
FT                   WHPELPIEELQKRLEAAFQAVPYTSGINNHMGSRMTAQPQAMAWLMADLQRRHKFFVDS
FT                   RTSAQTVAAAEAQKIGLASVSRDVFLDDERTEAAISQQLQTAIKLARKQGSAVMIGHPY
FT                   PQTLAVLERELPRLKAQGIEWIDIKSMISLRSNKAMAGHGKNGVYR"
FT   gene            complement(419807..421117)
FT                   /locus_tag="PFL_0368"
FT   CDS_pept        complement(419807..421117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0368"
FT                   /product="processing peptidase domain protein"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95777"
FT                   /db_xref="GOA:Q4KJS1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJS1"
FT                   /protein_id="AAY95777.1"
FT                   /translation="MLHLSRLTSLALTIALVIGAPQAFAAETAQAATAATTKAPLPLEE
FT                   LRTFAEVMDRIKAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFAELQESTSGEF
FT                   GGLGIEVGAEDGFIKVVSPIDDTPASKAGIQAGDLIVKINGQPTRGQTMTEAVDKMRGK
FT                   IGQKITLTLVRDGGTPFDVTLARATIQVKSVKSQLLESGYGYIRITQFQVKTGEEVSKA
FT                   LAKLRKDNGKKLNGIILDLRNNPGGVLQAAVEVVDHFITKGLIVYTKGRIANSELRFSA
FT                   TGKDESEAVPMVVLINGGSASASEIVAGALQDQKRAVLMGTTSFGKGSVQTVLPLNNDR
FT                   ALKITTALYFTPNGRSIQAQGIVPDIEVRRAKITSESQDGEYFKEADLQGHLGNGNGGA
FT                   DKPSGAASKAKPMPQDDDYQLAQALSLLKGLSITRGK"
FT   gene            complement(421149..422435)
FT                   /locus_tag="PFL_0369"
FT   CDS_pept        complement(421149..422435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0369"
FT                   /product="peptidase, M23 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95778"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJS0"
FT                   /protein_id="AAY95778.1"
FT                   /translation="MLRALITLALICLLQPAFADERAQTQQQLDATRQDIAELKKLLGK
FT                   LQEEKSGVQKDLRGTETEMGKLEKQVEALQKELKKSESELQRLDEEKKKLQSARTEQQR
FT                   LIAIQARAAYQNGRQEYLKLLLNQQNPEKFARTLTYYDYLSQARLEQLKSFNETLRQLA
FT                   NVEKDISLQQAQLLVQKSSLDTQREELDKVRKERQLALAKLNNDVKARDDKLKAREQDQ
FT                   ADLAKVLKTIEETLARQAREAEEARQKALIAQQEAEKKRLREAQADASDEPRKPARSSP
FT                   GALVSSAGPSYGGAFASARGKLPWPVDGRLLARFGETRGDDSRSKWDGVMISAAAGSQV
FT                   HAVHGGRVVFADWLRGAGLLVILDHGNGYLSLYGHNQTLLKEAGDVVKAGESISTVGNS
FT                   GGQDTPALYFAIRQQGRPSDPAQWCHAQG"
FT   gene            complement(422610..423524)
FT                   /locus_tag="PFL_0370"
FT   CDS_pept        complement(422610..423524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0370"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF07313"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95779"
FT                   /db_xref="GOA:Q4KJR9"
FT                   /db_xref="InterPro:IPR010846"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJR9"
FT                   /protein_id="AAY95779.1"
FT                   /translation="MNKTATLLLASLLSGCASQIPAQQPVDASALAQQHSPVEMDAQTA
FT                   DKLKALLKIQPPRGSTDIGQMNDLISREFLHTPYAANRLHGSATLAEKLVVDFRGLDCF
FT                   TYLDYVEALRQSSDEAGFINNLVQIRYVNGDINFLNRRHFFTDWAHAGQPMAEDVTAQL
FT                   SANAVTVAKRLNQKADGGRYLPGLPVAERDITYIPSALIDQHLLSHLRTGDYIGIYTHL
FT                   SGLDVTHTGLFIQTAQGPVLRNASSKKDQGAIIDSPFMEYVHNVPGIVVLRARQDSQAG
FT                   QDASAAKAGTQALQHQARSPAQG"
FT   gene            complement(423691..425232)
FT                   /gene="gpmI"
FT                   /locus_tag="PFL_0371"
FT   CDS_pept        complement(423691..425232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="PFL_0371"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by similarity to SP:P37689; match to
FT                   protein family HMM PF01676; match to protein family HMM
FT                   PF06415; match to protein family HMM TIGR01307"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95780"
FT                   /db_xref="GOA:Q4KJR8"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJR8"
FT                   /protein_id="AAY95780.1"
FT                   /translation="MTTTPKPLVLMILDGFGHSESHESNAVYAAKKPVLDRLCASMPNG
FT                   LISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDGEFFENPTICAAVD
FT                   KAVDAGKAVHILGLLSDGGVHSHQDHLIAMAELAFKRGAEKIYLHAFLDGRDTPPKSAQ
FT                   SSIELLDETFKTLGKGRIASLIGRYFAMDRDNRWDRVAQAYNLIVDGQGQFNAATAQEG
FT                   LQAAYAREESDEFVKATTIGEPVKVEDGDAVVFMNFRADRARELTRVFVEDDFKDFERP
FT                   RQPKLAGFVMLTQYAASIPAPSAFAPGSLENVLGDYLAKNGKTQLRIAETEKYAHVTFF
FT                   FSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDKIVDAIEHQRYDVIIVNYANG
FT                   DMVGHSGVFEAAVKAVECLDLCVGRIVDALEKVGGEALITADHGNVEQMSDESTGQAHT
FT                   AHTTEPVPFIYVGKRALKVREGGVLADVAPTMLKLLGLPKPAEMTGTSILVDPAH"
FT   gene            425397..425810
FT                   /locus_tag="PFL_0372"
FT   CDS_pept        425397..425810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0372"
FT                   /product="rhodanese-like protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95781"
FT                   /db_xref="GOA:Q4KJR7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJR7"
FT                   /protein_id="AAY95781.1"
FT                   /translation="MVAHLIQFATEHYLLVGAFAILLALLIAHELSRGGRSLSTRELTA
FT                   LVNSEQGVVIDIRPSKDYAAGHIVGALNIPQDKLAARVGELEKHKSKTIILVDAQGQHA
FT                   GTHARELLKSGFTAAKLSGGVASWKADNLPLVK"
FT   gene            425810..426064
FT                   /gene="grxC"
FT                   /locus_tag="PFL_0373"
FT   CDS_pept        425810..426064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="PFL_0373"
FT                   /product="glutaredoxin 3"
FT                   /note="identified by similarity to SP:P37687; match to
FT                   protein family HMM PF00462; match to protein family HMM
FT                   TIGR02181"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95782"
FT                   /db_xref="GOA:Q4KJR6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJR6"
FT                   /protein_id="AAY95782.1"
FT                   /translation="MSKVIVYSSDYCPYCSRAKHLLASKGVAFEEIKVDGKPQVRAEMA
FT                   QKAGRTSVPQIWIGATHVGGCDDLFALERAGKLDALLAA"
FT   gene            426107..426586
FT                   /gene="secB"
FT                   /locus_tag="PFL_0374"
FT   CDS_pept        426107..426586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="PFL_0374"
FT                   /product="protein-export chaperone SecB"
FT                   /note="identified by match to protein family HMM PF02556;
FT                   match to protein family HMM TIGR00809"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95783"
FT                   /db_xref="GOA:Q4KJR5"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJR5"
FT                   /protein_id="AAY95783.1"
FT                   /translation="MTDQQNTVADDESAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPS
FT                   VGLDLNTRQTALEADFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIKNLDEASMSHTL
FT                   GAFCPNILFPYAREALDSLVTRGSFPALMLAPVNFDALYAQELQRLQSAGENTVQ"
FT   gene            complement(426682..427137)
FT                   /locus_tag="PFL_0375"
FT   CDS_pept        complement(426682..427137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0375"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95784"
FT                   /db_xref="GOA:Q4KJR4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJR4"
FT                   /protein_id="AAY95784.1"
FT                   /translation="MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFEMDDKRLR
FT                   RAGLDYHEYATLQRHADLASCLESLGHPRLFAFTTKGSRPFHDASFQEGDAFLFGPESR
FT                   GLPADVLDALPGEQRLRLPMREGCRSLNLSNTVAVAVYEGWRQLGFK"
FT   gene            427136..427576
FT                   /locus_tag="PFL_0376"
FT   CDS_pept        427136..427576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95785"
FT                   /db_xref="GOA:Q4KJR3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJR3"
FT                   /protein_id="AAY95785.1"
FT                   /translation="MHGSEEKDRLHSTPEAYSRPKLMLRVFGSLAIVGVMVGLMIGRLT
FT                   QPDPVALQQVEVAPDGLVLWFNHEPKLHGEHIDGTVALLFDAQGQAQKGQLQVNQRNVN
FT                   WRVRRADQGLLLNLVAARPLRGQWDGSEVEGRWRLAIHLREE"
FT   gene            complement(428342..429778)
FT                   /gene="glnG"
FT                   /locus_tag="PFL_0377"
FT   CDS_pept        complement(428342..429778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnG"
FT                   /locus_tag="PFL_0377"
FT                   /product="nitrogen regulation protein"
FT                   /note="identified by similarity to SP:P06713; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00158; match to protein family HMM PF02954; match to
FT                   protein family HMM PF07728; match to protein family HMM
FT                   TIGR01818"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95786"
FT                   /db_xref="GOA:Q4KJR2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJR2"
FT                   /protein_id="AAY95786.1"
FT                   /translation="MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMSRLA
FT                   RQAPDVIISDIRMPGASGLDLLARIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLP
FT                   KPFDVDEAVSLVKRANQHAQEQQGLEVAPTLARTPEIIGEAPAMQEVFRAIGRLSHSNI
FT                   TVLINGESGTGKELVAHALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAA
FT                   NLRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHTPVKVDVRIIAAT
FT                   HQNLETLVHAGKFREDLFHRLNVIRIHIPRLSDRREDIPTLARHFLSRAAQELAVEPKL
FT                   LKNETEEYLKNLPWPGNVRQLENTCRWITVMASGREVHISDLPPELLSLPQDSAPVTNW
FT                   EQALRQWADQALARGQSNLLDSAVPSFERIMIETALKHTAGRRRDAAVLLGWGRNTLTR
FT                   KIKELGMKVDGGDEDEGEEG"
FT   gene            complement(429775..430860)
FT                   /gene="glnL"
FT                   /locus_tag="PFL_0378"
FT   CDS_pept        complement(429775..430860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="PFL_0378"
FT                   /product="nitrogen regulation protein NR(II)"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to SP:P06712; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00989; match to protein family HMM PF02518; match to
FT                   protein family HMM PF08448"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95787"
FT                   /db_xref="GOA:Q4KJR1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJR1"
FT                   /protein_id="AAY95787.1"
FT                   /translation="MTISDPLHRLLLDNLTTATILLNADLRLEYMNPAAEMLLAISGQR
FT                   SHGQFISELFTESAEALSSLRQAVEQAHPFTKREAMLTALTGQTLTVDYAVTPILSNGD
FT                   TLLLLEVHPRDRLLRITKEEAQLSKQETSKMLVRGLAHEIKNPLGGIRGAAQLLARELP
FT                   EESLKDYTNVIIEEADRLRNLVDRMLGSNKLPSLALTNIHEVLERVSSLVEAESQGCIT
FT                   LVRDYDPSIPDVLIDREQMIQAVLNIVRNAMQAISSQNEMRLGRITLRSRTMRQFTIGH
FT                   VRHRLVSKIEIIDNGPGIPAELQDTLFFPMVSGRPDGTGLGLAITQNIISQHQGLIECD
FT                   SHPGHTTFSIFLPLEQGAPST"
FT   gene            431232..432326
FT                   /locus_tag="PFL_0379"
FT   CDS_pept        431232..432326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0379"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase, ADA family"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by similarity to SP:P06134; match to
FT                   protein family HMM PF01035; match to protein family HMM
FT                   PF02805; match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95788"
FT                   /db_xref="GOA:Q4KJR0"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJR0"
FT                   /protein_id="AAY95788.1"
FT                   /translation="MENAPLLFQLPDDDTLYQALLARDPAYEGFAFVGVKSTGVFCRLT
FT                   CAARKPKRENTVFFGSIKGCVEAGFRACLRCRPLERAGVQEPWVQTLLEQLGRDPERRW
FT                   YEDDLVAQGLDPSTVRRAFKRYFGVTFLEMARLRRMGQGMQQLASGEPVIEAQISAGFD
FT                   SDSGFRHAFSRLAGQPPSNLRGRELLKVDWLQTPIGVMLAVADAQVLHLLEFFDRPALA
FT                   NELQNLQKSSGSSIGFGRFAPIDQIEAELQRYFAGEAVHFATPLAMSASPFTRTVWQAL
FT                   RAIPLGTTCSYAEVARQVGSPSAVRAVARANAANQISIVIACHRVIGADGSLTGYGGGL
FT                   WRKRWLLEHERRLHHLQGASASGL"
FT   gene            complement(432309..433721)
FT                   /locus_tag="PFL_0380"
FT   CDS_pept        complement(432309..433721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0380"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95789"
FT                   /db_xref="GOA:Q4KJQ9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ9"
FT                   /protein_id="AAY95789.1"
FT                   /translation="MNAAQDAAAHKKARKAGIASFIGTTIEWYDFYAYGIAAALVFGKV
FT                   FFPADLPPGTATLLSFLTLWAGFIARPVGGIIFGHMGDKIGRKTTLVITLIMMGLATTC
FT                   IGLLPSYLQIGVWAPIALVTLRIIQGIAVGGEWGGAILIASESAPKGKGILYAAFAQQG
FT                   SPAGNLLATLVFFGLSALPTPDFLLWGWRIPFLLSAVLVIIGMVIRLKLEESDNMKRLM
FT                   EQKKTVKLPILEVLRDHWRLVLLGAGVLPIIHVTYFKSTFALSWATKELGYSQSSFLSV
FT                   IVIALVVQFITQPLGAVLVSRMDMRKAMVLMVVPELLLMPAMFFAVETGHYWIAVLGMC
FT                   LATVPHSMFYGAVGGILARAFPTRVRYSGLSISYQLCSLLVGGATPVLAQSILNGTGSI
FT                   IGVAIASACYALVSLACMLALLKRIGHNAAELSTAEQADADELARQTGAQPPVDKVSRP
FT                   DPVPGSELQPAR"
FT   gene            complement(433879..434778)
FT                   /locus_tag="PFL_0381"
FT   CDS_pept        complement(433879..434778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0381"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95790"
FT                   /db_xref="GOA:Q4KJQ8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ8"
FT                   /protein_id="AAY95790.1"
FT                   /translation="MDLKQLRYFVAVAEELHFGRAANRLCISQPALSFDIKKLEGQLEV
FT                   QLLNRNNKSVSLTNAGQVLLDEARYLLLRADQARHLTQRSAEGFAGRLSLGFVNSILHR
FT                   GLPEAVKAFEQQYPETEVVLMEMNSADQTQALQRGQIDIGFVHGSTFAAGIHSEPLLAE
FT                   PFLCCLPQSHSLATQARIDLAQLANDDFILFPRAVSPHYHDLIISRCVAAGFSPRIRHE
FT                   TRLWQTVVAMVAHEMGVALVPQTLAMLGQPGVHYGELEGSGAPSQIQAIRLEDKPSAAA
FT                   ESFLGLLKSLIKPAAGGR"
FT   gene            434889..436610
FT                   /locus_tag="PFL_0382"
FT   CDS_pept        434889..436610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0382"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /EC_number="1.3.8.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95791"
FT                   /db_xref="GOA:Q4KJQ7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ7"
FT                   /protein_id="AAY95791.1"
FT                   /translation="MTAEPRPIEDSLNIPDSRGINLFECDAGLAALLQVYLPSAVYQQW
FT                   LPTLQHLGARAGGELDVLALSADKNPPVLQPRTRRGENLQSIAKHPDYVTLERVAFAEL
FT                   GLAAMSHQPGGPPPLIKYALTYLFVQAEFGLCCPVSMTDSLTRTLCKFGTPEVVARYLP
FT                   QLQSQDFETLFQGAMFMTEQAAGSDVSRTETRARLEDGQWRLFGEKWFCSNPDADLAMV
FT                   LARPEDAPPGMAGVTLFLLPKVLPDGSRNHYRIQRLKDKLGSRSMASGEITLEGATAYL
FT                   IGEVGRGFQQMADMINMSRLSNGVRAAGLMRRGLSEALYIARQRRAFGKHLIEMPLMQR
FT                   QLLKMMLPAEQARSMFMQIASLLPRADGGDETARKCVRILTPLIKFRACRDARRVTGDA
FT                   MEVRGGVGYIEEWSDARLVRDAHLGSIWEGTSNIVALDIARAVTREQALEPLQGYLAGL
FT                   LAEADLPPASRRLFDSALLRTVTGFHAVAQQRRDEQVRQVGSVLYHLASAIFMAWEAAR
FT                   QGSDHRRLALAHLVLVHKVLPRDPLGLEPVIDAELLVRLANESPLSQAQAMQLLPA"
FT   gene            436646..437833
FT                   /locus_tag="PFL_0383"
FT   CDS_pept        436646..437833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0383"
FT                   /product="CoA-transferase, family III"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95792"
FT                   /db_xref="GOA:Q4KJQ6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ6"
FT                   /protein_id="AAY95792.1"
FT                   /translation="MTFAQGALAGVKIIDLSRVLGGPYCSQALADHGAEVIKLEPLSGD
FT                   ETRGWGPPFEGDDAAYFRGINRNKQGIAVDLSRPEGLALLMQLLEGADVLIENFKPGTL
FT                   QRWGIGYQEVLSQRFPALIHCGISGFGADGPLGGLPGYDAVIQAMAGLMSVNGEGDGGP
FT                   LRIGLPIVDMVTGLNALAGILLALNERQRSGLGQSLDISLYDCGVSLLHPHLPNYFAAG
FT                   QTPKRTGNAHPNIAPYDSYRTAGEPIFLAVGNDRQFTRLCQELGAGALLEDPRFTDNGQ
FT                   RSVNREALKQQLEHYLSAHDGALLAPRLIGLGVPCGSIATVDQVVAHPHTRHRGLLVEL
FT                   DGYRGIGSPVKLSRTPASYRTAPPSLGQDTRAVLQGLGLDESTIAALLASGVVHG"
FT   gene            complement(437837..438430)
FT                   /locus_tag="PFL_0384"
FT   CDS_pept        complement(437837..438430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95793"
FT                   /db_xref="GOA:Q4KJQ5"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ5"
FT                   /protein_id="AAY95793.1"
FT                   /translation="MCVQRLTTPVPRAAAPYAGAFQAPARISEMHLVIACLLWISALPA
FT                   GAQIYQYTDSAGNRAYSDQPPGTSYRQIETPAPNRLPSPATPAPHTPAAQPASTLLAYE
FT                   RLQLSGVPEHGALRANNGSFSVQVELQPSLRPGHRLRLLLDGQPYGQAGQGPELQLVNI
FT                   DRGQHRLAVQVLAGDKVLQQSPAISFTLLRARRP"
FT   gene            complement(438412..438966)
FT                   /locus_tag="PFL_0385"
FT   CDS_pept        complement(438412..438966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0385"
FT                   /product="putative chorismate mutase"
FT                   /note="identified by match to protein family HMM PF01817;
FT                   match to protein family HMM TIGR01806"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95794"
FT                   /db_xref="GOA:Q4KJQ4"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008240"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ4"
FT                   /protein_id="AAY95794.1"
FT                   /translation="MTSRLNLCLALTCSLFATAACASDAPPALAPLLQSIGERLAIADQ
FT                   VALSKWDSHKAVEDRPREQQVIAGATAQAATYHLSEETVGQFFAAQIEANKLVQYARLS
FT                   TWHLQGRAPDTPRQDLAGQIRPQLDQLQKRLLQQLADFSPQRTDRQCPQWLARANQASS
FT                   SDPLRRLAMVRATAELCVFKG"
FT   gene            complement(439104..440510)
FT                   /gene="glnA_2"
FT                   /locus_tag="PFL_0386"
FT   CDS_pept        complement(439104..440510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA_2"
FT                   /locus_tag="PFL_0386"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by similarity to SP:P0A9C5; match to
FT                   protein family HMM PF00120; match to protein family HMM
FT                   PF03951; match to protein family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95795"
FT                   /db_xref="GOA:Q4KJQ3"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ3"
FT                   /protein_id="AAY95795.1"
FT                   /translation="MSKSVQLIKDHDVKWIDLRFTDTKGTQHHVTMPARDALDEDFFEA
FT                   GKMFDGSSIAGWKGIEASDMILMPDDETAVLDPFTEEPTLILVCDIIEPSSMQGYDRDP
FT                   RAIAKRAEEHLKATGIGDTVFAGPEPEFFIFDQVKFKSDISGSMFKIYSEQGSWMSDQD
FT                   IEGGNKGHRPGVKGGYFPVPPFDHDHEIRTSMCNALEEMGLTVEVHHHEVATAGQNEIG
FT                   VKFNTLVKKADETQTLKYVVHNVADAYGRTATFMPKPLYGDNGSGMHVHMSIWKDGKNT
FT                   FAGEGYAGLSDTALYFIGGIIKHGKALNGFTNPATNSYKRLVPGFEAPVMLAYSARNRS
FT                   ASIRIPYVSSPKARRIEARFPDPAANPYLAFAALLMAGLDGIQNKIHPGDAADKNLYDL
FT                   PPEEAKEIPQVCGSLKEALEELDKGRAFLTKGGVFSDDFIDAYIALKSEEEIKVRTFVH
FT                   PLEYELYYSC"
FT   gene            440842..442296
FT                   /gene="thiI"
FT                   /locus_tag="PFL_0387"
FT   CDS_pept        440842..442296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="PFL_0387"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="identified by similarity to SP:P77718; match to
FT                   protein family HMM PF02568; match to protein family HMM
FT                   PF02926; match to protein family HMM PF06508; match to
FT                   protein family HMM TIGR00342"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95796"
FT                   /db_xref="GOA:Q4KJQ2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ2"
FT                   /protein_id="AAY95796.2"
FT                   /translation="MKLIVKVFPEITIKSRPVRTRFIRQLAKNIRAVLRDLDPAVVVNG
FT                   VWDNLELETAVSEPKALKDMTERLSCMPGIAHFLQVDEYPLGDFDDIVAKCKQHFGEAL
FT                   PGKVFAVRCKRAGKHEFSSMDVEKYVGSQLRRQCGAAGISLKEPEIEVRMEIRDQRLFV
FT                   IHSQHNGIGGYPLGALEQTLVLMSGGFDSTVAAYQIMRRGLMGHFCFFNLGGRAHELGV
FT                   MEVAHYIWKKYGSSQRVLFVSVPFEEVLGEILGKVDNSHMGVILKRMMLRAASSIADRL
FT                   HIDALVTGEAISQVSSQTLPNLSVIDCVTEKLVLRPLIASHKQDIIDLAVEIGTADFAK
FT                   HMPEYCGVISVNPKTHAKRHRVEHEEKEFDMAVLERAIERAKLVPIDRVIDELGQDVQI
FT                   EEVSEALAGQIVIDIRHPDAEEDQPLELAGIEVKALPFYALNARFKELDPTRQYLLYCD
FT                   KGVMSRLHAHHLLSEGHANVRVYRPS"
FT   gene            442436..444256
FT                   /gene="typA"
FT                   /locus_tag="PFL_0388"
FT   CDS_pept        442436..444256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="PFL_0388"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95797"
FT                   /db_xref="GOA:Q4KJQ1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ1"
FT                   /protein_id="AAY95797.2"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLRQSGTLERNELNDERVMDS
FT                   NDQEKERGITILAKNTAINWNGYHINIVDTPGHADFGGEVERVMSMVDSVLLLVDAQDG
FT                   PMPQTRFVTKKAFEAGLRPIVVINKVDRPGARPDWVLDQIFDLFDNLGATEEQLDFKVV
FT                   YASALNGIAGMDHTEMAEDMTPLYQSIVDNVPAPSVDRDGPFQMQISALDYNSFLGVIG
FT                   VGRIARGRVKPNTPVVAIDVDGKRRNGRILKLMGHHGLHRVDVEEAAAGDIVCISGFDE
FT                   LFISDTLCDPTAVEAMKPLTVDEPTVSMTFQVNDSPFCGKEGKFVTSRNIKERLDKELL
FT                   YNVALRVEEGDSADKFKVSGRGELHLSVLIETMRREGFEMGVGRPEVIIREVDGVKQEP
FT                   FENVTIDIPEDSQGKVMEEMGLRKGDLSNMVPDGKGRVRLEYNIPARGLIGFRNQFLTL
FT                   TNGAGILTSIFDRYAPMKSGHMSGRQNGVLVSVETGKALTYSLETLQARGKLFVEHGQE
FT                   IYNGQIVGLNSRDNDLGVNPTKGKKLDNMRASGKDETIALVPPVRFTLEQALEFIQDDE
FT                   LCEVTPKSIRLRKKILDEGERTRAAKKAKN"
FT   gene            complement(444526..444975)
FT                   /locus_tag="PFL_0389"
FT   CDS_pept        complement(444526..444975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:C83043; match to
FT                   protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95798"
FT                   /db_xref="GOA:Q4KJQ0"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJQ0"
FT                   /protein_id="AAY95798.1"
FT                   /translation="MTLMKSNLIAAAEIDRLDTWAKYTAPMCGSCMSSCCTLPVEVKIK
FT                   DLIRIGIVDEFERGEPAKNIAKRLQKEGIVERYNQKSEIFTLQRMSNNDCLYLDRKSRL
FT                   CTIYDKRPDTCRNHPKIGPRPGYCAYKPKPQVRPTNTSSRTLERF"
FT   gene            445236..447686
FT                   /gene="glgP"
FT                   /locus_tag="PFL_0390"
FT   CDS_pept        445236..447686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="PFL_0390"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="identified by similarity to SP:P13031; match to
FT                   protein family HMM PF00343; match to protein family HMM
FT                   TIGR02093"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95799"
FT                   /db_xref="GOA:Q4KJP9"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJP9"
FT                   /protein_id="AAY95799.1"
FT                   /translation="MTQEPLVRDAEVAAFREAVLTKLTYAVGKDPDHAFDHDWFEAIAL
FT                   AARDHMVDHWMDHTRQIYRKGQKRVYYLSLEFLIGRLLFDSLSNLWLLEVAREALTDLG
FT                   VDLERIRLLEPDAALGNGGLGRLAACFMESMSTLGIAGHGYGIRYEHGLFRQAIVDGWQ
FT                   QEQTEHWLDFGNPWEFERPEVIYSIGFGGSVDTVTDEAGNTRQVWWPAETVRAVAYDTP
FT                   VVGWRGASVNTLRLWRARAMEDLHLERFNAGDHLGAVAEVARAESISRVLYPADSTEAG
FT                   QELRLRQEYFFVSASLQDLLRRHKNMHDSVLSLGEHAAIQLNDTHPSIAVAELMRQLVD
FT                   LHGIAWDAAWQITVETLSYTNHTLLPEALETWPVGLMERMLPRHMQIIYLINAQHIDSL
FT                   RAKGLHDFDVLRAVSLIEEDNGRRVRMGNLAFLGSHSVNGVSGLHTQLMRSTVFSELHK
FT                   LYPERINNKTNGITFRRWLYQANPQLTEMLVEALGPELLDSPEELLRGLEPFAEKPAFR
FT                   KQFAEQRLHSKRALAAIIHERLGIAINPAAMFDVQVKRIHEYKRQLLNLLHTVALYQAI
FT                   RAEPETDWVPRVKIFAGKAAASYHQAKLIIKLTNDIARTVNNDPTVRGLLKVVFLPNYN
FT                   VSLAESIIPAADLSEQISTAGFEASGTSNMKFGLNGALTIGTLDGANVEMCEQVGAEHM
FT                   FIFGLSAQQVEARKRNGEFSAVPDIAASHRLNDVLQAIRGGVFSPDDPSRYTALIDSLI
FT                   DYDRFLVCADFDAYWNAQARVEERWHDSKEWWRSAVLNTARMGWFSSDRTIREYATEIW
FT                   KALE"
FT   gene            447892..451524
FT                   /locus_tag="PFL_0391"
FT   CDS_pept        447892..451524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0391"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95800"
FT                   /db_xref="GOA:Q4KJP8"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJP8"
FT                   /protein_id="AAY95800.1"
FT                   /translation="MQWIFMLLGGGLGWLLDESFSDALIGAVSGLAIGLAIRSDALHRQ
FT                   VVDQHRELEKAKKALATLGQRLALLESTGGPAAEPASEPQASAPLAEAGSGMSAAPELA
FT                   DLPEFILEEVQPVEPAPAAPELVWELPAAASPAASVEASQPVPESVWQPQPQAPARESV
FT                   AAPREPNLIERALSGARNWLFGGNTVLRVGVVLLFLGLAFLLRYATEGMVVPLELRYAG
FT                   VAACSLGLLGLGWWLRRRNSNYALMLQGTGIAVLYLTVFAAMRLHPLLDPSAALGLLVA
FT                   VTVFSAILAITQDALSLAAAAALGGFAAPILTSTGAGSHVALFSYFALLNAGILAIAWF
FT                   KAWRLLNLIGFVGTFGIGFAWGLRSYTPELLWSTEPFLILFFVMYLAIGLLFTRRKLLE
FT                   MPDAPADDSRQALLHWSARKGDYVDGSMLFGPPLVGFGLQLALVQHLEFAASFSALALG
FT                   LTYMVLARLLMGGRALLLGETCLALGVIFASLAIPLGLDARWTCAAWAVEGAGIFWLGL
FT                   RQQRPLARVFALLLQLGSALAFLSKLQPGATSLLDGAPLGALLLGVALLFSFDQLRRAQ
FT                   KTQVASWEQGIAPILAVAGLAFLYLLAPLFLFTQGTAISWAVAGLATLFVGLRLQSRTF
FT                   LFTAFAVQLLGGALFLMRLQGADGDAGAVFNAGWSGLMSATLIGLALIGGMLLAARNDM
FT                   VRSDPRLLRGLSLVLLAGLMMINLAVLFVLPWSTASGVWAASGLLIIWLSLYLQQRASF
FT                   VFGLVLQVIGGSTFLLAGSGWYFVAADAARPLANGDFWTPMVLALAALVGAWRLQRGNH
FT                   GSAFDTLSLGHLSDLLLAWGACWWAFTWLKEVLRFAPAHWQASLLLLISAASVLLWALL
FT                   AVRLKWSSLGLLCSLLIPAAGLVLLASWAPRYHPAADFGWLAWTLLFAVHFFSQRRLAS
FT                   QLPARVASIAHVLGCWLLIGVLALELRYGLLLLSEQYNAWRWLGWAILPSLYLVAMAAP
FT                   RAWPWPVSAHSREYRLYAALPLAVLMLGWFWLANIFSDGRAEPLPYLPLLNPLELGLLF
FT                   ALFGVYVWSRSAVRELAIRADYAERATQLVAGLSLFAFFTVLVMRAAHHWSGVPFQADA
FT                   LLESMMVQAGLSIVWTLIALSLMIGGHLRHRREVWLIGAVLIAVVVAKLFLVELSNRGG
FT                   LARIVSFIGVGVLLLVVGYFAPLPPKRAEAQAEPGKPLNEGVSS"
FT   gene            451521..452894
FT                   /locus_tag="PFL_0392"
FT   CDS_pept        451521..452894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95801"
FT                   /db_xref="GOA:Q4KJP7"
FT                   /db_xref="InterPro:IPR025060"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJP7"
FT                   /protein_id="AAY95801.1"
FT                   /translation="MSVKLSLGWLGAVGLCVALSAVAQDKPGDFKSLAPLSLSGEGPWY
FT                   RLELPLAVQLHASQTDLRDIRVFNAAGEPQAYALARQQAQTTEQHTLSDVKWFPLYSSA
FT                   DAADSTPSVRVQSTTNGTLVEVQPSTQLEAGEEVLRGWLLDASAIKAPLQQLVLDWTSE
FT                   RDGFQRFSIEASDDLQHWQPWGEGQVARLSFADERVEQHEVALPGQTARYLRLLWNTPQ
FT                   TAPVLTSAQLQSSTTSSLPSPLVWSQPLKGSSAKAGEYTWQLPMGLNLERVRIALTQAN
FT                   SLAPATLYGRRESSLPWQPLGNGLLYRLTQNGQDVQQNELQLPGQTVQQLRLVVDERGG
FT                   GLGAEAPSLEFAVRGTQLVFLARGAGPYTLALGNPTASAANLPLATLIPDYSAQRLKQL
FT                   GQAKVEGAAQLASATVAPAAAVAAGGPDWKKIGLWAVLLLGVLALAGMAFSMLRKPAA"
FT   gene            453081..454091
FT                   /gene="fbp"
FT                   /locus_tag="PFL_0393"
FT   CDS_pept        453081..454091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="PFL_0393"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by similarity to SP:P19911; match to
FT                   protein family HMM PF00316"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95802"
FT                   /db_xref="GOA:Q4KJP6"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJP6"
FT                   /protein_id="AAY95802.1"
FT                   /translation="MSRVTLSRYLIEQTRSNNTPADLRFLIEVVARACKEISHAVSKGA
FT                   LGGVLGSMGTENVQGEVQKKLDVISNEILLEANEWGGHLAGMASEEMDNAYQIPGKYPK
FT                   GAYLLVFDPLDGSSNIDINAPVGTIFSVLRCPNEYLSQNEALNEKAFLQPGTQQVAAGY
FT                   AIYGPQTMLVLTLGDGVKGFTLDREMGSFVLTHEDIKIPESTQEFAINMSNERHWEAPV
FT                   KRYVEELLAGDTGPLKKNYNMRWVAAMVADVHRILTRGGLFMYPRDSREPEKPGKLRLM
FT                   YEANPMSFLVEQAGGASTDGHKRILDIQPEGLHQRVAVFLGSKEEVARVTGYHKE"
FT   gene            454095..454697
FT                   /locus_tag="PFL_0394"
FT   CDS_pept        454095..454697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06041"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95803"
FT                   /db_xref="GOA:Q4KJP5"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJP5"
FT                   /protein_id="AAY95803.1"
FT                   /translation="MSAPWQPLLDWWFGSAEKPAEIVAAKGRLWFGKRDSQDLEARQRF
FT                   AGLVEQALAGGLTEWAQSPQGWLAMVLLLDQLPRMIYRDTPKAFAGDLRAQALVAQGIA
FT                   ADFDRRLPAMQRCFIYLVFEHCENLAVQNESVSRFTALHDEQPADERAVFADNLDYAER
FT                   HQKVIARFGRFPHRNAILGRESTAEELAFLREPGSRF"
FT   gene            complement(454734..456614)
FT                   /gene="pctC"
FT                   /locus_tag="PFL_0395"
FT   CDS_pept        complement(454734..456614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pctC"
FT                   /locus_tag="PFL_0395"
FT                   /product="chemotactic transducer PctC"
FT                   /note="identified by similarity to GB:BAA23410.1; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95804"
FT                   /db_xref="GOA:Q4KJP4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJP4"
FT                   /protein_id="AAY95804.2"
FT                   /translation="MKFSHKILLAAALVVAVAFACFILFNDYRQREALRSSTEASMQEL
FT                   GSLTTSNIQTWLESRIQLLQSLAQQIAVDGSGANSLKRSVGLPAYTGNFQLSYFGGQDG
FT                   VMFSVPAGNRAADYDPRARGWYKAATGAQRTIVTEPYIAASSGKLVITVATPVQHQNQM
FT                   IGVAGADIDLSSVSAIINSLNFGGHGHAFIVSAEGKILIHPDSKLVLKNLSEAYPNAAP
FT                   NVSPGLKEVQQGGKTQFISFTHVNGVPSADWYVALVLDQDTAFAMLSEFRTSAIIAMAI
FT                   AVVIIISLLGMLIRMLMQPLHLMGRAMHDIAEGEGDLTKRLVIHGHDEFGTLGVSFNRF
FT                   VERIHSSIREVSSATGQVNEVALRVVAASNSSMFNSDQQASRTSSVAAAINQLGAAAQE
FT                   IAQNAALASQHSSDARSLAEDGQQVVDKTIAAMHQLSAKISSSCDNIETLNSSTVNIGQ
FT                   ILEVITSISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAHRTQDSAQQVQKMIE
FT                   ELQVGAREAVGTMTESQRESENSVGIANQAGERLGSVTQRIGEIDGMNQSVATATEEQT
FT                   AVVESINVDITEINTLNQEGVENLQATLRACADLEQQAKRLQHLVGSFRI"
FT   gene            456909..457163
FT                   /locus_tag="PFL_0396"
FT   CDS_pept        456909..457163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0396"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95805"
FT                   /db_xref="GOA:Q4KJP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJP3"
FT                   /protein_id="AAY95805.1"
