(data stored in ACNUC7421 zone)

EMBL: CP000083

ID   CP000083; SV 1; circular; genomic DNA; STD; PRO; 5373180 BP.
XX
AC   CP000083;
XX
PR   Project:PRJNA275;
XX
DT   01-AUG-2005 (Rel. 84, Created)
DT   19-AUG-2018 (Rel. 137, Last updated, Version 9)
XX
DE   Colwellia psychrerythraea 34H chromosome, complete genome.
XX
KW   .
XX
OS   Colwellia psychrerythraea 34H
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Colwelliaceae; Colwellia.
XX
RN   [1]
RP   1-5373180
RX   DOI; 10.1073/pnas.0504766102.
RX   PUBMED; 16043709.
RA   Methe B.A., Nelson K.E., Deming J.W., Momen B., Melamud E., Zhang X.,
RA   Moult J., Madupu R., Nelson W.C., Dodson R.J., Brinkac L.M.,
RA   Daugherty S.C., Durkin A.S., DeBoy R.T., Kolonay J.F., Sullivan S.A.,
RA   Zhou L., Davidsen T.M., Wu M., Huston A.L., Lewis M., Weaver B.,
RA   Weidman J.F., Khouri H., Utterback T.R., Feldblyum T.V., Fraser C.M.;
RT   "The psychrophilic lifestyle as revealed by the genome sequence of
RT   Colwellia psychrerythraea 34H through genomic and proteomic analyses";
RL   Proc. Natl. Acad. Sci. U.S.A. 102(31):10913-10918(2005).
XX
RN   [2]
RP   1-5373180
RA   Methe B.A., Nelson K.E., Deming J.W., Momen B., Melamud E., Zhang X.,
RA   Moult J., Madupu R., Nelson W.C., Dodson R.J., Brinkac L.M.,
RA   Daugherty S.C., Durkin A.S., DeBoy R.T., Kolonay J.F., Sullivan S.A.,
RA   Zhou L., Davidsen T.M., Wu M., Huston A.L., Lewis M.R., Weaver B.,
RA   Weidman J.F., Khouri H.M., Utterback T.R., Feldblyum T.V., Fraser C.M.;
RT   ;
RL   Submitted (07-JUL-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; d3f34db123c9eec8b14fb4e96a018b8c.
DR   BioSample; SAMN02604001.
DR   EnsemblGenomes-Gn; CPS_0034.
DR   EnsemblGenomes-Gn; CPS_0035.
DR   EnsemblGenomes-Gn; CPS_0037.
DR   EnsemblGenomes-Gn; CPS_0038.
DR   EnsemblGenomes-Gn; CPS_0039.
DR   EnsemblGenomes-Gn; CPS_0040.
DR   EnsemblGenomes-Gn; CPS_0043.
DR   EnsemblGenomes-Gn; CPS_0044.
DR   EnsemblGenomes-Gn; CPS_0046.
DR   EnsemblGenomes-Gn; CPS_0048.
DR   EnsemblGenomes-Gn; CPS_0049.
DR   EnsemblGenomes-Gn; CPS_0050.
DR   EnsemblGenomes-Gn; CPS_0052.
DR   EnsemblGenomes-Gn; CPS_0054.
DR   EnsemblGenomes-Gn; CPS_0339.
DR   EnsemblGenomes-Gn; CPS_0340.
DR   EnsemblGenomes-Gn; CPS_0342.
DR   EnsemblGenomes-Gn; CPS_0344.
DR   EnsemblGenomes-Gn; CPS_0345.
DR   EnsemblGenomes-Gn; CPS_0346.
DR   EnsemblGenomes-Gn; CPS_0348.
DR   EnsemblGenomes-Gn; CPS_0350.
DR   EnsemblGenomes-Gn; CPS_0556.
DR   EnsemblGenomes-Gn; CPS_0557.
DR   EnsemblGenomes-Gn; CPS_0559.
DR   EnsemblGenomes-Gn; CPS_0561.
DR   EnsemblGenomes-Gn; CPS_0562.
DR   EnsemblGenomes-Gn; CPS_0563.
DR   EnsemblGenomes-Gn; CPS_0565.
DR   EnsemblGenomes-Gn; CPS_0567.
DR   EnsemblGenomes-Gn; CPS_0748.
DR   EnsemblGenomes-Gn; CPS_1044.
DR   EnsemblGenomes-Gn; CPS_1045.
DR   EnsemblGenomes-Gn; CPS_1046.
DR   EnsemblGenomes-Gn; CPS_1047.
DR   EnsemblGenomes-Gn; CPS_1116.
DR   EnsemblGenomes-Gn; CPS_1609.
DR   EnsemblGenomes-Gn; CPS_1610.
DR   EnsemblGenomes-Gn; CPS_1611.
DR   EnsemblGenomes-Gn; CPS_1612.
DR   EnsemblGenomes-Gn; CPS_1734.
DR   EnsemblGenomes-Gn; CPS_1735.
DR   EnsemblGenomes-Gn; CPS_1736.
DR   EnsemblGenomes-Gn; CPS_1737.
DR   EnsemblGenomes-Gn; CPS_1738.
DR   EnsemblGenomes-Gn; CPS_1739.
DR   EnsemblGenomes-Gn; CPS_1742.
DR   EnsemblGenomes-Gn; CPS_2258.
DR   EnsemblGenomes-Gn; CPS_2259.
DR   EnsemblGenomes-Gn; CPS_2260.
DR   EnsemblGenomes-Gn; CPS_2261.
DR   EnsemblGenomes-Gn; CPS_2262.
DR   EnsemblGenomes-Gn; CPS_2352.
DR   EnsemblGenomes-Gn; CPS_2353.
DR   EnsemblGenomes-Gn; CPS_2609.
DR   EnsemblGenomes-Gn; CPS_2705.
DR   EnsemblGenomes-Gn; CPS_2828.
DR   EnsemblGenomes-Gn; CPS_2829.
DR   EnsemblGenomes-Gn; CPS_2830.
DR   EnsemblGenomes-Gn; CPS_2831.
DR   EnsemblGenomes-Gn; CPS_2832.
DR   EnsemblGenomes-Gn; CPS_2833.
DR   EnsemblGenomes-Gn; CPS_2834.
DR   EnsemblGenomes-Gn; CPS_2889.
DR   EnsemblGenomes-Gn; CPS_2890.
DR   EnsemblGenomes-Gn; CPS_2891.
DR   EnsemblGenomes-Gn; CPS_2892.
DR   EnsemblGenomes-Gn; CPS_2916.
DR   EnsemblGenomes-Gn; CPS_3218.
DR   EnsemblGenomes-Gn; CPS_3219.
DR   EnsemblGenomes-Gn; CPS_3220.
DR   EnsemblGenomes-Gn; CPS_3221.
DR   EnsemblGenomes-Gn; CPS_3222.
DR   EnsemblGenomes-Gn; CPS_3223.
DR   EnsemblGenomes-Gn; CPS_3261.
DR   EnsemblGenomes-Gn; CPS_3262.
DR   EnsemblGenomes-Gn; CPS_3263.
DR   EnsemblGenomes-Gn; CPS_3264.
DR   EnsemblGenomes-Gn; CPS_3265.
DR   EnsemblGenomes-Gn; CPS_3266.
DR   EnsemblGenomes-Gn; CPS_3267.
DR   EnsemblGenomes-Gn; CPS_3268.
DR   EnsemblGenomes-Gn; CPS_3280.
DR   EnsemblGenomes-Gn; CPS_3281.
DR   EnsemblGenomes-Gn; CPS_3282.
DR   EnsemblGenomes-Gn; CPS_3283.
DR   EnsemblGenomes-Gn; CPS_3284.
DR   EnsemblGenomes-Gn; CPS_3285.
DR   EnsemblGenomes-Gn; CPS_3446.
DR   EnsemblGenomes-Gn; CPS_3562.
DR   EnsemblGenomes-Gn; CPS_3563.
DR   EnsemblGenomes-Gn; CPS_3564.
DR   EnsemblGenomes-Gn; CPS_3565.
DR   EnsemblGenomes-Gn; CPS_3566.
DR   EnsemblGenomes-Gn; CPS_3567.
DR   EnsemblGenomes-Gn; CPS_3787.
DR   EnsemblGenomes-Gn; CPS_3788.
DR   EnsemblGenomes-Gn; CPS_3789.
DR   EnsemblGenomes-Gn; CPS_3790.
DR   EnsemblGenomes-Gn; CPS_3902.
DR   EnsemblGenomes-Gn; CPS_3904.
DR   EnsemblGenomes-Gn; CPS_3906.
DR   EnsemblGenomes-Gn; CPS_3907.
DR   EnsemblGenomes-Gn; CPS_4139.
DR   EnsemblGenomes-Gn; CPS_4150.
DR   EnsemblGenomes-Gn; CPS_4151.
DR   EnsemblGenomes-Gn; CPS_4332.
DR   EnsemblGenomes-Gn; CPS_4649.
DR   EnsemblGenomes-Gn; CPS_4650.
DR   EnsemblGenomes-Gn; CPS_4652.
DR   EnsemblGenomes-Gn; CPS_4779.
DR   EnsemblGenomes-Gn; CPS_4781.
DR   EnsemblGenomes-Gn; CPS_4782.
DR   EnsemblGenomes-Gn; CPS_4783.
DR   EnsemblGenomes-Gn; CPS_4784.
DR   EnsemblGenomes-Gn; CPS_5037.
DR   EnsemblGenomes-Gn; EBG00001187148.
DR   EnsemblGenomes-Gn; EBG00001187149.
DR   EnsemblGenomes-Gn; EBG00001187150.
DR   EnsemblGenomes-Gn; EBG00001187151.
DR   EnsemblGenomes-Gn; EBG00001187152.
DR   EnsemblGenomes-Gn; EBG00001187153.
DR   EnsemblGenomes-Gn; EBG00001187154.
DR   EnsemblGenomes-Gn; EBG00001187155.
DR   EnsemblGenomes-Gn; EBG00001187156.
DR   EnsemblGenomes-Gn; EBG00001187157.
DR   EnsemblGenomes-Gn; EBG00001187158.
DR   EnsemblGenomes-Gn; EBG00001187159.
DR   EnsemblGenomes-Gn; EBG00001187160.
DR   EnsemblGenomes-Gn; EBG00001187161.
DR   EnsemblGenomes-Gn; EBG00001187162.
DR   EnsemblGenomes-Gn; EBG00001187163.
DR   EnsemblGenomes-Gn; EBG00001187164.
DR   EnsemblGenomes-Gn; EBG00001187165.
DR   EnsemblGenomes-Gn; EBG00001187166.
DR   EnsemblGenomes-Gn; EBG00001187167.
DR   EnsemblGenomes-Gn; EBG00001187168.
DR   EnsemblGenomes-Gn; EBG00001187169.
DR   EnsemblGenomes-Gn; EBG00001187170.
DR   EnsemblGenomes-Gn; EBG00001187171.
DR   EnsemblGenomes-Gn; EBG00001187172.
DR   EnsemblGenomes-Gn; EBG00001187173.
DR   EnsemblGenomes-Gn; EBG00001187174.
DR   EnsemblGenomes-Gn; EBG00001187175.
DR   EnsemblGenomes-Gn; EBG00001187176.
DR   EnsemblGenomes-Gn; EBG00001187177.
DR   EnsemblGenomes-Gn; EBG00001187178.
DR   EnsemblGenomes-Gn; EBG00001187179.
DR   EnsemblGenomes-Gn; EBG00001187180.
DR   EnsemblGenomes-Gn; EBG00001187181.
DR   EnsemblGenomes-Gn; EBG00001187182.
DR   EnsemblGenomes-Gn; EBG00001187183.
DR   EnsemblGenomes-Gn; EBG00001187184.
DR   EnsemblGenomes-Gn; EBG00001187185.
DR   EnsemblGenomes-Gn; EBG00001187186.
DR   EnsemblGenomes-Gn; EBG00001187187.
DR   EnsemblGenomes-Gn; EBG00001187188.
DR   EnsemblGenomes-Gn; EBG00001187189.
DR   EnsemblGenomes-Gn; EBG00001187190.
DR   EnsemblGenomes-Gn; EBG00001187191.
DR   EnsemblGenomes-Gn; EBG00001187192.
DR   EnsemblGenomes-Gn; EBG00001187193.
DR   EnsemblGenomes-Gn; EBG00001187194.
DR   EnsemblGenomes-Gn; EBG00001187195.
DR   EnsemblGenomes-Gn; EBG00001187196.
DR   EnsemblGenomes-Gn; EBG00001187197.
DR   EnsemblGenomes-Gn; EBG00001187198.
DR   EnsemblGenomes-Gn; EBG00001187199.
DR   EnsemblGenomes-Gn; EBG00001187200.
DR   EnsemblGenomes-Gn; EBG00001187201.
DR   EnsemblGenomes-Gn; EBG00001187202.
DR   EnsemblGenomes-Gn; EBG00001187203.
DR   EnsemblGenomes-Gn; EBG00001187204.
DR   EnsemblGenomes-Gn; EBG00001187205.
DR   EnsemblGenomes-Gn; EBG00001187206.
DR   EnsemblGenomes-Gn; EBG00001187207.
DR   EnsemblGenomes-Gn; EBG00001187208.
DR   EnsemblGenomes-Gn; EBG00001187209.
DR   EnsemblGenomes-Gn; EBG00001187210.