FT                   /translation="MSLRSLALLSFCVLLAACSKVNQENYSKLSAGMPKAEVEQLLGKP
FT                   TDCSGALGMSSCTWGDKNSFISVQYAGDKVLMFSGQGLK"
FT   gene            457199..457768
FT                   /gene="blc"
FT                   /locus_tag="PFL_0397"
FT   CDS_pept        457199..457768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blc"
FT                   /locus_tag="PFL_0397"
FT                   /product="outer membrane lipoprotein Blc"
FT                   /note="identified by similarity to SP:P39281; match to
FT                   protein family HMM PF08212"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95806"
FT                   /db_xref="GOA:Q4KJP2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJP2"
FT                   /protein_id="AAY95806.1"
FT                   /translation="MMRFAVTLLVGLLLAGCATSRDDSLAPKTVNHVDLKRYQGTWYEL
FT                   ARLPMYFQRNCAQSEARYTLLPEGNVAVLNRCLTPEWKWEEARGTATPQVPGKTDKLWV
FT                   EFDNWFSRLLPGATKGDYWVLYVSDDYKTAIVGNPNRRYLWLLSRTKEVNETVREELLS
FT                   KARQQGYDTTRLIWRVSDSAMAKTSK"
FT   gene            complement(457850..459214)
FT                   /gene="hutF"
FT                   /locus_tag="PFL_0398"
FT   CDS_pept        complement(457850..459214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutF"
FT                   /locus_tag="PFL_0398"
FT                   /product="formimidoylglutamate deiminase"
FT                   /EC_number="3.5.3.13"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR02022"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95807"
FT                   /db_xref="GOA:Q4KJP1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJP1"
FT                   /protein_id="AAY95807.1"
FT                   /translation="MSAFFAERALLPDGWANHVRLEVSANGQLTQIQANASADGAERLK
FT                   GPLLPGMPNLHSHAFQRAMAGLAEVAGNPNDSFWTWRDLMYRLVGKINPEQLEVIARQL
FT                   YIEMLKAGYTSVAEFHYVHHDSDGKPYADPAELSRRISQAAAGSGIGLTLLPVLYSHAG
FT                   FGGQAPNDGQRRFINSTENYLKLQQHLQPLLAQQANQQLGLCFHSLRAVTPQQISEVLA
FT                   ASDRHCPVHIHIAEQQKEVDDCLSWSGRRPLQWLYENVAVDQRWCLVHATHANPEEVSL
FT                   MARSRAIAGLCLTTEANLGDGIFPAVDFLAQGGRLGIGSDSHVSLSVVEELRWLEYGQR
FT                   LRDQRRNRLYRADQPMVGRTLYDAALDGGAQALGQGIGALAVGTRADWLVLDGNDPYLA
FT                   TADGDGILNRWLFAGGDRQVRDVMVGGQWVVRDGRHAAEEDSSRAFTQVLRDLLN"
FT   gene            459322..460071
FT                   /gene="hutC"
FT                   /locus_tag="PFL_0399"
FT   CDS_pept        459322..460071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutC"
FT                   /locus_tag="PFL_0399"
FT                   /product="histidine utilization repressor"
FT                   /note="identified by similarity to SP:P12380; similarity to
FT                   SP:P22773; match to protein family HMM PF00392; match to
FT                   protein family HMM PF07702; match to protein family HMM
FT                   TIGR02018"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95808"
FT                   /db_xref="GOA:Q4KJP0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJP0"
FT                   /protein_id="AAY95808.1"
FT                   /translation="MPTPPAKSPLAAHLGDSPAPLYARVKQMITQQIESGNWPPHYRVP
FT                   SESELVNQLGFSRMTINRALREMTAEGMLVRMQGVGTFVAEPKSQSALFEVHNIADEIA
FT                   SRGHRHTCQVITLGEEAAGSERALALDMREGQKVFHSLIVHFENDIPVQIEDRFVNALV
FT                   APEYLKQDFTLQTPYAYLSQVAPLTEGEHVVEAILAEAEECRLLQIERGEPCLLIRRRT
FT                   WSGRQPVTAARLIHPGSRHRLEGRFHK"
FT   gene            460068..460640
FT                   /locus_tag="PFL_0400"
FT   CDS_pept        460068..460640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P24696; match to
FT                   protein family HMM PF05962"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95809"
FT                   /db_xref="GOA:Q4KJN9"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJN9"
FT                   /protein_id="AAY95809.1"
FT                   /translation="MIQLTHLRAADYPRMPWKNGGGSTEEIARDTGDGLDGFGWRLSIA
FT                   DIAESGGFSSFAGYQRVITVLQGAGMQLTIDGEDVRPLLPLDAFAFSGASQVDCTLLEG
FT                   AIRDFNLIYCPQRYVARLQWLDGQQRFFTQAHTLLLFSAAEQAWVDTGSAPVQALGRYD
FT                   CLRLEGNRGLLEVALDGLCCVIELTAR"
FT   gene            461045..462727
FT                   /gene="hutU"
FT                   /locus_tag="PFL_0401"
FT   CDS_pept        461045..462727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutU"
FT                   /locus_tag="PFL_0401"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="identified by similarity to GB:CAA41392.1; match to
FT                   protein family HMM PF01175; match to protein family HMM
FT                   TIGR01228"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95810"
FT                   /db_xref="GOA:Q4KJN8"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJN8"
FT                   /protein_id="AAY95810.1"
FT                   /translation="MTDSKPTKYRNVEIRAARGNKLTAKSWLTEAPLRMLMNNLDPEVA
FT                   ENPKELVVYGGIGRAARNWECYDKIVEALTHLNDDETLLVQSGKPVGVFKTHSNAPRVL
FT                   IANSNLVPHWASWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHY
FT                   DSNLKGRWVLTAGLGGMGGAQPLAATLAGACSLNIECQQTSIDFRLKTRYVDEQATDLD
FT                   DALARIKKYTAEGRAISIALCGNAAEILPELVRRGVRPDMVTDQTSAHDPLNGYLPKGW
FT                   TWEQYRDRAQTEPAAVIKAAKQSMAVHVQAMLDFQKMGVPTFDYGNNIRQMAQEEGVEN
FT                   AFDFPGFVPAYIRPLFCRGIGPFRWAALSGDPQDIYKTDAKVKELIPDDAHLHNWLDMA
FT                   RERISFQGLPARICWVGLGLRAKLGLAFNEMVRSGELSAPIVIGRDHLDSGSVASPNRE
FT                   TESMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGMVIVCDGTDEAA
FT                   ERIARVLHNDPATGVMRHADAGYQIAIDCAKEQGLNLPMITGK"
FT   gene            462857..464326
FT                   /locus_tag="PFL_0402"
FT   CDS_pept        462857..464326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0402"
FT                   /product="permease, cytosine/purine, uracil, thiamine,
FT                   allantoin family"
FT                   /note="identified by match to protein family HMM PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95811"
FT                   /db_xref="GOA:Q4KJN7"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJN7"
FT                   /protein_id="AAY95811.1"
FT                   /translation="MALANDRASNKPLIERRSIDYIPEAERHGRLLSQFTLWLGANLQI
FT                   TAIVTGALAVVLGGDVFWSLIGLLVGQLLGGGVMALHAAQGPQLGLPQMISSRVQFGVY
FT                   GAVIPLVLVCLMYVGFSASGSLLAGQAVAQLLHVEDWAGILLFAGSIMVFTIFGYRVIH
FT                   GIGRIASVLGVVAFIYLFYKLLAGNDIAALLGNKHFSLASFLLAVSLSASWQIAFGPYV
FT                   ADYSRYLPRSTSAAKTFWAVGLGSVIGAQAAMVFGVFAAALAGSQFAHHEVSFIVSLGG
FT                   TGIVAGLLYFAVAFGKVTVTTLNAYGSFMSIATIISGFRGSRHIGSGVRLFYIFIMVSL
FT                   AATLALLGKDSFLKDFSAFILFLLAFFTPWSAINLVDFYCITKERYDIPALSNPDGRYG
FT                   RWNVMGISIYVFGVLIQMPFISTHFYTGPLVASLGDTDISWIIGLVVPAALYYACAKKW
FT                   HGAVPEHLILPVEQGAPTEQKTSGTTRAAAV"
FT   gene            464402..465367
FT                   /gene="hisX"
FT                   /locus_tag="PFL_0403"
FT   CDS_pept        464402..465367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisX"
FT                   /locus_tag="PFL_0403"
FT                   /product="histidine ABC transporter, periplasmic
FT                   histidine-binding protein"
FT                   /note="identified by similarity to GB:AAF78097.1; match to
FT                   protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95812"
FT                   /db_xref="GOA:Q4KJN6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJN6"
FT                   /protein_id="AAY95812.1"
FT                   /translation="MKMHKTLLTTLLSMGLLAASGAQAAGWCESGKAVKFAGLNWESGM
FT                   LLTDVLQLVLEKGYGCKTDSLPGNSITMENALGSNDIQIFAEEWVGRSEVWNKAEKAGK
FT                   VVGVGAPVVGAVEGWYVPRYVIEGDAKRKLEAKAPDLKNIADLGKYASVFKDPEEPSKG
FT                   RFYNCPAGWTCELDNSEMLKSYGLESSYTNFRPGTGPALDAAVLSSYKRGEPILFYYWS
FT                   PTPLMGQVDLVKLDEKPGVDKSVSIKVGLSRVFHDEAPELVAVLEKVNLPIDLLNQNLA
FT                   RMSRERIESPKLAKLFLKEHPEVWHPWVSEEAAGKIDAAL"
FT   gene            465439..466290
FT                   /gene="hisW"
FT                   /locus_tag="PFL_0404"
FT   CDS_pept        465439..466290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisW"
FT                   /locus_tag="PFL_0404"
FT                   /product="histidine ABC transporter, permease protein"
FT                   /note="identified by similarity to GB:AAF78098.1; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95813"
FT                   /db_xref="GOA:Q4KJN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJN5"
FT                   /protein_id="AAY95813.1"
FT                   /translation="MFPESFTFSIADWVNGWVDALVTHYGDVFRHISDTLLWAIVNLEG
FT                   LLRMAPWWLMLAIVGGIAWHATRKLLTTAVIVGLLFLVGAVGLWDKLMQTLALMLVATL
FT                   ISVLIGIPLGILSARSNRLRSVLMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVI
FT                   YAAPPLIRLTDLGIRQVDGEVMEAINAFGANRWQQLFGVQLPLALPSIMAGINQTTMMA
FT                   LSMVVIASMIGARGLGEDVLVGIQTLNVGRGLEAGLAIVILAVVIDRITQAYGRPRHEV
FT                   SK"
FT   gene            466287..467117
FT                   /gene="hisV"
FT                   /locus_tag="PFL_0405"
FT   CDS_pept        466287..467117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisV"
FT                   /locus_tag="PFL_0405"
FT                   /product="histidine ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GB:AAF78099.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95814"
FT                   /db_xref="GOA:Q4KJN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJN4"
FT                   /protein_id="AAY95814.1"
FT                   /translation="MSSAAISKIEVRNVFKIFGSRPADALAMIRQGKGKDQVLAETGCV
FT                   VGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQYDMEAL
FT                   RQFRRHKISMVFQSFGLLPHRNVQDNVAYGLKVRGESKALCAERALHWINTVGLKGYEN
FT                   KYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTI
FT                   VFITHDLDEAVRIGNRIAILKDGRLIQVGTPREILHSPADEYVDRFVQRRAATV"
FT   gene            467198..468721
FT                   /gene="hutH_1"
FT                   /locus_tag="PFL_0406"
FT   CDS_pept        467198..468721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH_1"
FT                   /locus_tag="PFL_0406"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="identified by similarity to SP:P10944; match to
FT                   protein family HMM PF00221; match to protein family HMM
FT                   TIGR01225"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95815"
FT                   /db_xref="GOA:Q4KJN3"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJN3"
FT                   /protein_id="AAY95815.1"
FT                   /translation="MFQAEKIVIADAPLGWQDVVAVARHGAELELSEQAWARIDNAQAI
FT                   VRKVVDSGERAYGISTGLGALCNVLLAGEQLSQLSRNTLLSHACGVGPVLADEQTRAII
FT                   CAAIINYSHGKSGIHRQVVQALLALLNRGITPQVPSQGSVGYLTHMAHIGVALLGVGQV
FT                   SYRGHIVSAEQALAEEGLQAVQLGAKDGLCLVNGTPCMTGLGCLALADASRLLQWADVI
FT                   GAMSFEALRGQIAAFDAEIIALKAHPGMQVVGSNLRALLDRSEVIASSKGIRTQDALSI
FT                   RSIPQVHGAARDQLAHAARQVETELNAATDNPLLLGTPDNYRVVSQANPHGQSVALAAD
FT                   VLAIAMAEIGSIAERRLDRLINPHVSGLPAFLVAEPGVNSGMMIVQYVAASLCAQNRQL
FT                   AQPAVLDNFVTSGLQEDHLSLGTNAALKLLQVLENCTQILAIEYLLAAQAFEFLKEQRF
FT                   GTGTGIAWCLLRERVPAYDQDRWLAPDIASVAALLKDPRLLNKRFSKVQ"
FT   gene            468845..470377
FT                   /gene="hutH_2"
FT                   /locus_tag="PFL_0407"
FT   CDS_pept        468845..470377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH_2"
FT                   /locus_tag="PFL_0407"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="identified by similarity to SP:P21310; match to
FT                   protein family HMM PF00221; match to protein family HMM
FT                   TIGR01225"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95816"
FT                   /db_xref="GOA:Q4KJN2"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJN2"
FT                   /protein_id="AAY95816.2"
FT                   /translation="MTALNLIPGQLTLAQLRAIYQQPLTLTLDGSASAQIDASVACVEQ
FT                   ILAENRTAYGINTGFGLLASTRIASADLENLQRSLVLSHAAGVGEPISDDLVRLIMVLK
FT                   VNSLSRGFSGIRRQVIDALIALINAEVYPHIPLKGSVGASGDLAPLAHMSLVLLGEGKA
FT                   RYKGQWLEATAALEVAGLKPLTLAAKEGLALLNGTQVSTAYALRGLFEGEDLFAGALVC
FT                   GGLTVEAVLGSRSPFDPRIHAARGQRGQIDTAAAYRALLGDSTEVSASHKNCDKVQDPY
FT                   SLRCQPQVMGACLTQLRQAAEVLVVEANAVSDNPLVFAAEGDVISGGNFHAEPVAMAAD
FT                   NMALAIAEIASLSERRISLMMDKHMSQLPPFLVANGGVNSGFMIAQVTAAALASENKAL
FT                   AHPHSVDSIPTSANQEDHVSMAPAAGKRLWEMAENTRGVLAVEWLAACQGLDLREGLKT
FT                   SPTLEKARATLREKVAYYEKDRFFAPDINAASELLASRCLNGLLPARLLPSL"
FT   gene            470534..471946
FT                   /gene="proY"
FT                   /locus_tag="PFL_0408"
FT   CDS_pept        470534..471946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="PFL_0408"
FT                   /product="putative proline-specific permease ProY"
FT                   /note="identified by similarity to SP:P37460; match to
FT                   protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95817"
FT                   /db_xref="GOA:Q4KJN1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJN1"
FT                   /protein_id="AAY95817.2"
FT                   /translation="MQSQDSGLRRGLTARHIRFMALGSAIGTGLFYGSASAIQMAGPAV
FT                   LLAYLIGGAAVFMVMRALGEMAVHNPVSGSFGHYASQYLGPLPGFILGWTYAFEMLIVC
FT                   LADVTAFGIYMGFWFPEVARWIWVLGIVLFIGGLNLCNVKVFGEMEFWLSLLKVGAIVA
FT                   MILGGLGIMLFGISSAAQDQATGAANLWAHGGFMPNGISGVIASFAVVMFAFGGIEIIG
FT                   VTAGEAQDPKRVIPKAINAVPLRILLFYVLTLFVLMSIFPWPQIGTQGSPFVQIFDSLG
FT                   ISSAATILNIVVISAAVSAINSDIFGAGRMMYGLARQGQAPKGFAQVSKHGVPWMTVVV
FT                   MAVTLLIGVVLNYLIPENIFLLIASLATFATVWVWLMILLTHVAMRRSMTAEQVAQLQF
FT                   KVPFWPWAPAAAIAFMLFIFGVLGYFPKTQGALIVGVVWIALLVVAYMLWVKPMAGQAQ
FT                   AIMSDAPLPTDH"
FT   gene            471957..473162
FT                   /gene="hutI"
FT                   /locus_tag="PFL_0409"
FT   CDS_pept        471957..473162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutI"
FT                   /locus_tag="PFL_0409"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969; match to protein
FT                   family HMM TIGR01224"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95818"
FT                   /db_xref="GOA:Q4KJN0"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJN0"
FT                   /protein_id="AAY95818.1"
FT                   /translation="MKTLWQHCNVASMASGVYSIIEDAAMVTSGAHIEWIGRRSEAPAG
FT                   DYAQVNDLAGAWVTPGFIDCHTHTVFGGNRSGEFEQRLQGVSYAEIAAAGGGIASTVRA
FT                   TRAATEEELFGSARKRLLSLLRDGVTSVEIKSGYGLDLASERKILRVIRRLGEELPVSV
FT                   RSTCLAAHALPPEYAERSDAYIEHICSDMLPALAAEGLVDAVDAFCEYLAFSPEQVERV
FT                   FIAAQQLGLPVKLHAEQLSSLHGSSLAARYHALSADHLEFMTEEDAIAMAASGTVAVLL
FT                   PGAFYFLRETQQPPMEALRKHGVKIAVASDLNPGTSPALSLRLMLNMACTCFRMTPEEA
FT                   LAGVTLHAAQALGMEKTHGSLEVGKVADFVAWQIDRPADLAYWLGGDLEKRVVRHGVEV
FT                   TV"
FT   gene            473173..473973
FT                   /gene="hutG_2"
FT                   /locus_tag="PFL_0410"
FT   CDS_pept        473173..473973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutG_2"
FT                   /locus_tag="PFL_0410"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /EC_number="3.5.1.68"
FT                   /note="identified by match to protein family HMM PF05013;
FT                   match to protein family HMM TIGR02017"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95819"
FT                   /db_xref="GOA:Q4KJM9"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJM9"
FT                   /protein_id="AAY95819.1"
FT                   /translation="MDKVLNFKQGRVPLLISMPHAGTRLTPAVAAGLVPQAQSLPDTDW
FT                   HIPRLYQFAQELGASTLAAEYSRFVIDLNRPSDDKPLYVGATTGLYPATLFDGEPLFVE
FT                   GQAPSSEEREQYLHEVWGPYHRTLQEELARLKAEFGYALLFDAHSIRSLIPHLFEGKLP
FT                   DFNLGTFNGASCDPQLASRLEEICAGHGGYTHVLNGRFKGGHITRHYGNPAEHIHAVQL
FT                   ELAQSAYMEEFEPFRYREDLAAPTQVVLKELLQGLLAWGQERYA"
FT   gene            474176..475147
FT                   /gene="pip"
FT                   /locus_tag="PFL_0411"
FT   CDS_pept        474176..475147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="PFL_0411"
FT                   /product="prolyl aminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01249"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95820"
FT                   /db_xref="GOA:Q4KJM8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJM8"
FT                   /protein_id="AAY95820.1"
FT                   /translation="MQTLYPQIKPYARHDLAVDEPHVLYVDESGSPEGLPVVFIHGGPG
FT                   AGCDGASRCYFDPNLYRIVTFDQRGCGRSTPHASLENNTTWDLVADLERIRQHLGIDKW
FT                   VLFGGSWGSTLALAYAQTHPERVLGLIVRGIFLARPQEIQWYYQCGASRLFPDYWQDYV
FT                   APIPLEERHDLVSAFHKRLTGTDQIAQMHAAKAWSGWEGRTATLRPNPLVVDRFSEPQR
FT                   ALSIARIECHYFTNNAFLEPDQLIRDMGKIAHLPGVIVHGRYDVICPLDNAWELHQAWP
FT                   NSELQVIRDAGHAASEPGITDALVRATDQMARRLLDLPPEEA"
FT   gene            475144..475581
FT                   /gene="dtd"
FT                   /locus_tag="PFL_0412"
FT   CDS_pept        475144..475581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="PFL_0412"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to SP:P32147; match to
FT                   protein family HMM PF02580; match to protein family HMM
FT                   TIGR00256"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95821"
FT                   /db_xref="GOA:Q4KJM7"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJM7"
FT                   /protein_id="AAY95821.1"
FT                   /translation="MKGLLQRVRGARVEVAGDIVGAVDQGLLVLVAVEPEDTRASADKL
FT                   LHKLLNYRVFSDAEGKMNLSLADVQGGLLLVSQFTLAADTKSGLRPSFSTAAPPALGEE
FT                   LFDYLVVKAQQLHGKVASGRFGADMQVHLVNDGPVTFLLQT"
FT   gene            475858..477690
FT                   /gene="mdoG"
FT                   /locus_tag="PFL_0413"
FT   CDS_pept        475858..477690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdoG"
FT                   /locus_tag="PFL_0413"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="identified by similarity to SP:P33136; match to
FT                   protein family HMM PF04349"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95822"
FT                   /db_xref="GOA:Q4KJM6"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJM6"
FT                   /protein_id="AAY95822.1"
FT                   /translation="MIVSPCNAPNLFAKRLRNALVTGSALVCLLGAGQLMAFNLDDVSV
FT                   KAKDLAGQKYEAPRSNLPNEFREMKFADYQKIRFLTEKAEWADQKTPFKLSFYHQGMHF
FT                   DTPVKINEISANTVTEIKYDPNRFDFGDVKFDPKATEKLGYAGFRVLYPINKADKQDEI
FT                   MTMLGASYFRVVGKGHTYGLSARGLAIDTALPSGEEFPRFSEFWIQQPKATDKHLVIYA
FT                   LLDSPRATGAYRLTLRPGADTIVDVKARVFLRDKVGKLGLAPLTSMYLFGANQPSKVLN
FT                   YRRELHDSSGLSIHAGNGEWIWRPLNNPKHLAVSNFSVENPRGFGLLQRGRDFSHYEDL
FT                   DDRYDKRPSAWIEPKGDWGKGTVDLVEIPTADETNDNIVAFWNPEKQPEPGQPLDFAYR
FT                   LHWTIDEAALHSPDSAWVQQTLRSTGDVKQSNLIRQPDGSVAYLVDFEGPSLAALPENA
FT                   DVRSQVSVGDNAELVENSVRYNPETKGWRLTLRMKIKDASKSTEMRAALVRDIAQPEPA
FT                   KASTPNSNSSIAKADKIAAKQQEKKEKEAAAAAAKQAQAQPGKEAKDAKNAKDKDHKDA
FT                   KQPAAADAAPATPEPVKTEQVLTETWSYQLPADE"
FT   gene            477683..480253
FT                   /gene="mdoH"
FT                   /locus_tag="PFL_0414"
FT   CDS_pept        477683..480253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdoH"
FT                   /locus_tag="PFL_0414"
FT                   /product="glucans biosynthesis glucosyltransferase H"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by similarity to SP:P62517; match to
FT                   protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95823"
FT                   /db_xref="GOA:Q4KJM5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJM5"
FT                   /protein_id="AAY95823.1"
FT                   /translation="MSNSQLQPESLAEYLAHLPMSDQQRAELAGCQSFSELHQRLSSST
FT                   FDGPTDAAQASVGQRLTLSTAAELEEAEMLAVDAEGRVCLKATPPIRRTKVVPEPWRTN
FT                   ILVRGWRRLTGRTNPPAPKKDERVLPAARWRTVGSIRRYILLVLMLGQTIVAGWYMKGI
FT                   MPYQGWSFVDLEEVMHQPLMQTAQQVLPYALQTSILILFGILFCWVSAGFWTALMGFLE
FT                   LLTGHDKYRISGASAGNEPIPKDARTALVMPICNEDVPRVFAGLRATFESVAATGDLDR
FT                   FDFFVLSDSNDSDICVAEQQAWLDVCREAKGFGKIFYRRRRRRVKRKSGNLDDFCRRWG
FT                   GDYKYMVVLDADSVMSGECLTSLVRLMEATPDAGIIQTAPRASGMDTLYARMQQFATRV
FT                   YGPLFTAGLHFWQLGESHYWGHNAIIRMQPFIEHCALAPLPGKGAFAGAILSHDFVEAA
FT                   LMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRWCHGNLMNFRLFLVKGMHPVHRAV
FT                   FLTGVMSYLSAPLWFFFLVLSTALLAVNTLMEPQYFLEPRQLYPLWPQWHPDKAIALFS
FT                   TTIVLLFLPKLLSIILIWAKGAKEFGGKFKVTLSMLLEMLFSMLLAPVRMIFHTRFVLA
FT                   AFLGWAATWNSPQRDDDSTPWSEAVKRHGPQTLLGFCWALLVIWLNPSFLWWLVPIVGS
FT                   LMLSIPVSVISSRVGLGLKSRDESLFLIPEEYAPPQALLATDQYTHENRWHALNDGFVR
FT                   AVVDPQQNALACALATSRHTQAEPIEWLRQERVRHALKVGPAALNNSERLALLSDPVAL
FT                   GRLHEQVWSEGHSEWLSAWRQSVDADPHAPLLPLQPLNAAPQPA"
FT   gene            480513..481310
FT                   /locus_tag="PFL_0415"
FT   CDS_pept        480513..481310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0415"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /note="identified by similarity to SP:P30860; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95824"
FT                   /db_xref="GOA:Q4KJM4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJM4"
FT                   /protein_id="AAY95824.1"
FT                   /translation="MKKYLSLLLAGATALLAVNTAQAGAIDDAVKRGTLKVGMDPTYMP
FT                   FEMTNKRGEIIGFEVDLLKAMAKSMGVKLEMVSTGYDGIIPALLTDKFDMIGSGMTLTQ
FT                   ERNLRLNFSEPFIVVGQTLLIRKDLEGTIKSYKDLNSADYRITSKLGTTGEMVAKKLIA
FT                   KAKYHGYDNEQEAVLDVVNGKADAFIYDAPYNVVAVNKVGNGKLVFLDKPFTYEPLAFG
FT                   LKKGDYDSINFINNFLHQIHEDGTYDRIHDKWFKSTEWLKDME"
FT   gene            481456..482418
FT                   /locus_tag="PFL_0416"
FT   CDS_pept        481456..482418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0416"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95825"
FT                   /db_xref="GOA:Q4KJM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJM3"
FT                   /protein_id="AAY95825.1"
FT                   /translation="MNKHKKAQWPWHVLTVLVLIGLAGALYYATSLMSYEWRWNRVPQY
FT                   FAYQAEESQRAAEISTVAEVVRQGGKAQVTLRGDSGAEQHLSVDESSLQVASGDDVAEG
FT                   DVIGVTRHWAAGPLLWGLWTTLWLSVVSGVLGLLIGLGTGLCRLSSNPTLRDLSTIYVE
FT                   LVRGTPLLVQIFIFYFFIGTVLNLSREFAGIAALSLFTGAYVAEIVRAGVQSIARGQNE
FT                   AARSLGLSAGQSMRHVVLPQAFKRVLPPLAGQFISLVKDTSLVSVIAITELLKSGREVI
FT                   TTSFSPFEILFCVAGLYLLINLPLSKMASRLERRLAQSD"
FT   gene            482411..483145
FT                   /locus_tag="PFL_0417"
FT   CDS_pept        482411..483145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0417"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P0AAG3; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95826"
FT                   /db_xref="GOA:Q4KJM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJM2"
FT                   /protein_id="AAY95826.2"
FT                   /translation="MIEVRDLVKVFDTRGQVVRAVDNVTTQVAKGEVLVVIGPSGSGKS
FT                   TFLRCLNGLEEFDSGSVSIDGLQLADPRTDVNAYRREVGMVFQHFNLFPHMTVLENLCL
FT                   AQKVVRKRGKQEREAKALALLEKVGIAQKAHEFPSRLSGGQQQRVAIARALAMEPKVML
FT                   FDEPTSALDPEMVGEVLDVMKTLALEGMTMVCVTHEMGFAREVADRVLFFDHGKLLEDA
FT                   APQVFFDAPQDPRAQAFLRQVL"
FT   gene            complement(483195..485111)
FT                   /locus_tag="PFL_0418"
FT   CDS_pept        complement(483195..485111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0418"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95827"
FT                   /db_xref="GOA:Q4KJM1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJM1"
FT                   /protein_id="AAY95827.1"
FT                   /translation="MYRWLARNLGNVSVSLKLGIGFGLVLLLTLLITATGWTGLGRVID
FT                   RGDKLGNISVIYALTKDLRIARLNYEMSRGEHGPAAVNDFLKQLDDGLQDARAQLQQPE
FT                   SITMVDQQLDAVAEYQKAFADMTRATANREAARSQLGATADNAVARVAEVENSLLQGDS
FT                   VAQFNSVIDLSKLIQQARFQVRGYTYSAKPEAKQPALDAIDNALNNLTSLPSRLPEQHV
FT                   ANLQQASDSLKAYRMAVSAYSDAEEASAAALKRMAAQGDRLMDLSKQLTVAQTTKRDSD
FT                   AAQAKSTLLIATLLAMLFGLIAAWAITRQITQPLQQTLKAAERVASGDLSQNLAVERRD
FT                   ELGQLQKAMQRMTVSLRELIGGISDGVTQIASAAEQLSAVTEQTSAGVNSQKVETDQVA
FT                   TAMNEMAATVQEVARNAEEASEAAVAADQQAREGDRVVNEAIAQIERLASEVGHSTEAM
FT                   GHLKQESDKIGSVLDVIKSVAQQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLAQRT
FT                   QQSTEEIAELIVGLQSGTQQVASTLDTSRSLTDSSVELTRRAGGSLENITRTVSAIQAM
FT                   NQQIAAAAEQQSAVAEEINRSVLNVRDVSEQTSSASEETAASSAELARLGIHLQSLVGR
FT                   FRV"
FT   gene            complement(485249..485956)
FT                   /locus_tag="PFL_0419"
FT   CDS_pept        complement(485249..485956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0419"
FT                   /product="RNA methyltransferase, RsmE family"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95828"
FT                   /db_xref="GOA:Q4KJM0"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJM0"
FT                   /protein_id="AAY95828.1"
FT                   /translation="MNLLLLEEADFIAADRVVLRDRRLTHMQDVHRVAVGDSLRVGRIG
FT                   GLMGSAQVLRLEPAEAELQVTLDQPPPAKLPLTLVLALPRPKMLRRVFQTIATMGVPRL
FT                   VLVNSYRVEKSFWQTPFLEPETIREHLVLGLEQARDTVLPDVLIEKRFKPFVEDRLPAL
FT                   SAGTLGLVGHPGPYPPCPRGLDQAVTLAIGPEGGWIPYEIDLLGKAGLQPVQLGERILR
FT                   VETAVTALLSRLF"
FT   gene            complement(485953..486747)
FT                   /gene="tatC"
FT                   /locus_tag="PFL_0420"
FT   CDS_pept        complement(485953..486747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="PFL_0420"
FT                   /product="twin arginine-targeting protein translocase TatC"
FT                   /note="identified by match to protein family HMM PF00902;
FT                   match to protein family HMM TIGR00945"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95829"
FT                   /db_xref="GOA:Q4KJL9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJL9"
FT                   /protein_id="AAY95829.1"
FT                   /translation="MSDIPENDQHMPLVSHLTELRTRLLRCVAAIFIIFAGLFAFTQQI
FT                   YTIVSTPLRQYLPVGATMIATDVASPFLTPLKLTMMVSLFLAIPVILHQIWGFIAPGLY
FT                   KHEKRIAVPLLVSSILLFYIGMAFAYFLVFPLIFKFFAAATPAGVEMMTDITSYLDFVM
FT                   TLFFAFGVAFEIPVAVVLLVWIGVVNVAYLRKIRPYVIIGCFVVGMILTPPDIFSQTLL
FT                   AVPMWLLFEIGVLFGGLISKRGEHPDDEPADDHNDQPPATQA"
FT   gene            complement(486744..487202)
FT                   /gene="tatB"
FT                   /locus_tag="PFL_0421"
FT   CDS_pept        complement(486744..487202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="PFL_0421"
FT                   /product="twin arginine-targeting protein translocase TatB"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01410"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95830"
FT                   /db_xref="GOA:Q4KJL8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJL8"
FT                   /protein_id="AAY95830.1"
FT                   /translation="MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWVGRLKRSFNA
FT                   IKQEVEREIGADEIRRQLHNEHILSLEQEARKILAPTQQQPTPVEPVAEQTIHAPGAAT
FT                   VAEAPPASEVPAPLPSTPAPAPTAEPAAPVATPATTAPHDSTLPPRAP"
FT   gene            complement(487213..487494)
FT                   /gene="tatA"
FT                   /locus_tag="PFL_0422"
FT   CDS_pept        complement(487213..487494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="PFL_0422"
FT                   /product="twin arginine-targeting protein translocase,
FT                   TatA/E family"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95831"
FT                   /db_xref="GOA:Q4KJL7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJL7"
FT                   /protein_id="AAY95831.1"
FT                   /translation="MGIFDWKHWIVILVVVVLVFGTKKLKNLGTDVGESIKGFRKAMND
FT                   DEKPAEPVVPPAAQPVPPVQPQQSAPLNQPHTIDVQAQKVEEPTRKDS"
FT   gene            complement(487520..487852)
FT                   /gene="hisE"
FT                   /locus_tag="PFL_0423"
FT   CDS_pept        complement(487520..487852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="PFL_0423"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /note="identified by match to protein family HMM PF01503;
FT                   match to protein family HMM TIGR03188"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95832"
FT                   /db_xref="GOA:Q4KJL6"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJL6"
FT                   /protein_id="AAY95832.1"
FT                   /translation="MSDTLTRLAQVLEERKDAAADSSYVASLYHKGLNKILEKVGEESV
FT                   ETIIAAKDAAISGDCSDVIYETADLWFHTLVMLAQLGQHPQAVLDELDRRFGLSGHAEK
FT                   ASRPSA"
FT   gene            complement(487854..488246)
FT                   /gene="hisI1"
FT                   /locus_tag="PFL_0424"
FT   CDS_pept        complement(487854..488246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI1"
FT                   /locus_tag="PFL_0424"
FT                   /product="phosphoribosyl-AMP cyclohydrolase 1"
FT                   /EC_number="3.5.4.19"
FT                   /note="identified by match to protein family HMM PF01502"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95833"
FT                   /db_xref="GOA:Q4KJL5"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJL5"
FT                   /protein_id="AAY95833.1"
FT                   /translation="MKDWLDQIKWDADGLVPAIAQDHKTGRVLMMAWMNREALSLTAAE
FT                   NRAIYWSRSRGKLWRKGEESGHVQKLHEMRLDCDADVIILMVEQIGDIACHTGRHSCFY
FT                   RVYEDGEWKTVEPVLKDPHAIYSAGH"
FT   gene            complement(488327..489931)
FT                   /gene="ubiB"
FT                   /locus_tag="PFL_0425"
FT   CDS_pept        complement(488327..489931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="PFL_0425"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="identified by match to protein family HMM PF03109;
FT                   match to protein family HMM TIGR01982"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95834"
FT                   /db_xref="GOA:Q4KJL4"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJL4"
FT                   /protein_id="AAY95834.1"
FT                   /translation="MKLLAVRRLLRIQRVVIRYRLDDLLFDLPLPWFLLALRFALPWRW
FT                   FPRKPLDLSRGARLRLALQDLGPIFIKFGQILSTRRDLLPEDIADELMLLQDRVPPFDS