DR   EnsemblGenomes-Gn; EBG00001187211.
DR   EnsemblGenomes-Gn; EBG00001187212.
DR   EnsemblGenomes-Gn; EBG00001187213.
DR   EnsemblGenomes-Gn; EBG00001187214.
DR   EnsemblGenomes-Gn; EBG00001187215.
DR   EnsemblGenomes-Gn; EBG00001187216.
DR   EnsemblGenomes-Gn; EBG00001187217.
DR   EnsemblGenomes-Gn; EBG00001187218.
DR   EnsemblGenomes-Gn; EBG00001187219.
DR   EnsemblGenomes-Gn; EBG00001187220.
DR   EnsemblGenomes-Gn; EBG00001187221.
DR   EnsemblGenomes-Gn; EBG00001187222.
DR   EnsemblGenomes-Gn; EBG00001187223.
DR   EnsemblGenomes-Gn; EBG00001187224.
DR   EnsemblGenomes-Gn; EBG00001187225.
DR   EnsemblGenomes-Gn; EBG00001187226.
DR   EnsemblGenomes-Gn; EBG00001187227.
DR   EnsemblGenomes-Gn; EBG00001187228.
DR   EnsemblGenomes-Gn; EBG00001187229.
DR   EnsemblGenomes-Gn; EBG00001187230.
DR   EnsemblGenomes-Gn; EBG00001187231.
DR   EnsemblGenomes-Gn; EBG00001187232.
DR   EnsemblGenomes-Gn; EBG00001187233.
DR   EnsemblGenomes-Gn; EBG00001187234.
DR   EnsemblGenomes-Gn; EBG00001187235.
DR   EnsemblGenomes-Gn; EBG00001187236.
DR   EnsemblGenomes-Gn; EBG00001187237.
DR   EnsemblGenomes-Gn; EBG00001187238.
DR   EnsemblGenomes-Gn; EBG00001187239.
DR   EnsemblGenomes-Gn; EBG00001187240.
DR   EnsemblGenomes-Gn; EBG00001187241.
DR   EnsemblGenomes-Gn; EBG00001187242.
DR   EnsemblGenomes-Gn; EBG00001187243.
DR   EnsemblGenomes-Gn; EBG00001187244.
DR   EnsemblGenomes-Gn; EBG00001187245.
DR   EnsemblGenomes-Gn; EBG00001187246.
DR   EnsemblGenomes-Gn; EBG00001187247.
DR   EnsemblGenomes-Gn; EBG00001187248.
DR   EnsemblGenomes-Gn; EBG00001187249.
DR   EnsemblGenomes-Gn; EBG00001187250.
DR   EnsemblGenomes-Gn; EBG00001187251.
DR   EnsemblGenomes-Gn; EBG00001187252.
DR   EnsemblGenomes-Gn; EBG00001187253.
DR   EnsemblGenomes-Gn; EBG00001187254.
DR   EnsemblGenomes-Gn; EBG00001187255.
DR   EnsemblGenomes-Gn; EBG00001187256.
DR   EnsemblGenomes-Gn; EBG00001187257.
DR   EnsemblGenomes-Gn; EBG00001187258.
DR   EnsemblGenomes-Gn; EBG00001187259.
DR   EnsemblGenomes-Gn; EBG00001187260.
DR   EnsemblGenomes-Gn; EBG00001187261.
DR   EnsemblGenomes-Gn; EBG00001187262.
DR   EnsemblGenomes-Gn; EBG00001187263.
DR   EnsemblGenomes-Gn; EBG00001187264.
DR   EnsemblGenomes-Gn; EBG00001187265.
DR   EnsemblGenomes-Gn; EBG00001187266.
DR   EnsemblGenomes-Gn; EBG00001187267.
DR   EnsemblGenomes-Gn; EBG00001187268.
DR   EnsemblGenomes-Gn; EBG00001187269.
DR   EnsemblGenomes-Gn; EBG00001187270.
DR   EnsemblGenomes-Gn; EBG00001187271.
DR   EnsemblGenomes-Gn; EBG00001187272.
DR   EnsemblGenomes-Gn; EBG00001187273.
DR   EnsemblGenomes-Gn; EBG00001187274.
DR   EnsemblGenomes-Gn; EBG00001187275.
DR   EnsemblGenomes-Gn; EBG00001187276.
DR   EnsemblGenomes-Gn; EBG00001187277.
DR   EnsemblGenomes-Gn; EBG00001187278.
DR   EnsemblGenomes-Gn; EBG00001187279.
DR   EnsemblGenomes-Gn; EBG00001187280.
DR   EnsemblGenomes-Tr; CPS_0034-1.
DR   EnsemblGenomes-Tr; CPS_0035-1.
DR   EnsemblGenomes-Tr; CPS_0037-1.
DR   EnsemblGenomes-Tr; CPS_0038-1.
DR   EnsemblGenomes-Tr; CPS_0039-1.
DR   EnsemblGenomes-Tr; CPS_0040-1.
DR   EnsemblGenomes-Tr; CPS_0043-1.
DR   EnsemblGenomes-Tr; CPS_0044-1.
DR   EnsemblGenomes-Tr; CPS_0046-1.
DR   EnsemblGenomes-Tr; CPS_0048-1.
DR   EnsemblGenomes-Tr; CPS_0049-1.
DR   EnsemblGenomes-Tr; CPS_0050-1.
DR   EnsemblGenomes-Tr; CPS_0052-1.
DR   EnsemblGenomes-Tr; CPS_0054-1.
DR   EnsemblGenomes-Tr; CPS_0339-1.
DR   EnsemblGenomes-Tr; CPS_0340-1.
DR   EnsemblGenomes-Tr; CPS_0342-1.
DR   EnsemblGenomes-Tr; CPS_0344-1.
DR   EnsemblGenomes-Tr; CPS_0345-1.
DR   EnsemblGenomes-Tr; CPS_0346-1.
DR   EnsemblGenomes-Tr; CPS_0348-1.
DR   EnsemblGenomes-Tr; CPS_0350-1.
DR   EnsemblGenomes-Tr; CPS_0556-1.
DR   EnsemblGenomes-Tr; CPS_0557-1.
DR   EnsemblGenomes-Tr; CPS_0559-1.
DR   EnsemblGenomes-Tr; CPS_0561-1.
DR   EnsemblGenomes-Tr; CPS_0562-1.
DR   EnsemblGenomes-Tr; CPS_0563-1.
DR   EnsemblGenomes-Tr; CPS_0565-1.
DR   EnsemblGenomes-Tr; CPS_0567-1.
DR   EnsemblGenomes-Tr; CPS_0748-1.
DR   EnsemblGenomes-Tr; CPS_1044-1.
DR   EnsemblGenomes-Tr; CPS_1045-1.
DR   EnsemblGenomes-Tr; CPS_1046-1.
DR   EnsemblGenomes-Tr; CPS_1047-1.
DR   EnsemblGenomes-Tr; CPS_1116-1.
DR   EnsemblGenomes-Tr; CPS_1609-1.
DR   EnsemblGenomes-Tr; CPS_1610-1.
DR   EnsemblGenomes-Tr; CPS_1611-1.
DR   EnsemblGenomes-Tr; CPS_1612-1.
DR   EnsemblGenomes-Tr; CPS_1734-1.
DR   EnsemblGenomes-Tr; CPS_1735-1.
DR   EnsemblGenomes-Tr; CPS_1736-1.
DR   EnsemblGenomes-Tr; CPS_1737-1.
DR   EnsemblGenomes-Tr; CPS_1738-1.
DR   EnsemblGenomes-Tr; CPS_1739-1.
DR   EnsemblGenomes-Tr; CPS_1742-1.
DR   EnsemblGenomes-Tr; CPS_2258-1.
DR   EnsemblGenomes-Tr; CPS_2259-1.
DR   EnsemblGenomes-Tr; CPS_2260-1.
DR   EnsemblGenomes-Tr; CPS_2261-1.
DR   EnsemblGenomes-Tr; CPS_2262-1.
DR   EnsemblGenomes-Tr; CPS_2352-1.
DR   EnsemblGenomes-Tr; CPS_2353-1.
DR   EnsemblGenomes-Tr; CPS_2609-1.
DR   EnsemblGenomes-Tr; CPS_2705-1.
DR   EnsemblGenomes-Tr; CPS_2828-1.
DR   EnsemblGenomes-Tr; CPS_2829-1.
DR   EnsemblGenomes-Tr; CPS_2830-1.
DR   EnsemblGenomes-Tr; CPS_2831-1.
DR   EnsemblGenomes-Tr; CPS_2832-1.
DR   EnsemblGenomes-Tr; CPS_2833-1.
DR   EnsemblGenomes-Tr; CPS_2834-1.
DR   EnsemblGenomes-Tr; CPS_2889-1.
DR   EnsemblGenomes-Tr; CPS_2890-1.
DR   EnsemblGenomes-Tr; CPS_2891-1.
DR   EnsemblGenomes-Tr; CPS_2892-1.
DR   EnsemblGenomes-Tr; CPS_2916-1.
DR   EnsemblGenomes-Tr; CPS_3218-1.
DR   EnsemblGenomes-Tr; CPS_3219-1.
DR   EnsemblGenomes-Tr; CPS_3220-1.
DR   EnsemblGenomes-Tr; CPS_3221-1.
DR   EnsemblGenomes-Tr; CPS_3222-1.
DR   EnsemblGenomes-Tr; CPS_3223-1.
DR   EnsemblGenomes-Tr; CPS_3261-1.
DR   EnsemblGenomes-Tr; CPS_3262-1.
DR   EnsemblGenomes-Tr; CPS_3263-1.
DR   EnsemblGenomes-Tr; CPS_3264-1.
DR   EnsemblGenomes-Tr; CPS_3265-1.
DR   EnsemblGenomes-Tr; CPS_3266-1.
DR   EnsemblGenomes-Tr; CPS_3267-1.
DR   EnsemblGenomes-Tr; CPS_3268-1.
DR   EnsemblGenomes-Tr; CPS_3280-1.
DR   EnsemblGenomes-Tr; CPS_3281-1.
DR   EnsemblGenomes-Tr; CPS_3282-1.
DR   EnsemblGenomes-Tr; CPS_3283-1.
DR   EnsemblGenomes-Tr; CPS_3284-1.
DR   EnsemblGenomes-Tr; CPS_3285-1.
DR   EnsemblGenomes-Tr; CPS_3446-1.
DR   EnsemblGenomes-Tr; CPS_3562-1.
DR   EnsemblGenomes-Tr; CPS_3563-1.
DR   EnsemblGenomes-Tr; CPS_3564-1.
DR   EnsemblGenomes-Tr; CPS_3565-1.
DR   EnsemblGenomes-Tr; CPS_3566-1.
DR   EnsemblGenomes-Tr; CPS_3567-1.
DR   EnsemblGenomes-Tr; CPS_3787-1.
DR   EnsemblGenomes-Tr; CPS_3788-1.
DR   EnsemblGenomes-Tr; CPS_3789-1.
DR   EnsemblGenomes-Tr; CPS_3790-1.
DR   EnsemblGenomes-Tr; CPS_3902-1.
DR   EnsemblGenomes-Tr; CPS_3904-1.
DR   EnsemblGenomes-Tr; CPS_3906-1.
DR   EnsemblGenomes-Tr; CPS_3907-1.
DR   EnsemblGenomes-Tr; CPS_4139-1.
DR   EnsemblGenomes-Tr; CPS_4150-1.
DR   EnsemblGenomes-Tr; CPS_4151-1.
DR   EnsemblGenomes-Tr; CPS_4332-1.
DR   EnsemblGenomes-Tr; CPS_4649-1.
DR   EnsemblGenomes-Tr; CPS_4650-1.
DR   EnsemblGenomes-Tr; CPS_4652-1.
DR   EnsemblGenomes-Tr; CPS_4779-1.
DR   EnsemblGenomes-Tr; CPS_4781-1.
DR   EnsemblGenomes-Tr; CPS_4782-1.
DR   EnsemblGenomes-Tr; CPS_4783-1.
DR   EnsemblGenomes-Tr; CPS_4784-1.
DR   EnsemblGenomes-Tr; CPS_5037-1.
DR   EnsemblGenomes-Tr; EBT00001765601.
DR   EnsemblGenomes-Tr; EBT00001765602.
DR   EnsemblGenomes-Tr; EBT00001765603.
DR   EnsemblGenomes-Tr; EBT00001765604.
DR   EnsemblGenomes-Tr; EBT00001765605.
DR   EnsemblGenomes-Tr; EBT00001765606.
DR   EnsemblGenomes-Tr; EBT00001765607.
DR   EnsemblGenomes-Tr; EBT00001765608.
DR   EnsemblGenomes-Tr; EBT00001765609.
DR   EnsemblGenomes-Tr; EBT00001765610.
DR   EnsemblGenomes-Tr; EBT00001765611.
DR   EnsemblGenomes-Tr; EBT00001765612.
DR   EnsemblGenomes-Tr; EBT00001765613.
DR   EnsemblGenomes-Tr; EBT00001765614.
DR   EnsemblGenomes-Tr; EBT00001765615.
DR   EnsemblGenomes-Tr; EBT00001765616.
DR   EnsemblGenomes-Tr; EBT00001765617.
DR   EnsemblGenomes-Tr; EBT00001765618.
DR   EnsemblGenomes-Tr; EBT00001765619.