FT                   QKSVALIEAQLGKKISDVFSRFDIEPLASASVAQVHAAKLKTGEEVVVKVIRPGLKPII
FT                   AQDLAWLFILARAAEKLSADARLLHPVDVVSDYEKTIYDELDLLREAANASQLKRNFEG
FT                   SPLLYVPQVYWDWCRPKVLVMERIYGIQVTDLATLADQRTDMKMLAERGVEIFFTQVFR
FT                   DSFFHADMHPGNIFVSTVQPWSPQYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRV
FT                   AQLHIDSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQ
FT                   PQLVLLQKTLLNIEGLGRQLYPDLDLWNTAQPFLERWMRERVSPKAVLGNIHSQIEQLP
FT                   HLANMTRDLLERMSQPHAADPPAPWHKRKDDWFLRLLGTAHLGGGAVLAAGGPLHELGH
FT                   WPAGIMIAVGLYLIVRR"
FT   gene            complement(489928..490551)
FT                   /locus_tag="PFL_0426"
FT   CDS_pept        complement(489928..490551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0426"
FT                   /product="SCP-2 sterol transfer family protein"
FT                   /note="identified by match to protein family HMM PF02036"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95835"
FT                   /db_xref="GOA:Q4KJL3"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJL3"
FT                   /protein_id="AAY95835.1"
FT                   /translation="MLLSGLLASVETGINRVLRLDSTALPRLQHLNGKVIAVECRNPAL
FT                   QLFILPSDEGLMLASQWATDPDCTLRAPASSLLRLALSKDKTAVLHGPEVELEGDSGVL
FT                   LDLAATLQDLELDWEYELSRWLGPVATQLFSGHVRSRARWYQQGFASLNQNLAEFLAEE
FT                   SRTLVGQREAEARFRELDQAKLDLERLEARLERLSRSLDPSDNA"
FT   gene            complement(490551..491321)
FT                   /gene="ubiE"
FT                   /locus_tag="PFL_0427"
FT   CDS_pept        complement(490551..491321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="PFL_0427"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01135;
FT                   match to protein family HMM PF01209; match to protein
FT                   family HMM PF08241; match to protein family HMM PF08242;
FT                   match to protein family HMM TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95836"
FT                   /db_xref="GOA:Q4KJL2"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJL2"
FT                   /protein_id="AAY95836.2"
FT                   /translation="MTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMN
FT                   DVLSGGMHRLWKRFTIELSGVRAGNRVLDIAGGTGDLTKRFSHLVGPTGQVVLADINES
FT                   MLKVGRDRLLDLGVAGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLR
FT                   VLKPGGRLLVLEFSKPTNALMSKVYDAYSFAFMPLAGKLITNDSESYRYLAESIRMHPN
FT                   QETLKSMMVEAGFDRVTYHNMTAGIVALHRGIKP"
FT   gene            491477..491752
FT                   /locus_tag="PFL_0428"
FT   CDS_pept        491477..491752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0428"
FT                   /product="putative polyhydroxyalkanoic acid system protein"
FT                   /note="identified by match to protein family HMM PF09650;
FT                   match to protein family HMM TIGR02610"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95837"
FT                   /db_xref="GOA:Q4KJL1"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJL1"
FT                   /protein_id="AAY95837.1"
FT                   /translation="MARISVERAHGLGKQAAREKADKLAQKLADQYGLEPQWAGDTLNL
FT                   KRSGVKGAVHVGEESIRIDVELGMLMSAMSGTIKSEIEKALDKALV"
FT   gene            491876..492298
FT                   /gene="phaI"
FT                   /locus_tag="PFL_0429"
FT   CDS_pept        491876..492298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaI"
FT                   /locus_tag="PFL_0429"
FT                   /product="poly(3-hydroxyalkanoate) granule-associated
FT                   protein PhaI"
FT                   /note="identified by similarity to GB:BAB78724.1; match to
FT                   protein family HMM PF05597; match to protein family HMM
FT                   TIGR01837"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95838"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJL0"
FT                   /protein_id="AAY95838.1"
FT                   /translation="MAKVILKKKVDAQSTALSEVKSYARKIWLAGLGAYAKVGQEGSEY
FT                   FQELIKAGQSVEKKGKKVVTEQLEAANSQIDGVKGDVSTLKGKVEVQLDKVEKAFDTRV
FT                   ASALNRIGIPSKHDVETLSAKLDELTALLERVARKH"
FT   gene            492309..493181
FT                   /gene="phaF"
FT                   /locus_tag="PFL_0430"
FT   CDS_pept        492309..493181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaF"
FT                   /locus_tag="PFL_0430"
FT                   /product="poly(3-hydroxyalkanoate) granule-associated
FT                   protein PhaF"
FT                   /note="See Prieto et. al. 1999 (PMID: 9922249); identified
FT                   by similarity to GB:BAB78723.1; similarity to
FT                   GB:CAA09109.1; match to protein family HMM PF05597; match
FT                   to protein family HMM TIGR01837"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95839"
FT                   /db_xref="GOA:Q4KJK9"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJK9"
FT                   /protein_id="AAY95839.1"
FT                   /translation="MAGKKNTEKEGSSWIGKVEEYSRKIWLAGLGVYSKIDSDGSKLFE
FT                   TLVKDGEKAEKLTKSVVGKKVDAAKDSATSAKSRISDVKDRALGKWDELEGAFDKRLNS
FT                   AISRLGVPSRNEVKALHDKVDTLTKQIEKLTGAKVAPVAAKTAAAKPAAKPAAKPLAKP
FT                   AAKPVAKAAAKPAAKPAAKTAAAKPAAKPAAKPVAAKPAAKPAAKPAAKTAAAKPAAKP
FT                   AAKPAVAKKPVAKKPVAAKPAAKPAAKPAVAAKPAAPAPASSANSAAAPSPAATPTAAP
FT                   APATPSSQS"
FT   gene            complement(493243..493863)
FT                   /gene="phaD"
FT                   /locus_tag="PFL_0431"
FT   CDS_pept        complement(493243..493863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaD"
FT                   /locus_tag="PFL_0431"
FT                   /product="transcriptional regulator PhaD"
FT                   /note="identified by similarity to GB:BAB78722.1; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95840"
FT                   /db_xref="GOA:Q4KJK8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJK8"
FT                   /protein_id="AAY95840.1"
FT                   /translation="MKTRDRILECALQLFNQKGEPNVSTMEVANEMGISPGNLYYHFHG
FT                   KEPLVLGLFERFQNELTPLLDPPSDVQLAAEDYWLFLHLIVERLAHYRFLFQDLSNLAG
FT                   RLPKLAKGIRNLLNALKRTLASLLARLKAQGQLVSGTQALGQLVEQITMTLLFSLDYQR
FT                   ILDREGEVRLVVYQIMMLVAPHLLPPAKMATEQMALRYLDEQG"
FT   gene            complement(493929..495611)
FT                   /gene="phaC"
FT                   /locus_tag="PFL_0432"
FT   CDS_pept        complement(493929..495611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaC"
FT                   /locus_tag="PFL_0432"
FT                   /product="poly(3-hydroxyalkanoate) synthase 2"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by similarity to GB:BAB78721.1; match to
FT                   protein family HMM PF00561; match to protein family HMM
FT                   PF07167; match to protein family HMM TIGR01839"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95841"
FT                   /db_xref="GOA:Q4KJK7"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJK7"
FT                   /protein_id="AAY95841.1"
FT                   /translation="MQDKPATGSLPSPAAYINAQSAITGLRGRDLFSTLRSLAAHSLRN
FT                   PLHSARHTLALGGQLGRVLLGETLHKTNPKDNRFADPAWSLNPFYRRGLQAYLSWQKQV
FT                   RHWIDDSGMSEDDRARAHFAFSLLNDAVAPSNTLLNPLALKEIFNTGGNSVVRGIGNLL
FT                   DDLLHNNGLPSQVTKHAFEVGKNLAVTPGSVVFRNELLELIQYSPMSEKQYAKPLLIVP
FT                   PQINKYYIFDLSPTNSFVQYALKNGLQVFMVSWRNPDVRHREWGLSTYVEAAEEALNVT
FT                   RAITGSREVNLVGACAGGLTIAALQGHLQAKRQLRRVSSATYMVSLLDSQMDSPATLFA
FT                   DEKTLEAAKRRSYQQGVLDGRDMAKVFAWMRPNDLIWNYWVNNYLLGKEPPVFDILYWN
FT                   NDSTRLPAALHGDLLDFFKHNPLSHVGGLEVCGTPIDLQKVTVDSFSVAGINDHITPWD
FT                   AVYRSTLLLGGERRFVLSNSGHVQSILNPPSNPKANYVENRKLSSDPRAWYYDAEHVDG
FT                   SWWSQWLTWVQERSGAQRETLTTLGNQNYPPMEAAPGTYVRVR"
FT   gene            complement(495720..496580)
FT                   /gene="phaZ"
FT                   /locus_tag="PFL_0433"
FT   CDS_pept        complement(495720..496580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaZ"
FT                   /locus_tag="PFL_0433"
FT                   /product="poly(3-hydroxyalkanoate) depolymerase"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR02240"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95842"
FT                   /db_xref="GOA:Q4KJK6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR011942"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJK6"
FT                   /protein_id="AAY95842.1"
FT                   /translation="MPHSFIFRTVDLDGQTIRTAVRPGKPHLTPLLIFNGIGANLELVF
FT                   PFVQALDPDLEVIAFDVPGVGGSSTPSRPYRFPGLAKLTARMLDYLDYGQVNAVGVSWG
FT                   GALAQQFAYDYPERCKKLVLAATAAGAFMVPGKPKVLWMMASPRRYVQPSHVMRIAPLI
FT                   YGGSFRRDPSLAAEHAAKVRSAGKLGYYWQLFAGLGWTSIHWLHKIHQPTLVLAGDDDP
FT                   LIPLINMRMLAWRIPNAQLHIIDDGHLFLITRAEAVAPIIMKFLQEERQRAVMHPHPEP
FT                   VRPTK"
FT   gene            complement(496711..498390)
FT                   /gene="phaA"
FT                   /locus_tag="PFL_0434"
FT   CDS_pept        complement(496711..498390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaA"
FT                   /locus_tag="PFL_0434"
FT                   /product="poly(3-hydroxyalkanoate) synthase 1"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by similarity to SP:P26494; match to
FT                   protein family HMM PF00561; match to protein family HMM
FT                   PF07167; match to protein family HMM TIGR01839"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95843"
FT                   /db_xref="GOA:Q4KJK5"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJK5"
FT                   /protein_id="AAY95843.1"
FT                   /translation="MSNKNNDDLKRQASENTLGLNPVIGLRRKDLLTSARMVLAQAIKQ
FT                   PIHSVKHVAHFGIELKNVMFGKSTLQPESDDRRFNDPAWSQNPLYKRYLQTYLAWRKEL
FT                   HDWIDDSSLSEQDISRGHFVINLMTEAMAPTNSAANPAAVKRFFETGGKSLLDGLSHLA
FT                   KDLVHNGGMPSQVNMDAFEVGKNLGTSEGAVVFRNDVLELIQYRPITEQVHERPLLVVP
FT                   PQINKFYVFDLSPDKSLARFCLRNNVQTFIVSWRNPTKAQREWGLSTYIEALKEAVDVV
FT                   TAITGSKDVNMLGACSGGITCTALLGHYAALGQKKVNALTLLVSVLDTTLDTQVALFVD
FT                   EQTLEAAKRHSYQAGVLEGRDMAKVFAWMRPNDLIWNYWVNNYLLGNEPPVFDILFWNN
FT                   DTTRLPAAFHGDLIEMFKNNPLVRANALEVCGTPIDLKQVTADIFSLAGTNDHITPWKS
FT                   CYKSAQLFGGNVEFVLSSSGHIQSILNPPGNPKARYMTSTDIPACPDQWQENSIKHTDS
FT                   WWLHWQAWQAERSGDLKPAPTSLGNKKYAAAEAAPGTYVHER"
FT   gene            complement(498648..499025)
FT                   /locus_tag="PFL_0435"
FT   CDS_pept        complement(498648..499025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06155"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95844"
FT                   /db_xref="GOA:Q4KJK4"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJK4"
FT                   /protein_id="AAY95844.1"
FT                   /translation="MSKLPTGINLHKASKTLTLTYGPDEVYHLPAELLRVHSPSAEVQG
FT                   HGKPILQFGKLGVGLTKVEPAGQYALKLTFDDGHDSGLFTWDYLYQLALRQDELWNDYL
FT                   AELKAAGKSRDPNESIVKLML"
FT   gene            complement(499117..500457)
FT                   /gene="hslU"
FT                   /locus_tag="PFL_0436"
FT   CDS_pept        complement(499117..500457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="PFL_0436"
FT                   /product="ATP-dependent protease HslVU, ATPase subunit"
FT                   /note="identified by match to protein family HMM PF07724;
FT                   match to protein family HMM TIGR00390"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95845"
FT                   /db_xref="GOA:Q4KJK3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJK3"
FT                   /protein_id="AAY95845.1"
FT                   /translation="MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRV
FT                   EVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLAD
FT                   AAIKMFREQEMIRVRHRAEDAAEERILDALLPQARTGFNSDDAAPAQDSNTRQLFRKRL
FT                   REGQLDDKEIEIEVAEAAGVDISAPPGMEEMTNQLQSLFANMGKGKRKNRKLKVKEALK
FT                   LVRDEEASRLVNDEELKAKALEAVEQHGIVFIDEIDKVAKRGNAGGVDVSREGVQRDLL
FT                   PLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFE
FT                   RILSEPHASLTEQYRELLKTEGLNIEFLPEGIKRLAEIAWQVNEKTENIGARRLHTLLE
FT                   RLLEEVSFSAGDLASAHSEEPIRIDAAYVNSHLGELAQNEDLSRYIL"
FT   gene            complement(500515..501045)
FT                   /gene="hslV"
FT                   /locus_tag="PFL_0437"
FT   CDS_pept        complement(500515..501045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="PFL_0437"
FT                   /product="ATP-dependent protease HslVU, peptidase subunit"
FT                   /EC_number="3.4.25.-"
FT                   /note="identified by match to protein family HMM PF00227;
FT                   match to protein family HMM TIGR03692"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95846"
FT                   /db_xref="GOA:Q4KJK2"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJK2"
FT                   /protein_id="AAY95846.1"
FT                   /translation="MTTIVSVRRHGKVVMGGDGQVSLGNTVMKGNAKKVRRLYHGQVIA
FT                   GFAGATADAFTLFERFEGQLEKHQGHLVRAAVELAKEWRTDRSLSRLEAMLAVANKDAS
FT                   LIITGNGDVVEPEDGLIAMGSGGAYAQAAASALLKKTDLSAREIVETALGIAGDICVFT
FT                   NHTQTIEEQDLAE"
FT   gene            complement(501244..501951)
FT                   /locus_tag="PFL_0438"
FT   CDS_pept        complement(501244..501951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0438"
FT                   /product="sporulation and cell division repeat protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95847"
FT                   /db_xref="GOA:Q4KJK1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJK1"
FT                   /protein_id="AAY95847.1"
FT                   /translation="MAAKKKPAPKRGASRYQAPAKKPIPGWLWLAIGLTIGAFIVFLMK
FT                   LEPGKGGDSVKREKIEQQKATKIAEANKTPPSPQQPVKPKYDFYTLLPESEVIVPPEAV
FT                   PEKTLPTPQVPPVPTTPVTPAEAAKIDTARAQAALAGITPPPAPPVAKAAPVTKFFLQA
FT                   GSFRKEADADKVRAQIILLGQSVSVESGTVKDETWYRVLVGPFSNREQLTVAQKQLAGA
FT                   GFSNLLLQQRQSR"
FT   gene            complement(501953..503689)
FT                   /gene="argS"
FT                   /locus_tag="PFL_0439"
FT   CDS_pept        complement(501953..503689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="PFL_0439"
FT                   /product="arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by similarity to SP:P11875; match to
FT                   protein family HMM PF00750; match to protein family HMM
FT                   PF03485; match to protein family HMM PF05746; match to
FT                   protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95848"
FT                   /db_xref="GOA:Q4KJK0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJK0"
FT                   /protein_id="AAY95848.1"
FT                   /translation="MKDTIRQLIQQAITQLVTEGVLPEGLTPAIQVENTRDKTHGDFAS
FT                   NIAMMLAKPAGMKPRDLAEKIIAALPAHEDLSKAEIAGPGFINFFQNTQALAARLDAAL
FT                   GDDHLGVRKAGPAQRTVIDMSAPNLAKEMHVGHLRSTIIGDGVARVLEFLGDTVIRQNH
FT                   VGDWGTQFGMLMAYLEENPITSDELSDLENFYRAAKQRFDESEAFADRARGLVVKLQAG
FT                   DPDCLELWTKFKDISLSHCQKIYELLNVKLTMADVMGESAYNDDLINVVNDLKAQGLLV
FT                   ESNGAQCVFLDEFKNAEGEPLPVIIVKADGGYLYATTDLAAVRYRSGKLKADRALYFVD
FT                   QRQALHFQQVFAVARKAGFVTHPMEMEHMGFGTMNGADGRPFKTRDGGTVKLIDLLTEA
FT                   EERAYALVKEKNPQLPEADLRSIAKVVGIDSVKYADLSKHRTSDYSFNFDLMLNFEGNT
FT                   APYLLYAYTRAAGVFRKLGKDFSEVGGQIELHAAQELELAAKLAQFGEILNNVAEKGTP
FT                   HILCTYLYDVAGLFSSFYENCPILAAETPTQMHSRLRLTELTRRTLKQGLELLGLKVLE
FT                   QM"
FT   gene            complement(503900..506119)
FT                   /gene="priA"
FT                   /locus_tag="PFL_0440"
FT   CDS_pept        complement(503900..506119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="PFL_0440"
FT                   /product="primosomal protein N'"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851; match to protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95849"
FT                   /db_xref="GOA:Q4KJJ9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJJ9"
FT                   /protein_id="AAY95849.1"
FT                   /translation="MPDAILRLALPSPLRRLFDYRAPAGVLRAQLHPGMRLRVPFGRRE
FT                   MIGILVEVADHSEVPAEKLKPALALLDPTPPLPPALFKLCLWTAQYYQHSLGDTLSWAL
FT                   PVLLRQGELAEARQERFWSIAPGARLDDPRIARAPRQREALATLAQHPHGVPHTLLSKL
FT                   MLSKDSLDLLLAKDLVQVEVRKHAPGVRHEHWLAQPELPLNSEQRAAYEAIRAGFDSYH
FT                   AFLLAGVTGSGKTEVYLQLIRETLEAGKQALVLIPEINLGPQTLARFEQRFNARIALLH
FT                   SAVNDRERLDAWLAARDGEADIIIGTRSALFTPMKNPGLIIIDEEHDGSYKQQEGLRYH
FT                   ARDLALVRARQENIPIVLGSATPSLESLHNAYTGRYGLLRLNERAGGAKQPRFLRLDVK
FT                   SRPLDSGISGPMQQAIGQTLAAGQQVLVFLNRRGFAPTLLCHDCGWMSECQRCDARMTV
FT                   HQRSGELRCHHCGHVERVPRHCPQCGKVDLRPVGAGTERAEERLGILFPDYPVLRVDRD
FT                   STSRKDAMNQLFATIQKGQPCILVGTQMLAKGHHFPRVTLVSILDADGGLFSGDFRASE
FT                   RMAQLIVQVAGRAGRAEEPGKVIIQTHLADHPLLVQLTEQGYFAFAEQALSERRAAGLP
FT                   PFAHLALLRAEAHKPGQAEGFLDEACSEAERLLAEQNLGGIELLGPVPAPMERRAGRYR
FT                   AQLLLQANARAPLHRLLSSWLLVLEQMPSGRQVRWSLDVDPVDLY"
FT   gene            506419..506640
FT                   /gene="rpmE_2"
FT                   /locus_tag="PFL_0441"
FT   CDS_pept        506419..506640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE_2"
FT                   /locus_tag="PFL_0441"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95850"
FT                   /db_xref="GOA:Q4KJJ8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJJ8"
FT                   /protein_id="AAY95850.1"
FT                   /translation="MKADIHPVYEAITATCSCGNVIETRSTLAKPLSLDVCNECHPFYT
FT                   GKQKTLDVGGRVDKFKSRFGAFGATKKA"
FT   gene            506682..507461
FT                   /locus_tag="PFL_0442"
FT   CDS_pept        506682..507461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0442"
FT                   /product="nuclease, SNase family"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95851"
FT                   /db_xref="GOA:Q4KJJ7"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJJ7"
FT                   /protein_id="AAY95851.2"
FT                   /translation="MKKASLVGAFFVGAIWLTAAEAFCPAPKGLLPATVLRVVDGDTLH
FT                   LKDGRRLRMIGLNAPELAGKGRPAEPFAEAARQRLRQLVAQSGGRVGLLPGRERQDRYG
FT                   RVLAHVYGVTGINFEARLIAEGLAYRIAVLPNVALASCQKAAENHARRAGLGLWRRSPV
FT                   LKAQQIHRAGFALFEGRVSRVQRNRGGLWITLQGQVVLRIAPNVLRRFDRRLLSGLSGR
FT                   RIEARGWVVDRSRQPGRQSAHPRWMLSVTDPSMLGLI"
FT   gene            507649..508917
FT                   /gene="tme"
FT                   /locus_tag="PFL_0443"
FT   CDS_pept        507649..508917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tme"
FT                   /locus_tag="PFL_0443"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95852"
FT                   /db_xref="GOA:Q4KJJ6"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJJ6"
FT                   /protein_id="AAY95852.1"
FT                   /translation="MSDLKTAALEYHANPRPGKLSVELTKATATARDLALAYSPGVAEP
FT                   VREIARDPELAYKYTGKGNLVAVISDGTAILGLGNLGPLASKPVMEGKGVLFKRFAGID
FT                   VFDIEVDSESPQAFIDTVKRISITFGGINLEDIKAPECFEIERALIEQCDIPVFHDDQH
FT                   GTAIVTAAGMINALEIAGKTLADAKIVCLGAGAAAISCMKLLVSMGAQIENIFMVDRTG
FT                   VIHSGRDDLNQYKAVFAHATDKRTLADALQGADVFVGLSGPNLLSAEGLKSMAPNPIVF
FT                   ACSNPDPEIAPELAHATRDDVIMATGRSDYPNQVNNVLGFPFIFRGALDVRAKRINEEM
FT                   KIAAANALRDLAKLPVPQEVCDAYGGIKLEFGREYIIPKPMDARLITVISDAVAKAAIE
FT                   TGVATLPYPKNYPLKSVDDVFNG"
FT   gene            complement(509039..511474)
FT                   /gene="mrcA"
FT                   /locus_tag="PFL_0444"
FT   CDS_pept        complement(509039..511474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="PFL_0444"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by similarity to SP:P02918; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912; match to protein family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95853"
FT                   /db_xref="GOA:Q4KJJ5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJJ5"
FT                   /protein_id="AAY95853.1"
FT                   /translation="MIRLLKFFGWSIVAVFCGLLLALSGAFLYLSPGLPSVEALRSIQL
FT                   QIPLRVYSSDGKLIAEFGEMRRTPIRFADIPPNFINALLSAEDDNFANHYGVDPSSLMR
FT                   AATQLVKSGHIQSGGSTITMQVAKNFFLTSERSFSRKTTEILLALQIERQLTKDEILEL
FT                   YVNKIYLGNRAYGIEAAAQVYYGKSIRDVSLAQMAMIAGLPKAPSRFNPLANPARSKER
FT                   RDWILGRMYKLGKITEAAYTEAINEPLNASYHVPTPEVNAPYIAEMARAEMVGRYGSDA
FT                   YTEGFRVTTTVPSDLQEMANTAVHEGLMTYDQRHGYRGPESRLPGKTQAAWASELTKQR
FT                   TISGLEPAIVTLVEKNGLQVLTRNGEEHVAWDSMKWARPFLNTNSMGPVPRQPADVAQV
FT                   GDLIRVQRQADNSLKFSQIPVAQGALVTLDPQNGAIRALVGGFAFEQSNYNRAMQAKRQ
FT                   PGSSFKPFIYSAALDNGYTPASLVNDAPIVFVDEYLDKVWRPKNDTNTFLGPIRMREAL
FT                   YKSRNLVSIRLLQSMGVDRTIDYISKFGFNKQDLPRNLSLALGTATLTPMEIATGWSTF
FT                   ANGGYKITPYIIDKIESRNGELLFSANPPSAPTGNTATSGIAAPEHNFTINNVAGETSA
FT                   PAATQAPAVAERIIDGRTTYILNSMLQDVIKLGTGRRALALGRTDLAGKTGTTNESKDA
FT                   WFSGYNADYVTTVWTGFDQPESLGRREYGGTVALPIWMSFMGAALKDKPPHTQPEPEGI
FT                   LSLRVDPVSGRAATPGTPNAYFELFKSEDTPPSVNELGNGAVPGSPLPADEAAPIDLF"
FT   gene            511691..512752
FT                   /gene="pilM"
FT                   /locus_tag="PFL_0445"
FT   CDS_pept        511691..512752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="PFL_0445"
FT                   /product="type IV pilus biogenesis protein PilM"
FT                   /note="See Martin et. al. 1995 (PMID: 7565110) for
FT                   characterization in PAO1.; identified by similarity to
FT                   GB:AAG08429.1; match to protein family HMM TIGR01175"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95854"
FT                   /db_xref="GOA:Q4KJJ4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJJ4"
FT                   /protein_id="AAY95854.1"
FT                   /translation="MLGLFSKKPSSLMGIDINATSVTLLALGRQGQGYRVEAYAREPLA
FT                   PNTVLDQHIADPEALAAALSRAWLKTGSRLKGAAVAVVGEAVISKLIEMPAGLHTDELE
FT                   QQVRLEAGQYIPYPLEDVALDFEVQGPVPGNPQRVQVLLVACRNERVEALETVLGLAGL
FT                   TARVVDTQPLALERCLLLLAAHLPLATPGAVALLDIGPALSRFSVLHGQRVIYSREQLF
FT                   GSGLLMEALQRRYGLTLEQALLAQSQGRLPQGCAEELLQPFEQEVLQQVSRSLQQFATS
FT                   PQQQPLVQLLLAGDGSGLAGLERRVEGETGIDTSLANPFRAMPMGPRVDPQVLNEQAPN
FT                   LLLACGLALRGFD"
FT   gene            512752..513318
FT                   /gene="pilN"
FT                   /locus_tag="PFL_0446"
FT   CDS_pept        512752..513318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="PFL_0446"
FT                   /product="type IV pilus biogenesis protein PilN"
FT                   /note="identified by similarity to GB:AAA87403.1; match to
FT                   protein family HMM PF05137; match to protein family HMM
FT                   TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95855"
FT                   /db_xref="GOA:Q4KJJ3"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJJ3"
FT                   /protein_id="AAY95855.1"
FT                   /translation="MARINLLPWREASRELRRRRFLQMLAMMVVLGAGVILLADAYISR
FT                   VIERQHLRNQYLGQATARLDEQIASIQGLKAQRQQLLERMGIIEELQGNRSNSVRIFQQ
FT                   LARSLPDGVYFTEVDLQGQNLGISGAAESNNRVSDLMRNLQAAEGFAAPSLTEVKNAVD
FT                   AQQGLNNLFRLNVGQTPGPAGELRQ"
FT   gene            513315..513938
FT                   /gene="pilO_2"
FT                   /locus_tag="PFL_0447"
FT   CDS_pept        513315..513938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO_2"
FT                   /locus_tag="PFL_0447"
FT                   /product="type IV pilus biogenesis protein PilO"
FT                   /note="identified by similarity to GB:AAA87404.1; match to
FT                   protein family HMM PF04350"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95856"
FT                   /db_xref="GOA:Q4KJJ2"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJJ2"
FT                   /protein_id="AAY95856.1"
FT                   /translation="MTPRQWLAELRRIDLRELELANLGSWPGPARSLVAALLLLLVLLV
FT                   GYGFYLSPHLEQLERQRQEETRLRQEFAGKARQGANLPRYQEQLAVIRNSFDLLLRQLP
FT                   SDTEVPGLLEDISRVGLGSGLAFEEIRLQPEVARQFYVELPIQITVTGAYHDLASFVSG
FT                   VAGLPRIVTLHDFRIQSVAAGNPALLRMSIEARTYRYDAPEPHS"
FT   gene            513935..514465
FT                   /gene="pilP_1"
FT                   /locus_tag="PFL_0448"
FT   CDS_pept        513935..514465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP_1"
FT                   /locus_tag="PFL_0448"
FT                   /product="type IV pilus biogenesis protein PilP"
FT                   /note="identified by similarity to GB:AAG08426.1; match to
FT                   protein family HMM PF04351"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95857"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJJ1"
FT                   /protein_id="AAY95857.1"
FT                   /translation="MRRLRWAVLGCLCAGLWGCGGADDDFADLDAYMNQMRLQAPGPIE
FT                   PMPVIRSYPSFTYDASALRSPFQPPQRLDLAARRQGASAVRPDPQRARQYLEGFDIEQL
FT                   QMVGTLSNASGSFALLRGAGGIHRLQVGDYLGRNEGRVVTISESQIEVVEIVPDGAGAW
FT                   LERPRTLALKKHS"
FT   gene            514480..516231
FT                   /gene="pilQ"
FT                   /locus_tag="PFL_0449"
FT   CDS_pept        514480..516231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="PFL_0449"
FT                   /product="type IV pilus biogenesis protein PilQ"
FT                   /note="identified by similarity to SP:P34750; match to
FT                   protein family HMM PF00263; match to protein family HMM
FT                   PF03958; match to protein family HMM PF07660; match to
FT                   protein family HMM TIGR02515"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95858"
FT                   /db_xref="GOA:Q4KJJ0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJJ0"
FT                   /protein_id="AAY95858.1"
FT                   /translation="MNRTVSALGVALWIALLAPLVGAAEPKPAAPGTAARAPAKPQAVA
FT                   GSIRGVDFQRGEEGEGNVLIDLSDPRIAVDVQRREGRIVLDFARTQLPETLRVRLDVKD
FT                   FATPVQYITADTAAGRTTVTLEPKGAFDYSTFQTDNRLTVSVRPLAETSSRAAAARPAY
FT                   KGEKLSLNFQDIEVRSVLQLIADFTGLNLVASDTVQGGITLRLQNVPWDQALDLVLRTK
FT                   GLDSRKIGNVLLVAPADEIAARERQELESQKQLEDLAPLRRELLQVNYAKAADIAKLFQ
FT                   SVTRAEEKADERGSITVDERTNSIIAYQSQERLDELRRIVAQLDVPVRQVMIEARIVEA
FT                   NVDYDKSLGVRWGGSVQNQGNWSASGVQNAASGSSSIGAPGSGGSNSPFVDLGASAHTS
FT                   GIGIAYITDNVLLDLELTAMEKTGNGEIVSQPKVVTSDKETAKILKGTEIPYQEASSSG
FT                   ATSVSFKEASLSLEVTPQITPDNRIIMEVKVTKDEPDYLNKVQDVPPIKKNEVNAKVLV
FT                   NDGATIVIGGVFSNTQSKVVDKVPFLGDVPYLGRLFRRDVVSEKKSELLVFLTPRIMNN
FT                   QAIAVSR"
FT   gene            516236..516754
FT                   /gene="aroK"
FT                   /locus_tag="PFL_0450"
FT   CDS_pept        516236..516754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="PFL_0450"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by similarity to SP:P24167; match to
FT                   protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95859"
FT                   /db_xref="GOA:Q4KJI9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJI9"
FT                   /protein_id="AAY95859.1"
FT                   /translation="MRNLILVGPMGAGKSTIGRLLAKELRLPFKDSDKEIELRTGANIP
FT                   WIFDKEGEPGFRDREQAMIAELCGTDGVVLATGGGAVMREANRRALHAGGRVVYLHASV
FT                   EQQVGRTARDRNRPLLRTADPAKTLRDLLEIRDPLYREIADLVVETDERPPRMVVLDIL
FT                   ERLQQLPPR"
FT   gene            516900..518000
FT                   /gene="aroB"
FT                   /locus_tag="PFL_0451"
FT   CDS_pept        516900..518000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="PFL_0451"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="identified by similarity to SP:P07639; match to
FT                   protein family HMM PF01761; match to protein family HMM
FT                   TIGR01357"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95860"
FT                   /db_xref="GOA:Q4KJI8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJI8"
FT                   /protein_id="AAY95860.1"
FT                   /translation="MQTLKVDLGERSYPIHIGEGLLDQPELLVPHIAGRQVAIISNETV
FT                   APLYLERLTRSLGQFSVISVVLPDGEAYKNWETLQLIFDGLLTARHDRRTTIIALGGGV
FT                   IGDMAGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTGINHPLGKNMVGAFYQPNVVLI
FT                   DTTSLNTLPSRELSAGLAEVIKYGLICDEPFLTWLEENVDRLRALDQQALTYAIERSCA
FT                   AKAAVVGADERESGVRATLNLGHTFGHAIETHMGYGVWLHGEAVAAGTVMALEMSARLG
FT                   WITSQERDRGIRLFQRAGLPVIPPEEMSEADFLEHMAIDKKVIDGRLRLVLLRRMGEAV
FT                   VTDDYPKEVLQATLGADYRALAQLKG"
FT   gene            518011..519591
FT                   /locus_tag="PFL_0452"
FT   CDS_pept        518011..519591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0452"
FT                   /product="sporulation and cell division repeat protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95861"
FT                   /db_xref="GOA:Q4KJI7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJI7"
FT                   /protein_id="AAY95861.1"
FT                   /translation="MTSLHADEAFLGHYQLSHDPFAPRVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLLLVVTGPQGSGKTLLRQALVASTNKQSVQSVVVSARGAGDAAGVLRQVAQALN
FT                   VAEAEIGAILAQIVQLALTGQEVYLLVDDAEQLDESALEALLALAAGAPEGRPHVFLFG
FT                   ESSLIAALDQLNTEEERFHVIELQPYTEEETREYLAQRLEGAGQGIELFSADQISDIHE
FT                   GSDGWPGNINQVARDAMIEAMIASRSAVKRPSMGFNMPKKHVLAISAVVVVAVAAAWLM
FT                   PGRSKAPTTGAPANEQAQLPLGQAPTPNANGSPSVEFAGSSQPMPLPLVGQSQPVMRGP
FT                   LAEAAGGISEGDDGVPVEGSSAVPPTVTTTAPPAGATAGPTPTPAARPTPAPTQVATAK
FT                   PAPAAKPAEKPVAAKPAPAKPAEKPVTVAKAAGGSWYAGQAPGNYVVQILGTSSEATAQ
FT                   NFVKEQGGEYRYFKKVLNGKPLYVITYGNFASRDAAVSAIKSLPAKVQAGKPWPRTVAS
FT                   VQQELATTR"
FT   gene            519940..524388
FT                   /gene="gltB"
FT                   /locus_tag="PFL_0453"
FT   CDS_pept        519940..524388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="PFL_0453"
FT                   /product="glutamate synthase, large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by similarity to SP:P09831; match to
FT                   protein family HMM PF00310; match to protein family HMM
FT                   PF01493; match to protein family HMM PF01645; match to