DR   EnsemblGenomes-Tr; EBT00001765620.
DR   EnsemblGenomes-Tr; EBT00001765621.
DR   EnsemblGenomes-Tr; EBT00001765622.
DR   EnsemblGenomes-Tr; EBT00001765623.
DR   EnsemblGenomes-Tr; EBT00001765624.
DR   EnsemblGenomes-Tr; EBT00001765625.
DR   EnsemblGenomes-Tr; EBT00001765626.
DR   EnsemblGenomes-Tr; EBT00001765627.
DR   EnsemblGenomes-Tr; EBT00001765628.
DR   EnsemblGenomes-Tr; EBT00001765629.
DR   EnsemblGenomes-Tr; EBT00001765630.
DR   EnsemblGenomes-Tr; EBT00001765631.
DR   EnsemblGenomes-Tr; EBT00001765632.
DR   EnsemblGenomes-Tr; EBT00001765633.
DR   EnsemblGenomes-Tr; EBT00001765634.
DR   EnsemblGenomes-Tr; EBT00001765635.
DR   EnsemblGenomes-Tr; EBT00001765636.
DR   EnsemblGenomes-Tr; EBT00001765637.
DR   EnsemblGenomes-Tr; EBT00001765638.
DR   EnsemblGenomes-Tr; EBT00001765639.
DR   EnsemblGenomes-Tr; EBT00001765640.
DR   EnsemblGenomes-Tr; EBT00001765641.
DR   EnsemblGenomes-Tr; EBT00001765642.
DR   EnsemblGenomes-Tr; EBT00001765643.
DR   EnsemblGenomes-Tr; EBT00001765644.
DR   EnsemblGenomes-Tr; EBT00001765645.
DR   EnsemblGenomes-Tr; EBT00001765646.
DR   EnsemblGenomes-Tr; EBT00001765647.
DR   EnsemblGenomes-Tr; EBT00001765648.
DR   EnsemblGenomes-Tr; EBT00001765649.
DR   EnsemblGenomes-Tr; EBT00001765650.
DR   EnsemblGenomes-Tr; EBT00001765651.
DR   EnsemblGenomes-Tr; EBT00001765652.
DR   EnsemblGenomes-Tr; EBT00001765653.
DR   EnsemblGenomes-Tr; EBT00001765654.
DR   EnsemblGenomes-Tr; EBT00001765655.
DR   EnsemblGenomes-Tr; EBT00001765656.
DR   EnsemblGenomes-Tr; EBT00001765657.
DR   EnsemblGenomes-Tr; EBT00001765658.
DR   EnsemblGenomes-Tr; EBT00001765659.
DR   EnsemblGenomes-Tr; EBT00001765660.
DR   EnsemblGenomes-Tr; EBT00001765661.
DR   EnsemblGenomes-Tr; EBT00001765662.
DR   EnsemblGenomes-Tr; EBT00001765663.
DR   EnsemblGenomes-Tr; EBT00001765664.
DR   EnsemblGenomes-Tr; EBT00001765665.
DR   EnsemblGenomes-Tr; EBT00001765666.
DR   EnsemblGenomes-Tr; EBT00001765667.
DR   EnsemblGenomes-Tr; EBT00001765668.
DR   EnsemblGenomes-Tr; EBT00001765669.
DR   EnsemblGenomes-Tr; EBT00001765670.
DR   EnsemblGenomes-Tr; EBT00001765671.
DR   EnsemblGenomes-Tr; EBT00001765672.
DR   EnsemblGenomes-Tr; EBT00001765673.
DR   EnsemblGenomes-Tr; EBT00001765674.
DR   EnsemblGenomes-Tr; EBT00001765675.
DR   EnsemblGenomes-Tr; EBT00001765676.
DR   EnsemblGenomes-Tr; EBT00001765677.
DR   EnsemblGenomes-Tr; EBT00001765678.
DR   EnsemblGenomes-Tr; EBT00001765679.
DR   EnsemblGenomes-Tr; EBT00001765680.
DR   EnsemblGenomes-Tr; EBT00001765681.
DR   EnsemblGenomes-Tr; EBT00001765682.
DR   EnsemblGenomes-Tr; EBT00001765683.
DR   EnsemblGenomes-Tr; EBT00001765684.
DR   EnsemblGenomes-Tr; EBT00001765685.
DR   EnsemblGenomes-Tr; EBT00001765686.
DR   EnsemblGenomes-Tr; EBT00001765687.
DR   EnsemblGenomes-Tr; EBT00001765688.
DR   EnsemblGenomes-Tr; EBT00001765689.
DR   EnsemblGenomes-Tr; EBT00001765690.
DR   EnsemblGenomes-Tr; EBT00001765691.
DR   EnsemblGenomes-Tr; EBT00001765692.
DR   EnsemblGenomes-Tr; EBT00001765693.
DR   EnsemblGenomes-Tr; EBT00001765694.
DR   EnsemblGenomes-Tr; EBT00001765695.
DR   EnsemblGenomes-Tr; EBT00001765696.
DR   EnsemblGenomes-Tr; EBT00001765697.
DR   EnsemblGenomes-Tr; EBT00001765698.
DR   EnsemblGenomes-Tr; EBT00001765699.
DR   EnsemblGenomes-Tr; EBT00001765700.
DR   EnsemblGenomes-Tr; EBT00001765701.
DR   EnsemblGenomes-Tr; EBT00001765702.
DR   EnsemblGenomes-Tr; EBT00001765703.
DR   EnsemblGenomes-Tr; EBT00001765704.
DR   EnsemblGenomes-Tr; EBT00001765705.
DR   EnsemblGenomes-Tr; EBT00001765706.
DR   EnsemblGenomes-Tr; EBT00001765707.
DR   EnsemblGenomes-Tr; EBT00001765708.
DR   EnsemblGenomes-Tr; EBT00001765709.
DR   EnsemblGenomes-Tr; EBT00001765710.
DR   EnsemblGenomes-Tr; EBT00001765711.
DR   EnsemblGenomes-Tr; EBT00001765712.
DR   EnsemblGenomes-Tr; EBT00001765713.
DR   EnsemblGenomes-Tr; EBT00001765714.
DR   EnsemblGenomes-Tr; EBT00001765715.
DR   EnsemblGenomes-Tr; EBT00001765716.
DR   EnsemblGenomes-Tr; EBT00001765717.
DR   EnsemblGenomes-Tr; EBT00001765718.
DR   EnsemblGenomes-Tr; EBT00001765719.
DR   EnsemblGenomes-Tr; EBT00001765720.
DR   EnsemblGenomes-Tr; EBT00001765721.
DR   EnsemblGenomes-Tr; EBT00001765722.
DR   EnsemblGenomes-Tr; EBT00001765723.
DR   EnsemblGenomes-Tr; EBT00001765724.
DR   EnsemblGenomes-Tr; EBT00001765725.
DR   EnsemblGenomes-Tr; EBT00001765726.
DR   EnsemblGenomes-Tr; EBT00001765727.
DR   EnsemblGenomes-Tr; EBT00001765728.
DR   EnsemblGenomes-Tr; EBT00001765729.
DR   EnsemblGenomes-Tr; EBT00001765730.
DR   EnsemblGenomes-Tr; EBT00001765731.
DR   EnsemblGenomes-Tr; EBT00001765732.
DR   EnsemblGenomes-Tr; EBT00001765733.
DR   EuropePMC; PMC1180510; 16043709.
DR   EuropePMC; PMC4246168; 25428976.
DR   EuropePMC; PMC4815438; 27064928.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000083.
DR   SILVA-SSU; CP000083.
DR   StrainInfo; 681610; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5373180
FT                   /organism="Colwellia psychrerythraea 34H"
FT                   /strain="34H; BAA-681"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:167879"
FT   gene            72..1457
FT                   /gene="dnaA"
FT                   /locus_tag="CPS_0001"
FT   CDS_pept        72..1457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CPS_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24481"
FT                   /db_xref="GOA:Q48AS7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AS7"
FT                   /protein_id="AAZ24481.1"
FT                   /translation="MDHSPWQRCLSVLQEELPAQQFSMWIRPLQCVINDNVMTLYAPNR
FT                   FVLDWVRDKYVNRINELLTINESNNPLLLRFDVGSKPTIDNSVTNSPVSRNTGGNESLF
FT                   AKATSAPKVAEPESNIPKKTNVRLNYTFENFVEGKSNQLARAAASQVADNPGTAYNPLF
FT                   IYGGTGLGKTHLLHAVGNGILLNKPNAKIAYMHSERFVQDMVRALQNNAMEKFKQYYRS
FT                   VDALLIDDIQFFAGKERTQEEFFHTFNALLEGNQQVILTSDRYPKEINGVDDRLKSRFG
FT                   WGLTLAIEPPELETRVAILKRKAQESQINLADEVAFFIAKRLRSNVRELEGALNRVIAN
FT                   ANFTGRAITIDFVREALRDLLALQDKLVTIDNIQRTVAEYYKIKIADLLSKRRNRSVAR
FT                   PRQIAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKVKSLREETHDIKEDYSNLIRT
FT                   LSS"
FT   gene            1496..2599
FT                   /gene="dnaN"
FT                   /locus_tag="CPS_0002"
FT   CDS_pept        1496..2599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CPS_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25443"
FT                   /db_xref="GOA:Q48AS6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AS6"
FT                   /protein_id="AAZ25443.1"
FT                   /translation="MKFSLNRELLLKPLLLVSGAVERKSTLPILSNILFEVSGQSLTLT
FT                   ATDLELEMVAYAEIQNQGDDGKITIPARKLLDICKSLPESSLISFEVIDETIKLSSGRS
FT                   KYSLSTLPAVDFPNIEEWKGDVEFQLLKSEFLRLIESTHFSMANQDVRYYLNGMSIESE
FT                   GNEIRSVATDGHRLAICKISNETLALPARQVIVPRKGILEIIRLLAPVDEAVQVFLGSN
FT                   HIRIIDSEFSFTSKLVDGRFPDYRRVLPRNGDKVFETNKDALRQVLSRASILSNEKFKG
FT                   VRLNFSDTNLKITANNPEQEQAEEEIEINFPYGELEIGFNVSYVLDVLSAIKDENVKFT
FT                   LADANSSVVIEGSSNGEALYVVMPMRL"
FT   gene            2635..3768
FT                   /gene="recF"
FT                   /locus_tag="CPS_0003"
FT   CDS_pept        2635..3768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CPS_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P13456; match to
FT                   protein family HMM PF02463; match to protein family HMM
FT                   TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26772"
FT                   /db_xref="GOA:Q48AS5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AS5"
FT                   /protein_id="AAZ26772.1"
FT                   /translation="MSVARLTTYNFRNLSSVAIDLHPKLNFFIGNNGSGKSSLLEALFF
FT                   LGHGKSFRTSKVEHLACYETDNFVVSIKDVNDLQLGLSKNLQTGVTLIKINGERHARLS
FT                   ELAKNIAVQIVTPESFKLFFGGPKERRRFIELGMFHVKHDSSKQWREFNRVLKQRNACI
FT                   RHNLDKATFDYWTGLFCQLSEQVAEVRSQYITNLISELPYWLEILLPNIADKVTVQYLQ
FT                   GWPQKKNLMDSLNDSHEREQAFGYSIYGAHKFDVKFLIAKQALESQLSRGQQKLFLLAL
FT                   TFAQAKLIARVNRVKPILLIDDIGAELDINSRESLSQALSILDCQVIITAIEEGVLQPF
FT                   IDDVSVADKESSKKTKYHMFHVKHGGILPVNNSVKIE"
FT   gene            3778..6222
FT                   /gene="gyrB"
FT                   /locus_tag="CPS_0004"
FT   CDS_pept        3778..6222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CPS_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27440"
FT                   /db_xref="GOA:Q48AS4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AS4"
FT                   /protein_id="AAZ27440.1"
FT                   /translation="MTVENEYSSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   LDNSIDEALAGHCTDIIVTIHLDGSVSVQDDGRGIPTEIHPEEGISAAEVIMTVLHAGG
FT                   KFGGEDSGYKVSGGLHGVGISVVNALSEKLKLNIRRDGKLFEQFYHIGVAEAPLAEVGV
FT                   SDKTGTEVRFWPSTNTFTDVLFHYEILVKRIRELSFLNSGVSIRLIDEREEGKEDHFHY
FT                   DGGIQAFVDYLNTNKTPVNEEIFYFDLEREDGIAVEVAMQWNDGFQENIYCFTNNIPQR
FT                   DGGTHLSGFRTALTRTLNSYMTKEGLNKTKKGGATETSATGDDAREGLTAVISVKVPDP
FT                   KFSSQTKDKLVSSEVKTAVEQAMGEKLGEYLLENPSIARTIIMKIVDAARAREAARKAR
FT                   EMTRRKGVLDIAGLPGKLADCQEKDPALSEIYIVEGDSAGGSAKQGRNRKNQAILPLKG
FT                   KILNVEKARFDKMISSQEVGTLITALGCGIGRDEYNPEKLRYHSIIIMTDADVDGSHIR
FT                   TLLLTFFYRQMPEIMERGHIFIAQPPLYKVKKGKQERYIKDDDGLTEYLTTLALDNASI
FT                   HVNEDAPAITGAALEQLVNQFRNTMDIIKRLSRQIPADILEKMVYSSTISADDFADEAK
FT                   VNAWAKNLITQLENQDGNGSIYKIEVKYNQERNIYFPNFIVRKHGIDKEYHCSYEFIQS
FT                   KEFASIMALNTSINDLMEEGAYVKRGDKVNPAANFEDALEWLMAESKRGQYIQRYKGLG
FT                   EMNPEQLWETTMDPETRRMLQVTIEDAIAADQLFTTLMGDHVEPRRKFIEDNALKVSNL
FT                   DI"
FT   gene            6388..7323
FT                   /gene="glyQ"
FT                   /locus_tag="CPS_0005"
FT   CDS_pept        6388..7323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="CPS_0005"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by similarity to SP:P00960; match to
FT                   protein family HMM PF02091; match to protein family HMM
FT                   TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28106"
FT                   /db_xref="GOA:Q48AS3"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AS3"
FT                   /protein_id="AAZ28106.1"
FT                   /translation="MNTMTTYNSNTFQGLILQLQDYWSRQGCAIVQPLDMEVGAGTFHP
FT                   MTFLRSIGPEPISSAYVQPCRRPTDGRYGDNPNRLQHYYQFQVMLKPSPKNIQELYLNS
FT                   LKELGVDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEISQFTYFQQVGGLECTPVT
FT                   GEITYGLERLAMYIQNVDSIYDLVWTDGPLGTVYYRDIFHQNEVEQSTYNFEYADVDAL
FT                   FKQFDQCEKDSQKLIEANLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTLS
FT                   KAVAEAYYQKREELGFPMCKNNETLAKGDK"
FT   gene            7323..9389
FT                   /gene="glyS"
FT                   /locus_tag="CPS_0006"
FT   CDS_pept        7323..9389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="CPS_0006"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27379"
FT                   /db_xref="GOA:Q48AS2"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AS2"
FT                   /protein_id="AAZ27379.1"
FT                   /translation="MTTETLLIELGTEELPPKSLKTLATAFYDNIKGQLDSHNLSYSDI
FT                   KWFATPRRFAVQVFDLVEKQDDKIVEKRGPAVNVAFDDAGNASKAAQGWARSNGIEVDQ