FT                   protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95862"
FT                   /db_xref="GOA:Q4KJI6"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJI6"
FT                   /protein_id="AAY95862.2"
FT                   /translation="MKAGLYQPDEFKDNCGFGLIAHMQGEPSHTLLKTAIEALTCMTHR
FT                   GGINADGKTGDGCGLLMQKPDLFLRAVATEHFGIELPKQYAVGMVFFNQDPVKAEAARE
FT                   NMNREILAAGLQLVGWRKVPIDTSVLGRLALERLPQIEQVFIGGQGLSDQDFAIKLFSS
FT                   RRRSSVANAADTDHYICSFSHKTIIYKGLMMPADLAAFYPDLGDERLQTAICVFHQRFS
FT                   TNTLPKWPLAQPFRFLAHNGEINTITGNRNWAVARRTKFANDLIPDLEELGPLVNRVGS
FT                   DSSSMDNMLELMVTGGIDLFRGVRMIIPPAWQNVETMDADLRAFYEYNSMHMEPWDGPA
FT                   GVVMTDGRYAVCLLDRNGLRPARWVTTQNGFITLASEIGVWNYQPEDVIAKGRVGPGQI
FT                   FAVDTETGQILDTDAIDNRLKSRHPYKQWLRKNALRIQATMEDNDHGSAFYDVDQLKQY
FT                   MKMYQVTFEERDQVLRPLGEQGYEAVGSMGDDTPMAVLSQRVRTPYDYFRQQFAQVTNP
FT                   PIDPLREAIVMSLEICLGAERNIFQESPEHASRVILSSPVISPAKWRSLMNLDRPGFER
FT                   QVIDLNYDESVGLEAAIRNVADQAEEAARAGRTQIVLSDRHIAPGKLPIHASLATGAVH
FT                   HRLTEKGLRCDSNILVETATARDPHHFAVLIGFGASAVYPFLAYEVLGDLIRTGEVLGD
FT                   LYEVFKNYRKGITKGLLKILSKMGISTIASYRGAQLFEAIGLSEEVCNLSFRGVPSRIK
FT                   GARFVDIEAEQKALATEAWSPRKPIQQGGLLKFVHGGEYHAYNPDVVNTLQAAVQQGDY
FT                   AKFKEYTALVDNRPVSMIRDLFQVKTLDTPMDISEVEPLESILKRFDSAGISLGALSPE
FT                   AHEALAEAMNRLGARSNSGEGGEDPARYGTIKSSKIKQVATGRFGVTPEYLVNAEVLQI
FT                   KVAQGAKPGEGGQLPGGKVNGLIAKLRYAVPGVTLISPPPHHDIYSIEDLSQLIFDLKQ
FT                   VNPQALVSVKLVAEAGVGTIAAGVAKAYADLITISGYDGGTGASPLTSIKYAGAPWELG
FT                   LAETHQTLRGNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGTAPMIALGCKYLRI
FT                   CHLNNCATGVATQNEKLRKDHYIGTVDMVVNFFTYVAEETREWLAKLGVRSLEQLIGRT
FT                   DLLEVLEGQTAKQHHLDLTPLLGSDHIPADKPQFCQVDRNPPFDKGLLAEKMVEMARSA
FT                   INDKSGADFALDICNCDRSIGARISGEIARLHGNQGMAQAPITFRFKGTAGQSFGVWNA
FT                   GGLNLYLEGDANDYVGKGMTGGKLVIVPPKGSVYKTQDSAIIGNTCLYGATGGKLFAAG
FT                   TAGERFAVRNSGAHTVVEGTGDHCCEYMTGGFVCVLGKTGYNFGSGMTGGFAYVLDQDN
FT                   TFVDRVNHELVEIQRISGEAMEAYRSHLQRVLNEYVEETDSEWGRNLAENLDDYLRRFW
FT                   LVKPKAASLKSLLSSTRANPQ"
FT   gene            524422..525840
FT                   /gene="gltD"
FT                   /locus_tag="PFL_0454"
FT   CDS_pept        524422..525840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="PFL_0454"
FT                   /product="glutamate synthase, small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by similarity to SP:P09832; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF07992; match to protein family HMM TIGR01318"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95863"
FT                   /db_xref="GOA:Q4KJI5"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJI5"
FT                   /protein_id="AAY95863.1"
FT                   /translation="MAERLNNDFQFIDVGRKDPKKKLLRQRKKEFVEIYEPFKPQQSAD
FT                   QAHRCLGCGNPYCEWKCPVHNFIPNWLKLVAEGNILAAAELSHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGSVEKYITDTAFAMGWRPDMSKVKPTGKRVAIIGAGPAGLG
FT                   CADVLVRGGVTPVVFDKNPEIGGLLTFGIPEFKLEKTVLSNRREVFSGMGIEFRLNTEV
FT                   GKDVTMEQLLAEYDAVFMGMGTYTYMKGGFAGEDLPGVYDALDFLIANVNRNLGFEKSP
FT                   EDFVDMKGKKVVVLGGGDTAMDCNRTSIRQGAKSVTCAYRRDEANMPGSRKEVKNAKEE
FT                   GVKFLYNRQPIAIVGEDRVEGVKVVETRLGEPDARGRRSPEPIPGSEEIIPADAVVIAF
FT                   GFRPSPAPWFEQFSIQTDSQGRVVAPEQGQFKHQTSNPKIFAGGDMVRGSDLVVTAIFE
FT                   GRNAAEGILDYLGV"
FT   gene            526070..527137
FT                   /gene="hemE"
FT                   /locus_tag="PFL_0455"
FT   CDS_pept        526070..527137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="PFL_0455"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="identified by similarity to SP:P29680; match to
FT                   protein family HMM PF01208; match to protein family HMM
FT                   TIGR01464"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95864"
FT                   /db_xref="GOA:Q4KJI4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJI4"
FT                   /protein_id="AAY95864.1"
FT                   /translation="MTALKNDRFLRALLKQPVDVTPVWMMRQAGRYLPEYRASRANAGD
FT                   FMSLCMNPEFACEVTLQPLDRYPQLDAAILFSDILTIPDAMGQGLYFETGEGPRFKKVV
FT                   STLADIEALPIPDPHKDLGYVMDAVSTIRRELNGRVPLIGFSGSPWTLATYMVEGGSSK
FT                   DFRKSKAMLYDNPQAMHLLLDKLAQSVTAYLNGQIRAGAQAVQIFDSWGGSLSAAAYQE
FT                   FSLAYMRKIVSGLIREHDGRKVPVILFTKGGGLWLESIADAGADSLGLDWTCDIGEARR
FT                   RVGSKVSLQGNMDPTVLYANPQAIRSEVARILASYGKGSGHVFNLGHGITPEVKPEHAG
FT                   AFLEAVHELSAQYHE"
FT   gene            complement(527274..528533)
FT                   /locus_tag="PFL_0456"
FT   CDS_pept        complement(527274..528533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0456"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95865"
FT                   /db_xref="GOA:Q4KJI3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJI3"
FT                   /protein_id="AAY95865.2"
FT                   /translation="MKSAVAPSAEEPPATPLDEVVAQLNEAYIEKGTPMFMRTVLALFS
FT                   GGFATFALLYCVQPMMPLLSRDFSINAAQSSLILSVATGMLAIGLLITGPVSDRIGRKP
FT                   VMVAALLAAALCTIASALMPSWHGVLLMRALVGLSLSGLAAVAMTYLSEEIHPQHIGLA
FT                   MGLYIGGNAIGGMSGRLITGVLIDFVSWHTAMLVIGGLALIAAAVFWRILPESRNFRPR
FT                   SLHPRSLLDGFAMHFRDAGLPWLFLEGFLLMGAFVTLFNYIGYRLLAEPYQLSQAWVGM
FT                   LSVVYLSGIYSSAKIGALADQLGRRRVLWGTIVLMLAGIALTLLTPLSLVLIGMLLFTF
FT                   GFFGAHSVASSWIGRRATKAKGQASSLYLFSYYAGSSIAGTAGGVFWHLAGWNGIGLFI
FT                   GALLIGALLIAMKLAKLPPL"
FT   gene            528652..529551
FT                   /locus_tag="PFL_0457"
FT   CDS_pept        528652..529551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0457"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95866"
FT                   /db_xref="GOA:Q4KJI2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJI2"
FT                   /protein_id="AAY95866.1"
FT                   /translation="MELRHLRYFIAVAEELHFGRAAQVLGISQPPLSQQIQALEQEVGA
FT                   RLFERTNRRVELSEAGRLFLEEARLVLAQVDKAADVARRAQLGELGELKIGFTSSAPFN
FT                   STIPQAIFAFRQRFPAVHLKLKEMSSTQVAEALVDQAIQVGIMRPLPLPDSLSVVELLR
FT                   EPLVAVLSSKHPLASGSEEGLHLAELAHEPFVFFPRSYGSGLYAQLLSLSRDAGFTPHF
FT                   AQEAAEAMTIIGLVAAGLGVSVLPASYQRMRIDGVVYRRLLDPAAMSAVWLVQRKDQAS
FT                   PMAKAFVELLTRKTGATP"
FT   gene            complement(529519..530010)
FT                   /locus_tag="PFL_0458"
FT   CDS_pept        complement(529519..530010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0458"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAO10833.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95867"
FT                   /db_xref="GOA:Q4KJI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJI1"
FT                   /protein_id="AAY95867.1"
FT                   /translation="MQVKALIALALLAVLSPTSQATNLMYMPFEKVVADAERAGRLDGS
FT                   VSFHLAGNPLPPVLQVRLTEVTTHKKTNAFNKSDIAACEWALQSALITLQAAAKRVGAN
FT                   AVTNIVSYYKHHVRKDLNTYECHAGVLMAGVALRGDLVNLQAPVRPNSPSGRSPGLARQ
FT                   "
FT   gene            complement(530203..530649)
FT                   /locus_tag="PFL_0459"
FT   CDS_pept        complement(530203..530649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95868"
FT                   /db_xref="GOA:Q4KJI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJI0"
FT                   /protein_id="AAY95868.1"
FT                   /translation="MRLKTLAATATLLLCTLPGVSQARDTALYLPFDKVVAEAISTGKI
FT                   DGSVKFYLAGNKPAGKVSVLSPGAVTNKKTNAFGKADQVACEWALQSALITLHEAAKKV
FT                   GANAVTDIASFYKSHERKDATTYECHAGAIMAGVALRGDLSKVQ"
FT   gene            complement(530712..531161)
FT                   /locus_tag="PFL_0460"
FT   CDS_pept        complement(530712..531161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0460"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95869"
FT                   /db_xref="GOA:Q4KJH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH9"
FT                   /protein_id="AAY95869.1"
FT                   /translation="MSSLFRATLIVLALLSVTACTSKRMYTPNRVLPATIQADQEQVKQ
FT                   AILKNLVARKWTVQRISPELIQAEITVRQQFHAEIDIQYSASYYKIVYRDSRDMDYKDG
FT                   KIHKNYIRWVRLLDKGILRELRDNQNERAAQQLSDAAAKSFPAAQ"
FT   gene            complement(531187..532413)
FT                   /locus_tag="PFL_0461"
FT   CDS_pept        complement(531187..532413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0461"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95870"
FT                   /db_xref="GOA:Q4KJH8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH8"
FT                   /protein_id="AAY95870.1"
FT                   /translation="MKRVVVTGMAGITSLGSDWASIAERFAANRSGIRRMDEWDRFSEL
FT                   NTRLAGPIDDFQVPGHWTRKQLRSMGRVSRLAVGAAEQALADAGLLGDPSIKDGRMGVA
FT                   CGSSTGSTDEIKAFGNMLLNSVAEGLNANSYVRMMPHTTAANISIFFGLTGRLIPTSSA
FT                   CTSGSQGIGYAYEAIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTSPRPY
FT                   DSGRDGLVIGEGGGMLVLEELEHALARGARIHAEIVGFGSNADGQHTTRPEQSTMRRAM
FT                   ELALEDGALAPEAIGYVNGHGTATEQGDIAETLATSSLFGSRMPISSQKSFLGHTLGAC
FT                   GALESWFSIEMLNRDLYVHTCNLDQVDPRCGELDYLQGGFRAMSHEYVMNNNFAFGGVN
FT                   TSLIFRRWS"
FT   gene            complement(532413..533141)
FT                   /locus_tag="PFL_0462"
FT   CDS_pept        complement(532413..533141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0462"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01831"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95871"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH7"
FT                   /protein_id="AAY95871.1"
FT                   /translation="MTDSVLVTGSSRGIGRAIALRLARAGYDLVLHCRSGRTEAEAVRG
FT                   EVQALGRSARVLQFDVSDREACRAALEADVEAHGAYYGVVLNAGLTRDGAFPALSEEDW
FT                   DQVLRTNLDGFYNVLHPVMMPMIRRRAAGRIVCITSVSGLIGNRGQVNYSASKAGVIGA
FT                   AKALAIELGKRKITVNCVAPGLIDTAMLDENVPVEELLKMIPAQRMGTPEEVAGAVNFL
FT                   MSAEASYITRQVLSVNGGLC"
FT   gene            complement(533138..533611)
FT                   /locus_tag="PFL_0463"
FT   CDS_pept        complement(533138..533611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95872"
FT                   /db_xref="GOA:Q4KJH6"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH6"
FT                   /protein_id="AAY95872.1"
FT                   /translation="MIDWPLAELLPHAGDMILIDQVLAFDEEQIRTRLEVRPGGLFNRP
FT                   DGSLPAWVGVELMAQSVAAYAGCRARQQGLPVELGFLLGTRKFECNVEHFPLGSTLEIH
FT                   ALRSLEDDNGMGVFECHLSGPGITASARLNVFRPPQAADYLHETPASSTGTPS"
FT   gene            complement(533608..534804)
FT                   /locus_tag="PFL_0464"
FT   CDS_pept        complement(533608..534804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0464"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95873"
FT                   /db_xref="GOA:Q4KJH5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH5"
FT                   /protein_id="AAY95873.1"
FT                   /translation="MTAYLNALGVICALGRNRQEVARSLFAGDCSGMRDESHWVPERTL
FT                   PVAAVRSPLAGMPAGLEAQNSRNNQLLLEATRQIEDDIQQAIQRYGHGRIGIVLGTSTS
FT                   GIDEASRGIARYLQDRQFPAGYDYRQQELSAPANFLAQWLQLCGPAYVISTACTSSARA
FT                   LISARRLLDLGLCDAVLCGGVDSLCKLTLNGFTALEAVSGQRCNPFSRNRDGINIGEAA
FT                   VLFLMSREPAGDAPVALLGGGASSDAYHISAPAPDGRGALQAMSQALRGAGLQPQQIGY
FT                   LNLHGTATQHNDAMESLAVAQLFPEGVPCSSTKPMSGHTLGAAGALEAAFCWLALSTDN
FT                   PGLALPPHVWDAQADPSLPPLRWVTPDDRLAPHAPRRLMSNSFAFGGNNVSLIIGDAP"
FT   gene            complement(534801..535286)
FT                   /locus_tag="PFL_0465"
FT   CDS_pept        complement(534801..535286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0465"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95874"
FT                   /db_xref="GOA:Q4KJH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH4"
FT                   /protein_id="AAY95874.1"
FT                   /translation="MIRVLLLGCVLLLSACVSQAPLPERTPSLMLPLQLHVQRQADGQR
FT                   QDWLLVIQAEGPDLRWSLMDPLGIPQARQRLVHGQWQADGLLPPNPEARELFAALLFAL
FT                   TPEAELVANYPGAHQQGAQRTLGPRWRIDYQQPLDFELNLPQGPHYHITALSTEATP"
FT   gene            complement(535283..536044)
FT                   /locus_tag="PFL_0466"
FT   CDS_pept        complement(535283..536044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0466"
FT                   /product="methyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95875"
FT                   /db_xref="GOA:Q4KJH3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH3"
FT                   /protein_id="AAY95875.1"
FT                   /translation="MSEQTSQYLSDSYVEETRFGFWFLRSHTWQHHVLRVAINDLRSLF
FT                   DGELPRHPVLLDAGCGQGKSFQYLRQVFAPQRLIGLDADPHSLKLSAEEARRQQMQVEL
FT                   IGSDCATLELADASVDLLFCHQTFHHLVEQEKALAEFYRVLKPGGYLLFAESTEAYIDT
FT                   WVIRWLFRHPMHVQKSAAQYLQMIRQQGFEFGPQNVSYPYLWWSRAKDFGLLERFGLRQ
FT                   PPPVGQREETLVNVVARKPLNPTVVEEGLPA"
FT   gene            complement(536041..537288)
FT                   /locus_tag="PFL_0467"
FT   CDS_pept        complement(536041..537288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0467"
FT                   /product="putative tryptophan halogenase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494; match to protein
FT                   family HMM PF04820"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95876"
FT                   /db_xref="GOA:Q4KJH2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH2"
FT                   /protein_id="AAY95876.2"
FT                   /translation="MPTVEMERRQVVVIGAGPSGAIAAALLKRQGHDVLIVERQHFPRF
FT                   SIGESLLSHCLDFVEEAGMLEAVQAAGFQLKNGAAFAWGEHYSTFDFGDTFSNGKPTTF
FT                   QVQRADFDKLLADQAALQGVEIRYGEEIVAVEVERPLPQLDCRREDGSQYRIEADFILD
FT                   ASGYGRVLPRLLELEAPSNFPVRRAVFTHVEDRIDCEHFDRNKILITTHPEHRDIWFWS
FT                   IPFSNGRCSVGVVAAQEHFAGRDGDLDACLRGFISETPSLAKVLQYAEWDTSVRTIGGY
FT                   SANVSTLHGPGFALLGNAAEFLDPVFSSGVTIAMRSASMAAAVLHRQLQGQGVDWATEF
FT                   AEPLKRGVDTFRCYVEGWYAGTFQDVIYHPGSSPEIRRMISSILAGYAWDERNPFVSEP
FT                   KRRLKALSEVCARDRA"
FT   gene            complement(537275..538465)
FT                   /locus_tag="PFL_0468"
FT   CDS_pept        complement(537275..538465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0468"
FT                   /product="transporter, CPA2 family"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95877"
FT                   /db_xref="GOA:Q4KJH1"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH1"
FT                   /protein_id="AAY95877.1"
FT                   /translation="MLTLMFWLLALALFALATHIGRRLGLIPIVSQLLLATFGLPLLML
FT                   LWIEPHWQLSGAQLVSPQWLKHLYSLSFALLLGHILSDVIDLRLDRQSLKIAVPSFGIP
FT                   FACGLATAFWLLPAQPWISSLAVGLLFAITAIPVLYLYLRHIQYPPAATRRLVQTAILI
FT                   DLTCWSLFALAQGSLHLSSLLLPLAGACLPLVLRGLGLRQPLLYSLGFFGLLVVAEHYR
FT                   LNALIFGIGYLLCMAALKLALVLPLQAAWMNRLQTYIAIPLILTFGIVQIDVHSAMGSL
FT                   GWVQLAALLLLPIASKLLGNWLGLGWAGASFTGASRWRESLLLNIRGLSEIVFLNLLLQ
FT                   QQLISPALYFALMLMGLIATLLPALAGMHRTPQAAPHAAPLNLNIAKPARSPSANS"
FT   gene            complement(538459..540801)
FT                   /locus_tag="PFL_0469"
FT   CDS_pept        complement(538459..540801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0469"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95878"
FT                   /db_xref="GOA:Q4KJH0"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJH0"
FT                   /protein_id="AAY95878.1"
FT                   /translation="MTLPSERWLPRFFLILLTLVLALGAWQWRHGAPLSANLMELVPGT
FT                   APDALEQQAEQRMQEPLNREILVLVGHAERQQAVAMARQLAEQWQASGLFEKVQWNLQA
FT                   DLPALRQQLLQGRLAMLGAKDREQLAQQPQAFIQQRVQSLFDPFGGFTLVPSQDDWLGL
FT                   TGRIQNSQPQHGAVQLDIGSGALVAEADGQHWVLLRARTGGNAFDMQLPLQVADLLRHS
FT                   REQASQQQVQLLAASGLLYAANGQQQATREITWVGGGATLGILLLLLLAFRRWRALLAF
FT                   VPVLVGMLFGAVACVALFGRMHVMTLVLGSSLIGVAVDYPLHYLSKSWSLKPWRSWPAL
FT                   RLTLPGLSLSLATSCIGYLALAWTPFPALTQIAVFSAAGLVGAYLAAVCLLPALLKGVQ
FT                   LRPAHWPLQVAQALLQARAALLKRVPSLVLLVLLALFCAAGLWQLESKNDIRQWVGAPP
FT                   QLLQEAQAIARITGYQPTSQFFLVRATDQQQLLERLEALDLRLQQLVNLGKLKGYLSLN
FT                   QLLSQPTEQQQVREALKQLPRFWQPLLDLGVPLAALQAELEQLQQLPVEDLDAALSGPL
FT                   AEPYRPLWLGANANGVAAMVSLQGLNDAALLRIQADDLPGVQLVDRLGELNRVFAATQV
FT                   SAAELKLASCVLIVLLLILPFGLGGALRLVALPLLAALCSLASLGWLGQPLTLFSLFGL
FT                   LLVTAISVDYAILMREQIGGAAVSLLGTLLAALTTWLSFGLLAISSTPAVSNFGLAVSL
FT                   GLAFSFILAPWAGHRPHPAPDAERAAC"
FT   gene            complement(540785..541465)
FT                   /locus_tag="PFL_0470"
FT   CDS_pept        complement(540785..541465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0470"
FT                   /product="outer membrane lipoprotein carrier protein, LolA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95879"
FT                   /db_xref="GOA:Q4KJG9"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJG9"
FT                   /protein_id="AAY95879.2"
FT                   /translation="MKVGASLLAKRVGLSASCMRLRTVVRRFASKLAPTLLVLWCVPGL
FT                   AQAFDLQQLSDQLSRPEVIHGRFIQEKHLRALPQPLTSKGHFVLAKNHGLLWLLQTPLQ
FT                   QDYRITAQGIARRDGGGWQMLPGKSAGAEQNRLFLAVLQGDSSGLQRDFELKLQGSAQN
FT                   WQLQLIPRSLLLKQIFNQINIDGGELVQRIELLEAQGDRTLLIMQDSSSAQPLSETEQH
FT                   DFAE"
FT   gene            complement(541462..541887)
FT                   /locus_tag="PFL_0471"
FT   CDS_pept        complement(541462..541887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0471"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95880"
FT                   /db_xref="GOA:Q4KJG8"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJG8"
FT                   /protein_id="AAY95880.1"
FT                   /translation="MRSKGVIHADTQIQVPFFDVDTMHVVWHGHYVKYLEVARCALLDK
FT                   LGHNYQQMLESGYAWPVIDLQLRYVRGAVFGQTLNVRASLVEWESRLKINYLITDQATG
FT                   ERMTRASSVQVAVEIASREMQLASPKVFTDAVARALP"
FT   gene            complement(541880..543424)
FT                   /locus_tag="PFL_0472"
FT   CDS_pept        complement(541880..543424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0472"
FT                   /product="putative phenylalanine and histidine
FT                   ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /EC_number="4.3.1.24"
FT                   /note="identified by match to protein family HMM PF00221"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95881"
FT                   /db_xref="GOA:Q4KJG7"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJG7"
FT                   /protein_id="AAY95881.1"
FT                   /translation="MTTSTHEPVTFGEHPLRIEDVLALANRQVPTRLQGDAAWRQRIAK
FT                   GAQFLDSLLDKEGVIYGVTTGYGDSCVVAVPLQHVEALPRHLYTFHGCGLGKLLDAQAT
FT                   RAVLAARLQSLCHGVSGVRVELLERLQAFLDQDILPLIPEEGSVGASGDLTPLSYVAAT
FT                   LSGEREVMFRGERRESADVHRELGWEPLVLRPKEALALMNGTAVMTGLACLAFARADYL
FT                   LRLATRITALNVVALQGNPEHFDERLFAAKPHPGQMQVAAWLRQDLAIDAPTAPLHRLQ
FT                   DRYSLRCAPHVLGVLADSLNWLRGFIETELNSANDNPIIDAEAERVLHGGHFYGGHIAF
FT                   AMDSLKNLVANVADLLDRQLALLVDVRYNHGLPSNLSGASAERAMLNHGFKAVQIGASA
FT                   WTAEALKNTMPASVFSRSTECHNQDKVSMGTIAARDAIRVLELTEQVAAATLLAANQGV
FT                   WLRSQEADARPLPPALDAMHRQLAADFPPVIEDRALEHELRLCLQRIAEQHWRLHA"
FT   gene            complement(543405..544361)
FT                   /locus_tag="PFL_0473"
FT   CDS_pept        complement(543405..544361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0473"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /note="identified by match to protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95882"
FT                   /db_xref="GOA:Q4KJG6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJG6"
FT                   /protein_id="AAY95882.1"
FT                   /translation="MSQEQPKEPGNEHWADHQERGSFWLMKLTALGVRVLGRRLLSPVL
FT                   YAIVFYFFLFGRRARRSIWQYQQHLAQWSGRDELRPSHWRVFGQFMAFADALLDKLDVW
FT                   NGKLRIEQIEIVDPAQLRHQLRGERGQMLVGAHLGNLEVCRALAELGEQVTMNVLVHTK
FT                   HAERFNRLLGEAGASNLRLIQVSELDPAIMLQLSQRLDRGEWLAIAGDRVPLHGGRNVR
FT                   VDFLGHPAAFPQGPWLLAGLLKCPVNLLLCLKQQGRYQVILEPFADAVQWKRNDRQQVI
FT                   AQWTARYAERLGQYCLQAPQQWFNFYPFWKTDDDLDP"
FT   gene            complement(544358..545092)
FT                   /pseudo
FT                   /locus_tag="PFL_0474"
FT                   /note="glycosyltransferase, group 2 family; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00535"
FT   gene            complement(545158..546831)
FT                   /locus_tag="PFL_0475"
FT   CDS_pept        complement(545158..546831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0475"
FT                   /product="AMP-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF07977"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95884"
FT                   /db_xref="GOA:Q4KJG4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJG4"
FT                   /protein_id="AAY95884.1"
FT                   /translation="MNWIPLEQLLLKLHTPRAVSAAPAIDLGAVQEQALSLAAALQARG
FT                   VRRLAVHLEDAVELAVALLGAWRAGASVLLPADLQAQTRQRWSSEVDLWLTDQDTPLHQ
FT                   LQASPLAPAELDPDTCQLSLCTSGSSGEPKRIEKNLRQLANEVVALEHLWGADLGQAWI
FT                   IGSVATQHIYGLLFRVLWPLCAGRPFVRRQLPFPEDLQRASRECPAFAWVASPALLKRM
FT                   GDNLDWPALSQVRRVFSSGGALPAEAASGLHQRLQQWPTEILGSSETGGIAWRQGPGLW
FT                   QPFADVRLSQDADGALLIASPYLPAGHVEHTADAARIAADGRFELLGRLDRIVKLEEKR
FT                   ISLPMLEQALASHEWVAEARLGVIEDNRAYLGALLVLSEPGLHALRNQGRRHLTQALRQ
FT                   HLAGHCEALALPRRWRLVRQLPLNSQGKLPQAQVQALLLAPRPQAPEVLEQRQHEEEWQ
FT                   LQLAIPPDLAYFSGHFPQTPVLPGVVQVDWALALGQQLLELPGRFAGMEVLKFQQLVRP
FT                   GDRIQLNLRFDAQRQKLYFAYLNDGAPCSCGRIVLEASCG"
FT   gene            complement(546828..547373)
FT                   /locus_tag="PFL_0476"
FT   CDS_pept        complement(546828..547373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0476"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95885"
FT                   /db_xref="GOA:Q4KJG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJG3"
FT                   /protein_id="AAY95885.1"
FT                   /translation="MSRLIGLGLLLAGLLYPFAVYFGMEHFAPWQFGLLLGGLWLARAL
FT                   TGERRPGSLWMAIAAIAFCLLLAWFDNPALLRWYPVLISAFMLGLFGLSLKYGPPVAER
FT                   LARISEPQLPEKAIRYTRQVTVAWSVFFLCNGMLAAALTLWAPLSWWTLYNGLIAYGLM
FT                   GLLFAIEWLLRQRVRGRR"
FT   gene            complement(547370..547624)
FT                   /locus_tag="PFL_0477"
FT   CDS_pept        complement(547370..547624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0477"
FT                   /product="putative acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95886"
FT                   /db_xref="GOA:Q4KJG2"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJG2"
FT                   /protein_id="AAY95886.1"
FT                   /translation="MQTRDDIFNTLRDALVELFELEPERVSLESNLYEDLEIDSIDAVD
FT                   LIDHIKRQTGKKIAAEEFKSVRTVNDVVEAVYRLVQPAA"
FT   gene            complement(547634..547906)
FT                   /locus_tag="PFL_0478"
FT   CDS_pept        complement(547634..547906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0478"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95887"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJG1"
FT                   /protein_id="AAY95887.1"
FT                   /translation="MSDTHPDLMLEIKLLIIDALGLEDISAQDIGNDQTLFGEGLGLDS
FT                   VDALELGLAIQKKYGIKIDADAKDTRNHFSNVASLAAFVTAKQAA"
FT   gene            complement(547875..548696)
FT                   /locus_tag="PFL_0479"
FT   CDS_pept        complement(547875..548696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0479"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95888"
FT                   /db_xref="GOA:Q4KJG0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJG0"
FT                   /protein_id="AAY95888.1"
FT                   /translation="MDLATQPLSAKGRNAYYWRLTATALSFALFGIGGLCLRLVIFPLL
FT                   ACLPGDAQRQRQRARKTVSRLFWLFIRFMARSGVLTYEVQGAERLGRPGQMIIANHPSL
FT                   IDVVFLIGLVRDANCVVKQSLWNNPFTRGPVRATQYISNDGSMDMLDSACGALQAGQTL
FT                   IVFPEGTRTQPGAAPAFHRGAAAIALRGAKIITPVVIRVSPSTLTKAEPWYRIPQRRVH
FT                   FSFHVGADIDPQTFAAQGPAPQASRKLNEHLHHFFIKELARDERYTPGPDA"
FT   gene            complement(548672..549391)
FT                   /locus_tag="PFL_0480"
FT   CDS_pept        complement(548672..549391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95889"
FT                   /db_xref="GOA:Q4KJF9"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJF9"
FT                   /protein_id="AAY95889.1"
FT                   /translation="MIKFNIAQWRAWAPGLESVDAWQAWSRQPALPENSDAAPDVSFLP
FT                   AMQRRRLSRLARMAFSVGWPLAEGLEQLPLVFISRHGETPRTFEILSDLAAEQPLSPTQ
FT                   FSLSVHNAVIGLWSIMRGETSEMTALAAAGDGLEHGLLEAATLLADGAPHVLLVITEEQ
FT                   PPEAYASWIDDVPFPYALGLLLTPGDDWQLSLGSHDGQTPRAQWPHALNLLRTLLGAQT
FT                   FCQHAWMNRVWTWQRNH"
FT   gene            549737..550507
FT                   /locus_tag="PFL_0481"
FT   CDS_pept        549737..550507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0481"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95890"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJF8"
FT                   /protein_id="AAY95890.1"
FT                   /translation="MRRVVFNQKGGVGKSSIACNLAAVSASEGYRTLLVDLDAQANSTQ
FT                   YLTGLTGEDIPMGIADFFKQTLSSGPFAKKNQVDIYETPFDNLHVITATAELADLQPKL
FT                   EAKHKINKLRKLLDELAEDYDRIYLDTPPALNFYAVSALIAADRVLIPFDCDSFSRQAL
FT                   YGLLAEIEELKEDHNEGLEVEGIVVNQFQARASLPQQMLDELISEGLPVLPVYLGSSVR
FT                   MRESHQASMPLIHLDPRHKLTQQFVDLHNLLENA"
FT   gene            complement(550559..550993)
FT                   /locus_tag="PFL_0482"
FT   CDS_pept        complement(550559..550993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0482"
FT                   /product="putative thioredoxin"
FT                   /note="identified by similarity to SP:P33636; match to
FT                   protein family HMM PF00085; match to protein family HMM
FT                   TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95891"
FT                   /db_xref="GOA:Q4KJF7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJF7"
FT                   /protein_id="AAY95891.1"
FT                   /translation="MSDPLLIPCPHCNGLNRIPADRLGDHPKCGRCKAEVLLSKPFDLK
FT                   QGDYASQIKGDLPLLVDVWADWCGPCKSFAPVFQQAAAQLSGKCRLAKLDSEANPQLAG
FT                   QLGIRSIPSLILFKNGREVARQSGALPLPQLLSWLRSQGI"
FT   gene            complement(551093..552061)
FT                   /locus_tag="PFL_0483"
FT   CDS_pept        complement(551093..552061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0483"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95892"
FT                   /db_xref="GOA:Q4KJF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJF6"
FT                   /protein_id="AAY95892.1"
FT                   /translation="MRRGFPLNRRLSTTALLLMLLTGCKQTYLTLHFQEEVGNPQQARI
FT                   VPYFAEAITQMAAGIGIEPDAIGLEMDRKDDKTLHISLDSSVPEPQRQRLQALFSEIVE
FT                   ARAAGTFEAVLEIAPQTGRYTTPEYRKRAMALPRRFSLALEPVKYADVLFHYSMEELIS
FT                   GKLAATGTPNEAFCQYQATLQAPGMPFSQMGSKAGSGTGDYNVYLEWKDGKREPAQYLF
FT                   GNITFANPTLNQMLFDNRIQLSAIKTSWGTRADRRADRVGFSVGSLGLQYHEDGEISPL
FT                   QHIGFMGRCEGMAMALGRPFTFYIGRSMDRLVSVELAPPSA"
FT   gene            complement(552070..553014)
FT                   /locus_tag="PFL_0484"
FT   CDS_pept        complement(552070..553014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0484"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95893"
FT                   /db_xref="GOA:Q4KJF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJF5"
FT                   /protein_id="AAY95893.1"
FT                   /translation="MKRRYLLLLPLLLSLAGCKEDFATLHFQESVRSDPKAGPQYSDQL
FT                   VHEAYKHSIYTALGAQGLDPDAIALERDQEDDKVIHLRLVDYSLSPEQRGSLKAILEQV
FT                   VSARNASSMNLRLELDNAHAKVTPSGTSDLPDNIDATLAFEPEFGMLLDRSYEDSMQAI
FT                   VNASEIEGPVSCKITARLAMPRPLKLIAYEALEQDNSERGLISLLTRGGSIAKVPLKVH
FT                   FDDPDLNRLLQHKTVQAWPSSSKITRPAPVPLDEFAIVIGSIGVQTLTSALAFDTRKDE
FT                   LQALCDQKMQALGRPFTFHMGRTLDRLTSVDYR"
FT   gene            complement(553413..553574)
FT                   /locus_tag="PFL_0485"
FT   CDS_pept        complement(553413..553574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95894"
FT                   /db_xref="GOA:Q4KJF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJF4"
FT                   /protein_id="AAY95894.1"
FT                   /translation="MRALISSTCKDAHEPVLHPGHPRPGRLQPGVGRHLPESPRQVPHE
FT                   PAGPAPAR"
FT   gene            complement(553712..555175)
FT                   /locus_tag="PFL_0486"
FT   CDS_pept        complement(553712..555175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02696"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95895"
FT                   /db_xref="GOA:Q4KJF3"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJF3"
FT                   /protein_id="AAY95895.1"
FT                   /translation="MKALDELTFDNRFARLGDAFSTHVLPEPLDNPRLVAASPGAMALL
FT                   DLDPAVAETPVFAELFGGHKLWAEAEPRAMVYSGHQFGSYNPQLGDGRGLLLGEVYNQA
FT                   GEHWDLHLKGAGQTPYSRMGDGRAVLRSSIREFLASEALHALGIPSSRALCVIGSDTPV
FT                   WREKQERGAMVLRLAPSHVRFGHFEYFYYTKKPEQQKQLGEHVLALHFPECQELPEPYL
FT                   AMFREIVERNAELIAKWQAYGFCHGVMNTDNMSILGITFDFGPFAFLDDFDAHFICNHS
FT                   DDQGRYSFSNQVPIGQWNLSALAQALTPFISVEALRESLGLFLPLYQAHYLDLMRRRLG
FT                   FTQAEDDDQKLVERLLQLMQNSGVDYSLFFRRLGEHAPEQALARLRDDFVDRNGFDAWA
FT                   ELYRERVARDPIQGQDLRRARMHAVNPLYILRNYLAQKAIDAAEAGDYSEVRRLHQVLS
FT                   RPFEEQPGMDSYAERPPEWGKHLEISCSS"
FT   gene            complement(555225..558578)
FT                   /gene="kefA"
FT                   /locus_tag="PFL_0487"
FT   CDS_pept        complement(555225..558578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefA"
FT                   /locus_tag="PFL_0487"
FT                   /product="putative potassium efflux system protein KefA"
FT                   /note="identified by similarity to SP:P77338; match to
FT                   protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95896"
FT                   /db_xref="GOA:Q4KJF2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJF2"
FT                   /protein_id="AAY95896.1"
FT                   /translation="MPILRKFFAVALLGLSLSVGAVQGGDPPSAEAVQQSLDKIAERKL
FT                   PEADQKALQTLLQNTLNQLANKQNYEQRLSDLKQQLSNAPRQTSENQRELARLKASKVV