FT                   AERLVTGKGEWLLHRATVSGKAVVELIPDMVTTALNKLPIAKPMRWGAERTQFIRPVQT
FT                   LTMLFGSDIIAGEALGVSSSNQVQGHRFHHEGLVTINHANDYQAELAKAYVEVDFNERQ
FT                   NKIVAQIKQVANDIDAVALIDEELLNEVTALVEWPVTLVGTFDEDFLNVPAEPLIYSMK
FT                   DHQKYFPVTDKNGQLVNKFIFVTNIESKDPNTIIFGNEKVIRPRLADAEFFFKTDKKQS
FT                   LESRLKSLESVLFQKQLGTLKAKSERIASLSQFIAEQLNENAQDAYRAGLLSKTDLMSD
FT                   MVLEFPQVQGTMGKYYALHDGENENIAQALEDQYRPRFAGDSLPEANIGCAVAISDKID
FT                   SLVGIFGINQAPKGDKDPFALRRAAIGSIRIIIEKQLDLDLSTLINKSIELFGDKLVNE
FT                   NTATDVLEFIMGRFRAFYQEQGISVDVIQAVLAKKPSAPLDFEKRIKAVTFFGELPEAA
FT                   TLAAANKRVGNILAKFDGELYQSFNTDLATEQAERDLADIYRDISLKVAPLMADKNYQA
FT                   ALSELAQLKAPIDTFFDGVMVMSDDEAVKINRLTLLNQIRNSFFAIADISVLQ"
FT   gene            9849..10163
FT                   /locus_tag="CPS_0007"
FT   CDS_pept        9849..10163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0007"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02AT0888"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28041"
FT                   /db_xref="GOA:Q48AS1"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AS1"
FT                   /protein_id="AAZ28041.1"
FT                   /translation="MPSKEITTLLENKLVQLTKRISAIEADFHKGRSQDFSEQATETEN
FT                   DGVLDEIHHEAKLELSLVKSALKRITEGLYGSCVECEEPINPDRLSALPYTTKCIKCAV
FT                   "
FT   gene            10196..10447
FT                   /locus_tag="CPS_0008"
FT   CDS_pept        10196..10447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO3280; match to
FT                   protein family HMM PF04325"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24170"
FT                   /db_xref="GOA:Q48AS0"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AS0"
FT                   /protein_id="AAZ24170.1"
FT                   /translation="MTLEKHDLHHEFPEFTDEIHHLKLNDNHFARLFTEYHEIDHEVNR
FT                   IEQGVENTSDEYLEGKKKQRLKLKDKLFVMLKKVQIPA"
FT   gene            complement(10789..11481)
FT                   /gene="lepB1"
FT                   /locus_tag="CPS_0009"
FT   CDS_pept        complement(10789..11481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB1"
FT                   /locus_tag="CPS_0009"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by similarity to SP:P26844; match to
FT                   protein family HMM PF00717; match to protein family HMM
FT                   TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24810"
FT                   /db_xref="GOA:Q48AT9"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AT9"
FT                   /protein_id="AAZ24810.1"
FT                   /translation="MTNFSNKKFISFLHSNKKFLIFILLMSVFRSAVADWYSVPTGSMK
FT                   PTIQEGDRIIVNKIAYDVRLPFTDVSLLSITTPKRGEIVVFESKAAELRLVKRVIGLPG
FT                   DVVEMNNEVIKVNGKPLSYKIVDKLINKTNSQNITTSIEKIGNVEHHININNTASNRLS
FT                   NFLPVTVPSGHYLVLGDNRRHSADSRVYGFVPHQELRGKATAIAFSIDYNNYYIPRSDR
FT                   LLQDIYGI"
FT   gene            complement(11579..11824)
FT                   /gene="sirA"
FT                   /locus_tag="CPS_0010"
FT   CDS_pept        complement(11579..11824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="CPS_0010"
FT                   /product="sirA protein"
FT                   /note="identified by similarity to SP:P37618; match to
FT                   protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24609"
FT                   /db_xref="GOA:Q48AT8"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AT8"
FT                   /protein_id="AAZ24609.1"
FT                   /translation="MTTTIFQQTNHTLDAIGLRCPEPVMMVRMNIRKIASGETLLIKCD
FT                   DPSTARDIPSFCRFMEHELLAKQTDTLPFLYVIKKN"
FT   gene            11977..13908
FT                   /locus_tag="CPS_0011"
FT   CDS_pept        11977..13908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0011"
FT                   /product="putative soluble lytic murein transglycosylase"
FT                   /note="identified by similarity to GP:5822332; match to
FT                   protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25465"
FT                   /db_xref="GOA:Q48AT7"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023800"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AT7"
FT                   /protein_id="AAZ25465.1"
FT                   /translation="MKSILKVILLSVCTLSSINILQANDSLQILTDVGQQRIFLKAEKL
FT                   LVKSNSQQYQSLYNQLYYYPLQPYLDQRRLIENMQLSSAGEIATFLEKHQHSPLDWPLR
FT                   KAWLMFLAKKNKGALFLEFYQSTRNNVLTCHKLNFSLEAGLPSNVVLPQVTKLWLVGKS
FT                   LDKVCDPIIEQWQQAGYRTDEIVWQRIGLAADGGKHTLIPYLTNLLPKDQQYLGRLWHQ
FT                   VRRDPATVTRQYKFIKKSTKESQIYTYGIKRLIWRDPDKALASFKKAQQIFTFSTTQHQ
FT                   QIVAKFAVALASKNHPQARIWLEKLDPLNIDSNIMQWQLTEVLKQQNWQLVLKELATMP
FT                   EKYKAKLQWRYWYARALIATDDLEHGQDVMNELSSKRHYYGFLAASYLETPVSLQDSPL
FT                   AITSQEKNAILLHPSAKRAFEFYYLGRYVKARREWRYWLTQLNNREKLVAAKLANENGW
FT                   FDRAIFTLSKVGYMDDVELRFPKAFDKKINQHAKKQAINPAWAFAIARRESSFMTDARS
FT                   PVGAKGLMQLMPNTAKQLKRGSVSRQYLYNADNNIKLGTKYLRKLLDKNKGNQILATAS
FT                   YNAGPHRVKGWLKNSHAMPADIWIETIPFKETRNYVKSVLAYQEIYQHKPGQVSQIFEQ
FT                   VINMSIGD"
FT   gene            complement(13936..14118)
FT                   /locus_tag="CPS_0012"
FT   CDS_pept        complement(13936..14118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0012"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24126"
FT                   /db_xref="GOA:Q48AT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AT6"
FT                   /protein_id="AAZ24126.1"
FT                   /translation="MSWVLASQLSIKCCHVFCLRKTAIKNLTYDSISLKSHTISNIKSH
FT                   FKCAKFVHITLQRQT"
FT   gene            14074..15405
FT                   /gene="pepQ"
FT                   /locus_tag="CPS_0013"
FT   CDS_pept        14074..15405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="CPS_0013"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="identified by similarity to SP:P21165; match to
FT                   protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26309"
FT                   /db_xref="GOA:Q48AT5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AT5"
FT                   /protein_id="AAZ26309.1"
FT                   /translation="MTTLNAKLASQYPAHIAQLQQMTKSVLSRENLEGLVIHSGQEVKA
FT                   FLDDNCYPFKVNPHFKYWLPLIDIPNSWLVVNGEDKPTLIYYQPVDFWHKVTPLAESYW
FT                   GEFFNIKILTKASEVDKLLPYDKKGFAYIGSHIEVATALGFEAINPEPLLNYVHYHRGY
FT                   KSKYEHECLRQSNALAVKAHQAARNAFLQGDSEYDIQQAYLKSIGYGTNDTPYGNIVAL
FT                   NKNCSILHYMSLDKMTPQVHQSFLIDAGANFNGYSADITRTYSYKNDKFAELIARMDQL
FT                   MLNAVAGLKPGVSYVDLHIETHRAIGQVLRDFNFINVDADTAVESGIISTFFPHGLGHH
FT                   LGLQVHDVGGFMADERGTHVNTPAEHPFLRTSRVIETNQVFTIEPGLYFIDSLLADLKA
FT                   SANADQVNWQNVDEMRCFGGIRIEDNIIVHQSHNENMTRDLGLS"
FT   gene            15591..16217
FT                   /locus_tag="CPS_0014"
FT   CDS_pept        15591..16217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0014"
FT                   /product="conserved hypothetical protein TIGR00257"
FT                   /note="identified by match to protein family HMM PF01205;
FT                   match to protein family HMM TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26478"
FT                   /db_xref="GOA:Q48AT4"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AT4"
FT                   /protein_id="AAZ26478.1"
FT                   /translation="MTKSYPIAINDVEDESIVNRSRFICYLRPCDDIAQAKAMLKELQQ
FT                   LHPQASHHCHAFLSKAADDSQGYGFSDDGEPTGTAGKPMLLALQGGGIGHVCAIVVRYF
FT                   GGTKLGTGGLQRAYGGSVRQALAFLQSKIKIAMVHKTLACQYSQIDDVLHLLRQIEGQV
FT                   VTQDYQQTVIFRLAIPIEKLGLMQDKLHTLSSGQLQLTAIEQETE"
FT   gene            16242..17693
FT                   /gene="trkH"
FT                   /locus_tag="CPS_0015"
FT   CDS_pept        16242..17693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="CPS_0015"
FT                   /product="Trk system potassium uptake protein TrkH"
FT                   /note="identified by similarity to SP:P21166; match to
FT                   protein family HMM PF02386; match to protein family HMM
FT                   TIGR00933"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27435"
FT                   /db_xref="GOA:Q48AT3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AT3"
FT                   /protein_id="AAZ27435.1"
FT                   /translation="MQYKNIIRILGLLVGLLSVTMLPPALISLIYRDGGGLPFILAFLW
FT                   CICTGFLAWYPHRFEKTDLKAREGFLIVVLFWLVLASFSAIPLMLLEEPNLSTADAFFE
FT                   SFSGLTTTGATILNHIDDLPHAVLWYRQQLQWLGGMGIIVLAVAVLPMLGIGGMQLYRA
FT                   ETPGPVKDSKMTPRIADTAKHLWYIYLGLTIACALAYWLAGMSGFDAICHAFSTIAIGG
FT                   FSTHDASMGYFNSPTINLVCVTFLLIAGVNFALHYAAVQSRSVRSYFFDPEFKVFIGIQ
FT                   IVLTVICFTVLLATGTYQDVDQALDQALFQSVSISTTAGFATTSFADWPTLLPMLLIFS
FT                   SFIGGCAGSTGGGMKVVRVVLLYLQGLRELNKLVHPRAIFSIKLGRKVLPDRIVEAVWG
FT                   FFSAYAAVFVICMLLLLAAGMDDITAFTAVAACINNLGPGLGEVAANFSSINDMSKWVL
FT                   IMAMLFGRLEIFTLLVLFTPAFWRS"
FT   gene            complement(17757..20696)
FT                   /locus_tag="CPS_0016"
FT   CDS_pept        complement(17757..20696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26599"
FT                   /db_xref="GOA:Q48AT2"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AT2"
FT                   /protein_id="AAZ26599.1"
FT                   /translation="MKVSKVLTAITLALSSIAFSSQAELVDNTKNWQTFETENFRVHFT
FT                   PEYRQWALSSAREMEVVRQLIKDQQGRVITEKVDAYIVDPYNAANGFAFPLSHRPYMAF
FT                   FATPPQSDTIIANSTGWQQLLVLHEYVHLVHLAQKSRSNWRNNVANWYDFYDASQINGE
FT                   RWVSEGYATLLESKLTGRGRLFNNQVEAIIQKFARQGALPSYKQLNSGDDSFMSGSMAY
FT                   LVGVRYLKWLEENYGEETLDAVWTRWSAVEQRDFEKSFKGVFPDTAKNLYQRFVAEYTY
FT                   KAMQHEIKLTAQSNEDNRSKLWLDLSGYTSDPSLSPQGDYLAIVETQRTEEGNTTKLNI
FT                   YKTGENTKSIEEFTKRSKELLADDPQDIADKAPSVFKREVAYTLNQRNNRGIKNPRWLN
FT                   KDTLIYGASSLTKKNSYHQDLFSWHLPTNTIKQLTTSANIRRFDISNDGQFIIAERSRV
FT                   GNSQLVKVSLAAESLGEIIAELTPPSLEQVYDFPRLRPTLDGSTSDSFAYVSSSLNNKW
FT                   QLKVRQFEDEQEQIIPLPENYQFLSFPEWSKDGQSLYFVAGLDSATRLYKYDFLNKVLS
FT                   TVTSGEQVITWPMVNGDNELLHLAINAQGPDVYQLDLNKANNQIITNTTTSSAMTVNLA
FT                   DSLKLSEATIAVDESIGEQSAYGIGPQQGTITIAESIYSASSSMLEVGYKSGDVLSRFD
FT                   WQVNASQDIFSSIISGASGAIRWQGWPVKLLAHGYVFDLKTDKQDSDALNLGKTTEKGL
FT                   LLEARYPYSIETLAVDIFAQMQASQYENSQHVDFSSLSFSLGIEQSWSHDQQSWGISQA
FT                   INAQLISAQDDQAEINGNDGSYTGSNGLASLNAHIQGFTLGFKYLWAQRSEDAGDILSL
FT                   GGYSSTLIQEKAHINKQLAPELAFYRQLGNDYQAYQAYMPLGIVEVFYTRHEMTERDII
FT                   DSYGVKGSLNNDFGFTGITNVAINYGIAQVNPENESSDTQGWVALSYKW"
FT   gene            complement(21059..22435)
FT                   /gene="trkA"
FT                   /locus_tag="CPS_0017"
FT   CDS_pept        complement(21059..22435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="CPS_0017"
FT                   /product="Trk system potassium uptake protein TrkA"
FT                   /note="identified by similarity to SP:P39448; match to
FT                   protein family HMM PF02080; match to protein family HMM