FT                   PVIQRYGSLPVSQLEQLLTERTSLQGDLQKALADANTLDITAQTRPERAQAEISSSQTR
FT                   ILQINAALKSGKDGGKLLSADQRNLLNAELAAINALIPLRRQELAGNSQLQDLGSSQHD
FT                   LLMEKTARLEQEIQDLQTLINQKRLAQSQETVTQQSIEAQKAGSSSLLATESASNLRLS
FT                   DYLLKSTDRLNELTQQNLLTKQQLDSVTQSDAALDEQINVLKGSLLLSKILYKQKQALP
FT                   RLKLDRDLADEIADIRLYQFEVNQQRELLGSPSTYVDNLLKNQPPEQVTPQLRRTLIDL
FT                   AITRADLLERLNRELSALLNESITLQLNQKQLLSTSQSLRATLDEQMFWIPSNKPLDAE
FT                   WLQSVPVRLERQVTTLPWASSLSELTDGLAQRPLLFLPLALLFGALLWRRKALYARLNK
FT                   VHKDIGHFKRDSQWHTPLAILVNILLAMPVTLVLALCGYALQIDARGQNANLGAALLQI
FT                   AQAWLVFYTAYRILAPGGVAELHFRWEKPQVEFLQGWVRRLGLVVLALVAVVAVAEHQP
FT                   AALAEDVLGIAVVLTCYALMAWLLSRLLLSSPTHQNTSLFRKAVGVLFTLLPIALFIAV
FT                   CFGYYYTALKLSDRLINTLYLLMFWLVIEATFVRGLSVAARRLAYQRALSKRQAAKEAG
FT                   ESGEAVVEEPTLDIEKVNEQSLRLIRLALLGGFMAALYWVWADLITVFSYLDNVTLYEY
FT                   TSGTGANMSMVPISIGDVIGALIIVGITFALARNLPGLLEVLVLSKLDLAQGSAYATTT
FT                   LLSYAIAGIGFVATLSTLGVSWDKLQWLVAALSVGLGFGMQAIFANFISGIIILFERPV
FT                   RIGDTITIGNLSGTVSKIRIRATTITDFDRKDIIVPNQTFITGQLINWSLTDTITRVTL
FT                   KLGVDYGSDLDLVKELLLKAARENPRVLKEPEPHVYFLNFGESTLDHELRMHVRELGDR
FT                   NPVVDEVNRFINREFKKQHINISFRQMEVYLKNLHGQEYKMVPIEPEAKTIVPVAEGKP
FT                   LQEPPASKLD"
FT   gene            complement(558641..560383)
FT                   /gene="cvrA"
FT                   /locus_tag="PFL_0488"
FT   CDS_pept        complement(558641..560383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvrA"
FT                   /locus_tag="PFL_0488"
FT                   /product="cell volume regulation protein A"
FT                   /note="identified by similarity to SP:P76007; match to
FT                   protein family HMM PF00999; match to protein family HMM
FT                   PF02080; match to protein family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95897"
FT                   /db_xref="GOA:Q4KJF1"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR023729"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJF1"
FT                   /protein_id="AAY95897.1"
FT                   /translation="MNATTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMTA
FT                   GVDGGGIIFDNYPTAYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVLITTG
FT                   LTGMAAAWLFDLNLIQGLLIGAIVGSTDAAAVFSLLGGKGLNERVTASLEIESGSNDPM
FT                   AVFLTVTLIDMLASGHTGLHWSLLTDLIREFGIGAVIGLGGGWLMLQLVNRIHLATGLY
FT                   PILVVAGGLVVFALTNALHGSGFLAVYLCGLVIGNRPVRSRHGILHMLDGMAWLAQIGM
FT                   FLVLGLLVTPHDLLPIALPALGLALWMILFARPLSVLVGLAPFKAFHGREKAFISWVGL
FT                   RGAVPIILAVFPLMAGLPNAQLYFNLAFFIVLISLLVQGTSLPWVAKWLKVTVPPEPAP
FT                   ISRAALEVHVTSEWELFVYRLGAEKWCIGAALRELKMPEGTRIAALFRGQQLLHPSGST
FT                   VLEADDLLCVIGHEHNLPALGKLFSQAPERGLDLRFFGDFVLEGDAQLGAVSALYGLKL
FT                   DGQDADMPLGAFIAQKVGGAPVVGDQVEWNNTIWTVAVMDGNKIGKVGVRFPEGSRPGP
FT                   GLFL"
FT   gene            complement(560560..562197)
FT                   /locus_tag="PFL_0489"
FT   CDS_pept        complement(560560..562197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0489"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95898"
FT                   /db_xref="GOA:Q4KJF0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJF0"
FT                   /protein_id="AAY95898.1"
FT                   /translation="MVPTMSLRNMNIAPRAFLGFAMIGGLMLILGVFALNQMSKIRGAA
FT                   EDITSSSVPSIKSLDEFTQLTLRLRVLSYRLLVNREPDVQQKTIELLEMRNQQIRAAQV
FT                   IYEKFITSPEEKSAYEQYLQLLGQYRQIEERMKSLSRNNQVDELRNLLNTELLNNSEAM
FT                   NTVLNRLLEINTQQTVDTNQQAAEQYSSAFNLVVALLVLATGLTFLFAWLLTRSITQPI
FT                   ANALGAAEEIAEGNLTRPIKVDGSDEAGRLLQAMAKMQEKLRDTLQRISGSATQLASAA
FT                   EELNSVTEESARGLTQQNNEIEQAATAVNEMTSAVEEVARNAVSTSEASKNATASAGDG
FT                   RDLVQETVSAIERMSSDVQGTASLIGDLANESRDIGKVLDVIRGLADQTNLLALNAAIE
FT                   AARAGEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQSGTEHAVDSMRNSTERAES
FT                   TLNIARGAGLSLDTINSAIIEINERNLVIASAAEEQAQVAREVDRNLVNIRDLSVQSST
FT                   GANQTSAASNELSRLAVDLNGMVARFRL"
FT   gene            complement(562380..564005)
FT                   /locus_tag="PFL_0490"
FT   CDS_pept        complement(562380..564005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0490"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95899"
FT                   /db_xref="GOA:Q4KJE9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE9"
FT                   /protein_id="AAY95899.2"
FT                   /translation="MSLRSLNIAPRAFLGFALIGCLMLFLGVFALNQMGKIRSATERMS
FT                   QDTIPSIKSVDEFTQLSLRQRVQAYRLLLNREPQAQQQTLDAIDQRNQKIEEARAQYLK
FT                   LISSPEERLAYEQYGTLLSHHRQLESQLIELSHNNQLEAMQQLLNTDLMDSAEKINAVL
FT                   NQLVEINSHYATVADDDAAAQYRRAFNLVVGLLVLASALTLLFAWRLIRSITQPIANAL
FT                   RAAEEIAEGNLTRPITVDGSDEAGRLLQAMVTMQEKLRDTLQSISGSAHQLASAAEELN
FT                   SVTEEGARGLTQQNNEIEQAATAVNEMTSAVEEVARNAVSTSEASKSATTSAGDGRDLV
FT                   RETVSAIERMSSDVQGTASLIGDLANESRDIGKVLDVIRGLADQTNLLALNAAIEAARA
FT                   GEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQSGTEHAVDSMRNSTERAESTLSI
FT                   ARGAGQSLDTINSAISEINERNLVIASAAEEQAQVAREVDRNLVNIRDLSVQSTTGANQ
FT                   TQAASSELSRLAVDLNNLVTRFKL"
FT   gene            564266..564547
FT                   /locus_tag="PFL_0491"
FT   CDS_pept        564266..564547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95900"
FT                   /db_xref="GOA:Q4KJE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE8"
FT                   /protein_id="AAY95900.1"
FT                   /translation="MTFLYRTRPLQKARKIKMLEASLSQLEQLVSDLVVQNQELLGTNA
FT                   ALKEQLDQAKDENESLQLSLMEQEEKQGATAARIQALVERVSASPANP"
FT   gene            564544..564846
FT                   /locus_tag="PFL_0492"
FT   CDS_pept        564544..564846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05164"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95901"
FT                   /db_xref="GOA:Q4KJE7"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE7"
FT                   /protein_id="AAY95901.1"
FT                   /translation="MRHHIDGVKVVSILGEDYSIKAPAGEEQTLMDAALMLKAALADTK
FT                   KKYPTLIGERLLVLAAMNLCSQQIEMQKRHAQELERYQEQVSATVEVIAKTIQQN"
FT   gene            564821..566902
FT                   /locus_tag="PFL_0493"
FT   CDS_pept        564821..566902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0493"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95902"
FT                   /db_xref="GOA:Q4KJE6"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE6"
FT                   /protein_id="AAY95902.1"
FT                   /translation="MPRPFNRTDGTAHSRRVIGWTNITNVCIQPSAAGATFQPLIPIRK
FT                   RCSMQFWRRSIQWQLVLSMGSALLVSLLVVVAVYTVVINHLTQNYLVDKALPSSIEAMR
FT                   NDIERILAQPLTVARDIASNGMLRDWLAGGEDPAQAQVFVDYLEGIRAENQAFTTLMVG
FT                   TATNHYYNEKGLDRTLSRSNPKDAWFYSFIDSDKPRLLNIDTDVATGELAMFIDMRVKK
FT                   DGKLVGVAGLGLKMQALSQLIHDFSFGEHGKVYLVRADGLIQVHPEAQFSGKRHLSEQI
FT                   GESAAQAVMGHEGLASSRFVRDGEDFVALSLPLRGMGWSLVAEVPEAQIYADARQTLWL
FT                   TTGIGLAIALVCLLLVIWLARGLVRPVRQVTAGLVAIGSGGGDLTLRLDASRADELGDL
FT                   ARGFNRFLDSQHGMIGEVLATTERLRSSVGQVAAVVENTAERSGRQQEMTDMVATAVHQ
FT                   MGLTVQDIARNAGQAADASQAARDEAQLAQGVVDGSIRHIESMSGEIALAASAVSELAH
FT                   QVASIDQVLAVIRGVSEQTNLLALNAAIEAARAGEMGRGFAVVADEVRTLAQRTQASTD
FT                   EIQQMIQSLKQGAENAVASMHAGQSATGTGVQSSQQTGASLTAITGQVEHISDMNQQVA
FT                   TATEEQSAVTEEINRNVQGISDLARATAAEVQACREDCRTLQRLSEDLARQVGGFKLH"
FT   gene            complement(567157..568959)
FT                   /locus_tag="PFL_0494"
FT   CDS_pept        complement(567157..568959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0494"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /EC_number="1.3.8.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95903"
FT                   /db_xref="GOA:Q4KJE5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE5"
FT                   /protein_id="AAY95903.1"
FT                   /translation="MSETLLSSRNLAFELYEVLDAEGLTQRERFAEHNRETFDAALGTA
FT                   RSIAEKFFAPHNRKGDEHEPRYEDGQAVLIPEVKPAVDAFLEAGFLNAARSFEAGGMQL
FT                   PTLLSQACFAHFQAANAASTSYPFLTMGAANLIESFGTEEQKQRFLQPMIDGRFFGTMA
FT                   LTEPHAGSSLSDIRTRAEPAADGSYRLKGNKIFISGGDHPLSENIVHMVLAKLPDAPPG
FT                   VKGISLFIVPKFLVNDDGSLGPRNDVLLAGLFHKMGWRGTTSTALNFGDNGQCVGYLVG
FT                   KPHHGLSYMFQMMNEARIGVGMGAVMLGYAGYLYSLEYARERPQGRLPDSKDPSTAPVA
FT                   IIQHADVRRMLLTQKAYVEGAFDLGLYAARLFDDTTTLADAAERQQAHELLDLLTPIVK
FT                   SWPSEFCLKANELAIQILGGHGYTREYPVEQYYRDNRLNPIHEGTHGIQSLDLLGRKLA
FT                   QNGGAGLKHLVRLIAETGERARAHQSLDALRLPLEQLVTRLQNVTLGLLGDLASGKVTG
FT                   TLANSALYLKAFGHAVIGWRWLEQAIRAEEGLARAVAADRDFYLGKLQAARYFLTWEVP
FT                   GCQHELALLEARDDTCLSMQDAWF"
FT   gene            complement(569237..573190)
FT                   /gene="putA"
FT                   /locus_tag="PFL_0495"
FT   CDS_pept        complement(569237..573190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="PFL_0495"
FT                   /product="proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /EC_number="1.2.1.88"
FT                   /note="identified by similarity to SP:P09546; match to
FT                   protein family HMM PF00171; match to protein family HMM
FT                   PF01619; match to protein family HMM TIGR01238"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95904"
FT                   /db_xref="GOA:Q4KJE4"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR024090"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE4"
FT                   /protein_id="AAY95904.1"
FT                   /translation="MATTTLGVKLDDPTRERLKAAAASIDRTPHWLIKQAIFNYLEKLE
FT                   GGATLTELSSATAKDGEDAGEVQTDHAHQCFLEFAESILPQSVLRASITAAYRRPEPEV
FT                   VPMLLEQARLPAATAEAANKLAASIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVAL
FT                   MCLAEALLRIPDKGTRDALIRDKISTGNWQPHLGNSPSLFVNAATWGLLLTGKLVSTHN
FT                   EAGLTSSLSRIIGKSGEPMIRKGVDMAMRLMGEQFVTGETIAEALANASKFEAKGFRYS
FT                   YDMLGEAALTEHDAQKYLASYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQY
FT                   ERVMEELYPRLLSLTLLAKQYDIGLNIDAEEADRLELSLDLLERLCFEPQLTGWNGIGF
FT                   VIQAYQKRCPYVIDYVIDLARRSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKV
FT                   YTDVSYIACARKLLSVPEVIYPQFATHNAHTLSAIYHIAGQNYYPGQYEFQCLHGMGEP
FT                   LYEQVVGKVAEGKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADQSISIQ
FT                   ELVADPVTQIEQMATLEGGFGLPHPRIPLPRDLYGAERANSAGIDMANEHRLASLSCAL
FT                   LATAHNNWKAAPMLGCAASSETPAPVLNPSDHRDVVGHVQEATVEDVDNAIQCALNAAP
FT                   IWQATPPAERAAILERAADLMEGEIQPLMGLLAREAGKTFANAIAEVREAVDFLRYYAV
FT                   QARNDFSNDAHRPLGPVVCISPWNFPLAIFSGQVAAALAAGNPVLAKPAEQTPLVAAQA
FT                   VRLLLEAGIPEGVLQLLPGQGESVGARLVGDERVKGVMFTGSTEVARLLQRNIAGRLDN
FT                   QGRPIPLIAETGGQNAMIVDSSALTEQVVIDVVSSAFDSAGQRCSALRVLCLQEDSADR
FT                   VIEMLKGAMAENRLGNPERLSVDIGPVIDAEAKAGIEKHIQAMRDKGRNVYQMAIADGE
FT                   ECKRGTFVMPTLIELESFDELQREIFGPVLHVVRYKRKEIDQLIAQINASGYGLTLGVH
FT                   TRIDETIAKVVDNVHAGNVYVNRNIVGAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLST
FT                   RPVDAIEQSFARGDAENAPDLRLREVLSKPLNALQAWAESSKLAELAILCKQFAGQSQS
FT                   GITRQLTGPTGERNSYAILPREHVLCLAEVEGDLLTQLAAVLAVGGSAVWPESEISKAL
FT                   FARLPKEVQARIQRVADWSKDEVVFDAVLHHGDSDQLRSVCQQVAQRAGAIVGVQGLSH
FT                   GETAIALERLVIERALSVNTAAAGGNASLMTIG"
FT   gene            573654..575138
FT                   /gene="putP"
FT                   /locus_tag="PFL_0496"
FT   CDS_pept        573654..575138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="PFL_0496"
FT                   /product="sodium/proline symporter"
FT                   /note="identified by match to protein family HMM PF00474;
FT                   match to protein family HMM TIGR00813; match to protein
FT                   family HMM TIGR02121"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95905"
FT                   /db_xref="GOA:Q4KJE3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE3"
FT                   /protein_id="AAY95905.1"
FT                   /translation="MSASNPTLITFVIYIAAMVLIGFMAYRSTNNLSDYILGGRSLGSV
FT                   VTALSAGASDMSGWLLMGLPGAIYMSGLSESWIAIGLIVGAYLNWLFVAGRLRVQTEHN
FT                   GDALTLPDYFSSRFEDKSGLLRIISAVVILVFFTIYCASGIVAGARLFESTFGMPYETA
FT                   LWAGAAATIAYTFVGGFLAVSWTDTVQATLMIFALILTPIIVLLATGGVDTTFLAIEAK
FT                   DPTNFDMLKNTTFIGVISLMGWGLGYFGQPHILARFMAADSVKSIAKARRISMTWMILC
FT                   LGGTVAVGFFGIAYFSAHPEVAGPVTENPERVFIELAKLLFNPWIAGVLLSAILAAVMS
FT                   TLSCQLLVCSSALTEDFYKAFLRKHASQLELVWVGRAMVLVVALIAIAMAANPENRVLG
FT                   LVSYAWAGFGAAFGPVVLISVIWKGMTRDGALAGIIVGAVTVILWKHFALLGLYEIIPG
FT                   FIFASLAILLVSKMGTPSAGMVQRFEAAEKDFKLNH"
FT   gene            complement(575323..575817)
FT                   /locus_tag="PFL_0497"
FT   CDS_pept        complement(575323..575817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95906"
FT                   /db_xref="GOA:Q4KJE2"
FT                   /db_xref="InterPro:IPR018681"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE2"
FT                   /protein_id="AAY95906.1"
FT                   /translation="MIVRYVKITMTLAVAAFALLVAYNNISDYGSNFAFVQHVLSMDSV
FT                   FPGNSATDRALTLPLLWNAGYWLIIAGEALTGALLVFGALRLWLARHGVASDFNRAKRW
FT                   AIAGFCLGFCVWFFGFMVVGGEWFMMWQSKAWNGQDAAFKFYMAILGVLIFLNQPDTEL
FT                   H"
FT   gene            complement(575926..577197)
FT                   /gene="cysD"
FT                   /locus_tag="PFL_0498"
FT   CDS_pept        complement(575926..577197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="PFL_0498"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="identified by similarity to SP:O13326; match to
FT                   protein family HMM PF01053; match to protein family HMM
FT                   PF01212; match to protein family HMM TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95907"
FT                   /db_xref="GOA:Q4KJE1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE1"
FT                   /protein_id="AAY95907.1"
FT                   /translation="MKDATIALHHGFKSDPTTKAVAVPIYQNVAFEFDNAQHGADLFNL
FT                   DVPGNIYTRIMNPTNDVLEQRMAALEGGIAGLAVAAGSAAIHYAIQTLTQAGDNIVSTP
FT                   QLYGGTYTLFAHLLPSFGVEVRFARDDSPEAIAELIDDKTKLVYCESIGNPAGNIVDIE
FT                   GLAQAAHARNVPLMVDNTVATPILCKPIQFGADIVVHSVTKYVGGHGNSLGGVIVDSGN
FT                   FPWADHPQKFASLNTPEPAYHGVVYTEKFGPAAFIARARTVPLRNTGAALAPMNAFLLL
FT                   QGLETLALRMERHTDNALKVAQFLKAHPLVVWVSYAGLPDHPHHELARKYMQGKPSAIL
FT                   SFGLKGGYAAGVRFYDALQIFKRLVNIGDAKSLACHPASTTHRQMNEEEQAKAGVKPEM
FT                   IRLSVGIEAIEDLLEDLDQALQQA"
FT   gene            complement(577447..578871)
FT                   /locus_tag="PFL_0499"
FT   CDS_pept        complement(577447..578871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0499"
FT                   /product="putative glycerol kinase"
FT                   /note="identified by similarity to SP:P44400; match to
FT                   protein family HMM PF00370; match to protein family HMM
FT                   PF02782"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95908"
FT                   /db_xref="GOA:Q4KJE0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042021"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJE0"
FT                   /protein_id="AAY95908.1"
FT                   /translation="MRIAALDQGTTSTRVLVVDMQGRADIQLALRHQQHHPRPGWVEHD
FT                   PLELLANLQRCLEATGRVDAIGLANQGESCLAWDAVSGAPLSPVIVWQDNRSAARIEEL
FT                   RASGAEALTLERAGLPLDAYFSASKLAWIVDNLPAAQAALSAGRLRLGTTDAYFLDRLT
FT                   GVYATDITTASRTSLMNLATGQWDPQLCQLFGVPMQALPEIRATVGDFGRIGQTPISAS
FT                   VVDQQASLYGHGCREPGDAKITFGTGAFALTVTGEQIIRAPEKGLLATVAWQADGKPVY
FT                   AMDGGVYDASAAVEWAGRLGLFSDFSELAAFDQPPAISRELAFVPALSGLACPHWDRSA
FT                   GAVWIGMNAATTRQDLCQAVLEGVALRSAEVITAMDDHLNVTDQLSIDGGLARSPYFAQ
FT                   FLADILQRTIVTQRFDELTALGCAALAARGLGLELPELDNTRTDYRPRIDRATADAWRC
FT                   TFSAAVKRSQGWSQPH"
FT   gene            complement(578874..580130)
FT                   /locus_tag="PFL_0500"
FT   CDS_pept        complement(578874..580130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0500"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95909"
FT                   /db_xref="GOA:Q4KJD9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD9"
FT                   /protein_id="AAY95909.1"
FT                   /translation="MNSTELLQAEAAIIGSGPAGLAAAIELRRQGIGPVIVIERESEAG
FT                   GIPRHCAHPPFGMREYQRLLSGPAYARRNVEAALKAGVILLLRHTVVSLEPGGLLHLAT
FT                   PDGPRQIQAQKVLIATGARETPRSARLLSGDRPVGVINTGALQNFLYVQHLKPFERPLI
FT                   IGTELVSLSAVLSCRRAGIRPVAVLEANKRATARWPLSVFPRLLGIPMHFGAELLAING
FT                   CGRVESARVRLADGQVRDISCDGVLLTGQFTPESSLVRLSHLQLDNGSGGPKIDQYGRC
FT                   SDPAYFAAGNLLRPIETAGWSYREGRRIGSLMALALSGQLPDANDALTLKYAAPIKLGV
FT                   PGRLVRGELAGLAHIQLRVSQAVSGTLRVRAQGLELWSRPVSALPERRLLIPIKDLHLP
FT                   EHFDQLDICIDQAVPQQEK"
FT   gene            complement(580117..581499)
FT                   /locus_tag="PFL_0501"
FT   CDS_pept        complement(580117..581499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0501"
FT                   /product="oxidoreductase, FAD-dependent"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95910"
FT                   /db_xref="GOA:Q4KJD8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD8"
FT                   /protein_id="AAY95910.1"
FT                   /translation="MTFDVAIVGGGVVGCAMARRFALEGARVVLLEKGSDILSGASKAN
FT                   SAILHTGFDAPSGSLELQCMQAGYQEYLEIHSAMNLPLLKSGALVVAWNAEDQARLPGI
FT                   LAQAQANGVDNVRLLERSEILALEPHLANHAVGAVLVPDEHLIDPWSAPLGYLQQAMAH
FT                   GARVQLQCEVQQGQFDGDAWTLHTNRGTLRSAQVINCAGLFGDTLEHNLLGHSEFRIMP
FT                   RKGQFVVFDKAAATLLERIVLPVPNERTKGIVLTRTVYGNLLVGPTAEEQEDRVHAGLD
FT                   GPTLQSLIDAAVERIPALAGMPVTATYAGLRPASEKKEYRIQADHARHWITVGGIRSTG
FT                   LTAALGIARHVYGLYSQRRQHQPVREPVWPQMPNLAEHLPRDWQRPGYGEIVCHCELVT
FT                   RREIESALHSPLPPGDLGGLKRRTRACMGRCQGFYCSAQVAELSASQLAVPLATGRCHE
FT                   QH"
FT   gene            complement(581681..582445)
FT                   /locus_tag="PFL_0502"
FT   CDS_pept        complement(581681..582445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0502"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF01022; match to protein
FT                   family HMM PF08220; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95911"
FT                   /db_xref="GOA:Q4KJD7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD7"
FT                   /protein_id="AAY95911.1"
FT                   /translation="MRPNERRQHILELLRQRERISVEELARITATSQETIRRDLSDLAE
FT                   SGLVTKFHGGAALPPTGEHENTFQTRMNEHAQEKRAIGRYAAGLFCAGDSIFIDTGTTT
FT                   LFFARELAQHTRLTVITNSLPIAGCIGESGNRVFMIGGEYRPDSTQNVGTLALEQITRF
FT                   NAEHAVITIGALNEDGAMDFSIEEAEVARAMIAQARQLTVIADSSKLERRGLFKVFPLE
FT                   RIDRLVIDRQPGPELLAALEKAGVEVHLVPQP"
FT   gene            582828..584063
FT                   /gene="eutH_2"
FT                   /locus_tag="PFL_0503"
FT   CDS_pept        582828..584063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutH_2"
FT                   /locus_tag="PFL_0503"
FT                   /product="ethanolamine utilization protein EutH"
FT                   /note="identified by similarity to SP:P76552; match to
FT                   protein family HMM PF04346"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95912"
FT                   /db_xref="GOA:Q4KJD6"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD6"
FT                   /protein_id="AAY95912.1"
FT                   /translation="MAEFGNYVIYLIMLGAVIGALSSIIKPESGLGKEFVNGIHSIGPV
FT                   FLAQAGIMVAIPYLSQGISHALGPFFNALGSDVSIAALSIIAVDMGGYQLANALTANRD
FT                   LWITAMLVGYTSGATIVYLIPVGLTMLERKDHKYLALGAMAGLISIPFAVLMSLLIITA
FT                   THLPVRDIVSTNSEALYYLSLGFVDMLKLLAPLFVFCFLLAAGLRYRPQMMVRGFLVFG
FT                   KIMDAAIKLILALSIVEHFTKFFSINFGGWGFDPMFADEKELFRAIEIAGYIGIMLAGT
FT                   FPICYLFQRYCKKPMELLGRHLNLSSTGAAGFIMVFANIIATFHLFKHMTARDKVLCVA
FT                   LGVCAQALIGDHLAFTANFQPSLILPILLGKLFGGLLAVAIAIRISVPAAQRYELQEQE
FT                   QAAAFALQPARA"
FT   gene            584100..584456
FT                   /locus_tag="PFL_0504"
FT   CDS_pept        584100..584456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09152"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95913"
FT                   /db_xref="GOA:Q4KJD5"
FT                   /db_xref="InterPro:IPR015235"
FT                   /db_xref="InterPro:IPR027269"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD5"
FT                   /protein_id="AAY95913.1"
FT                   /translation="MRKIFLACPYSHSEPAVINERFLQCNQVAAQILEAGHAVFSQVSM
FT                   SHPINLCLAGKDNAAIGKLWAPVDALYMAMMEELIVLDLPGWKDSGGIKREIEVFETSG
FT                   RRVSLWSQVSHEFV"
FT   gene            584560..585396
FT                   /locus_tag="PFL_0505"
FT   CDS_pept        584560..585396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04378"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95914"
FT                   /db_xref="GOA:Q4KJD4"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD4"
FT                   /protein_id="AAY95914.1"
FT                   /translation="MNYRHAFHAGNHADVFKHLTLTRLIALMSRKEQPFAYLDSHAGIG
FT                   LYDLKGDQATRTGEYLEGIARLWGDEDLPALTADYMQVLHKMNPDGELRYYPGSPELAR
FT                   RLTRSQDRVLLNEKHPEDGLLLKDNMKGDRRVAVHLGEGWHVARALLPVAEKRAVMLID
FT                   PPFEQLDEMQRCAASLKEAIGRMRQTVAAIWYPVKDQRALRRFYQDLAGTGAPKLLRVE
FT                   LLVHPLDTPNSLNGSGLAIANPPWGLEEELRELLPWLSKKLGQTQGGWQMDWLIAE"
FT   gene            complement(585459..586106)
FT                   /gene="msrA_2"
FT                   /locus_tag="PFL_0506"
FT   CDS_pept        complement(585459..586106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA_2"
FT                   /locus_tag="PFL_0506"
FT                   /product="peptide-methionine (S)-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="identified by match to protein family HMM PF01625;
FT                   match to protein family HMM TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95915"
FT                   /db_xref="GOA:Q4KJD3"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD3"
FT                   /protein_id="AAY95915.1"
FT                   /translation="MVLRSEILVNKNVLPTKEQALPGRETPMALPAEHYVNGNPLLGPF
FT                   PGNVDFAIFGLGCFWGAERRFWQREGVFSTCVGYAGGFTPNPTYEEVCSGLTGHTEVVL
FT                   VVYEPEKVSYKELLAMFWELHNPTQGMRQGNDIGTQYRSVIYATNPTQLEQALHSRDVF
FT                   QAELTKAGLGTITTEIEEAPTVYFAEAYHQQYLAKNPEGYCGIGGTGVTCPI"
FT   gene            complement(586181..588874)
FT                   /locus_tag="PFL_0507"
FT   CDS_pept        complement(586181..588874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0507"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF00990; match to protein family HMM PF01590;
FT                   match to protein family HMM PF08447; match to protein
FT                   family HMM PF08448; match to protein family HMM TIGR00229;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95916"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD2"
FT                   /protein_id="AAY95916.1"
FT                   /translation="MKSQPDAASRMAAEVVTQLPVPSRLGMLRFERLNEASWALLFLDP
FT                   NCERQFGLPAVELCALVGSPYASLMEPEARYQLHDTIQQQLSNSSHYLIRYTLHTAQGP
FT                   LSILELGEAYKQHNRHLLRGYLLVVEGLFSDASALPALDLETQNTRLQIALELNQRAQQ
FT                   EQLQHLERVRAQQDLILLLTRQRYSTGNSLKEAAELITRSACDIYQIDCASIWNLEDQQ
FT                   LVPIAAYHRGPQEYRMPESIDASSFPDYLEALHSCRAIDAQNAMRDPRTREMAESLRPR
FT                   DVNAMLDASIRIDGQVVGVLCLEQTGMTRAWQSDEIAFAGELADQFAQVINNHNRRAAT
FT                   SALHLFQRAVEQSANAFLLVNCDGVVEYVNPSFTAITQYSTEEVHGHRLSELPALENLS
FT                   ELLFDAPSSLAKSNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGIYEDITQT
FT                   KLAQQRIERLAYTDNLTNLGNRPAFIRNLDERFARDSDTPISLLLVDIDNFKRINDSLG
FT                   HQTGDKLLISLARRLRNSLSPSGSLARFASNEFAVLLDNTDLETGQQIASQLLMTLDKP
FT                   MFVDNQLISVTGSVGLASAPLHGRDPQTLMRNAGLALHKAKANGKHQVQVFTEALNAEA
FT                   SYKLFVENNLRRALTQNELDVFYQPKLCLRSGRLLGMEALLRWNHPEKGMIRPDQFISV
FT                   AEETGLIIPIGKWIARQACRMSKQLTAAGMGNLHVAINLSPKQFSDPDLVASIASILKE
FT                   EQLPSSLLELELTEGLLLEATDDTHQQLEQLKKLGLTLAMDDFGTGYSSLSYLKKFPID
FT                   IIKIDRSFIHEIPDNQDDMEITSAVIAMAHNLKIKVVAEGIETAEQLAFLRRHRCDVGQ
FT                   GYLFDRPIPGSELIAKLKRYPRGPIA"
FT   gene            complement(589186..591135)
FT                   /gene="aceF"
FT                   /locus_tag="PFL_0508"
FT   CDS_pept        complement(589186..591135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="PFL_0508"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase, long form"
FT                   /EC_number="2.3.1.12"
FT                   /note="identified by similarity to SP:P06959; match to
FT                   protein family HMM PF00198; match to protein family HMM
FT                   PF00364; match to protein family HMM PF02817; match to
FT                   protein family HMM TIGR01348"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95917"
FT                   /db_xref="GOA:Q4KJD1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD1"
FT                   /protein_id="AAY95917.1"
FT                   /translation="MSELIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASME
FT                   VPAPKAGVIKSLKVKLGDRLKEGDELLELEVEGAAAAAPAAAPAAKAEAKPAAAPAAAS
FT                   APAAAPAAASVQQVHVPDIGSSGKAQIIEIQVKVGDKVEADQSLITLESDKASMEIPSP
FT                   AAGVVKAISVKLNDEVGTGDLILDLEVAGAAAPAAAPAQAAAPAAAAAPAPAAAPAAPV
FT                   ADSVQDIHVPDIGSAGKAKIIEVLVKAGDSVEADQSLITLESDKASMEIPSPAAGVVES
FT                   VSIKLDDEVGTGDLILKLKVKGAAPAAAPAPAAAPSAPAPAAAAAPAAAAPAAAPAAAP
FT                   AKPGAKVHAGPAVRQLAREFGVELSAVGASGPHGRILKEDVQVYVKAMMQKAKEAPAAG
FT                   GATGGAGIPPIPVVDFSRFGEIEEVPMTRLMQAGAANLHRSWLNVPHVTQFDSADITEL
FT                   EAFRVAQKAVAEKAGVKLTILPLLLKSCAHLLKELPDFNSSLAPSGKAIIRKKYVNIGF
FT                   AVDTPDGLLVPVIKNVDQKSLLQLAAEAASLAEKARTKKLSADEMQGACFTISSLGHIG
FT                   GTGFTPIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTK
FT                   RLSDLLADIRTILL"
FT   gene            complement(591147..593792)
FT                   /gene="aceE_2"
FT                   /locus_tag="PFL_0509"
FT   CDS_pept        complement(591147..593792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE_2"
FT                   /locus_tag="PFL_0509"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring),
FT                   homodimeric type"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by similarity to SP:P06958; match to
FT                   protein family HMM TIGR00759"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95918"
FT                   /db_xref="GOA:Q4KJD0"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJD0"
FT                   /protein_id="AAY95918.1"
FT                   /translation="MQDLDPVETQEWLDALESVLDKEGEDRAHYLMTRMGELATRSGSQ
FT                   LPYAITTPYRNTIPVTHEARMPGDLFMERRIRSLVRWNALAMVMRTNLKDSDLGGHISS
FT                   FASSATLYDIGFNYFFQAPTDEHGGDLIYFQGHASPGVYARAFMEGRITEDQMNNFRQE
FT                   VDGNGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEARGFIPAGKQKVWCF
FT                   MGDGECDEPESLGAISLAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGVFRGAQ
FT                   WNVNKVVWGRFWDPLLAKDVDGILQRRMDEVIDGEYQNYKAKDGAFVREHFFNTPELKA
FT                   MVADLSDDEIWKLNRGGHDPYKVYAAYHEAVNHKEQPTVILAKTIKGYGTGAGEAKNTA
FT                   HNTKKVDVDSLKLFRDRFDIPVKDDDIENLPFFKPEEGSAEARYLSERRAALGGFVPQR
FT                   RAKSFSVPTPPLDTLKAILDGSGDREISTTMAFVRILAQLVKDKEIGQRIVPIIPDEAR
FT                   TFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYREDKKGQILEEGINEAGAMSSFIAAGT
FT                   SYSSHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRTTLNGEGLQHED
FT                   GHSHMLAGTIPNCRTFDPTYGYELAVIIQDGMKKMTEEQQDVFYYITVMNESYQQPAMP
FT                   AGVEEGIIKGMYLLEEDTREAAHHVQLMGSGTILREVREAAKILRDEFNVAADVWSVTS
FT                   FNELRRDGLAVERSNRLHPGQKPKLSYVEECLNGRKGPVIASTDYMKLFAEQIRQWVPS
FT                   KEFKVLGTDGFGRSDSRKKLRHFFEVDRHFVVLAALEALADRGDIEPKVVAEAITKFGI
FT                   NPEKRNPLDC"
FT   gene            594176..597115
FT                   /gene="glnE"
FT                   /locus_tag="PFL_0510"
FT   CDS_pept        594176..597115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="PFL_0510"
FT                   /product="[glutamate--ammonia-ligase] adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="identified by similarity to SP:P30870; match to
FT                   protein family HMM PF03710"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95919"
FT                   /db_xref="GOA:Q4KJC9"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC9"
FT                   /protein_id="AAY95919.1"
FT                   /translation="MSLPALAPVPAILLPLVSRAEQSLRGAVAALEGDPGLADWSTERW
FT                   AEFARVGAASDFVIEQSLRDPLMLLELVRSGELDRPFAPGELCAQIAAAVQAAESEDQL
FT                   GRVLRRQRTRQQVRIIWRDLTRQADLVQTCRDLSDLADACIDQAYQWLYLRHTQQFGVP
FT                   TGGRSGEPQQMVILGMGKLGAVELNLSSDIDLIFAYPEGGETVGVKRPLDNQEFFIRLG
FT                   QRLIKALDPMTVDGFVFRVDMRLRPYGSAGALVLSFNALEQYYQDQGRDWERYAMIKAR
FT                   VVAGDQAAGAQLLDMLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMADNIKLGSGG
FT                   IREVEFIAQAFQLIHGGRDLSLQQRPLLKVLGTLEGQGYLPPAVISELREGYEFLRYTE
FT                   HAIQAIADRQTQMLPDNPQDQARIAFMLGFADWNAFHEQLMHWRGRVDWHFRQVIADPD
FT                   EDEGAESEVVVGGEWLPLWEEAQDEEAACRQLQEGGFVDAPKALRALAGLRGSPQLRAM
FT                   QRLGRERLDAFIPRLLAQAVEHANPDLVLERVLPLVEAVARRSAYLVLLTENPGALRRL
FT                   LTLCAASPWIAEQITRFPLLLDELLNEGRLFKPPLAPELAAELRERLTRIPEDDLEQQM
FT                   EALRHFKLAHRLRVAASEIAGSLPLMKVSDYLTWLAEAILEQVLALAWRQTVSKHGAPL
FT                   RTDGTLCDPGFIIVGYGKVGGIELGHGSDLDLVFIHDGDPQAETDGPKPIDGAQFFTRL
FT                   GQRIIHLLTTQTNSGQLYEVDMRLRPSGASGLLVSSLGAFARYQENEAWTWEHQALVRA
FT                   RVLVGSQDVGQAFEKVRAAVLGKKRDLPKLRQEVSEMRAKMRDNLGSRLTAAGTAANAF
FT                   EATAPFDLKQDAGGIVDIEFMVQYAALAWSEEHPSLLRYTDNIRILEGLEQVGLMPASD
FT                   ASLLREVYKAYRSAAHRQALQNEAGIITGDQFVTERREVLRIWRELGLS"
FT   gene            597250..598284
FT                   /gene="rfaF"
FT                   /locus_tag="PFL_0511"
FT   CDS_pept        597250..598284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="PFL_0511"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM TIGR02195"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95920"
FT                   /db_xref="GOA:Q4KJC8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC8"
FT                   /protein_id="AAY95920.1"
FT                   /translation="MNILIVGPSWVGDMVMAQTLFECLKQRHPQCEIDVLAPEWSRPIL
FT                   ERMPQVRRALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIPKR
FT                   TGWRGEFRYGLLNDVRRLDKERYPLMIERFMALAYAPGAELPKPYPRPSLQIDPQSREA
FT                   ALAKFGLSLDRPVLALCPGAEFGEAKRWPSEHYAQVAEAKIREGWQVWLFGSKNDHAVG
FT                   EEIRGRLIPGLREESTNLSGETSLAEAIDLLSCADSVVSNDSGLMHVAAALNRPLVAVY
FT                   GSTSPGFTPPLADRVEVVRLGIECSPCFDRTCRFGHYNCLRQLLPQPVNEALQRLQGSP
FT                   VEVQ"
FT   gene            598286..599347
FT                   /gene="rfaC"
FT                   /locus_tag="PFL_0512"
FT   CDS_pept        598286..599347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /locus_tag="PFL_0512"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM TIGR02193"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95921"
FT                   /db_xref="GOA:Q4KJC7"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC7"
FT                   /protein_id="AAY95921.1"
FT                   /translation="MRVLLIKTSSLGDVIHALPALTDAARAIPGIKFDWVVEEGFAEIP
FT                   TWHPAVGKVIPVAIRRWRKNIWQTIKSGEWRRFKQSVRSTKYDLVIDAQGLLKSAWLTR
FT                   YVRAPVAGLDKNSAREPLASRFYSRRLAVARGQHAVERVRQLFAVALGYDLPQGLGDYG
FT                   LNVEKLVELPRKKPFVLFLHGTTWDTKHWPEAYWRELTERMGMLGVEVKLPWGNPAEKA
FT                   RAERIASGLKNATVLPKLNLAGVAKVLADAQACVAVDTGLGHLAAALDVPTISLFGPTN
FT                   PGLTGAYGRVQIHLGSNFPCAPCLQKKCTYQPTAVDQQRYDLKREWPLCFTRLNPERVA
FT                   SRLSTLLLAEEPR"
FT   gene            599347..600471
FT                   /gene="waaG"
FT                   /locus_tag="PFL_0513"
FT   CDS_pept        599347..600471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaG"
FT                   /locus_tag="PFL_0513"
FT                   /product="lipopolysaccharide core biosynthesis protein
FT                   WaaG"
FT                   /note="identified by similarity to GB:AAD33103.1; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95922"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC6"
FT                   /protein_id="AAY95922.1"
FT                   /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQRRGHQIRVYTLIWEGDV
FT                   PPGFEVLVAPVKALFNHRRNEKLSAWMEADLAKRPVDRLVGFNKMPGLDVYYAADGCFE
FT                   DKAQNLRHSLYRRWGRYRHFAEYERAVFAKDAKTEILMISEVQQPLFIKHYDTPLERFH
FT                   LLPPGIAQDRRAPANAAEIRADFRREFKLKDDDLLLVQIGSGFKTKGVDRSLKALAALP
FT                   SALKKRTRLFVIGQDDPKVFQVQSAALGLSDQVQFMKGRSDIPRFLLGADLLIHPAYNE
FT                   NTGTVLLEALVAGLPVLVSAVCGYAHYIAEAQSGLVLDEPLEQAQLNQYLTTMLTDDAA
FT                   RATWSRNGLAFAETADLYSMPQHAADVILAEQHR"
FT   gene            600468..601274
FT                   /gene="waaP"
FT                   /locus_tag="PFL_0514"
FT   CDS_pept        600468..601274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaP"
FT                   /locus_tag="PFL_0514"
FT                   /product="lipopolysaccharide kinase WaaP"
FT                   /note="identified by similarity to GB:AAG08394.1; match to
FT                   protein family HMM PF06293"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95923"
FT                   /db_xref="GOA:Q4KJC5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC5"
FT                   /protein_id="AAY95923.1"
FT                   /translation="MKLMLAEPFKSLWAGRDAFDAVEGLKGQVYRELEARRTLRTEVDG
FT                   RGYFVKIHRGIGWGEIVKNLVTAKLPVLGAGQEWRALERLHQVGVPTMTAVAYGERGAN
FT                   PADQHSFIVTEELAPTVSLEDFSIGWVKQPPAPALKRALIAEVARMTGMMHRAGVNHRD
FT                   CYICHFLLHTDRPVTPEGLKLSVIDLHRAQTRPKITQRWRNKDLAALYFSALDIGLTRR
FT                   DKLRFLKGYFQQPLRQILAEEAALLAWLEGKAEKLYARKQRYGDAL"
FT   gene            601274..602008
FT                   /gene="wapP"
FT                   /locus_tag="PFL_0515"
FT   CDS_pept        601274..602008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wapP"
FT                   /locus_tag="PFL_0515"
FT                   /product="putative heptose kinase WapP"
FT                   /note="identified by similarity to GB:AAG08393.1; match to
FT                   protein family HMM PF06293"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95924"
FT                   /db_xref="GOA:Q4KJC4"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC4"
FT                   /protein_id="AAY95924.1"
FT                   /translation="MASWNLDPAYQALAEDFGSLEAVFALQGEHLTRDPLSEVIRVERG
FT                   GVNYYVKRYTGAGKNLRRYLGKPRVKFEWQNLKRFAKWGIPTADVVAWGLERRCLAYSR
FT                   GAMITRELPRTEDLSVLAERNDPRLQDRRWVDGVSRQLAAYTRVMHDHRFTHNDLKWRN
FT                   LLVDDQDRLYLIDCPNGDFWRGFWLKYRITKDLACLDKVAKYHLSATQRLRFYLQYRQR
FT                   DHLSAADKERIRHVVRFFEGRE"
FT   gene            602005..602757
FT                   /locus_tag="PFL_0516"
FT   CDS_pept        602005..602757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0516"
FT                   /product="lipopolysaccharide kinase, WaaP family"
FT                   /note="identified by match to protein family HMM PF06293"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95925"
FT                   /db_xref="GOA:Q4KJC3"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027023"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC3"
FT                   /protein_id="AAY95925.1"
FT                   /translation="MTDFLASEERALLERNGLGTFDQLWATQLEAVDEPNTGRGGSSSV
FT                   FRLDVEGQGFYLKRQTNYLTRTLHRPFGEPSFAREFRNIRRYQQLGIPALQAVFFGMRK
FT                   VDGESRAILLTRALDGWDDLDALLLQWDRLSEHQRQAVLQACGQLARQLHGLRQVHGCF
FT                   YPKHIFLRAEGDGYQAQLIDLEKTRPLLFGQRDRVKDLEPLLRRAAVWSGDEVRSLLAA
FT                   YVGQPRDSSLVDAWVARLSARRSHKGAR"
FT   gene            602757..604211
FT                   /locus_tag="PFL_0517"
FT   CDS_pept        602757..604211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95926"
FT                   /db_xref="GOA:Q4KJC2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC2"
FT                   /protein_id="AAY95926.1"
FT                   /translation="MRLSELKNSGRSPTLPLSLELADAAGPAQLQLLSLLRVLPGQRYV
FT                   GAGVWRGRPVLAKLLVGSKAARHFQRELQGVRLLAEQGLTTPLLLADGLQEGEGGWLLF
FT                   ELLQGAQSLGDAWKQVEALPVLADEQAEVLAEALGAIGQLHAKGLWQSDLHLDNLLRHD
FT                   NRLYLIDGAGICVEEAGKPLSRQKVLENLGVFFAQLPKSLEPFTEELLVHYLLSNAEHA
FT                   LPLEALQKQVNKVRGWRLRDFLNKVGRECTLFSVQRGPFALRAIRREEEAAMLPVLEQA
FT                   DALLDQGHLYKTGGAASVGRVEVAGRPLVIKRYNIKGFAHWLKRFWRPSRAWHSWREGN
FT                   RLAFLGIATPKPLALLERRFLWLRRSAYLVTEHLPGPDIIERFAPFVDSGQAPEPELLA
FT                   LDQLFAELIKERISHGDFKGHNLFWQEGRWALIDLDSMCQHSSLSSFALAYARDRARFM
FT                   RNWPQDSNLYQVIDQRLPKTAQGTEA"
FT   gene            604411..606168
FT                   /locus_tag="PFL_0518"
FT   CDS_pept        604411..606168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0518"
FT                   /product="carbamoyltransferase"
FT                   /note="identified by match to protein family HMM PF02543"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95927"
FT                   /db_xref="GOA:Q4KJC1"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC1"
FT                   /protein_id="AAY95927.1"
FT                   /translation="MALTILGLSGALSHDPSAALYIDGKLIAAAEEERFVRDKHAKNRM
FT                   PYESAKFCLEQAGIKPSDVDVVAIPFAPISLFGKARWHYAKRYWYAPDRALDAILMGNR
FT                   RYKRYRNKIVWCLEQLGFDPKKVKIEPVEHHLAHASSAYHCSGFTEKTAILGIDGKGEY
FT                   ATTFFGYGENGKIHKIKEFFDPDSLGGLYGAITEFLGFEMLDGEFKVMGMAPYGDASKY
FT                   DFSRLASFENGELVINTDYANVIGLRRYKEKGKGFYFSPKLIEWLGPKREGDIADEPYI
FT                   HYAASMQALFEKLALQMIDHYLGDILKETGKLAFAGGCALNVKLNQKIIARPEVKELFV
FT                   QPASGDAGTAVGAAAYVSHARGVPVEKMEHVYLGPSYSNEDVIAACARHPNKPAWRQID
FT                   NTPERIAKIMVDGNPVAWFQGRMEFGPRALGGRSIIGCPSATGVADRINEQIKFRERWR
FT                   PFCPSMLDTVGPQMIKVDHPAPFMTFTFEVAEEWKTRVPEVVHEDGTSRAQVLKREYNP
FT                   RYYDMMKALEVLTGNGVSLNTSLNRRGEPMICSPTDALNMFYGSDLQYLIMEDILVVKD
FT                   GVDPYDTLG"
FT   gene            606152..607282
FT                   /locus_tag="PFL_0519"
FT   CDS_pept        606152..607282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0519"
FT                   /product="glycosyltransferase, group 1 family"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95928"
FT                   /db_xref="GOA:Q4KJC0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJC0"
FT                   /protein_id="AAY95928.1"
FT                   /translation="MTRSAERHVLQFCHGYDGPFLDCARQYANLFAGSGYRVTTVFLTG
FT                   AADADVAAGCASDEVLFMEYSSKAIRGLKLGAIRDLRKIAASRNFSFCIAHRFKPIYIA
FT                   LLGTGLPVIGVHHAFSDYKRGSRKLFAQLFRKRLSLLGVSDAVRDDMRACLPKWPAQRI
FT                   QTLYNRIDLEALQAEQLSAAQARSELGLSADAWIVGNVGRLHPDKDQATLLRGFAAALP
FT                   QLPPHSQLAILGTGRLEKDLKSLARELGIADRVLFLGQVPQARRYFRAFDVFALSSDHE
FT                   PFGMVLLEAMAAGVPLLATACGGAREVVEGVGILFPLGDVEHMAQGLQHLAAMDDHQRR
FT                   VCAELMLDRLRERFSDRAVRDVFWRLPQVTDLTARG"
FT   gene            607282..608178
FT                   /locus_tag="PFL_0520"
FT   CDS_pept        607282..608178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0520"
FT                   /product="Mig-14 family protein"
FT                   /note="identified by match to protein family HMM PF07395"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95929"
FT                   /db_xref="GOA:Q4KJB9"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJB9"
FT                   /protein_id="AAY95929.1"
FT                   /translation="MLNRFQGWRERGWSVIDASTYADAWQRFGGSVATHPLVVEQLADL
FT                   AQIPVRYLAWERNGQLQAAIATWGRDLALSKDVLKRAGKKGLFDIGNAELILPAAADAQ
FT                   AVLRHRGRYLSALNEGRLTGLKPQAEQLAMARTPEELSKKFRYNQRRELRLLEEAGGVV
FT                   RPVSDFSSPELAAIYCDLFQRRWGFAATGAERMAEVLERLRELLIGSVIFLNDAPIAVQ
FT                   LIYRVEAPEWISVEYVNGGVDPETREFSPGSVLSFLNTQSAWEQARALNKPLRFSFGRA
FT                   DREYKDRWCNPVPVFQV"
FT   gene            608187..609599
FT                   /locus_tag="PFL_0521"
FT   CDS_pept        608187..609599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0521"
FT                   /product="N-acetylglucosaminylphosphatidylinositol
FT                   deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95930"
FT                   /db_xref="GOA:Q4KJB8"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJB8"
FT                   /protein_id="AAY95930.1"
FT                   /translation="MSRKQQLLKRHRRNKRIALLIGLVLLLVAGILVTWWVPVLLAVLA
FT                   WLAHEAWFADHLFYSPKDDYCYDFGSDAQQAAVRLEAGRLLLEAPLALAGNETLVLGVH
FT                   VKSSWLGRFLDPAVEVSGGPLADRQVFERGVNGLRYLNLSGLASSLVSGELRLRGRFCR
FT                   LRIQPQLMFWRDPDYRRQRVMVIAPHADDAELAAFGLYSQADEAWIVTLTAGEIEAEHY
FT                   QAMGMNPAEAARIKGRLRAWDSITVPRWAGVPESHCVQLGYFCLQLPAMQASPEQPVAS
FT                   REAQLSDIRLFRQFNPFPLPADQDGLPTWNNLLADLRELLLKARPEVIVLPHPTLDPHP
FT                   DHICAREAVMQALEGLAWQPTTILGYANHLHDNDRWPMGDSGAGIALPPVFESTAVLRP
FT                   WCLSLSQGEQYDKAMALGMMHDLQPKMPFKRRLRRSIQWLMASRMPSALGENEFFRKAV
FT                   RRHELFWLLQQR"
FT   gene            609652..610530
FT                   /locus_tag="PFL_0522"
FT   CDS_pept        609652..610530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0522"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95931"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJB7"
FT                   /protein_id="AAY95931.1"
FT                   /translation="MINPRPRILFLMPYFGRWPFWMPFFLESCRRNPDIDWLFFSDCGT
FT                   PDNLPPNVKLENMSFAEYCALVSRRLEIDFAPNAAYKLCDIRPAMGYIHIDRLEGYDFW
FT                   AFGDIDLVYGDLRAYFTADRLAGYDLFSTHERRVAGHLCLIRNTARKLELFRQIKDWQT
FT                   RFTDQQHHALDEGAFSRIFLWRKNFPEPLFKLVGKFNPWRRRSEFTEAFSTPGGVIKWH
FT                   DGSRDFPTRWYWKDGHLTNDRDGDRSFPYFHFVCWKRNEWSQLPEQDAQSLQALASEPS
FT                   WIIDAAGFHRG"
FT   gene            610533..611684
FT                   /locus_tag="PFL_0523"
FT   CDS_pept        610533..611684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0523"
FT                   /product="glycosyltransferase, group 1 family"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95932"
FT                   /db_xref="GOA:Q4KJB6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJB6"
FT                   /protein_id="AAY95932.1"
FT                   /translation="MSQRFKVLQLQPDYNVKSHDFADLAEQIVKALPAERYEVTAAFLR
FT                   GRPGPNDPVSRAAHSVYFEFSDKSLKGMRLRAMWRLYQFCRKEQFDVVICNRFKPVNMM
FT                   LALNRWLKVSLCIGISHGFGEYDRLYRRRQTQRLIDRHWRFVGVSPAVKQYLLDCQCGF
FT                   TDQNTWAITNAIDIEQAEALQHSRERSRELLGLAPDVRLIGALGRLVPVKGHTYLLQAF
FT                   AQLKDKYPKTQLAIIGAGREEANLRAEIERLGLQGRAHLLGFKENALQYVRAFDIWTMP
FT                   SLAEGLGLALLEGMSGQLPVIASNVPAMLPLIEGAGGLAVEPANVSALVAALDAYLGLS
FT                   DEELAAKGQQAYAYLQKEHDIEVFREEYRQLIDSGLSQAGKRQ"
FT   gene            611684..612568
FT                   /locus_tag="PFL_0524"
FT   CDS_pept        611684..612568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0524"
FT                   /product="glycosyltransferase, group 2 family"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95933"
FT                   /db_xref="GOA:Q4KJB5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJB5"
FT                   /protein_id="AAY95933.1"
FT                   /translation="MADQQPVVTVIIASYNHAPYIEQSILSVLNQTYPNIELLVVDDGS
FT                   SDDSVERIRRLQEQHGFDFRVQQNQGLTNTLNGAIARSRGSLIVPFGSDDIMLPERIAT
FT                   QVAYMDGKPEVGICAGNIELIDSDGNLFPEKRQRRDVPFRRLDFDDMFLERKPYPPAPT
FT                   LMIRREALEKVGGFDPNIRLEDLLIELKITRAGYFIDGLNMLMARYRKHATNSYKNHRF
FT                   MIDNILRSYALFSDHPLYDEVRYKFLSSMFLKVSNRDRKLARELLAQIPFKAWNKKTWR
FT                   GLGRLYFSPLEKD"
FT   gene            612583..613203
FT                   /gene="cat"
FT                   /locus_tag="PFL_0525"
FT   CDS_pept        612583..613203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cat"
FT                   /locus_tag="PFL_0525"
FT                   /product="putative chloramphenicol O-acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /note="identified by similarity to SP:P26841"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95934"
FT                   /db_xref="GOA:Q4KJB4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJB4"
FT                   /protein_id="AAY95934.1"
FT                   /translation="MGWIQRFLEKRAKRAIRKLPKIERGVVRFQQRYPGYSIGRGSYGL
FT                   PEVHDWQEGSTLSIGAYCSIAEGVQIFLGGHHRADWVTTYPFPAMLPQAAHISGYAGTN
FT                   GDVRVGSDVWLCSNSTLLSGVTIGHGAIVAAGALVTKDVEPYAVVGGNPARFLRWRFPE
FT                   EQRQQLLQSAWWDWPEAELHGLADKLCSDDIDGFLAYARQRSA"
FT   gene            complement(613283..615145)
FT                   /locus_tag="PFL_0526"
FT   CDS_pept        complement(613283..615145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0526"
FT                   /product="O-antigen polymerase family protein/toluene
FT                   tolerance protein"
FT                   /note="identified by similarity to GB:AAD17955.1; match to
FT                   protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95935"
FT                   /db_xref="GOA:Q4KJB3"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJB3"
FT                   /protein_id="AAY95935.1"
FT                   /translation="MQPNALHNTANRVFDFICLWILPIGYLLLLCAMFFLPGRSGLHKL
FT                   YYGLFSIPTLIALCTRPSELKSLLREPVFIAMLLFCTWAIVSLAWSPPVDSVLGEIKTP
FT                   LHTLMLFAGCMLLVRYRGEVLQPLVFCAAIVALIASIFNLYVFVRYHTPELRMIGAGAF
FT                   DNPLLSSHVFGFFCVYWLCLSMNCRRYQILWLSVPALVIMVAALIATGSRTPLVALTLA
FT                   ALWLSFISWNRRSLMLLGGMLAGGIAVVALFSQMLLERGSSSRFDLWRLALEQIANHPW
FT                   IGHGYNASLSLDPGIGFLLQEPHNFALGVLYYVGIIGLLPWLFMQAWALFKSWQLRAEP
FT                   LLILASTWLMFGIGAGLTEGGGILSRPKEHWFLLWIPLALIAALCISQRARRSPSHTVE
FT                   SLTQADADKLMANARVIEADGLGPKVLRLDDGSFLKLFRPRRWYTSGGFNPYSERFVTN
FT                   SEQLRELGITTPKILGLYRLADGSNAVRYQPLPGQTLRQSLQLASSGDERSKLIKRFGA
FT                   FMANLHEQGVYFRSLHLANVLVLENGEFGLIDLADLRVYPSSLRKSLRQRNVRHMQRYA
FT                   EDCGWLFLEHLDALQAGYAQGTSMPLATGLLKQLPANDLHQVAR"
FT   gene            615302..617107
FT                   /gene="msbA"
FT                   /locus_tag="PFL_0527"
FT   CDS_pept        615302..617107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="PFL_0527"
FT                   /product="lipid A export permease/ATP-binding protein MsbA"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM TIGR02203"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95936"
FT                   /db_xref="GOA:Q4KJB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJB2"
FT                   /protein_id="AAY95936.1"
FT                   /translation="MTDSSPDASPSSLKIYFRLLGYVRPYIGLFLISIVGFLIFASTQP
FT                   MLGYILKYFVDGLSNPQAVLFPGVPYLRDMQLLQAVPLLIVLIAAWQGLGSYLGNYFLA
FT                   KVSLGLVHDLRVQLFNNLLTLPNRYFDKHNSGHLISRITFNVTMVTGAATDAIKVVIRE
FT                   GMTVIFLFGSLLWMNWRLTLVMIAILPLIAVMVRTASKKFRKQSKKIQVAMGDVTHVAS
FT                   ETIQGYRVVRSFGGETYEQQRFLAASQGNTDKQLRMTRTGAIYTPLLQLVIYSAMAVLM
FT                   FLVLYLRGDASAGEMVAYITMAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEPEV
FT                   DRGTVERASINGHLEVRNLSFTYPGTERQVLDDISFSIEPGKMVALVGRSGSGKSTLAN
FT                   LIPRFYHHDKGQILLDGTEVEDFRLLNLRRHIAQVTQHVTLFSDTVANNIAYGDLAGAP
FT                   REDIEKAAADAYAMDFIAQLPEGLDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILD
FT                   EATSALDTESERHIQAALDKVMKGRTTLVIAHRLSTIEKADLILVMDQGRIVERGSHAQ
FT                   LLAQNGYYSRLHAMGLEEPAPSGIA"
FT   gene            617295..617999
FT                   /locus_tag="PFL_0528"
FT   CDS_pept        617295..617999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95937"
FT                   /db_xref="GOA:Q4KJB1"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJB1"
FT                   /protein_id="AAY95937.1"
FT                   /translation="MLQRFVWKLLPKTQRNFLLGRLSVVDRQVVNKSMSANVRFPDAFS
FT                   RHSCLFIHVPKCAGSSICSALFDGWMPGHLPLYWYEQQFPQAFSSSFKFAFVRDPLERA
FT                   YSAYAFLRGNRLGRRDQVAQALVGHYRDFDDFIGRWLHPETIHKQMHFAAQSDFLTDSL
FT                   GRLALDFVGYQEHLQRDFQLLCEQLQVQTRLPHVNSTQQRHSTPVRDICSVRTRRLVRR
FT                   VYQRDYEMLGYE"
FT   gene            617992..618603
FT                   /gene="cysC"
FT                   /locus_tag="PFL_0529"
FT   CDS_pept        617992..618603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="PFL_0529"
FT                   /product="adenylyl-sulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="identified by match to protein family HMM PF01583;
FT                   match to protein family HMM TIGR00455"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95938"
FT                   /db_xref="GOA:Q4KJB0"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJB0"
FT                   /protein_id="AAY95938.1"
FT                   /translation="MNKLACVPLERPQIRPYSLSLSTEARAALKQQQPCCLWLTGLSGA
FT                   GKSTLANLLELRLNELGMHTFVLDGDNVRSGLCSDLGMGAEARKENIRRMAEVARLMVD
FT                   AGLLVIVSAISPFRAERDAARALFGPGEFIEVYVSTPFDTCARRDPKGLYQAALEGRIK
FT                   DFTGLDSPYEAPLQADCEIDTATVALPEAIRRLLQLLPRK"
FT   gene            618706..620139
FT                   /gene="hldE"
FT                   /locus_tag="PFL_0530"
FT   CDS_pept        618706..620139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="PFL_0530"
FT                   /product="bifunctional protein HldE"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM PF01467; match to protein
FT                   family HMM TIGR00125; match to protein family HMM
FT                   TIGR02198; match to protein family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95939"
FT                   /db_xref="GOA:Q4KJA9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJA9"
FT                   /protein_id="AAY95939.1"
FT                   /translation="MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVEQ
FT                   IEDRPGGAANVALNIAALGAPASLVGVTGDDEAADSLANSLQGAGVRALFQRIKHQPTI
FT                   VKLRVMSRHQQLLRIDFEEPFATDALALAAEVDALLDGIKVLVLSDYGKGALRNHQVLI
FT                   AAARARGIPVLADPKGKDFSIYRGASLITPNLSEFETIVGGCADEHELVSKGAQLMHDL
FT                   ELGALLVTRGEHGMTLLRPDHPAMHLPARAREVFDVTGAGDTVISTLAAAIAAGEELPH
FT                   AVGLANLAAGIVVGKLGTAAISAPELRRAIQREEGSERGVLSLDQLLLAIDDARAHNEK
FT                   IVFTNGCFDILHAGHVTYLEQARAQGDRLIVAINDDASVSRLKGPGRPINSVDRRMAVL
FT                   AGLGAVDWVISFPEGTPENLLSQVRPDVLVKGGDYSIDQVVGADIVGAYGGTVKVLGLV
FT                   ENSSTTAIVEKIRKTDKAE"
FT   gene            complement(620191..621162)
FT                   /locus_tag="PFL_0531"
FT   CDS_pept        complement(620191..621162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95940"
FT                   /db_xref="GOA:Q4KJA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJA8"
FT                   /protein_id="AAY95940.1"
FT                   /translation="MSRPLIRKNPSNFKTLPLFVEATPEGLSYQSVGMPLNFAQTLQRR
FT                   RAVTVADNQRFALELANLGVSVRLTLHWQNRDYWVLVRQRRQDRGDVVLKLISGYVPAH
FT                   ELNLPLHTAIQEIAEECLLETPEGWLGGRFNDTWLPAPYAGALHYREALPFRLTPLSGA
FT                   ALPVRCGNLQLLERPRAYVHLPTASLQLIYDLRLDVPREAKSLSLFHVDERLEGDQLVA
FT                   RLDRKRPDLYLMPLDNGEPCAELYTLKKDQLHPASTRGLYLAESFAQQEGWVVSDERIR
FT                   WKDWLRQRGLEPPQKASKLSRLTGRARQILRKIVPGNARRQG"
FT   gene            complement(621204..622016)
FT                   /locus_tag="PFL_0532"
FT   CDS_pept        complement(621204..622016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0532"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95941"
FT                   /db_xref="GOA:Q4KJA7"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJA7"
FT                   /protein_id="AAY95941.1"
FT                   /translation="MSQPTLHDLHRPLGSTGLLVSPLGLGTVKLGRDQGVKYPNGFQIP
FT                   DDQEARMLLKLTRDLGINLIDTAPAYGRSEERLGPLLRGQRQEWVIVSKVGEEFADGLS
FT                   RHDFSATHTRMSVERSLQRLETDFIDLVLVHSDGNDLAILEQCEVYQALAQLKQEGKIR
FT                   GYGFSGKTVDGGLKALEQGDCAMVTYNLNEQAERAVIDYATAHHKGILVKKALASGHVC
FT                   LSPGIDPVRASFELLFDRPGVASAIVGTINPLHLAHNVSTVAQVLGKN"
FT   gene            complement(622013..623188)
FT                   /locus_tag="PFL_0533"
FT   CDS_pept        complement(622013..623188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0533"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95942"
FT                   /db_xref="GOA:Q4KJA6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJA6"
FT                   /protein_id="AAY95942.1"
FT                   /translation="MPSAISTDVLIVGAGVAGLWLNARLQRLGFSTVLVESASLGGGQS
FT                   VKSQGIIHGGAKYALHGALTGASEAIADMPRRWREALAGNGELDLSGVRLLSEAHYLWS
FT                   PGTLAGNLTSFFASKAVRGRVDQVKGEQLPPALQDKRFKGKVYRLAELVVDVPSLIERL
FT                   AHLAGDSLLAGQKIEPLLENGQLLGLRVDGREIRAQRIVLSAGAGNAKLLQAAGLSQPT
FT                   MQLRPLHMVLVKGPSLKPLYAHCLGGGPKPRITVTTHPAADGQWVWYLGGDIAEAEGVA
FT                   REPAAQIAAAQKELGQLLPWIDLSQAQWATLRVDRAEPAQSGLARPDNAFLAEQDRLLV
FT                   GWPTKLALAPDFADRVLAALERDGIRPAAAQALPELPKPPLAQPAWEQLLP"
FT   gene            complement(623299..623631)
FT                   /locus_tag="PFL_0534"
FT   CDS_pept        complement(623299..623631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0534"
FT                   /product="multidrug resistance protein, SMR family"
FT                   /note="identified by similarity to SP:Q57225; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95943"
FT                   /db_xref="GOA:Q4KJA5"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJA5"
FT                   /protein_id="AAY95943.1"
FT                   /translation="MNAYYYLAIAICAEVIATVSMKAVKGLSTPLPLALIIVGYGVAFW
FT                   MLTLVVRTVPVGVAYAVWAGMGIVMVSIAALFLYGQKLDIPAMLGMALIVLGVVVIQLF
FT                   SKTAGH"
FT   gene            623736..624626
FT                   /locus_tag="PFL_0535"
FT   CDS_pept        623736..624626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0535"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95944"
FT                   /db_xref="GOA:Q4KJA4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJA4"
FT                   /protein_id="AAY95944.2"
FT                   /translation="MNMQWNLEQLRLFVGVAELRSFSAVARQQRKAQSAISSAIAQLED
FT                   DLGVSLFERSSGRQPRLTEAGSALLQEAREILRQCDRLNGRALALMRGQEARLRLAQDE
FT                   AMPYQPVLDSLEALAEHFPSLEVQLASGAQGDVARKLVERRADLGLLFHHEQMPETLER
FT                   RALGSVEMVTVCAVGHPLAHEKRVNRQLLALHRQLLIAPQASGYPGGEQVSPQVWRADS
FT                   FYVLAEWLMRGLGWAWLPRHVVQYPAYQNQMVELASQWTPPALVVELAWRRDEPLGPAA
FT                   HWLAERFAVHLKAIG"
FT   gene            624649..625929
FT                   /gene="waaA"
FT                   /locus_tag="PFL_0536"
FT   CDS_pept        624649..625929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaA"
FT                   /locus_tag="PFL_0536"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="identified by similarity to SP:P0AC75; match to
FT                   protein family HMM PF04413"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95945"
FT                   /db_xref="GOA:Q4KJA3"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJA3"
FT                   /protein_id="AAY95945.1"
FT                   /translation="MNRTLYTALFYLGLPLVAIRLWLRSRKAPAYAKRIGERFSLGLPS
FT                   MQPGGIWVHAVSVGESIAAAPMIRALLARYPQLPITVTCMTPTGSERIHALFANEPRIQ
FT                   HCYLPYDLPCAAARFLDRVQPKLAVIMETELWPNHIDQCARRGIPVALANARLSERSAK
FT                   GYGRFARLTAPMLAQMSLFAVQTEAEAQRFLRLGARPETVQVTGSIKFDLSIDPQLLQR
FT                   ATELRQQWQAMERPVWIAASTHEGEDAVVLDAHRQLLGNYPNALLILVPRHPERFDSVH
FT                   ELCRQQGFATVRRSAAEPVLATTSVLLGDTMGELLFLYALADSAFVGGSLVPNGGHNLL
FT                   EPAALAKPVISGPHLFNFLEIAAMLREAGALQEVDDAEGLAVAVQRLFELPQDARKMAD
FT                   AGLKVLKANQGALQRLLDGLGRLLGRH"
FT   gene            complement(626029..627459)
FT                   /locus_tag="PFL_0537"
FT   CDS_pept        complement(626029..627459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0537"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01844"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95946"
FT                   /db_xref="GOA:Q4KJA2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJA2"
FT                   /protein_id="AAY95946.1"
FT                   /translation="MLRKLSLAVAVSCASNGMAWAAEAPLTTKTDLVSVYQEAVDNNAD
FT                   LAAARAQYGAQKEVVPQARAGLLPNLSAGADMNNTRTKFDEPSMTSTRSGNVYQATLAQ
FT                   PLFRADRWFQLQAAKDINEQASLQLSATEQNLILQSAENYFAVLRAQDNLASTKAEEAA
FT                   FKRQLDQSNERFDVGLSDKTDVLQSQASYDTARANRILAQRQVDDAFEALITLTNREYN
FT                   SIQGIVHTLPVLAPTPNDAKAWVDTAAKQNLNLLASNYAVSAAEETLKQRKAGHAPTLD
FT                   AVAQYKKGDNDALGFSNPNPLTRYGSDVEQRSIGLQLNIPIYSGGLTSSQVRESYSRLS
FT                   QTEQQRESLRRQVVENTRNLHRAVNTDVEQVQARRQSIISNQSAVEATEIGYQVGTRNI
FT                   VDVLDAQRQLYTSVRNYNNSRYDYILDNLRLKQAAGTLNPGDLQDLSRYLKADYNPDRD
FT                   FLPPDLAKAAQEQLRARP"
FT   misc_binding    627657..627761
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); Rfam score 80.45"
FT                   /inference="nucleotide motif:RFAM:RF00059"
FT   gene            627925..629814
FT                   /gene="thiC"
FT                   /locus_tag="PFL_0538"
FT   CDS_pept        627925..629814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="PFL_0538"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95947"
FT                   /db_xref="GOA:Q4KJA1"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJA1"
FT                   /protein_id="AAY95947.1"
FT                   /translation="MTTKLKNASNLSESAQVDQQSVQPFTRSQKVYVQGSRPDIRVPMR
FT                   EITLDVTPTDFGGEINAPVTVYDTSGPYTDPNVVIDVRKGLGDVRSAWIEDRGDTERLA
FT                   GLSSNFGQQRLADPELTKLRFAHVNNPRRAKAGANVSQMHYARKGIITAEMEYVAIREN
FT                   MKLQEARAAGLLKQQHAGHSFGASIPKEITPEFVREEIARGRAIIPANINHVELEPMII
FT                   GRNFLVKINGNIGNSALGSSIEEEVAKLTWGIRWGSDTVMDLSTGKHIHETREWIIRNS
FT                   PVPIGTVPIYQALEKVNGVAEDLTWELFRDTLIEQAEQGVDYFTIHAGVLLRYVPLTAK
FT                   RVTGIVSRGGSIMAKWCLAHHKENFLYTHFDEICEIMKAYDVSFSLGDGLRPGSIADAN
FT                   DEAQFGELETLGELTKIAWKHDVQCMIEGPGHVPMQLIKENMDKQLECCDEAPFYTLGP
FT                   LTTDIAPGYDHITSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKDDVKTGIITYKIAAHA
FT                   ADLAKGHPGAQIRDNALSKARFEFRWEDQFNLGLDPDTARSYHDETLPKDSAKVAHFCS
FT                   MCGPKFCSMKITQEVREYAANQRIEAVDVDVAKGLAEQAERFKQEGSQLYKKV"
FT   gene            629928..631220
FT                   /gene="cytX"
FT                   /locus_tag="PFL_0539"
FT   CDS_pept        629928..631220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cytX"
FT                   /locus_tag="PFL_0539"
FT                   /product="putative hydroxymethylpyrimidine transporter
FT                   CytX"
FT                   /note="identified by match to protein family HMM PF02133;
FT                   match to protein family HMM TIGR02358"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95948"
FT                   /db_xref="GOA:Q4KJA0"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012732"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJA0"
FT                   /protein_id="AAY95948.1"
FT                   /translation="MSSPISTYSPDLAVPADKRVFGARDLFSLWFSLGIGLMVLQTGAL
FT                   LAPGLGLAHSLLAILLGTAVGVLLLAAVGVIGSDTGLSSMAALKLSLGRRGTSLPALLN
FT                   LLQLVGWGSFEIIVMRDAASLLGSRAFSEGSLLANPLLWTLFFGALATLLAVSGPLTFV
FT                   RQILRKWGIWLLLAACLWLTWNLFARADLAALWAQAGDGSMPFAVGFDIAIAMPLSWLP
FT                   LIADYSRFGKRAKSVFGGTALGFFIGNFWLMSLGVAYTLAFAPSGEVNALLLALAGAGL
FT                   GIPLLLILLDESENAFADIHSAAVSSGILLRLKVEHLALAIGVLCTLIACLAPLAQYQN
FT                   FLLLIGSVFAPLFGVVLVDHFILRRRSGQNPASALRWPALLAWLGGVSTYHLLANLYPD
FT                   IGATLPSLVLAGLLQWLLGRAFSYRQETARA"
FT   gene            complement(631189..631935)
FT                   /locus_tag="PFL_0540"
FT   CDS_pept        complement(631189..631935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0540"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95949"
FT                   /db_xref="GOA:Q4KJ99"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ99"
FT                   /protein_id="AAY95949.1"
FT                   /translation="MSLVKIASVACIALTLGACQSLFQPSYMTPLEPTRDKSEQLKPGC
FT                   SGADCPLVNLDTVHFPAEPQLDAIIEKRLLQMTRTSPDAALPASLAAYREQFLRSAPDR
FT                   HGMYLQSKLREQHDGLVIIELASYLDTGAANGTPGRGFVNYSRQQHKALNLADMLLPGQ
FT                   EEMFWKAARVAHNNWLISTHLDREAEFVKTWPFQKTQNVALTRNAVTLKYDVTTIAPSV
FT                   LGHIELQIPYDRLKGVLKPELFPGGN"
FT   gene            632160..632777
FT                   /gene="nudF"