FT                   PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26043"
FT                   /db_xref="GOA:Q48AT1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AT1"
FT                   /protein_id="AAZ26043.1"
FT                   /translation="MKIIIVGAGQVGGTLAENLVGENNDISVVDVDGEKLRELQDKMDL
FT                   QVVTGQGGHPDVLKSAGAEDADMVIAVTSDDATNMITCQICSSLFNTPKKIARIRSNQI
FT                   LKYSEQLFHKKHIPVDHIIAPEELVTRDIARLIDYPGALQVLEFANGKVSLVAVKAYYG
FT                   GLLVGHALSTLRDHIPNVDTRVAAIYRNGKPIRPLGTTVIEADDEVFFIAASIHIRAVM
FT                   NELQKLESAYKRIMIAGGGNIGAGLARILEKNHQVKLIERSPKRAEQLTSELNDTLVFA
FT                   GDSSDQELLTEENIDQFDIFIAVTNDDEANIMSSLLAKKLGVRKTMVLIQRDAYIDLVH
FT                   GSTIDIAISPQQATISALLTHVRRGAIDNVYSLRGGAAEAIEIVAKGDEKSSKVVGRAI
FT                   KNIKLPPGATIGAVVRGHEVLIAHSNTLIHEEDHVILFLVNKRYISDIEKLFQVSAIYF
FT                   "
FT   gene            complement(22465..23787)
FT                   /gene="sun"
FT                   /locus_tag="CPS_0018"
FT   CDS_pept        complement(22465..23787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="CPS_0018"
FT                   /product="sun protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P36929; match to
FT                   protein family HMM PF01029; match to protein family HMM
FT                   PF01189; match to protein family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24604"
FT                   /db_xref="GOA:Q48AT0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AT0"
FT                   /protein_id="AAZ24604.1"
FT                   /translation="MIINIRALAAKCCYAVIDQGRSLSDELPKQQDKLIGKDKGLLQEI
FT                   CYGVLRYLPELENDVSQLVQKPIKGKQRVFHFLLLVGVYQIRYMRIPDHAAVSETVAAT
FT                   KTLKNDHMKGLVNAVLRGFLRALEAENKQVNKTDKKIPDPIKYNHPGWFIKKIQQAYSD
FT                   QWQAILDANQQKPPMWLRVNQQHHTSEQYQALLEEAEIEIAHVEPNSQAIELAKPLDVA
FT                   KLPGFDDGWVSIQDGAAQQAARLLDCQPNDIVLDCCAAPGGKTCHIIEQTPDIASMTAI
FT                   DIEEGRLTRVHENLDRLNLTANVITADAATQNWWSGEQFDRILLDAPCSGTGVIRRHPD
FT                   IKWLRKADDIDKLVVLQQQILDNIWSLLKPGGTLLYATCSVLPEENSLQISRFIEQNQD
FT                   AQLIAINGNTPETDKNAIGWQLLPDAENMDGFYYAKLLKLK"
FT   gene            complement(23796..24779)
FT                   /gene="fmt"
FT                   /locus_tag="CPS_0019"
FT   CDS_pept        complement(23796..24779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="CPS_0019"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by similarity to SP:P23882; match to
FT                   protein family HMM PF00551; match to protein family HMM
FT                   PF02911; match to protein family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25053"
FT                   /db_xref="GOA:Q48AS9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AS9"
FT                   /protein_id="AAZ25053.1"
FT                   /translation="MVTPLNIIFAGTPEFAAQHLAALINSEHNIVAVYCPPDKPAGRGK
FT                   KLTACATKLLAIEHDIIVEQPINFKNEEDQQQLAKYNADIMVVVAYGLLLPEVILNSPR
FT                   LGCINVHGSILPKWRGAAPIQRSLEAGDKKTGVTIMQMDKGLDTGDMILSAECEIENTD
FT                   TSASLYEKLANLGPTALVNTLTIMAEPDYQASNHNIAQDDELATYAKKLDKTEAELNWQ
FT                   FSADELHRKIRAYIPWPVAQFTFTESEGKQHRLRIWQASVQEYRGNADPGTIIKADKEG
FT                   IEVATTSGSLRLEVIQLPGKKALAVKDILNGRSDWFVVGSTINKLG"
FT   gene            complement(24812..25327)
FT                   /gene="def1"
FT                   /locus_tag="CPS_0020"
FT   CDS_pept        complement(24812..25327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="CPS_0020"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by similarity to SP:P27251; match to
FT                   protein family HMM PF01327; match to protein family HMM
FT                   TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25581"
FT                   /db_xref="GOA:Q48AS8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AS8"
FT                   /protein_id="AAZ25581.1"
FT                   /translation="MTILTILRFPDPRLRTKAQPVTDITDATATIIDDMLATMYEENGV
FT                   GLAATQVDIHQRIVVMDTSEDNDQPIIFINPEIIATSNETSINEEGCLSVPGTYAKVDR
FT                   HDACTVKALDRHGKEFSLNATELQSICIQHELDHLKGVLFVDYLSPLKRQRIQKKLEKE
FT                   AKTDKNNK"
FT   gene            25482..26567
FT                   /locus_tag="CPS_0021"
FT   CDS_pept        25482..26567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0021"
FT                   /product="LysM domain protein"
FT                   /note="identified by similarity to OMNI:SO0033; match to
FT                   protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24689"
FT                   /db_xref="GOA:Q48AU7"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AU7"
FT                   /protein_id="AAZ24689.1"
FT                   /translation="MLKEIILSLSLLSCSLVALADQITLNDDAPKTHVVVKGDTLWDIS
FT                   ALFLEQPWLWPKLWRLNPEINNPHLIYPGDVLKLVFDENGEPMLVVEPVKPSYKWSPKI
FT                   RQEKKKDSAITLLPLEVIAPFVRYDHLFTEDELEQLPHIIGSDEGYRMTTKDFKVYVNK
FT                   DLEVAQSYAIYDKGEEIFDPETDDSLGFYVNLVGTGQVTKRGDIENDVPSTMSVGSVKR
FT                   EIHSGDYVVPVNEGQLLPAIFSMKAANKSLRGSIVKATSNGREFAKLEVVMINRGIDHD
FT                   VTVGDVMAIKRTSPAVVDTGSGPAYSVESSRWNKITGSDYKMPEEQLGELMIFKVYQKA
FT                   SMALILHTEKPARINDLITAP"
FT   gene            26651..27802
FT                   /locus_tag="CPS_0022"
FT   CDS_pept        26651..27802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0022"
FT                   /product="putative DNA processing protein DprA"
FT                   /note="identified by similarity to SP:P43862; match to
FT                   protein family HMM PF02481; match to protein family HMM
FT                   TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ23974"
FT                   /db_xref="GOA:Q48AU6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AU6"
FT                   /protein_id="AAZ23974.1"
FT                   /translation="MINNSKSNIEYWLALKFVPRLAIHKKIALVETFGLIALFSLDNKP
FT                   SVLSSANNLSVKQLHAFHQPDWQTITHIIHASAACNSAIICYDDTYYPQLLKQIYDPPL
FT                   VIFMQGNPLLLNAPQVAVVGSRAASVGGRDTAFKICQQLAQHNFIITSGLALGIDAAAH
FT                   RGALSEPASTIAVVATGLDQVYPARHHSLAQKIIDSSGAIISEFVPGTQARAGHFPKRN
FT                   RLISGLSLGVLVVEAELKSGSLITARCALEQNRDVFAIPSSIENKQAKGCHWLIKQGAK
FT                   LVEQCADIIDEFAFADKPSLHLKSELKPLKSATHSTHKGGDEINQKVLCNDALLDSVGF
FT                   EITPVDKVVLRSELPVEEVLTRLTMLELNGLVSAVPGGYIRTQ"
FT   gene            27822..28295
FT                   /gene="smg"
FT                   /locus_tag="CPS_0023"
FT   CDS_pept        27822..28295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smg"
FT                   /locus_tag="CPS_0023"
FT                   /product="smg protein"
FT                   /note="identified by similarity to SP:P30853; match to
FT                   protein family HMM PF04361"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28481"
FT                   /db_xref="GOA:Q48AU5"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AU5"
FT                   /protein_id="AAZ28481.1"
FT                   /translation="MFDILMYLFETYIQNESEAMVDHELLTDELTRAGFHQDEIYKALN
FT                   WLEKLTALQDTDAYPYLTRVGSKSVRIYTSEEMQLLDTPSRGFILFLEQVNVLDFTTRE
FT                   MVIDRVMELDTKYFSMDDLKWVILMVLFNVPGKESAYSQLEDLIFEEQEGPLH"
FT   gene            28415..28975
FT                   /locus_tag="CPS_0024"
FT   CDS_pept        28415..28975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0024"
FT                   /product="topoisomerase DNA-binding C4 zinc finger domain
FT                   protein"
FT                   /note="identified by similarity to SP:P39814; match to
FT                   protein family HMM PF01396"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28293"
FT                   /db_xref="GOA:Q48AU4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AU4"
FT                   /protein_id="AAZ28293.1"
FT                   /translation="MSESEKPLFTQHEHALEKEYQVCPDCGSELTMKHGKSGTFLGCVN
FT                   YPNCQYTRAVVEHERVEDKILSGSECPLCSHVLAVKQGRYGMFIGCSNFPQCHHIEHEA
FT                   QEIIQDVVCPSCKRGSLQEKTSRFGKKFYSCDAYPKCKFVVNHEPVEGRCEKCQFPLLL
FT                   KRNMAAGIKYQCADKKCSHMQKI"
FT   gene            complement(29054..30211)
FT                   /gene="purK"
FT                   /locus_tag="CPS_0025"
FT   CDS_pept        complement(29054..30211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="CPS_0025"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by similarity to SP:P09029; match to
FT                   protein family HMM PF02222; match to protein family HMM
FT                   TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27764"
FT                   /db_xref="GOA:Q48AU3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AU3"
FT                   /protein_id="AAZ27764.1"
FT                   /translation="MNKILILGAGQLARMMELAGTPLNLDIKALDVSSNKVVQPLSPEN
FT                   IYGDLEAGIKNADVITAEFEHIAHDILAECEQSGKLYPTSNAIKIGGDRRLEKALLESC
FT                   NAANAKHYFVNAKIDFDKAIEHLSLPIIFKTALEGYDGKGQWRLKSAADAEVIWQDMAN
FT                   FLAASKTTVKQGIVAEQMVPFDREVSLVGVRRVNGDVAVYPLTENHHTNGILSVSVAAP
FT                   VNEQLQQQASTVFKALSDELDYVGVMAIEFFQVGDQLLVNEIAPRVHNSGHWTQQGADT
FT                   CQFENHLRAICDLPLGSTALIRPTAMVNIIGEDTVSNEVLAIPSATIHWYNKGKRVGRK
FT                   MGHINVSGESELQLAQRLQHLADILCKEAFPDLNDFAKNYLDKQS"
FT   gene            complement(30220..30702)
FT                   /gene="purE"
FT                   /locus_tag="CPS_0026"
FT   CDS_pept        complement(30220..30702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="CPS_0026"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by similarity to SP:P12044; match to
FT                   protein family HMM PF00731; match to protein family HMM
FT                   TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24419"
FT                   /db_xref="GOA:Q48AU2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AU2"
FT                   /protein_id="AAZ24419.1"
FT                   /translation="MTVGIIMGSKSDWPTMQHTAEMLDSLGVQYETKVVSAHRTPHLLA
FT                   EYAESAKDRGIKVIIAGAGGAAHLPGMAAAYTSLPVLGVPVQSKALNGQDSLLSIVQMP
FT                   KGIAVGTLAIGNAGAANAGLLAAQIIGTHNTEIQQNIEEFRRKQTETILANPNPAE"
FT   gene            30897..31448
FT                   /locus_tag="CPS_0027"
FT   CDS_pept        30897..31448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0027"
FT                   /product="putative RNA-binding protein"
FT                   /note="identified by similarity to GP:13096287; match to
FT                   protein family HMM PF01300"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26138"
FT                   /db_xref="GOA:Q48AU1"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AU1"
FT                   /protein_id="AAZ26138.1"
FT                   /translation="MSEKNVVEAFKNGGIIAYPTEAVFGLGCDPDNKEALKRLLKLKQR
FT                   SPEKGLILLAGSYSQLLPYIDDSKIPQDKRLTLLSRWPDGITQLVPKNNNISSLLSGSF
FT                   DTIAVRITSQPDVVALCQQTNKPIVSTSANLSGQEPAKTWQSLDLVLSKQVDFILKGVT
FT                   LGRTSPSKIIDALTGKIIRN"
FT   gene            complement(31497..31592)
FT                   /locus_tag="CPS_0028"
FT   CDS_pept        complement(31497..31592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0028"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25614"
FT                   /db_xref="GOA:Q48AU0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AU0"