FT                   /locus_tag="PFL_0541"
FT   CDS_pept        632160..632777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="PFL_0541"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /note="identified by similarity to SP:P36651; similarity to
FT                   SP:P83843; match to protein family HMM PF00293; match to
FT                   protein family HMM TIGR00052"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95950"
FT                   /db_xref="GOA:Q4KJ98"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ98"
FT                   /protein_id="AAY95950.1"
FT                   /translation="MTDFANSTPSAVEIIRRENCFQGFYRLDRLQLRHELFAGGMGREI
FT                   NREVFVRHDAVCVLPYDPQRDEVVLIEQFRVGAMGKTASPWLVELVAGLIDKDEQPEQV
FT                   ARREAQEEAGLDISALWPMTQYFPSPGGSTEFVHLYLGRCDSSAAGGLHGLEEEAEDIR
FT                   VCVMAYEDALQAMRDGRICNAASIIALQWLALNRAEVRGLWS"
FT   gene            632768..633220
FT                   /locus_tag="PFL_0542"
FT   CDS_pept        632768..633220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06853"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95951"
FT                   /db_xref="GOA:Q4KJ97"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ97"
FT                   /protein_id="AAY95951.1"
FT                   /translation="MVVNKVRDRYRVDLAGLQASCEANYARLMRLLPDMRNQPVARRIA
FT                   VTQGDQMLGVLALEVVLACPYTTTLQVRQEHSLPWLPVPQLEVQVYHDARMAEVISAEH
FT                   ARRFRSIYPYPNAFMHQPDEKAQLNVFLGEWLSHCLACGHEFEAVR"
FT   gene            633320..634135
FT                   /gene="icc"
FT                   /locus_tag="PFL_0543"
FT   CDS_pept        633320..634135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="PFL_0543"
FT                   /product="3',5'-cyclic-nucleotide phosphodiesterase"
FT                   /EC_number="3.1.4.17"
FT                   /note="identified by similarity to SP:P0AEW4; similarity to
FT                   SP:P44685; match to protein family HMM PF00149; match to
FT                   protein family HMM PF08413"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95952"
FT                   /db_xref="GOA:Q4KJ96"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ96"
FT                   /protein_id="AAY95952.1"
FT                   /translation="MPSVSALTAADPVLLVQLSDSHLFAETDGTLLGMNTADSLQRVID
FT                   LVLAQQPRIDLMLATGDLSQDGTLESYQRFRQLTRQIAAPGRWLPGNHDEPQVMEQAAS
FT                   GSDLLDPVVDIGNWRITLLDSAVPGSVPGYLQDEQLQLLTRSLSEAPERHHLVCLHHHP
FT                   VSIDCAWMEPIGLRNAQALFAVIDAFPQVRAVLWGHVHQEIDRLRGDVRLLASPSTCIQ
FT                   FEPLSDDFKVEEQVPGYRWLRLLPDGRLETGVQRVEGYEFTIDYGSEGY"
FT   gene            634203..634811
FT                   /locus_tag="PFL_0544"
FT   CDS_pept        634203..634811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05728"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95953"
FT                   /db_xref="GOA:Q4KJ95"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ95"
FT                   /protein_id="AAY95953.1"
FT                   /translation="MSGSILYIHGFNSAPASTKASQLHQVMEQLGLAGQLRVPALHHHP
FT                   RQAIGQLEQAIAELGRPLLVGSSLGGYYATHLAERYGLKALLINPAVSPHRMFDGYLGT
FT                   QKNLYTDETWELTHDHVAALAALEVAPPQDPERYQVWLQTGDETLDYRSAERYYRACAL
FT                   RIQAGGDHSFQGFAGQLPAMLNFAGITADQYQAIDFTAL"
FT   gene            634854..636758
FT                   /gene="parE"
FT                   /locus_tag="PFL_0545"
FT   CDS_pept        634854..636758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="PFL_0545"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR01055"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95954"
FT                   /db_xref="GOA:Q4KJ94"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ94"
FT                   /protein_id="AAY95954.1"
FT                   /translation="MATPSASSYNADAIEVLSGLDPVRKRPGMYTDTTRPNHLAQEVID
FT                   NSVDEALAGHAKSIQVILHADHSLEVSDDGRGMPVDIHPEEGVSGIELILTKLHAGGKF
FT                   SNKNYQFSGGLHGVGISVVNALSNQVRVRVKRDGNEYQMTFADGYKATELEVVGTVGKR
FT                   NTGTSVYFAPDPKYFDSPKFSVSRLKHVLKAKAVLCPGLLVSFEDKSSGEKVEWHYEDG
FT                   LRSYLVDAVSEFERLPAEPFCGSLAGNKEAVDWALLWLPEGGDSVQESYVNLIPTAQGG
FT                   THVNGLRQGLLDAMREFCEFRNLLPRGLKLAPEDVWERIAFVLSMKMQDAQFSGQTKER
FT                   LSSREAAAFVSGVVKDAFSLWLNANPELGMQLAELAISNAGRRLKASKKVERKRITQGP
FT                   ALPGKLADCAGQDPMRSELFLVEGDSAGGSAKQARDKEFQAILPLRGKILNTWEVDGSE
FT                   VLASQEVHNIAVAIGVDPGAEDMSQLRYGKICILADADSDGLHIATLLCALFVQHFRPL
FT                   VDAGHVYVAMPPLYRIDLGKEIYYALDEAERDGILDRLVAEKKRGKPQVTRFKGLGEMN
FT                   PPQLRETTMDPNTRRLVQLTLDDVEATAEIMDMLLAKKRAGDRKSWLESKGNLAEVLA"
FT   gene            636758..637741
FT                   /locus_tag="PFL_0546"
FT   CDS_pept        636758..637741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO58390.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95955"
FT                   /db_xref="GOA:Q4KJ93"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ93"
FT                   /protein_id="AAY95955.1"
FT                   /translation="MHRGFALALALLATSVVAAPAPELKLLSEHPVQGMRGGNLSGLAL
FT                   CGQELWTVSDRDDEQIYRLDTRNTVWQAETVGIEVPAVPDSGLPWGLKVRTWAASFVRG
FT                   GDLDFEGITCDAAGNKYVVSEAHAAVLQVPAQGAAAWLKISPIMVREARASGMLLHFNA
FT                   LFEGLAVNPAGDRIWLAAERERRGLLLIKRGQTTWDCDGGCVLLSEAGALMQPEQVPNA
FT                   KAVSRDFADLSLFDGKLFTLERNAYQICRRDALSAKVEQCWSYAGEALVEHRRYPQPYG
FT                   LAEALVVDAKGAWIGLDNNNGARADGEARPIVWRFAAPEGGWSAKP"
FT   gene            637738..638259
FT                   /locus_tag="PFL_0547"
FT   CDS_pept        637738..638259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0547"
FT                   /product="clan AA aspartic protease"
FT                   /EC_number="3.4.23.-"
FT                   /note="identified by match to protein family HMM PF00077;
FT                   match to protein family HMM TIGR02281"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95956"
FT                   /db_xref="GOA:Q4KJ92"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ92"
FT                   /protein_id="AAY95956.2"
FT                   /translation="MSQQPGKSAGRVMLIMAWAAALFLATRFFADWEAHQENPNTVVSS
FT                   QQHEGYIEVQLAGNRQGHFVASGHINGRPVQFMLDTGATDVSVPADLAERLGLERGAPV
FT                   TLSTANGRSEGYRTRIELLQLGDIVLRDVAALVAPGLDGDQVLLGMSALKKLEFTQRGG
FT                   SMLLRQTTNQ"
FT   gene            638267..640525
FT                   /gene="parC"
FT                   /locus_tag="PFL_0548"
FT   CDS_pept        638267..640525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="PFL_0548"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01062"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95957"
FT                   /db_xref="GOA:Q4KJ91"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ91"
FT                   /protein_id="AAY95957.1"
FT                   /translation="MSDSLDLSLDGVERRSLADFTENAYLNYSMYVIMDRALPHIGDGL
FT                   KPVQRRIVYAMSELGLDADSKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRY
FT                   TLVDGQGNWGAPDDPKSFAAMRYTEARLSRYSEVLLSELGQGTADWGPNFDGTLQEPLV
FT                   LPARLPNILLNGTTGIAVGMATDVPPHNLREVASACVRLLDEPKATVEQLCEHIQGPDY
FT                   PTEAEIITPRADLLKIYETGRGSVRMRAVYRVEDGDIIVTALPHQVSGAKVLEQIAGQM
FT                   QAKKLPMVADLRDESDHENPCRIVIIPRSNRVDADELMQHLFATTELESTYRVNINIIG
FT                   LDGKPQLKNLRALLVEWLEFRVTTVRRRLQFRLDKVERRLHLLDGLLIAYLNLDEVIHI
FT                   IRTEEHPRAKLIERFALSEIQADYILDTRLRQLARLEEMKLRAEQDELLKEQAKLQALL
FT                   NSEAKLKKLVRTELLQDAETYGDDRRSPIVARAEAKALSENELMPTEPVTIVLSEKGWV
FT                   RCAKGHDIDATGLSYKAGDGYKTAAPGRSNQFAVFIDSTGRSYSVAAHTLPSARGQGEP
FT                   LTGRLTPPPGATFECVLLPDDDALYVIASDAGYGFVVKGEDLQAKNKAGKALLSLPNNA
FT                   KVLAPRPVADREQNWLASVTTEGRLLVFKISDLPQLGKGKGNKIIGIPGERVASREEYV
FT                   TDIAVLPDGATLVLQAGKRTLSLKADDLEHYKGERGRRGNKLPRGFQRVDALLVEPLS"
FT   gene            640702..641415
FT                   /locus_tag="PFL_0549"
FT   CDS_pept        640702..641415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0549"
FT                   /product="lipoprotein of unknown function, DUF330 family"
FT                   /note="identified by match to protein family HMM PF03886"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95958"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ90"
FT                   /protein_id="AAY95958.1"
FT                   /translation="MMTALRLPLVFLLAGVLGLAGCSVHQPVSLYQLDSGSPAQPASAG
FT                   MSVLLGPVLIADYLQRETLLQRQDDGSLQASTDGRWAGSLSSDIDQLLLRQVAGHLDSQ
FT                   RVVLAPATSGFTPDVQVLLSITRLDSGKSQPAVLDAQWRLIDRRGQVRDNRIVHLQEQH
FT                   AGTTASQVQAQGVLLQRLAEQLSGALKPLANQPAVAEVPRKAAPAPAPKPAEQEKQPKI
FT                   PMATPIRTDMEVFRF"
FT   gene            complement(641645..643171)
FT                   /locus_tag="PFL_0550"
FT   CDS_pept        complement(641645..643171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0550"
FT                   /product="HAMP domain protein"
FT                   /note="identified by match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95959"
FT                   /db_xref="GOA:Q4KJ89"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ89"
FT                   /protein_id="AAY95959.1"
FT                   /translation="MNRPTPVKTDNFFLLIFRALRHRRVPIALRIASHNVILVALALVI
FT                   YAGVMGLQFKQAMHEQADALGQSLTTQTATSATELLVSNDILSLNVLLNNLTKNPLVAH
FT                   AAIYSVDNRILAEAGQRPKSSLLGETEGVYQTKITFQDVTAGNLRISLDMAQFQQPMTI
FT                   SLQSMGILSAILLALALALSLRLGRHISTPLLQLRVWLRDLDEHTPATQRQDEIGDLAR
FT                   QLHARLVPEKPEPAPQPEAEVQDDEDDEPAFEVRNLRDPSFDESAPVAGLKPAPRHLVH
FT                   AEEDELDEEDPFADLRDSSSTPAAKPQPQPQVPTQPQHSAVLAVQLGAQEQLRRLPRAR
FT                   LMELLERYRDCLDQAASLYQSELHTLNDGSTLMLFHSEDSGDDYLTNAICCGELLRALG
FT                   HALQIEVADSGITLQLQLGLTLGDELFGLSQIDLLLTETAQDALALSQHSRNLLLVERK
FT                   VNDDPLLRQRARIRPIASPEGACCVERLMEPYPSMLERQLARMHETRAKL"
FT   gene            643305..644519
FT                   /gene="serB"
FT                   /locus_tag="PFL_0551"
FT   CDS_pept        643305..644519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="PFL_0551"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF06888; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00338;
FT                   match to protein family HMM TIGR01488"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95960"
FT                   /db_xref="GOA:Q4KJ88"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ88"
FT                   /protein_id="AAY95960.2"
FT                   /translation="MREIVLINITGEDRPGLTAAITGVLAQGGVNILDIGQAVIHDTLS
FT                   FGILVEIPSNEQSSSVLKDILFTAYKLDQQVRFTPVSEEDYQQWVAGQGKKRHIVTLLT
FT                   RKVTAEQLQRVSSITAKYGLNIDHIDRLSGRMPLDMPADQGKGCIEFSVRGEAADPQAL
FT                   RAEFLSVAQELNVDIAFQEDSLFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGDRVAE
FT                   ITERAMAGELDFRASFKERLALLKGLDVNVLDAIGASLRLTEGAETLFAELKRLGYKTA
FT                   ILSGGFTYFAKQLQAKLGIDYVFANELEVVDGKVTGVAVEPIVDAQRKADLLRELAHKE
FT                   GLRLEQTIAVGDGANDLPMLGIAGLGVAFRAKPLVKQSAKQAISTLGLDGVLYLLGFRD
FT                   RDGQL"
FT   gene            complement(644591..645457)
FT                   /gene="psd"
FT                   /locus_tag="PFL_0552"
FT   CDS_pept        complement(644591..645457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="PFL_0552"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="identified by match to protein family HMM PF02666;
FT                   match to protein family HMM TIGR00163"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95961"
FT                   /db_xref="GOA:Q4KJ87"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ87"
FT                   /protein_id="AAY95961.1"
FT                   /translation="MKKRLFIISQYLLPHHLLSRLAGCIAECRVRWFKNAFTRWFAKQY
FT                   QVDMSEAQVEDVTAYEHFNAFFTRALKDGARPLDPTPGAVLSPADGAVSQLGPIEHGRV
FT                   FQAKGHSYSVLELLGGDPALAQPFMGGDFATIYLSPKDYHRVHMPLAGTLREMVYVPGR
FT                   IFSVNQTTAENVPELFARNERVVCIFDTERGPMALVLVGAMIVASIETVWAGLVTPPKR
FT                   ELKTVRYDEAARAPIHLEKGAEMGRFKLGSTAIVLFGPDQVQWAQELAAGSPVRMGQGL
FT                   GLGLPKA"
FT   gene            complement(645476..646291)
FT                   /gene="rhdA"
FT                   /locus_tag="PFL_0553"
FT   CDS_pept        complement(645476..646291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhdA"
FT                   /locus_tag="PFL_0553"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="identified by similarity to SP:P52197; match to
FT                   protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95962"
FT                   /db_xref="GOA:Q4KJ86"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ86"
FT                   /protein_id="AAY95962.1"
FT                   /translation="MSDFSGLPLVIEPSDLLARLNARELILVDLTSAARYATGHIPGAR
FT                   FIDPKRTQLGQAPAPGLLPPQAALETLFGELGHNPDAVYVVYDDEGGGWAGRFIWLLDV
FT                   IGHHRYHYLDGGLPAWLAEGLPVSTEVPAAVGGPVALALHDEPTATREYLQSRLGAADL
FT                   VIWDARGPLEYSGEKVLAAKGGHIPGAVNFEWTAGMDQARHLRIRRDMPQILADLGISK
FT                   DKEVITHCQTHHRSGFTYLVAKALGYPRVKGYAGSWGEWGNHPDTPVEI"
FT   gene            complement(646335..647873)
FT                   /locus_tag="PFL_0554"
FT   CDS_pept        complement(646335..647873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0554"
FT                   /product="HDOD domain protein"
FT                   /note="identified by match to protein family HMM PF08668"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95963"
FT                   /db_xref="GOA:Q4KJ85"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ85"
FT                   /protein_id="AAY95963.1"
FT                   /translation="MSNETSVPHSPPASLDAWVKLLNGVRLPVPQASHDRVCRAIANNR
FT                   SSLREIVDLMQNSPALALSVIREANRHSHGSMSEPAENLEIAVNRLGLKRTEELLEQLP
FT                   TLPEEQIPQALRQFQLISQHASQQANGFFAGRLARLWQDIHWGSLLFLSPLWAMALVYP
FT                   KLLEEWELRVIYKHESAHDVELQLFGVRLMEMCQALVLAWHLPIWVQQGYRLLTQEQHL
FT                   LAKVMLIARDSDNPLRQQQRLDAEPDLRRWLNQPANTVLLANGLALAAQQSWNSPHGRR
FT                   WQNLTALYLQIPLDQVQQQLHQQAAQSARNDTQPDLWHPAQALLWPWDARRLHHGEQPA
FT                   PAPTALELAKWRKLCGELLLDPSPFTNAVHLTGFARDALAACGMHRVMLLMVDRSLSHL
FT                   RVQQLYGLPREAASLTLQAKQSPLLQRLLEKSAQIRLTPANRAQFAPHLPSSLRQLFRG
FT                   EHLLIRSLSCNGRVLMLAIADQGGVPFSEISVQAFGKTAQCIEKALHSFTNRSQ"
FT   gene            648040..648891
FT                   /gene="motA"
FT                   /locus_tag="PFL_0555"
FT   CDS_pept        648040..648891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="PFL_0555"
FT                   /product="chemotaxis protein MotA"
FT                   /note="identified by similarity to SP:P09348; match to
FT                   protein family HMM TIGR03818"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95964"
FT                   /db_xref="GOA:Q4KJ84"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ84"
FT                   /protein_id="AAY95964.2"
FT                   /translation="MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVLIIGGAAFGAF
FT                   LQANPGYMTMHVVKKSLGMFSSRFTHTFYLEVLGLIYEILNKSRREGMMAIEGDIEDAA
FT                   ASPIFAKYPAVLKDERMTAFVCDYLRIMSSGNMAPHELEGLFDMELFSLKEDLEHPSHA
FT                   VNGIADGMPGFGIVAAVLGIVVTMASLGDGDQKSIGLHVGAALVGTFFGILAAYGFFGP
FT                   LAHSLAHDAKEELNVYEAIKASLVASASGMPPSLAVEFGRKVLYPAHRPSFAELEQAVR
FT                   GR"
FT   gene            648895..650013
FT                   /gene="motB"
FT                   /locus_tag="PFL_0556"
FT   CDS_pept        648895..650013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="PFL_0556"
FT                   /product="chemotaxis protein MotB"
FT                   /note="identified by similarity to SP:P0AF06; match to
FT                   protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95965"
FT                   /db_xref="GOA:Q4KJ83"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ83"
FT                   /protein_id="AAY95965.1"
FT                   /translation="MENNQPIIIKRVKRFAGGHHGGAWKIAFADFATAMMAFFLVLWLL
FT                   STATPEQKIAIAGYFKDPIGFSESGTPYIIDLGGSPELAPDNTLNPEIKSQPQPDKVTV
FT                   DADQVEGMAEQVERERLELLLQELQNKVEENPQLQKFKDQILFEITPDGLRIQIMDAEN
FT                   RPMFDSGSARLKPYFEDILLAMADTIKTVPNKISISGHTDAKPYSGTGDFGNWELSANR
FT                   ANAARRALVAGGYPDPQVARVVGFASSALFDRKDPFNPVNRRIDIVVLTKKAQRAIEGE
FT                   QTDPNAPVPTQGSGAPGEVPGAAADPNALPPGSEPLPAHEVRQRMNIFEDGVLKMDEQG
FT                   AAGQSSAPAPAPAPAPAPTAPVTPPATPGTAK"
FT   gene            complement(650066..651097)
FT                   /gene="rsgA"
FT                   /locus_tag="PFL_0557"
FT   CDS_pept        complement(650066..651097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="PFL_0557"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95966"
FT                   /db_xref="GOA:Q4KJ82"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ82"
FT                   /protein_id="AAY95966.1"
FT                   /translation="MAKRQLNRRQNWRIEKIQGERAARAAKRESSAVEALEGGDLGPEQ
FT                   TGLVIAHFGVQVEVEAREGETAGQVFRCYLRANLPALVTGDQVVWRAGNQGIGVIVAQL
FT                   PRSTELCRPDSRGQLKPVAANVDMIVIVFAPMPEPHANLIDRYLVAAEHAGIRPLLLLN
FT                   KADLIDEQNAPALNALLAVYRQLGYPLLEVSAHHGDGMEQLQALLDGRISVFVGQSGVG
FT                   KSSLVNSLLPEVETRVGPLSEFSGQGTHTTTTARLFHFPGGGELIDSPGIREFGLGHVS
FT                   RADVEAGFIEFNDLLGTCRFRDCKHDREPGCALLKALEDGRIQQQRMNSYRSILASLPD
FT                   NSY"
FT   gene            651206..651748
FT                   /gene="orn"
FT                   /locus_tag="PFL_0558"
FT   CDS_pept        651206..651748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="PFL_0558"
FT                   /product="oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to SP:P0A784; match to
FT                   protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95967"
FT                   /db_xref="GOA:Q4KJ81"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ81"
FT                   /protein_id="AAY95967.1"
FT                   /translation="MQNPQNLIWIDLEMTGLNPDTDVIIEMATIVTDSNLNTLAEGPVI
FT                   AIHQSDEILAGMDEWNTRQHGGSGLTQRVRESRISMAEAEAQTIAFLEQWVPKGKSPIC
FT                   GNSICQDRRFLYRHMKALESYFHYRNLDVSTLKELAARWAPDVRDSFKKGSTHLALDDI
FT                   RESIAELQHYRKHFIKF"
FT   gene            651869..652480
FT                   /locus_tag="PFL_0559"
FT   CDS_pept        651869..652480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0559"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95968"
FT                   /db_xref="GOA:Q4KJ80"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ80"
FT                   /protein_id="AAY95968.1"
FT                   /translation="MLLMLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSV
FT                   RDVLLGHYPLTWVKHPEYLVLTSVAALVTIFIAPLMRHLRSLFLVLDAVGLVAFTLIGC
FT                   MTALEMGHGMLVASVSGVITGVFGGILRDIFCNDIPLIFRRELYASVSFAAAWCYMLCI
FT                   YLQLPSEQSILVTLFGGFLLRLLAIRFHWEMPKFVYNDEH"
FT   gene            complement(652462..653541)
FT                   /locus_tag="PFL_0560"
FT   CDS_pept        complement(652462..653541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0560"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF08331; match to protein
FT                   family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95969"
FT                   /db_xref="GOA:Q4KJ79"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ79"
FT                   /protein_id="AAY95969.1"
FT                   /translation="MPAITQDLPALAQSIKDWGRELGFQQVGISGLDLAEHEQHLERWL
FT                   AAGYHGEMEYMGAHGSKRSHPDQLVPGTLRVVSLRMDYLPGDTQMAQRLAQPSKAYVSR
FT                   YALGRDYHKLIRKRVQQLAERIQQAIGPFGYRAFVDSAPVLEKAIAEQAGLGWIGKNTL
FT                   VLNRKAGSYFFLSELFVDLPLPVDAPHATEHCGRCTACLDICPTNAFVGPYVLDARRCI
FT                   SYLTIELKSAIPEDLRPLIGNRVFGCDDCQIVCPWNRFARSTAEGDFKPRHNLDNAELA
FT                   ELFMWDEDKFLSNTEGSPLRRAGYERWLRNLAVGLGNAPSSIPVLEALKARQDYPSELV
FT                   REHVQWALDQHANRQCSSL"
FT   gene            653605..654465
FT                   /locus_tag="PFL_0561"
FT   CDS_pept        653605..654465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0561"
FT                   /product="YjeF family protein"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM TIGR00196"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95970"
FT                   /db_xref="GOA:Q4KJ78"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ78"
FT                   /protein_id="AAY95970.1"
FT                   /translation="MPQTKHPLPDVQLLTSGHLPHLNGRLRDAHKGQFGHLLLIGGDRG
FT                   FAGAALLSAESALRSGAGLVSLATRSEHVAAAAARLPEVMTQGTHSANQLMGLLARATV
FT                   LVVGPGLGQGAWGRSLLSAAANAPLPQVWDADALNLLAEGGLQLPAASVITPHPGEAAR
FT                   LLGISSAEVQADRPAAALALSKKYAAVAVLKGAGSLIATADGRLARCDVGHPAMATAGL
FT                   GDVLAGLIGALLAQGLSAFDAACLAVWLHASAGEQQGKLGRGLAASDLIPAIRQLLEEQ
FT                   SPCLS"
FT   gene            654453..654923
FT                   /locus_tag="PFL_0562"
FT   CDS_pept        654453..654923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0562"
FT                   /product="ATPase, YjeE family"
FT                   /note="identified by similarity to SP:P0AF69; match to
FT                   protein family HMM PF02367; match to protein family HMM
FT                   TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95971"
FT                   /db_xref="GOA:Q4KJ77"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ77"
FT                   /protein_id="AAY95971.1"
FT                   /translation="MSELTLFLADEPAMVEFGARIAQVTQGVGVIFLEGDLGAGKTTLS
FT                   RGIIRGLGHAGAVKSPTFTLVEPYEIGSVRAFHFDLYRLVDPEELEFLGIRDYFEGDAL
FT                   CLLEWPQRGAGFLPKPDLTITITPHNNGRSVHLLSQGSRGESWCAALALEFK"
FT   gene            654939..656354
FT                   /locus_tag="PFL_0563"
FT   CDS_pept        654939..656354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0563"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95972"
FT                   /db_xref="GOA:Q4KJ76"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ76"
FT                   /protein_id="AAY95972.1"
FT                   /translation="MRIRALVAVVGLLLTALAVDAVAATQVRSVRLWRAPDNTRLVFDL
FT                   SGPVQHSVFTLTAPDRLVIDINGATLGGPLNVATANTPITAMRSAQRTPSDLRVVIDLK
FT                   KAVTPKSFTLAPNAQYGNRLVVDLFDNPADAAPPTAPPPTVATVPAVPVTPAEPAIKLP
FT                   PAPAGKRDIIVVIDAGHGGEDPGASGSRGQHEKDVVLAIARELQRQVNGLKGFRAELTR
FT                   TGDYFIPLRGRTEIARKKGADLFVSIHADAAPSAAAFGASVFALSERGATSETARWLAD
FT                   SENRSDLIGGAGNVSLDDKDRMLAGVLLDLSMTASLTSSLNVGQKVLNNIGRVTPLHKQ
FT                   RVEQAGFMVLKSPDIPSILVETGFISNSNEASKLATASHQQALARSISSGVRQFFQQNP
FT                   PPGTYIAWLRDSGKIAQGPRDHRVNPGETLAMIAVRYQVSAATLRSANNLKSDELKVGQ
FT                   VLTIPGTELAAKE"
FT   gene            656351..658261
FT                   /gene="mutL"
FT                   /locus_tag="PFL_0564"
FT   CDS_pept        656351..658261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="PFL_0564"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="identified by similarity to SP:P23367; match to
FT                   protein family HMM PF01119; match to protein family HMM
FT                   PF02518; match to protein family HMM PF08676; match to
FT                   protein family HMM TIGR00585"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95973"
FT                   /db_xref="GOA:Q4KJ75"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ75"
FT                   /protein_id="AAY95973.1"
FT                   /translation="MSESVISSARIELLSPRLANQIAAGEVVERPASVIKELLENSLDS
FT                   GAKRIDVDVEQAGVKLLRVRDDGSGISSDDLPLALARHATSKIRDLEDLERVMSLGFRG
FT                   EALASISSVARLTLTSRTRDAEQAWQVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTP
FT                   ARRKFLKAEKTEFDHLQEVIKRLALARFDVAFHLRHNGKSILSLHEAKDDAARARRVAA
FT                   VCGSGFLEQALPIEVERNGLHLWGWVGLPTFSRSQADLQYFYVNGRAVRDKLVAHAVRQ
FT                   AYRDVLFNGRHPTFVLFFEVDPSVVDVNVHPTKHEVRFRDGRMVHDFLYGTLHRALGDV
FT                   RPEDQLAAPAAVAGIVRPTGIEAGEFGPQGEMRLAANLALEQPQSQPSFNAPGAGAGSG
FT                   YQYQYTPRPQPVLPAAESQGVYREFFAPLPGAPAAALPDGQEDIPPLGYALAQLKGIYI
FT                   LAENALGLVLVDMHAAHERIMYERLKVAMASEGLSGQPLLVPESIAVSQREADCAEEHM
FT                   SWFQRLGFELQRLGPESLAIRQIPALLKQAEANRLVHDVLADLMEYGTSDRIQAHLNEL
FT                   LGTMACHGAIRANRRLALPEMNALLRDMENTERSGQCNHGRPTWTQMGLDDLDKLFLRG
FT                   R"
FT   gene            658261..659232
FT                   /gene="miaA"
FT                   /locus_tag="PFL_0565"
FT   CDS_pept        658261..659232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="PFL_0565"
FT                   /product="tRNA dimethylallyltransferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by match to protein family HMM PF01715;
FT                   match to protein family HMM TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95974"
FT                   /db_xref="GOA:Q4KJ74"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ74"
FT                   /protein_id="AAY95974.1"
FT                   /translation="MTQLPPAIFLMGPTAAGKTDLAIELTKVLPCELISVDSALVYRGM
FT                   DIGTAKPSRELLAQFPHRLIDILDPAESYSAADFRTDALAAMADITARGKIPLLVGGTM
FT                   LYYKALLEGLADMPAADPQVRAELEEEAARLGWQALHDQLAAVDPESAARIHPNDPQRL
FT                   TRALEVYRVSGLTMTAHRQRQLAQSTEAGASGRSQLPYTVANLAIAPANRQVLHQRIAQ
FT                   RFTQMLEQGFIDEVVALRSRSDLHAGLPSIRAVGYRQVWDHLDGKLTSAEMQERGIIAT
FT                   RQLAKRQFTWLRSWADLQWLDSLDCDNLPRALKYLGTISILS"
FT   gene            659325..659585
FT                   /gene="hfq"
FT                   /locus_tag="PFL_0566"
FT   CDS_pept        659325..659585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="PFL_0566"
FT                   /product="RNA chaperone Hfq"
FT                   /note="identified by match to protein family HMM PF01423;
FT                   match to protein family HMM TIGR02383"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95975"
FT                   /db_xref="GOA:Q4KJ73"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ73"
FT                   /protein_id="AAY95975.1"
FT                   /translation="MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPVRPIRLPSASESEQGDAEPGNA"
FT   gene            659598..660899
FT                   /gene="hflX"
FT                   /locus_tag="PFL_0567"
FT   CDS_pept        659598..660899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="PFL_0567"
FT                   /product="GTP-binding protein HflX"
FT                   /note="identified by similarity to SP:P25519; match to
FT                   protein family HMM PF01926; match to protein family HMM
FT                   TIGR03156"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95976"
FT                   /db_xref="GOA:Q4KJ72"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ72"
FT                   /protein_id="AAY95976.1"
FT                   /translation="MFFERHGGGERAILVHLDGQDPEAREDPQEFQELALSAGAETVAF
FT                   VSVPRHRPTAKYLVGSGKVEELRDLVKAEQVDLVIFNHILTPSQERNLERVFECRVIDR
FT                   TGLILDIFAQRARTHEGKLQVELAQLEHMSTRLVRGWTHLERQKGGIGLRGPGETQLET
FT                   DRRLLRVRLRQIKARLEKVRSQREQARRGRKRADIPSVSLVGYTNAGKSTLFNAVTASD
FT                   VFAADQLFATLDPTLRRLELDDLGPIVLADTVGFIRHLPHKLVEAFRATLEESSNSDLL
FT                   LHVIDAHEPERMAQIEQVMVVLGEIGAQDLPILEVYNKLDLLEGVEPQIQRDPDGKPQR
FT                   VWLSARDGQGLDLLKQAIAELLGEDLFVGTLRLPQRFARLRAQFFQLNAVQKEDHDDEG
FT                   VSLLAVRLPRAELNRLVSREGMQPSEFIEQHTLQ"
FT   gene            660996..662174
FT                   /gene="hflK"
FT                   /locus_tag="PFL_0568"
FT   CDS_pept        660996..662174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="PFL_0568"
FT                   /product="HflK protein"
FT                   /note="identified by similarity to SP:P25662; match to
FT                   protein family HMM PF01145; match to protein family HMM
FT                   TIGR01933"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95977"
FT                   /db_xref="GOA:Q4KJ71"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ71"
FT                   /protein_id="AAY95977.1"
FT                   /translation="MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNG
FT                   LFGGGKKRGDDGGSSGKGGGFGLLGIGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYYE
FT                   TVGPGLNIYFPPIDRKYMENVTRERAYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVL
FT                   NVDQPEISLQHATDSALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDNYRTGITVT
FT                   QVNVQSAAAPREVQEAFDDVIRAREDEQRSRNQAETYANGVVPEARGQAQRILEDANGY
FT                   RDEVVSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGSKGGQNN
FT                   LLYLPLDKMIDSGRSGSAPVTGAASAASNEANARAAADHMQQQQQTRSRETR"
FT   gene            662174..663043
FT                   /gene="hflC"
FT                   /locus_tag="PFL_0569"
FT   CDS_pept        662174..663043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="PFL_0569"
FT                   /product="HflC protein"
FT                   /note="identified by match to protein family HMM PF01145;
FT                   match to protein family HMM TIGR01932"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95978"
FT                   /db_xref="GOA:Q4KJ70"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ70"
FT                   /protein_id="AAY95978.1"
FT                   /translation="MSNKSLIALIVGVVVAVVAWNSFYIVAQTERAVLLQFGRVVQADV
FT                   QPGLHVKVPYVNQVRKFDARLMTLDAPTQRFLTLEKKAVMVDAYAKWRVKDAERFYTAT
FT                   SGLKQIADERLSRRLESGLRDQFGKRTLHEVVSGERDALMADITASLNKMAEKELGIEV
FT                   VDVRVKAIDLPKEVNRSVFERMSTEREREAREHRAKGNELAEGIRADADRQRRVLLAEA
FT                   YRESEEARGDGDAQAAAIYAKAYGQDQEFYAFYRSLRAYRESFANKSDVMVLDPSSDFF
FT                   HYLEKSKP"
FT   gene            663336..664523
FT                   /gene="hisZ"
FT                   /locus_tag="PFL_0570"
FT   CDS_pept        663336..664523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="PFL_0570"
FT                   /product="ATP phosphoribosyltransferase, regulatory
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM TIGR00443"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95979"
FT                   /db_xref="GOA:Q4KJ69"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ69"
FT                   /protein_id="AAY95979.1"
FT                   /translation="MATVDRWLLPDGIEEVLPPEAARIEVARRQVLDLFQSWGYEFVVT
FT                   PHIEYLESLLTGAGQDLDLRTFKVIDPQSGRQMGFRADITPQVARIDAHTLRREGPSRL
FT                   CYAGSVLHAQPRALSSSRSPIQLGAELYGDASPSSDVEVISLMLAMLQLADVPDVHMDL
FT                   GHVGIYRGLAQAAGLSGAVEQQLFDALQRKAIDEVISLTEGLPADLADMLRSLVDLCGS
FT                   REVLGDARRRLAGAPTSVLLALDELLTIAERLSVRFPDLPLYFDLGELRGYHYHTGVVF
FT                   AVFVPGVGQSIAQGGRYDDIGADFGRARPATGFSTDLKTLVTLGRAEVELPSGGIWMPD
FT                   NTDAALWQTVCRLRSEGQRVVQALPGQPLAAAREADCDRQLIQQNGLWQVLPLAS"