FT                   /protein_id="AAZ25614.1"
FT                   /translation="MTANYEAKQYFDLDQILIIIKKKIVLNNVNY"
FT   gene            31667..32380
FT                   /locus_tag="CPS_0029"
FT   CDS_pept        31667..32380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0029"
FT                   /product="outer membrane protein, OmpW family"
FT                   /note="identified by match to protein family HMM PF03922"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27203"
FT                   /db_xref="GOA:Q48AV6"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AV6"
FT                   /protein_id="AAZ27203.1"
FT                   /translation="MKKTLLTIALLSSLSTTAFANQAGDILVRGGVTMVSPSSNEATVL
FT                   LDGSATPLSVSVDDNTQFGLNLVYFFDSNWAIELLAATPFTHDVILHDPKGATNDIYGI
FT                   DLNGATLAEVSHLPPTLSALYYFDTGTAFKPYVGVGVNYTIFFDEDFTSTPQAAGFSNL
FT                   ELDGSWGYSVQLGLDYELDKNWSVNVSARYIDINTKATFNIDNALGVDGGLVGKGSASV
FT                   DVDPMVYSVMLGYTF"
FT   gene            32504..33331
FT                   /gene="aroE"
FT                   /locus_tag="CPS_0030"
FT   CDS_pept        32504..33331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="CPS_0030"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by match to protein family HMM PF01488;
FT                   match to protein family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27050"
FT                   /db_xref="GOA:Q48AV5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AV5"
FT                   /protein_id="AAZ27050.1"
FT                   /translation="MTQQTPDQYRVFGNPIEQSKSPAIHHIFADKSQQNIDYQKQLVDT
FT                   KDFSNAVADFIRHGGKGANVTAPFKEQALAIADELTERATLAGAVNTLTFKNGKIFGDN
FT                   TDGEGLVQDLITNKVILNESRVLLLGAGGAARGVLLPLLAQNPRSIVIANRTASKAATL
FT                   CQHFSDIRLSASGYQDLEQQHFDVIINATSASLSGNLPPIPTSLLSQNVVCYDMVYGKD
FT                   ETPFLKWAKEHGAMKVIDGLGMLVGQAAVSFEVWRGVTPEVQPVIDKLRASLK"
FT   gene            33346..33579
FT                   /locus_tag="CPS_0031"
FT   CDS_pept        33346..33579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25746"
FT                   /db_xref="GOA:Q48AV4"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AV4"
FT                   /protein_id="AAZ25746.1"
FT                   /translation="MNQAILFNDDLAFDKEQDAWCFTVLLSAQVISIYFHSMQLKKLEE
FT                   IDNCTKFDLEEIVELWLEKNEPEGNTIHIQMR"
FT   gene            complement(33576..34115)
FT                   /locus_tag="CPS_0032"
FT   CDS_pept        complement(33576..34115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0032"
FT                   /product="bacterial transferase hexapeptide domain protein"
FT                   /note="identified by similarity to OMNI:VC0058"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28704"
FT                   /db_xref="GOA:Q48AV3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AV3"
FT                   /protein_id="AAZ28704.1"
FT                   /translation="MSTTNIRPYKGILPSIGSDNYIDKSAILVGDITLSDDVSIWPLVA
FT                   ARGDVNTITIGARTNIQDGTVLHVTRKSSENPQGNPLIIGSDVTVGHKCMLHGCQLGDR
FT                   ILVGMGAIIMDGAVIEDDVFIGAGSLVPPNKTLLSGYLYVGNPVKQARPLKESEAAFLK
FT                   QSAINYVELKNEYLNN"
FT   gene            complement(34795..34899)
FT                   /locus_tag="CPS_0033"
FT   CDS_pept        complement(34795..34899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0033"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26822"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AV2"
FT                   /protein_id="AAZ26822.1"
FT                   /translation="MCNLTASDVLLLNEFCRDTNPKTDIALHSRYLPN"
FT   gene            34936..36449
FT                   /gene="rrsA"
FT                   /locus_tag="CPS_0034"
FT   rRNA            34936..36449
FT                   /gene="rrsA"
FT                   /locus_tag="CPS_0034"
FT                   /product="16S ribosomal RNA"
FT   gene            36547..36623
FT                   /locus_tag="CPS_0035"
FT   tRNA            36547..36623
FT                   /locus_tag="CPS_0035"
FT                   /product="tRNA-Ile"
FT   gene            36736..36828
FT                   /locus_tag="CPS_0036"
FT   CDS_pept        36736..36828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24658"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AV7"
FT                   /protein_id="AAZ24658.1"
FT                   /translation="MRANLNSLTIWKADINIGIYITNTVSRCCL"
FT   gene            37077..39970
FT                   /gene="rrlA"
FT                   /locus_tag="CPS_0037"
FT   rRNA            37077..39970
FT                   /gene="rrlA"
FT                   /locus_tag="CPS_0037"
FT                   /product="23S ribosomal RNA"
FT   gene            40130..40248
FT                   /gene="rrfA"
FT                   /locus_tag="CPS_0038"
FT   rRNA            40130..40248
FT                   /gene="rrfA"
FT                   /locus_tag="CPS_0038"
FT                   /product="5S ribosomal RNA"
FT   gene            40354..40470
FT                   /locus_tag="CPS_0039"
FT   rRNA            40354..40470
FT                   /locus_tag="CPS_0039"
FT                   /product="5S ribosomal RNA"
FT   gene            40608..40692
FT                   /locus_tag="CPS_0040"
FT   tRNA            40608..40692
FT                   /locus_tag="CPS_0040"
FT                   /product="tRNA-Tyr"
FT   gene            complement(40709..42316)
FT                   /locus_tag="CPS_0041"
FT   CDS_pept        complement(40709..42316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0041"
FT                   /product="response regulator"
FT                   /note="identified by similarity to GB:AAN66393.1; match to
FT                   protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26111"
FT                   /db_xref="GOA:Q48AV1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AV1"
FT                   /protein_id="AAZ26111.1"
FT                   /translation="MAKYNYQNMRFLIVDNIKPSQEILKQFVMRLTSKQVDSTHYAQDV
FT                   ASICQQRHYDVIFLGYDLGENQKNGQQILEELRVNGYINRHCIVILITAEVSQSMVLAA
FT                   LEHKPDHYLCKPYTLSELEKRLNFCLHKKMAMAAIYQALDTDDPELVIKRCKHALSINT
FT                   PYKTECLGIIARQYFELEKFDEAKAIYLAHQNTSNCQWATIGLGKVALHEKKLNQAEKL
FT                   FKLLIRDCPLYLSSYDWLAITYEEQFHYILAEEILEQALLLSPRSLTRLKKYAHLCIHN
FT                   EHFDKATAAFEQTYNLAQNSIHHCADNAIKYVQALIEHLPSLPLVDAKKMNNKAFSYLK
FT                   QMARDFNESDIRVQSHLLGACLLEITKERQLANDEIVRGERLLHSEHNNIENSKLIDIS
FT                   LTLKKLKRDDLASRILAAREESAIYQSSNEMNRQIFNIKDKAQADIELGLTLYTQKKYR
FT                   EATLKLQDASAMFPKHIGIKLNLMQVLLVSYDQDKQSEEDLHKAKILLMELTRLDLSNN
FT                   ELERLKKMQKKYQLIAGI"
FT   gene            42397..43659
FT                   /locus_tag="CPS_0042"
FT   CDS_pept        42397..43659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0042"
FT                   /product="ATP-dependent RNA helicase, DEAD box family"
FT                   /note="identified by similarity to SP:P25888; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26869"
FT                   /db_xref="GOA:Q48AV0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AV0"
FT                   /protein_id="AAZ26869.1"
FT                   /translation="MAKRMTFSSFSLDSTLLKAITESAYDEPTEIQKQSIPLILAKHDV
FT                   MARAQTGTGKTAAFALPILQQLISVQPCKPELRALVLTPTRELAQQVHKSFCHYGQFTD
FT                   VTIGIAYGGVSTKKQISELKVGVDILIATPGRLLDLLRTESVSLSNIETLVFDEADRML
FT                   DMGFKEEIDQITQYLPKTKQTLLFSATFADDIYKMSKNILVEPKMVEIDEKNKAADDVE
FT                   QLVYGVDADRKRELTSFLIGSRNWKQVLVFTRTKQCADDLAKEMTKDGVKSLAIHGDKS
FT                   QGAREKALHEFKEGKVRALIATDVAARGIDIKGLSHVINYELPYNAEDYVHRIGRTARA
FT                   GNSGLAVSLVSPGEEWLLTAIEELLDIQLLQQWLPGYELDLTKIANSNKRPINKKNARK
FT                   DALSAGDKSKGHRPNTRNRRR"
FT   gene            44357..45868
FT                   /gene="rrsB"
FT                   /locus_tag="CPS_0043"
FT   rRNA            44357..45868
FT                   /gene="rrsB"
FT                   /locus_tag="CPS_0043"
FT                   /product="16S ribosomal RNA"
FT   gene            45969..46044
FT                   /locus_tag="CPS_0044"
FT   tRNA            45969..46044
FT                   /locus_tag="CPS_0044"
FT                   /product="tRNA-Ala"
FT   gene            46140..46343
FT                   /locus_tag="CPS_0045"
FT   CDS_pept        46140..46343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25642"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A09"
FT                   /protein_id="AAZ25642.1"
FT                   /translation="MRANLNSLTIWKADINIGIYKVSTVSRCCLHDYKYQAVISFSYRE
FT                   CGNGDSASPQGCIIKFILLARA"
FT   gene            46481..49374
FT                   /gene="rrlB"
FT                   /locus_tag="CPS_0046"
FT   rRNA            46481..49374
FT                   /gene="rrlB"
FT                   /locus_tag="CPS_0046"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(49350..49511)
FT                   /locus_tag="CPS_0047"
FT   CDS_pept        complement(49350..49511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25253"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A08"
FT                   /protein_id="AAZ25253.1"
FT                   /translation="MSYKYRLVFLVQVTRKYVMFSYLSVYVSLYTNHFSITSQQNYLGV
FT                   VWLSLTGN"
FT   gene            49542..49660
FT                   /gene="rrfB"
FT                   /locus_tag="CPS_0048"
FT   rRNA            49542..49660
FT                   /gene="rrfB"
FT                   /locus_tag="CPS_0048"
FT                   /product="5S ribosomal RNA"
FT   gene            50199..51712
FT                   /gene="rrsC"
FT                   /locus_tag="CPS_0049"
FT   rRNA            50199..51712
FT                   /gene="rrsC"
FT                   /locus_tag="CPS_0049"
FT                   /product="16S ribosomal RNA"
FT   gene            51813..51888
FT                   /locus_tag="CPS_0050"
FT   tRNA            51813..51888
FT                   /locus_tag="CPS_0050"
FT                   /product="tRNA-Ala"
FT   gene            51984..52076
FT                   /locus_tag="CPS_0051"
FT   CDS_pept        51984..52076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28229"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AV7"
FT                   /protein_id="AAZ28229.1"
FT                   /translation="MRANLNSLTIWKADINIGIYITNTVSRCCL"
FT   gene            52325..55218
FT                   /gene="rrlC"
FT                   /locus_tag="CPS_0052"
FT   rRNA            52325..55218
FT                   /gene="rrlC"
FT                   /locus_tag="CPS_0052"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(55194..55355)
FT                   /locus_tag="CPS_0053"
FT   CDS_pept        complement(55194..55355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0053"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28538"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX9"
FT                   /protein_id="AAZ28538.1"
FT                   /translation="MSYKYRLVFLVQVTRKYVMFSYLSVYVNLYTNHFSITSQQNYLGV
FT                   VWLSLTGN"
FT   gene            55386..55504
FT                   /gene="rrfC"
FT                   /locus_tag="CPS_0054"
FT   rRNA            55386..55504
FT                   /gene="rrfC"
FT                   /locus_tag="CPS_0054"
FT                   /product="5S ribosomal RNA"
FT   gene            56389..56775
FT                   /gene="atpI"
FT                   /locus_tag="CPS_0055"
FT   CDS_pept        56389..56775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="CPS_0055"
FT                   /product="ATP synthase protein I"
FT                   /note="identified by match to protein family HMM PF03899"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24306"
FT                   /db_xref="GOA:Q48AX8"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX8"
FT                   /protein_id="AAZ24306.1"
FT                   /translation="MRNELTKPGRKFAYQQSALITLITLIFTLITYFIWGFESAKSAAL
FT                   GGIIGILPNLFFAYKAFRFAGARASKMVVESFFSGVKQKMALMALLLGLTIKFVVISPL
FT                   PFFSMFCLVMALPIITPFIIKQQR"
FT   gene            56819..57604
FT                   /gene="atpB"
FT                   /locus_tag="CPS_0056"
FT   CDS_pept        56819..57604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="CPS_0056"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25166"
FT                   /db_xref="GOA:Q48AW6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AW6"
FT                   /protein_id="AAZ25166.1"
FT                   /translation="MSSGAVLTSQEYITHHLSNLKVGEGFWAVHLDSLGWSVFLGLVFL
FT                   TIFRSVAKKATSGVPGKLQCAVEMVVGFVDDSVKSTFHGKNALIAPLSLTIFVWILLMN
FT                   SMDWVPVDLLPHLIHWVTGMPLGDIYMKPVPTADPNITFGLALGVFILIIYYSIKVKGV
FT                   GGFMKELTTQPFGHWSLYPVNFILETVTMLARPLSLALRLFGNLYAGELIFLLIATIGV
FT                   FQLPVHFLWAAFHLLVIPLQAFIFMMLTIVYLSLAHEDH"
FT   gene            57703..57939
FT                   /gene="atpE"
FT                   /locus_tag="CPS_0057"
FT   CDS_pept        57703..57939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="CPS_0057"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00137;
FT                   match to protein family HMM TIGR01260"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27236"
FT                   /db_xref="GOA:Q48AW5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AW5"
FT                   /protein_id="AAZ27236.1"
FT                   /translation="MENFGLMYIAAALLIGLGALGTAIGFGLLGGKFLESAARQPELAP
FT                   QLQVKMFIVAGLIDAIAMIGVAIGLYILFVKIG"
FT   gene            57987..58457
FT                   /gene="atpF"
FT                   /locus_tag="CPS_0058"
FT   CDS_pept        57987..58457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="CPS_0058"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430;
FT                   match to protein family HMM TIGR01144"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26261"
FT                   /db_xref="GOA:Q48AW4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AW4"
FT                   /protein_id="AAZ26261.1"
FT                   /translation="MDINMTLVGQLIAFVVFVIFCMKYVWPPIIGAIEDRQATIADGLA
FT                   ASDRAAKDLELAQEKATAQLKEAKVQAASIVDAAKKHEAKIVDEAAGKAQVEKERILAS
FT                   GHAEIETERNRAKEELRKEVAVLAIAGAEKILERSIDAAAHSDILDKLVAEL"
FT   gene            58470..59003
FT                   /gene="atpH"
FT                   /locus_tag="CPS_0059"
FT   CDS_pept        58470..59003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="CPS_0059"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28273"
FT                   /db_xref="GOA:Q48AW3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AW3"
FT                   /protein_id="AAZ28273.1"
FT                   /translation="MSELTTVARPYAKAAFEFAVEAKAIDSWLVQLTFAAEVAKDETIK
FT                   GFLSSGASVEQAQTLFLNVCGEQVDSQGQNFLKVMAINERLLVLPQVLEQFIALKADFD
FT                   QEVSVDVTSAVEVTAEQKTTLSAALEKRLARKVKLNCFVDASIVSGLVIKAGDMVIDGS
FT                   IKGKLNRLATTLQS"
FT   gene            59019..60560
FT                   /gene="atpA"
FT                   /locus_tag="CPS_0060"
FT   CDS_pept        59019..60560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="CPS_0060"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26667"
FT                   /db_xref="GOA:Q48AW2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AW2"
FT                   /protein_id="AAZ26667.1"
FT                   /translation="MQLNSTEIAELIKNRIEQFNVVSEARNEGTIVSVTDGIIRINGLA
FT                   DVMQGEMIELPGSRFAIALNLDRDSVGAVVMGPYADLAEGQKVKGTGRILEVPVGRGLL
FT                   GRVVNTLGEPIDGKGPIENDGFSPVEVIAPGVIDRKSVDEPVQTGIKSIDAMIPIGRGQ
FT                   RELIIGDRQIGKSAIALDAIINQKNTGIKSIYVAIGQKASTVANVVRSLEEHGALSNTI
FT                   VVVASASEAAALQYLAPYAGCSMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNEAYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLQSDLFNSGIRPAVNAGISVSRVGGAAQTKIIKKLGGGIRLALAQ
FT                   YAELAAFAQFASDLDDATRAQLEHGQRVTELMKQKQYSPLSIAETAVSLFAAEKGFLND
FT                   VAINKVVDFEEALHAYMSNEQAALMATINEKGDYNKDIEASLKTALENFKSTQTW"
FT   gene            60598..61461
FT                   /gene="atpG"
FT                   /locus_tag="CPS_0061"
FT   CDS_pept        60598..61461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="CPS_0061"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28379"
FT                   /db_xref="GOA:Q48AW1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AW1"
FT                   /protein_id="AAZ28379.1"
FT                   /translation="MAVGKEIKTKIASVKNTQKITSAMEMVAASKMRKAQEGMAASRPY
FT                   ATNIRNVIGHIALGNLEYRHPYMEERETKRVGYIVVSTDRGLCGGLNINLFKKVLADAA
FT                   EKQASGAEVEFGVVGSKATSFFNNMGAKVSAQISGLGDSPSLTDLVGSVAVMLKAYDNG
FT                   EIDKLYVVYNKFVNTMTQDATIDQLLPLPKSDDEEISHRWDYIYEPDANSLLDKLLVRY
FT                   IESQVYQGVVENIACEQAARMVAMKAATDNAGDLIDDLQLVYNKARQAAITQELGEIVA
FT                   GAAAVG"
FT   gene            61562..62947
FT                   /gene="atpD"
FT                   /locus_tag="CPS_0062"
FT   CDS_pept        61562..62947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="CPS_0062"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26635"
FT                   /db_xref="GOA:Q48AW0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AW0"
FT                   /protein_id="AAZ26635.1"
FT                   /translation="MSTGKVVQIIGAVVDVEFPQDAVPQVYDALKITEGDLEGLVLEVQ
FT                   QQLGGGVVRTIAMGTSDGLRRGLNVVNTGQGIQVPVGVETLGRIMNVLGEPIDEAGPIG
FT                   EKDRWSIHREAPAYAEQSMSNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMME
FT                   LIRNIAIEHSGYSVFAGVGERTREGNDFYHEMNDSNVLDKVSLVYGQMNEPPGNRLRVA
FT                   FTGLTMAEKFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQ
FT                   ERITSTNKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASQGIYPAIDPLD
FT                   SSSRQLDPLVVGTEHYETARGVQTVLQRYKELKDIIAILGMDELSEEDKQTVSRARKIQ
FT                   RYLSQPFFVAEVFTGSPGKYVSLKDTIAGFKGILAGEYDDMPEQAFYMVGGIEEAIEKA
FT                   NKM"
FT   gene            63009..63431
FT                   /gene="atpC"
FT                   /locus_tag="CPS_0063"
FT   CDS_pept        63009..63431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="CPS_0063"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00401;
FT                   match to protein family HMM PF02823; match to protein
FT                   family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24741"
FT                   /db_xref="GOA:Q48AV9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AV9"
FT                   /protein_id="AAZ24741.1"
FT                   /translation="MALLTVNLNVVSAEESLFSGSIKSLQITGSEGELGIMPGHAPLLT
FT                   SLKPGMALITKADGTEEVIYLSGGMLEVQPNNVTVLADVATRAADLDEEAALAAKQRAE
FT                   DNMNAHGGDVDYAAVAAELARAVAQLRVIQATSKHS"
FT   gene            complement(63625..64536)
FT                   /locus_tag="CPS_0064"
FT   CDS_pept        complement(63625..64536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27781"
FT                   /db_xref="GOA:Q48AV8"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AV8"
FT                   /protein_id="AAZ27781.1"
FT                   /translation="MSLTSSQLNSLRSLPCFEKVVDISLLIDGMSHTCIKVTTALQVFF
FT                   VKKLNSETAETEVLSSKYAAKHGLSPRIIYHDNAWLVTDYIVGITLDKNELSSSQCIDT
FT                   GLTLMAKLHQLVPQPNAKTIPCLDTSESVRRLFTNPNSIPSQQKLFLADITETLTLKIG
FT                   IEQKRSDVTNIICHGDINYSNIIIDETRQSWLIDFECSHLAPVDFDLSMFIAINNISPL
FT                   HIDEIVNRYMSLVPSYKPNKILLTYYLLYSYFINGLWYLDNTNDAKINNHLRSLAIEQW
FT                   SAFDSFVVKYHLDIPKLMPLIS"
FT   gene            complement(64541..65194)
FT                   /locus_tag="CPS_0065"
FT   CDS_pept        complement(64541..65194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0065"
FT                   /product="putative nicotinamide mononucleotide transporter
FT                   PnuC"
FT                   /note="identified by similarity to SP:P31215; match to
FT                   protein family HMM PF04973; match to protein family HMM
FT                   TIGR01528"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24851"
FT                   /db_xref="GOA:Q48AX7"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX7"
FT                   /protein_id="AAZ24851.1"
FT                   /translation="MTELLNSVSAYFQQLPWLELVAMVLSIAYVILAAKGSRWCWPAAF
FT                   ISTALYTVIFYDVLLLMDSALNAYYLLMAVYGYWQWSKQPDQNQNESSQLTIVSWQLSW
FT                   HIKVCAALALLAMGLGYLMDNYSPAHFPYLDTFTTVYAVFATYLVANKVLENWLYWIVI
FT                   DLASIYLYLEKGLIPTTVLFIVFVIVAGYGYHKWLKLYQKSSTNLQPSAIANTR"
FT   gene            complement(65194..65460)
FT                   /locus_tag="CPS_0066"
FT   CDS_pept        complement(65194..65460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0066"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO2714"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28011"
FT                   /db_xref="GOA:Q48AX6"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX6"
FT                   /protein_id="AAZ28011.1"
FT                   /translation="MKISIELSLYPLAEEQYKTEIWAFIKRLRGVEGLQVITNGMSTQV
FT                   FGDYDLAVNHVMAEIKHVHKTTGAAVFVCKFINGDRSQVEAES"
FT   gene            complement(65523..67703)
FT                   /locus_tag="CPS_0067"
FT   CDS_pept        complement(65523..67703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0067"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27492"
FT                   /db_xref="GOA:Q48AX5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX5"
FT                   /protein_id="AAZ27492.1"
FT                   /translation="MTFSKSATCLAITASLFNVTASAEQQANNDTSNTGNTGNTGNLET
FT                   ITVTSDFRQQNLQNTPASLSVLTDIEINQRNARHLEELVAVSPNVNFASGSQRARYYQI
FT                   RGIGERSQFQEPINPSVGMIIDDIDFTGIGSIANLFDVKQAEIFRGPQGTRFGANAIAG
FT                   MINITTNEPTEDFEGAVQLGVGNYNSYDMGVALSGPASDTVNYRLAVNQHNSDGFTENI
FT                   HLQRDDTNNRDELSVRGKLAIEASNDLTIDLAGFYFDFDNGYDVFSLDNTRETYSDQPG
FT                   FDQQETAAFSAKFTYTGFESATLLAIVSHSDTDLGYGYDEDWAFGEYEWRSDDPVYTPD
FT                   PCITPSGCLADFDGYSSTDHYYRDKTVLTTELRAVSNQGQEIFNGSTAWVAGVYFKQDD
FT                   EDLLRQYTYASGDFTSINESTSVALYGQLDTQIAEKWSLMSGLRIENRSADYNNSDLFD
FT                   DRIDDTMVGGKLVLSYQQNEDSMWYGSINRGYKAGGHNTDGTLPEDLRTFDPEYLLNYE
FT                   IGYKVSLLENSAYVRTSVFYMDREDMQVKSSKTIIREDGSSEFISYLGNAATGSNYGVE
FT                   IEGAWYINDLINVYGSLGLLDTEFNDFVNADGVSLSGREQAHAPNYQFNVGINVQPTDH
FT                   WLINLSVDGKDSFYFSDSHDEQSESVALLNASVAYIQDNWQIKIWGRNLANEDYANRGF