FT   gene            664578..665870
FT                   /gene="purA"
FT                   /locus_tag="PFL_0571"
FT   CDS_pept        664578..665870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="PFL_0571"
FT                   /product="adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by similarity to SP:P12283; match to
FT                   protein family HMM PF00709; match to protein family HMM
FT                   TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95980"
FT                   /db_xref="GOA:Q4KJ68"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ68"
FT                   /protein_id="AAY95980.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLV
FT                   IDGEKTVLHLIPSGVLREGVQCLIGNGVVVAPDALMREIVKLEEKGVPVRERLRISPSC
FT                   PLILSYHVALDQAREKARGEQKIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLG
FT                   ELLDYHNFVLVNYYKEPAIDFQKTLDECMEYAELLKPMMLDVTAELHQLRRAGKDIMFE
FT                   GAQGSLLDIDHGTYPYVTSSNTTAGGIATGSGVGPMYLDYILGITKAYTTRVGSGPFPT
FT                   ELFDDIGAFLAKRGHEFGATTGRARRCGWFDAVILRRAIDVNSISGLCLTKLDVLDGLE
FT                   TINICVGYKNQDGAVIDAPTDADSYIGLEPVYEQMPGWSESTLGAKTLEELPAAAQAYI
FT                   KRIEELVGAPIDIISTGPDRNETIVLRHPFA"
FT   gene            666010..667944
FT                   /locus_tag="PFL_0572"
FT   CDS_pept        666010..667944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0572"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95981"
FT                   /db_xref="GOA:Q4KJ67"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ67"
FT                   /protein_id="AAY95981.1"
FT                   /translation="MSAVLSLLQSRLLRPVFVTLGIALLVQVLVAVALTRSTVTALEAD
FT                   LASRLGGDSQKLAGELEQAGKEVTSSLESLSSSTRQRLTAGLSSRLKEEQVQLRAALEK
FT                   DLKDSANDMAQLLASVAPRAMWDSDVPTLSEFARRAQRNPNVLFVVYDDAAGEHLTRYL
FT                   NRENPINKALLEKGKGDRALDKVLDAAKNDPSVYYLEASINPNGVEIGKVLMGVSTASV
FT                   EADIAALDQRFSALIASSDQLVGDSLKGASADSSAAMRSRLQSAQGTAAQMQANTASTV
FT                   QEAAATLRWQIGVGLALVGLALLLLLAVVLGRRVVSKLHLLIAALNDLAAGEGDLTKRV
FT                   PLNSNDEIGDMASAVNRFVDKLQPIVREAGDVAQRTGVEIGAMSQRNAGADAAAEAQRD
FT                   EVAESLRALSQMADEAQAESQAMQAALQQVVEIRQATDETTRTSEQVGSLIEALAGQVD
FT                   TGAKVIERLAQQSEQIEVVLTVIHGIAEQTNLLALNAAIEAARAGETGRGFAVVADEVR
FT                   ALASKTQSSTGDIQAHIGALQQGAREAVAAIGQAGRQASEGLLVLRDSARLQQSVQSSV
FT                   EQVHAAIGLATQAAAHQAQGAQAVRGRVETIHAQAERAAQAVVETTASGKVLDSLAAQL
FT                   KASLGQFRA"
FT   gene            complement(668011..669576)
FT                   /gene="fbpB"
FT                   /locus_tag="PFL_0573"
FT   CDS_pept        complement(668011..669576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpB"
FT                   /locus_tag="PFL_0573"
FT                   /product="iron ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P71338; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95982"
FT                   /db_xref="GOA:Q4KJ66"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ66"
FT                   /protein_id="AAY95982.2"
FT                   /translation="MNPSPSASALRTTFVPRRKRPSIWLLLPVLLLVCLSLLPLLYVGL
FT                   KAWQAGWAEALHLLWRPYVLRLLSNTLLLMLGVTLACAVLGLSLAWLLERSDLPGRRIW
FT                   GVVLCLPFAVPAFVSSFTWVSLSAGFEGLGGAILVMTLSKYPLVFLPVAATLRNLDPSL
FT                   EESARTLGQNRWGVFFKITLPLLWPSLLAGSLLIALHMLVEFGALSIIGLQTFTTAIYQ
FT                   QFELEFSNANAAMLSAVLLALCLLLLGLELRVRGKGRHVRTGQGAARHAEQVRLGRWSI
FT                   GGQLYCLMLALIGSGVPLGMLAYWLAVGSSAAFPVAAISEALLSSLALSLGGAGLCLVL
FT                   AVPVGLLVVRYKGRLAIWAERLPYLLHALPGLVIALTLVYFALHYVPVLYQTSALLLIA
FT                   YALLFLPLAQAPIRTALNKAAPQLEEAARTLGASSFSAFCRVTLPIIFPALGAAFALVF
FT                   LDAMKELTATLLLSPTGLNTLATEVWAHTANVEFAAAAPYAALLILVSGLPVYLLTTRM
FT                   YLSR"
FT   gene            complement(669576..670601)
FT                   /gene="fbpA"
FT                   /locus_tag="PFL_0574"
FT   CDS_pept        complement(669576..670601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpA"
FT                   /locus_tag="PFL_0574"
FT                   /product="iron ABC transporter, periplasmic iron-binding
FT                   protein"
FT                   /note="identified by similarity to SP:P35755; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95983"
FT                   /db_xref="GOA:Q4KJ65"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ65"
FT                   /protein_id="AAY95983.1"
FT                   /translation="MMFRNTLLPTSLLRGLTITLLGLTLASPFTQAADPVSLTLYNGQH
FT                   KEVGDAVAKAFEAKTGIHVNVRKGSSNQLASQVVEEGDRSPADVIYTEESPPLNKLGEQ
FT                   GLLAQTDTTTLAVLPKEYVAGNGTWIGVTARVRVVAFNPKLIDEKDLPKSVMEFSQPQW
FT                   QGKVGFVPTSGAFQEQAVAIIKMHGRDAAEEWLTGLRAFGKVYSNNMVALKAVENGEVA
FT                   TVLVNNYYWFALQREKGQLDSKLHYFMGGDVGGLITVSSAAVLKSSKHPKEAQQLLAYM
FT                   ASEEGQRVITQTTAEYPLHKGMQSDRGLKPFNELEAPKVTPADLGNAEEALDLERDVGL
FT                   N"
FT   gene            complement(670787..670873)
FT                   /locus_tag="PFL_0575"
FT   tRNA            complement(670787..670873)
FT                   /locus_tag="PFL_0575"
FT                   /product="tRNA-Leu"
FT   gene            complement(671039..671125)
FT                   /locus_tag="PFL_0576"
FT   tRNA            complement(671039..671125)
FT                   /locus_tag="PFL_0576"
FT                   /product="tRNA-Leu"
FT   gene            671352..673979
FT                   /gene="rnr"
FT                   /locus_tag="PFL_0577"
FT   CDS_pept        671352..673979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="PFL_0577"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to SP:P21499; match to
FT                   protein family HMM PF00575; match to protein family HMM
FT                   PF00773; match to protein family HMM PF08206; match to
FT                   protein family HMM PF08461; match to protein family HMM
FT                   TIGR00358; match to protein family HMM TIGR02063"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95984"
FT                   /db_xref="GOA:Q4KJ64"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ64"
FT                   /protein_id="AAY95984.1"
FT                   /translation="MADWQSLDPEAAREAEKYENPIPSRELILQHLADRGSPASREQLV
FT                   EEFGLTTEDQLEALRRRLRAMERDAQLIYTRRGTYAPVDKLDLILGRISGHRDGFGFLV
FT                   PDDGSDDLFMSPAQMRLVFDGDRALARVSGLDRRGRREGVIVEVVSRAHESIVGRYFEE
FT                   GGIGFVVADNPKIQQEVLVTPGRNANAKIGQFVEVKITHWPTPRFQPQGDVVEVVGNYM
FT                   APGMEIDVALRTYDIPHVWPEAVLKEAGKLKPEVEEKDKEKRIDLRDLPFVTIDGEDAR
FT                   DFDDAVFCEAKPGKLRLFGGGWKLYVAIADVSSYVKIGSALDAEAQVRGNSVYFPERVI
FT                   PMLPEQLSNGLCSLNPKVDRLAMVCEMTISKSGEMTDYQFYEAVIHSKARLTYNKVSTM
FT                   LEQPKTSEAKQLRGEYGDVLPHLKQLYALYKVLLGARHTRGAIDFETQETRIIFGSERK
FT                   IAEIRPTTRNDAHKLIEECMLAANVATAEFLKKHEIPALYRVHDGPPPERLEKLRAFLG
FT                   ELGLSLHKGKDGPTPKDYQALLETIKDRPDYHLIQTVMLRSLSQAVYSADNQGHFGLNY
FT                   EAYTHFTSPIRRYPDLLTHRAIRSVIHSKQDTPHVRRAGAMTIPKARIYPYDEATLEQL
FT                   GEQCSMSERRADEATRDVVNWLKCEFMKDRVGESFPGVITAVTGFGLFVELTDIYVEGL
FT                   VHVTALPGDYYHFDPVHHRLAGERTGRSFRLGDTVEVRVMRVDLDERKIDFEMAEKTIN
FT                   APIGRKKRGAADAPASKVVEEPAPAKAGRRSSAKEKAVEAYRPSDAAAKNAEVRKSREM
FT                   KRALLAEAKGGGKATSAGKSGKPAPSRAGEKPAKPSKHRKGPPKAGSASGAKSGGARKP
FT                   KAKS"
FT   gene            673976..674740
FT                   /gene="rlmB"
FT                   /locus_tag="PFL_0578"
FT   CDS_pept        673976..674740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="PFL_0578"
FT                   /product="23S rRNA (guanosine-2'-O-)-methyltransferase
FT                   RlmB"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P63177; match to
FT                   protein family HMM PF00588; match to protein family HMM
FT                   PF08032; match to protein family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95985"
FT                   /db_xref="GOA:Q4KJ63"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ63"
FT                   /protein_id="AAY95985.1"
FT                   /translation="MSQLEKIYGVHAVEALLRHHPKRVKQIWLAEGRSDPRVQVLVDLA
FT                   AQNRVSVGQAERREMDAWVEGVHQGVVAEVSPSQVWGEAMLDELLDRTEGAPLLLVLDG
FT                   VTDPHNLGACLRTADAAGALAVLVPKDKSATLTPTVRKVACGAAEVIPLVAVTNLARTL
FT                   EKLQQRGLWIVGTAGEAEQELYDQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAG
FT                   SVSSLNVSVATGVCLFEAMRQRGAKAKAAKKA"
FT   gene            674991..675416
FT                   /gene="rpsF"
FT                   /locus_tag="PFL_0579"
FT   CDS_pept        674991..675416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="PFL_0579"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by similarity to SP:P02358; match to
FT                   protein family HMM PF01250; match to protein family HMM
FT                   TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95986"
FT                   /db_xref="GOA:Q4KJ62"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ62"
FT                   /protein_id="AAY95986.1"
FT                   /translation="MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRR
FT                   QLAYAINNVHKAHYVMLNVECTGKALAELEDNFRYNDAVIRNLVIRREEAITGQSEMLK
FT                   AEENRSERRERRDRPEHADSADGDDSDNSDASDNADE"
FT   gene            675445..675675
FT                   /gene="rpsR"
FT                   /locus_tag="PFL_0580"
FT   CDS_pept        675445..675675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="PFL_0580"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95987"
FT                   /db_xref="GOA:Q4KJ61"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ61"
FT                   /protein_id="AAY95987.1"
FT                   /translation="MARFFRRRKFCRFTAEDVKEIDYKDLNTLKAYVSETGKIVPSRIT
FT                   GTKARYQRQLATAIKRARFLALLAYTDSHGR"
FT   gene            675712..676611
FT                   /locus_tag="PFL_0581"
FT   CDS_pept        675712..676611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0581"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95988"
FT                   /db_xref="GOA:Q4KJ60"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ60"
FT                   /protein_id="AAY95988.1"
FT                   /translation="MRALAEFIMRGRMQATLVVAGCSALPLLYWLGAAAGSLVLLRRGL
FT                   KDALGVLALGVLPALLWWLTFDDPRALLVLLGSSSLALVLRASESWSRVLLVSIAMGLV
FT                   FAGVLGAAFRPQIEALSQELIKILPMALGEVYQQLSVEERARLATLIAPILTGLIAALL
FT                   QAISVLSLILGRYWQAVLYNPGGFGREFRAIRIPLGPAMLLLACMLVGPNFGPQLAMLT
FT                   PMCSVPLAFAGLALIHGLVAQGRLARFWLVGLYVTLLPFMQLIYPLLVVLAIVDSLVDF
FT                   RGRLAPKDADNGSANGEG"
FT   gene            676633..677079
FT                   /gene="rplI"
FT                   /locus_tag="PFL_0582"
FT   CDS_pept        676633..677079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="PFL_0582"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95989"
FT                   /db_xref="GOA:Q4KJ59"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KJ59"
FT                   /protein_id="AAY95989.1"
FT                   /translation="MELILLEKIANLGNLGDKVNVKAGYGRNYLLPFGKATAATAANLA
FT                   AFEARRAELEKLAAEKKASAETRAAQLAELEVTITATAGDEGKLFGSIGTHDIADALTA
FT                   SGVEVAKSEVRLPNGTIRNVGEFDVAVHLHAEVEATVRVVVVAA"
FT   gene            677204..678601
FT                   /gene="dnaB_2"
FT                   /locus_tag="PFL_0583"
FT   CDS_pept        677204..678601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB_2"
FT                   /locus_tag="PFL_0583"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95990"
FT                   /db_xref="GOA:Q4KJ58"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ58"
FT                   /protein_id="AAY95990.1"
FT                   /translation="MNDISAPEQYDLQTAALKVPPHSIEAEQAVLGGLMLDNNAWERVL
FT                   DQVSDGDFYRHDHRLIFRAIAKLADQNMPIDVVTLSEQLDKEGQTSQVGGLGYLGELAK
FT                   NTPSVANIKAYAQIVRQRATLRQLIGISTEIADSAFNPEGRTAEEILDEAERQIFQIAE
FT                   ARPKTGGPVGVNELLTKAIDRIDTLFNTDNAITGLSTGYTDLDEKTSGLQPADLIIVAG
FT                   RPSMGKTTFAMNLVENAVLRSDKAVLVYSLEMPGESLIMRMLSSLGRIDQTKVRSGQLE
FT                   DDDWPRLTSAVNLLNDRKLFIDDTAGISPSEMRARTRRLVREHGDIAMIMIDYLQLMQI
FT                   PGSSGDNRTNEISEISRSLKALAKEFNCPVVALSQLNRSLEQRPNKRPVNSDLRESGAI
FT                   EQDADVIMFVYRDEVYHPETEHKGIAEIIIGKQRNGPIGFIRLAFIGKYTRFENLAPGS
FT                   YNFDDDE"
FT   gene            678782..681079
FT                   /locus_tag="PFL_0584"
FT   CDS_pept        678782..681079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0584"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF08497"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95991"
FT                   /db_xref="GOA:Q4KJ57"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ57"
FT                   /protein_id="AAY95991.1"
FT                   /translation="MQAAKPLFDYPKYWAECFGPAPFLPMSREEMDQLGWDSCDIIIVT
FT                   GDAYVDHPSFGMAIIGRLLESQGFRVGIIAQPNWQSKDDFMKLGEPNLFFGVAAGNMDS
FT                   MINRYTADKKIRSDDAYTPGGLAGKRPDRASLVYSQRCKEAYKHVPIVLGGIEASLRRI
FT                   AHYDYWQDRVRNSILIDASADILLYGNAERAIVEVAQRLSYGHKIEDITDVRGTAFIRR
FT                   DTPKDWYEVDSTRIDRPGKIDKIINPYVNTQDTQACAIEQEKGPVDDPQEAKVVQILAS
FT                   PRMTRDKTVIRLPSMEKVRNDPVLYAHANRVLHLETNPGNARALVQKHGEVDVWFNPPP
FT                   IPMTTEEMDYVFGMPYQRIPHPAYGKEKIPAYDMIRFSVNIMRGCFGGCTFCSITEHEG
FT                   RIIQNRSEESIIREIEEIRDKVPGFTGVISDLGGPTANMYRIACKSPEIESACRKPSCV
FT                   FPGICPNLNTDHSSLIQLYRSARALPGVKKILIASGLRYDLAVESPEYVKELVTHHVGG
FT                   YLKIAPEHTEEGPLNQMMKPGIGTYDRFKRMFEKYSKEAGKEQYLIPYFIAAHPGTTDE
FT                   DMMNLALWLKGNGFRADQVQAFYPSPMATATAMYHSGKNPLRKVTYKSDGVTIVKSEEQ
FT                   RRLHKAFLRYHDPKGWPMLREALLRMGRGDLIGPGKNQLIPTHQPATDSYQSARRKNST
FT                   PAGSHKVAKETKILTQHTGLPPRGSDGGNAWDKREQAKAAAFARNKQAAKERADAAKGK
FT                   GKKPTRKPVVPR"
FT   gene            681261..682193
FT                   /locus_tag="PFL_0585"
FT   CDS_pept        681261..682193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95992"
FT                   /db_xref="GOA:Q4KJ56"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ56"
FT                   /protein_id="AAY95992.1"
FT                   /translation="MTSPLDGVIRDLSLTQVLARQRIESQINLPRLFAAIDTDPSIAGA
FT                   GVVYIDADFNVVTLREFRPICSIVPKRVILREAKRYIAPQQFVDQVKNNPRESRLATES
FT                   FNTTLACTAAVIGWLVVFSGSIAVPFTAGASVWVVALGASAAMAGTAQCVIGGARVINE
FT                   IQDPAANDRMDDAEWYNIVTPILDGISLVGVGGSALTTLRLLKASKAANTGKSWMQLLK
FT                   GLNRQERAKLTKELLTLRDPSLTSKLLKLQQRAGALPRRYSSTQIRHATLTQMQDALGA
FT                   ALSTSGSISSGNLGQVKTLAVGLYEEFDE"
FT   gene            682190..682639
FT                   /locus_tag="PFL_0586"
FT   CDS_pept        682190..682639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0586"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95993"
FT                   /db_xref="GOA:Q4KJ55"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ55"
FT                   /protein_id="AAY95993.2"
FT                   /translation="MIDGGRMRDFLVRYFPTFMLTVLLGCFSASLLLSLAGTTYWRAMA
FT                   PPQRDEYLLFGLLVLIPLLVLGNLLIVRGISRAVWLVAGYFVACLLGVVPMFQYHPHQG
FT                   VYLFGVLLPLLGLLLLNSKRHREMRERLLQIRQQRQRFKQQRKRG"
FT   gene            682811..686086
FT                   /locus_tag="PFL_0587"
FT   CDS_pept        682811..686086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0587"
FT                   /product="transglutaminase-like protein"
FT                   /note="identified by match to protein family HMM PF01841;
FT                   match to protein family HMM PF08379"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95994"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ54"
FT                   /protein_id="AAY95994.1"
FT                   /translation="MSIHVALHHVTHYRYDRAVELGPQIVRLRPAAHSRTRILSYALKV
FT                   QPEQHFINWQQDPQGNYLARLVFPEKTSELRIEVDLLAEMAVFNPFDFFLEPYAEQIPF
FT                   AYAADEQRELAPYLETLPLTPRFQAYLDAISRSPLPAVDFLVGLNQRLSADIAYLIRME
FT                   PGVQTPEQTLLNASGSCRDSAWLLVQLLRNLGLAARFVSGYLIQLTADVKSLDGPSGTE
FT                   VDFTDLHAWCEVYLPGAGWIGLDATSGLFAGEGHIPLACSPDPSSAAPITGLVEPCECE
FT                   FSHEMSVERIWEAPRVTKPYTDEQWLAIQALGRQIDVDLLEADVRLTMGGEPTFVAIDD
FT                   PDGPEWNTAALGANKRRLAGELFQRLRQHYAPQGLVHFGQGKWYPGEQLPRWSLNCHWR
FT                   RDGVPVWRNNALIADEHEDYAADALLAGRFLASVAERLKLPARFVFPAYEDNFYYLWRE
FT                   GSLPLNVSAEDSRLEDALERQRLRKVFSQGLDKVIGQVLPLARTAKGDQWQSGRWYLRD
FT                   SHCRLVPGDSPLGYRLPLASQPWVTAAEYPFIHATDPNQDFPELAGAAQLAAIDEPAVA
FT                   DERVPQVDESADWLTRTALCAEAREGRLYLFMPPLERLEDYLQLVSVIEATAEELRCPV
FT                   LLEGYEPPADPRLCNFRVTPDPGVIEVNVQPSVSWDELVERTEFLYEQARQTRLTSEKF
FT                   MIDGRHTGTGGGNHFVLGGATPADSPFLRRPDLLRSLISYWHNHPSLSYLFSGLFIGPT
FT                   SQAPRVDEARNDALYELEIAFAQMPAPGQECAPWLVDRLLRNLLIDVTGNTHRAEFCID
FT                   KLYSPDGATGRLGLLELRAFEMPPHARMSLAQQLLLRALVARFWREPYAPARLARWGTE
FT                   LHDRFLLPHFIEQDFADVLVELNAAGYPLRAEWFAAHLEFRFPKVGDYAVSGIELELRQ
FT                   ALEPWHVLGEEGAAGGTVRYVDSSLERLQVKVGGLVPERHVLTCNGVALPLHPTGRVGE
FT                   FVAGVRYRAWQPANCLQPTIPVHAPLVFDLLDTWMQRSLGGCQYHVAHPGGRNYDSLPV
FT                   NANEAESRRMARFFRLGHSPGSLEVPPVVINAELPLTLDLRRF"
FT   gene            686174..688660
FT                   /locus_tag="PFL_0588"
FT   CDS_pept        686174..688660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04168;
FT                   match to protein family HMM PF04169; match to protein
FT                   family HMM PF04174"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95995"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ53"
FT                   /protein_id="AAY95995.1"
FT                   /translation="MPDLLDRYPLTAGTYHELLDDQGQVRAHWQRLLEQLQRSSPGQLA
FT                   QRQALLTRQIHENGVTYNVYADPKGADRPWELDLLPHVIAADEWQLLSTGIAQRARLLN
FT                   AVLADLYGPQRLIREGLLPAELVFGHNNFLWPCQGICPPEQTFLHLYAVDLARSPDGRW
FT                   WVTADRTQAPSGAGYALENRMSVSRAFPDLYRDLQVQHLAGFFRTLQETLARQAPRDSE
FT                   APLVVLLTPGRFNESYFEHLYLARQLGYPLVEGGDLTVRDATVYLKTLSGLRRVHAIMR
FT                   RLDDDFCDPLELRTDSALGVPGLLDAVRQGRVLVANALGSGVLESPGLLGFLPKISQFL
FT                   LGEELLLPSIATWWCGEAPVLQQALEKLPDLLVKPAFASQSFTPVLGRDLDPEQRRQLA
FT                   ERMRARPYAYVAQELPQLSQAPVWQAENGQLQPRAIGMRVYAVASEDGYRVLPGGLTRV
FT                   AAQAGAEVVSMQRGGASKDTWVLGERAPSGEQWKAQRTIGVYDLVRRDPYLPSRVVENL
FT                   FWFGRYCERCDDSARLLRIMLARYVDGDDPQALLAAVDLGESLMLLPDEGELPERLLAA
FT                   LLGEDWSFSLRSNLQRLQWAASQVRGKLSRENWQALVELQREAQELDTPEPDFAELLDF
FT                   LNRLVMSLAALSGFALDDMTRDEGWRFLMIGRRIERLQFLSSSLAAFLRGTAAFDQAGL
FT                   DWLLELGNSSITYRSRYLAVAQLIPVLDLLLLDEQNPHAVLFQLKLVTRTLKRLNDDFC
FT                   VPRELALPRLVERLAHFDLGCLENSLFGETSVRAAVEGLADLLQEIAEVSGQVSDRLAL
FT                   RHFAHVDDVSQQTVSV"
FT   gene            688660..689550
FT                   /locus_tag="PFL_0589"
FT   CDS_pept        688660..689550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0589"
FT                   /product="transglutaminase-like protein"
FT                   /note="identified by match to protein family HMM PF01841;
FT                   match to protein family HMM PF08379"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95996"
FT                   /db_xref="GOA:Q4KJ52"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ52"
FT                   /protein_id="AAY95996.1"
FT                   /translation="MSARYQVFHDTHYRYDSPVSLAQQLAHLWPRACAWQLCSERQLLI
FT                   SPDPTSRRDEQDVFGNPLTRLAFERPHDELLVNAQLSVEVLERPALDFAASLPWDAARG
FT                   ALTYSGQPLSEALLEACRYRFESPYVHLKQSFVEFCASCFVPGRPLLQGAQALMEKIFS
FT                   EFTFDAEATQVATPLVEVLERRRGVCQDFAHLMLACLRSRGLAARYVSGYLLTQPPPGQ
FT                   PRLIGADASHAWVSVFCPVLGWVDFDPTNNVQPALEHITLAWGRDFSDVSPLRGVILGG
FT                   GSHDPDVRVTVMPLA"
FT   gene            complement(689660..689836)
FT                   /locus_tag="PFL_0590"
FT   CDS_pept        complement(689660..689836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95997"
FT                   /db_xref="GOA:Q4KJ51"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ51"
FT                   /protein_id="AAY95997.1"
FT                   /translation="MAKPNYSFAKRQRDLAKEQKKEEKLQRKKAAAEETSALNPDAEGE
FT                   VSVDDAEPEAPQA"
FT   gene            complement(689905..690492)
FT                   /locus_tag="PFL_0591"
FT   CDS_pept        complement(689905..690492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03641;
FT                   match to protein family HMM TIGR00730"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95998"
FT                   /db_xref="GOA:Q4KJ50"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ50"
FT                   /protein_id="AAY95998.1"
FT                   /translation="MSLTSVCVFCGASTGANPLYREAAQALGRAIAERRLTLVYGGGAV
FT                   GLMGIVADAALAAGGEVIGIIPQSLKDKEIGHRGLTRLEVVDGMHARKARMAELSDAFI
FT                   ALPGGLGTLEELFEVWTWGQLGYHHKPLGLLEVNGFYEKLSGFLDHIVGEGFVRAPHRD
FT                   MLQMSESPAGLLDALDAWQPTVPDKWAEGKPS"
FT   gene            690844..691290
FT                   /gene="azu"
FT                   /locus_tag="PFL_0592"
FT   CDS_pept        690844..691290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azu"
FT                   /locus_tag="PFL_0592"
FT                   /product="azurin"
FT                   /note="identified by similarity to SP:P00286; match to
FT                   protein family HMM PF00127; match to protein family HMM
FT                   TIGR02695"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAY95999"
FT                   /db_xref="GOA:Q4KJ49"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014068"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ49"
FT                   /protein_id="AAY95999.2"
FT                   /translation="MFAKLVAVSLLTLASSQLMAAECKVDVDSTDQMSFNTKEITIDKS
FT                   CKTFTVNLTHSGSLPKNVMGHNWVLSKTADMAGIATDGMAAGIDKSYLKEGDTRVIAHT
FT                   KIIGAGEKDSVTFDVSKLTAGESYQFFCSFPGHNSMMKGAVVLK"
FT   gene            complement(691444..692271)
FT                   /gene="nadE_2"
FT                   /locus_tag="PFL_0593"
FT   CDS_pept        complement(691444..692271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE_2"
FT                   /locus_tag="PFL_0593"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="identified by similarity to SP:P18843; match to
FT                   protein family HMM PF02540; match to protein family HMM
FT                   TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAY96000"
FT                   /db_xref="GOA:Q4KJ48"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ48"
FT                   /protein_id="AAY96000.1"
FT                   /translation="MQAVQREIAQQLKVQAPFPDHAALEAEIARRIRFIQDCLVNSGLK
FT                   SLVLGISGGVDSLTAGLLAQRAMRELRERSGDDRYRFIAVRLPYETQFDEHDAQASVDF
FT                   INPDERHTVNIGPAVRALANEVAAFEGQHAVSRDFVLGNTKARMRMVAQYTIAGAAHGL
FT                   VIGTDHAAEAVMGFFTKFGDGACDLAPLSGLVKNQVRSIARYFGAPESLVEKVPTADLE
FT                   DLSPGKPDEASHGVTYAEIDAFLHGQPVREEAFKIICDTYRKTHHKRVMPFAP"
FT   gene            complement(692275..693489)
FT                   /gene="pncB_2"
FT                   /locus_tag="PFL_0594"
FT   CDS_pept        complement(692275..693489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB_2"
FT                   /locus_tag="PFL_0594"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01514"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAY96001"
FT                   /db_xref="GOA:Q4KJ47"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ47"
FT                   /protein_id="AAY96001.1"
FT                   /translation="MSESVFADRIVQNLLDTDFYKLTMMQAVLHNYPNVEVEWEFRCRN
FT                   SEDLRPYLAEIRYQFERLADLSLSADQLGFLERISFLKPDFLRFLGLFRFNLRYVHTGI
FT                   EDGELFIRLRGPWLHVILFEVPMLAIISEVRNRYRYREIQLVQAREQLYRKFDWLTANA
FT                   SSEELSELQVADFGTRRRFSYRVQEEVVNVLKHDFPGRFVGTSNVHLSRELNMKPLGTM
FT                   AHEWIMAHQQLGPRLIDSQIAALDCWVREYRGLLGIALTDCITTDAFLGDFDLFFAKLF
FT                   DGLRHDSGDPILWAEKAIAHYHKLGIDPMSKTLVFSDSLSLPRALEIFRALRGRINVSF
FT                   GIGTNLTCDIPGVEPMSIVLKMAACNGQPVAKISDEAGKTHCKDPNFVAYLRHVFQVPA
FT                   QPGKE"
FT   gene            complement(693692..694594)
FT                   /locus_tag="PFL_0595"
FT   CDS_pept        complement(693692..694594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0595"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by similarity to GB:BAC65316.1; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAY96002"
FT                   /db_xref="GOA:Q4KJ46"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ46"
FT                   /protein_id="AAY96002.1"
FT                   /translation="MLNKRYLPSITALQCFEAVTRHLSFTRAAEELNLTQSAVSKQVAQ
FT                   LEELLQHLLFRRVRRRLQLTPAGDLYLVEVRKILTQVEMSTHYLRSYGGETEVLRVSTP
FT                   YTFGARWLVPRLKGWRLRHPHIHLDLCNEQEPDELLQGHADLAFYFGQGSRPGTESLKL
FT                   FSEELVAVCAPDSLPAEPLTDPRQLTELVLLQNASRPQGWHEWFDQQGYQTEHSYHGPR
FT                   FETFYMCIRAAQVGCGVALLPRFLVEEELAEGKLVIAWEYAMPSQDAYYLAYPEHSAEV
FT                   PKVRDFVRWMLEHNDSPLS"
FT   gene            694765..696255
FT                   /gene="pcd"
FT                   /locus_tag="PFL_0596"
FT   CDS_pept        694765..696255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcd"
FT                   /locus_tag="PFL_0596"
FT                   /product="piperideine-6-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by similarity to GB:BAB19801.1; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAY96003"
FT                   /db_xref="GOA:Q4KJ45"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ45"
FT                   /protein_id="AAY96003.1"
FT                   /translation="MVAALLDRLGVNPALYQSGTQPVHSPIDGSRIAAVNWQGAAEVEQ
FT                   QVSRAEHAFALWRKVPAPRRGELVRQFGEVLREYKADLGELVSWEAGKITQEGLGEVQE
FT                   MIDICDFAVGLSRQLYGLTIASERPGHHMRETWHPLGVVGVISAFNFPVAVWAWNTTLA
FT                   LVCGNPVIWKPSEKTPLTALACQALLERVLKNFQDAPEYLSQVIIGGRDAGAALVDDPR
FT                   VALISATGSTRMGREVAPKVAARFARSILELGGNNAMILGPSADLDMAVRAILFSAVGT
FT                   AGQRCTTLRRLIAHESVKEEIISRLKTAYSKVRIGHPLEGNLIGPLIDKHSFEAMQDAL
FT                   EQALSEGGRVFGGQRQLQDQFPNAYYVSPAIVEMPEQSEVVCSETFAPILYVIGYNDFE
FT                   EALRLNNAVPQGLSSCIFTTDVREAEQFMSAVGSDCGIANVNIGPSGAEIGGAFGGEKE
FT                   TGGGRESGSDAWRGYMRRQTNTVNYSRELPLAQGITFD"
FT   gene            696369..697652
FT                   /locus_tag="PFL_0597"
FT   CDS_pept        696369..697652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PFL_0597"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAY96004"
FT                   /db_xref="GOA:Q4KJ44"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ44"
FT                   /protein_id="AAY96004.1"
FT                   /translation="MALQEQCLWETLTPQRPDRAPLKGELTADVCIIGAGFTGLSAAVH
FT                   LLEQGKRVCVVEAHRAGHGGSGRNVGLVNAGMWIPPDEIEAGFGEQVGSQLNRMLGAAP
FT                   SLVFSLVDKYHIDCQLRREGTLHMAHNARGEADLRSREEQWKRRGAPVELLTGAACEAA
FT                   TGTRKIAAALLDRRAGTLNPMAYVSGLARAATELGGRLFDHSPVTRLERQGQRWSVQTE
FT                   QGSVLAEQVVIASNAYTEGDWTELRRNFFPGYYYQVASAPLTEEAARQILPGGQGSWDT
FT                   RQVLSSIRRDAEGRLLLGSLGNGSQKPLWFLKAWADRVQQHYFPYLKPVEWECTWTGCI
FT                   AFTPDHLMRLFEPAPGLVAVTGYNGRGVTTGTVVGKAFADYLCNGDPQALPIPFAAMQP
FT                   LAGVGLRSCLYEAGFSLYHAGQCLRIVI"
FT   gene            698017..699153
FT                   /gene="livJ"
FT                   /locus_tag="PFL_0598"
FT   CDS_pept        698017..699153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livJ"
FT                   /locus_tag="PFL_0598"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic branched-chain amino acid-binding protein LivJ"
FT                   /note="identified by similarity to SP:P0AD96; match to
FT                   protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAY96005"
FT                   /db_xref="GOA:Q4KJ43"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ43"
FT                   /protein_id="AAY96005.1"
FT                   /translation="MSQTFYKKGFLALAVATALGVSAFAQADLKIGVAGPMTGANAAFG
FT                   EQYMKGAQAAADEINAKGGVNGEKIVLVKGDDACEPKQAVAVANRLVDQDKVAGVVGHF
FT                   CSSSTIPASEVYSDAGVIAITPGSTNPQVTERGLSAMFRMCGRDDQQGIVAGDYIIDVL
FT                   KGKKVVVLHDKDTYGQGLADATKAQLTKRGVTPVLYEGLTRGEKDFSAVVTKIRAAGAD
FT                   VVYFGGLHPEAGPLVRQLREQGLKDVKFMSDDGIVTDELVTTAGGPQYVDGVYMTFGAD
FT                   PRLLPDSKAVVDAFRKAGTEPEGYTLYAYASIQALAAGFGGAKSNKGEDAAKWLKANPV
FT                   KTVMGEKSWDAKGDLKVSDYVVYQWDKDGKYHQLEKQK"
FT   gene            699315..700229
FT                   /gene="livH"
FT                   /locus_tag="PFL_0599"
FT   CDS_pept        699315..700229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="PFL_0599"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, permease protein LivH"
FT                   /note="identified by similarity to SP:P0AEX7; match to
FT                   protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAY96006"
FT                   /db_xref="GOA:Q4KJ42"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ42"
FT                   /protein_id="AAY96006.1"
FT                   /translation="MDGIFLQQLINGLTLGSVYGLIAIGYTMVYGIIGMINFAHGEVYM
FT                   ISAYLAAISLALLAYFGIESFPLLILGTLIFTVVVTGIYGWVIERVAYKPLRNSTRLAP
FT                   LISAIGISLILQNYAQISQGAKQQGVPTLLAGAWKVDIGTGFVQLTYTKIFILVAAFAG
FT                   MALLTYIIKYTKLGRMCRATQQDRKMASILGINTDRVISYVFVIGAAMAALAGVLITMN
FT                   YGTFDFYAGFVIGIKAFTAAVLGGIGSLPGAMLGGIILGISESLFSGLINSDYKDVFSF
FT                   SLLVLILIFRPQGLLGRPLVAKV"
FT   gene            700232..701527
FT                   /gene="livM"
FT                   /locus_tag="PFL_0600"
FT   CDS_pept        700232..701527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="PFL_0600"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, permease protein LivM"
FT                   /note="identified by similarity to SP:P22729; match to
FT                   protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:PFL_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAY96007"
FT                   /db_xref="GOA:Q4KJ41"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KJ41"
FT                   /protein_id="AAY96007.1"
FT                   /translation="MSAANKPIDIKKSVIDAVLAGLISLIVFGPIVGVVLDGYSFNLQP
FT                   TRVAWLVAIVMAGRLALSLFLQTPKGLKILQGFESTGSGVHVLAPDYKSRLRWIIPALI
FT                   VIAIVFPFFANKYLLTVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALG
FT                   YQYLGLGFWTVLPLAAIAAALAGCILGFPVLRMHGDYLAIVTLGFGEIIRLVLNNWLSF
FT                   TGGPNGMPVPSPTFLGLEFGRKAKDGGVPFHEFFGLEYNPNLKFLFIYIVLFLVVLLVL
FT                   YIKHRLTRMPVGRAWEALREDEIACRAMGLNHVLVKLSAFTIGASTAGLAGVF