FT                   YFGNDPRDGYTAKQYTQLSEPLVFGATLDYQF"
FT   gene            68317..71787
FT                   /locus_tag="CPS_0068"
FT   CDS_pept        68317..71787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0068"
FT                   /product="sensory box sensor histidine kinase/response
FT                   regulator"
FT                   /note="identified by similarity to OMNI:NTL03PA03271; match
FT                   to protein family HMM PF00072; match to protein family HMM
FT                   PF00512; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25872"
FT                   /db_xref="GOA:Q48AX4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX4"
FT                   /protein_id="AAZ25872.1"
FT                   /translation="MFPNWQLVLLSLAYIGLLFLIAFLGDRYRHQLARKGQSIIYALTL
FT                   GVYCTSWSFLGTTGQASTSLLSHLPIYLGPILLFVFAWPFIQRIIRVSLKLHLTSIADL
FT                   LAARFGKSHNLAIMVTIVALVGTMPYIALQLKAMVYSFQQLQIDQSLNSWHIGLVVSLV
FT                   LAMFTVLFGIRHIDVTERHPGVMLAIAFESLVKLAAFLAVGIFVCFVLYDSPADIWQQA
FT                   NADELLEQQLTIDNVTSMFAMLVIVMAAFLSLPRQFQVMVVELKDQRDTWLSRRVFPIY
FT                   ILIFAFFAVPLGLAGQMLLGNTVPSDTYVLFLPDVTQQTWLTLFAFLGAVSAASSMVII
FT                   SSIALSTMLSNEIVFPLLYRRQKVAQTDYDNFRKRLLNIRKLLALFVILLGYGVFIMAS
FT                   PDTLSSLGEVAFGAFAQLTPALIAAFYWRRASLMGVYAGILVGFILWLTLNFLPQFGLY
FT                   ASPFAEGFLPVKTTATLFSLGANIIVMWALSQISRQSVQERVQASLFLEWQSPKLLKVE
FT                   KKRQLDVQELELLASRFVGLEKAQANFNSFLSSHDKKELGNVIYNQQLIQHTENTLATV
FT                   MGSSSARLVLSSALDGRDIALEELAVLVEDASSQQQEFSQHLLQSAIENASEGISIVDD
FT                   ELRLVAWNKKYLDLFEYPPELVYMGSPISALIRHNVKRGLCGSGDIESQVERRLDFLRK
FT                   GSPHSSERQQVSGQTIRIEGNPLPGGGFVMLFSDITAYRQAEQVLKEANLDLETRVYER
FT                   TLTLAKTNEALAKAHEKAEQAHLKKSQYLNACSHDLMQPLEAARLFTSALSEQNNLTTD
FT                   QQRQVENIDRSLKAANDLLADLAEIARLESGNIKANIQAFALNELFEDLAQEFSALAIE
FT                   KSVEFRLAVSKVWVKSDRHLLRRIIQNLVGNAFRYASPGKVLLGARVFNNQVIIQILDN
FT                   GPGIPVEKQVLVFEQFTQLNTPNNHAGRGLGLGLNITQSLAQLLGHTLSLQSKTMQGCK
FT                   FSVQVEQAEPLVQSRIVNNPSFIVALKDITVLCIDNDPDVLSGMVELLSAWQCNILAAD
FT                   SRETALEEFANHSNEIDILLVDYQLGYQTDDPQGKQVDGLTLISDLRSQCHHSLPAILI
FT                   TATTEPGIEDKARSLDVGYMRKLVKPAALRAMMSAMLAKKLQADYVGYS"
FT   gene            72137..73672
FT                   /locus_tag="CPS_0069"
FT   CDS_pept        72137..73672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0069"
FT                   /product="putative FG-GAP repeat lipoprotein"
FT                   /note="identified by match to protein family HMM PF01839"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26253"
FT                   /db_xref="GOA:Q48AX3"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX3"
FT                   /protein_id="AAZ26253.1"
FT                   /translation="MKKPLLLNNKTLFALLVTLSCVMSSPALAKKSKAVEFNEVVINSP
FT                   FKLTQEIIAADVLPSKGKELVTFSIDEQSNRWLIIYQLDHTANQYVVAEKIIVPKAFYR
FT                   FDLSKQTDEKQQSIYFLSTDSLFQYQTNKFKRLAKIESLYIQEQADFISRGDFIQDLNN
FT                   DAFDDVVIADFNKTHVFIGQGLNTFAKQTLPIMPSVRVLSAGASYTETKLYFSDVNFDD
FT                   KTDILVVGDGEMLVYSQYGASYFTKEATSITINKAISGTEWWNKRDESGEQLDQSDLEY
FT                   RKIEELRDVNADGMTDMVVRYTKTSGVLDRVNDYEIFLGNKNQGMLGYAQEADSVIHAE
FT                   GTLTGLEFVDINNDDKLEVLLAGFDIGLSQIIGALVTGGIDQDVYVFKMNKEDKFPTRP
FT                   AIKKGVELTFSLTSGQSGSAIVKLADLNGDGLKELVLSDDDDELKIYLGIKTNKKKKSF
FT                   KKRSVSYDTQLPKDGNLVMVEDLNGDGKDDLLMKFSRLDGEDKAKQFKVLFSQ"
FT   gene            73721..73927
FT                   /locus_tag="CPS_0070"
FT   CDS_pept        73721..73927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:1536827"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24613"
FT                   /db_xref="GOA:Q48AX2"
FT                   /db_xref="InterPro:IPR021948"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX2"
FT                   /protein_id="AAZ24613.1"
FT                   /translation="MKQAICGYHQDEEHHWVAQLACGHFQHVRHNPPFTNRPWVISLKG
FT                   RQGMLGHLLKCKKCDEAAPKDKL"
FT   gene            complement(73992..75203)
FT                   /gene="hemY"
FT                   /locus_tag="CPS_0071"
FT   CDS_pept        complement(73992..75203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="CPS_0071"
FT                   /product="hemY protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25445"
FT                   /db_xref="GOA:Q48AX1"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX1"
FT                   /protein_id="AAZ25445.1"
FT                   /translation="MIRIIIALIIFFSVMAISPFLIDEKGYILIAMGNTTIELTVLSAG
FT                   IMLTLLFIALVISLKLLRGGLNISFGTWNKLAFAGQRRGIANFNKGLAAYMLEDYSQAE
FT                   ALFAKSAIPSKRKQSAYLLAASASAKLDLNSNTNHYLALLEKETVKLKDVGLESVIVNI
FT                   KLLMNQDKTETYAKARALIDENHKQIGHDARLLALEIDLCIIEQRFAQAVQYIAAARKE
FT                   KTILDETVQTWEQLAYYGSFNESIKQHDSEVLHDNWNGLSRKVKQREAVLFAYCKVLTE
FT                   NEITEPLNKLLVPLFKKSPSGDFLKQIRNLPIKRADELIAIVQKQLHKNIHSGKWLSCL
FT                   GHLAMKSEQYSMAEKAFGSLLKLEDTEYGTQYDRQDLQAFAQVHSKQGQFQAADALWSK
FT                   ANSL"
FT   gene            complement(75200..76618)
FT                   /gene="hemX"
FT                   /locus_tag="CPS_0072"
FT   CDS_pept        complement(75200..76618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemX"
FT                   /locus_tag="CPS_0072"
FT                   /product="putative uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="identified by similarity to SP:P09127; match to
FT                   protein family HMM PF04375"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24325"
FT                   /db_xref="GOA:Q48AX0"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AX0"
FT                   /protein_id="AAZ24325.1"
FT                   /translation="MEYRIMSDNEVPKNTLSDNSDTEKKQDATLPPSSTANKTSATEND
FT                   NADTKKATLSKPEPKKSTASAGARKPSPSNTQETADKPSNKTAIIALVIASVSIFASIG
FT                   HYVWQQQQSSAQLLTLNQQNQQAIQQSQAQLKNSLTAEFSRQLQQQHRTTSQSQESAKK
FT                   AHLDSDTQLQQLTTQIRQLEQQVSLRQPNDWLIHEAEYLVRVAARTMWLERDTKAAINL
FT                   LRDADNRLKELDQPKFLPVRALINEDIESLALMPTLQNQEAILTLMALNKQVPTLMLAG
FT                   VNLTEALDQTTEDLALSDNIGDWQENLAKTWHKFLNDFITVRRRTGMVEPLMAPDQQQH
FT                   LKQNLSLKIQLVQWAASEQKEEIYQQTLLDIQQWLNEFFDMNSPVNKRFYQSIEQLKQQ
FT                   TIHYDYPSDLRSLAAIKRLLQDSKQVTKPQTSKSKSVKVEQTEKQVVEQLAEPSSAPKD
FT                   SPKPESEKASGGQL"
FT   gene            complement(76642..77403)
FT                   /gene="hemD"
FT                   /locus_tag="CPS_0073"
FT   CDS_pept        complement(76642..77403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="CPS_0073"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by similarity to SP:P09126; match to
FT                   protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26108"
FT                   /db_xref="GOA:Q48AW9"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AW9"
FT                   /protein_id="AAZ26108.1"
FT                   /translation="MPVKPLKVLITRPKAKAQQLALLLNQQGILNTSQTLFDYQKNASA
FT                   NDIATALENADILIFVSVAAVEFAHASYPLPNNLSQTIFAVGNATKKALQAIGMTTILS
FT                   PPPQQEHSEGLLKLPQLSKVIGKRIIIFRGNGGREHIANSLTLRGAEVRYIESYQRVWR
FT                   TLPIIIAEQWRAQKINCIVVTSNDILLALLKYLASTTNSTDNYWQSQCLWVVVSDRIEK
FT                   NAKALGLKRVINTHGASSQILCNTLQALSCS"
FT   gene            complement(77468..78421)
FT                   /gene="hemC"
FT                   /locus_tag="CPS_0074"
FT   CDS_pept        complement(77468..78421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="CPS_0074"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="identified by match to protein family HMM PF01379;
FT                   match to protein family HMM PF03900; match to protein
FT                   family HMM TIGR00212"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24707"
FT                   /db_xref="GOA:Q48AW8"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AW8"
FT                   /protein_id="AAZ24707.1"
FT                   /translation="MNNTTVRIATRKSALALWQAEYVKAQLEHFHDGINVELVPMTTKG
FT                   DIILDTPLAKVGGKGLFVKELEVAMLEDRADIAVHSMKDVPVDFPEGLGLEVICPREDP
FT                   RDAFVSNTIKSLSDLPQGSIVGTSSLRRQCQLKASRPDLDIRDLRGNVNTRLRKLDEGQ
FT                   YDAIILAAAGLIRLEMSERIAQFIEPEEMLPANGQGAVGIECRNDDATIKALLAPLECA
FT                   TTRIRVLAERAMNRALQGGCQVPIGSYGVISADGKNIHLRGLVGSVDGSEMIESEITGP
FT                   VEEGEALGNKLAQELLSRGADKILQQVYSENDIKNS"
FT   gene            complement(78446..78766)
FT                   /gene="cyaY"
FT                   /locus_tag="CPS_0075"
FT   CDS_pept        complement(78446..78766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="CPS_0075"
FT                   /product="cyaY protein"
FT                   /note="identified by similarity to SP:P27838; match to
FT                   protein family HMM PF01491"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24018"
FT                   /db_xref="GOA:Q48AW7"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AW7"
FT                   /protein_id="AAZ24018.1"
FT                   /translation="MNDSQYNLIAEALLLAIEEAIEDSGVDIDYEGVGGLLTLTFKNNS
FT                   KVIINKQAPLHEIWVATKFNGHHFVLNNDSWTDKRSGEEFWQFLSNAVSTQAETELTLS
FT                   AQ"
FT   gene            78921..79259
FT                   /locus_tag="CPS_0076"
FT   CDS_pept        78921..79259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SS02679"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28119"
FT                   /db_xref="GOA:Q48AR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AR9"
FT                   /protein_id="AAZ28119.1"
FT                   /translation="MRTNRLHYLHQKLHQKLKLKSILLTFVAVTFLSACGIKGDLYQTP
FT                   EQAVTSKTETVAQSDESQEKSISKSVESQDKSVTTLDESQKKQAVQQPIEQIEQATNQS
FT                   TDQVKEQQ"
FT   gene            79259..80089
FT                   /gene="dapF"
FT                   /locus_tag="CPS_0077"
FT   CDS_pept        79259..80089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="CPS_0077"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by similarity to SP:P46357; match to
FT                   protein family HMM PF01678; match to protein family HMM
FT                   TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24959"
FT                   /db_xref="GOA:Q48AR8"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AR8"
FT                   /protein_id="AAZ24959.1"
FT                   /translation="MLVNFSKMHGLGNDFLVLDNVTQNVFLSPEQITKFANRNFGVGFD
FT                   QLLVVEPPYDPDLDFHYRIYNADGSEVGQCGNGARCFAKFVRMKGLCNKHKIKVSTSTG
FT                   KMNLHIERDGNISVTMPVPQFEPKKIPFTAQKTEGTYILRSESETVLCGAVSMGNPHCV
FT                   VTVDSVAEADVESLGKELSVHERFPEDANVGFMEIVSPNYIKLRVYERGAAETLACGSG
FT                   ACAAVVIGYMQKKLAKQVTVELPGGKLRIFWQGPGHPVKMSGPATHVFDGQISI"
FT   gene            80150..80842
FT                   /locus_tag="CPS_0078"
FT   CDS_pept        80150..80842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO4307; match to
FT                   protein family HMM PF04340"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26863"
FT                   /db_xref="GOA:Q48AR7"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AR7"
FT                   /protein_id="AAZ26863.1"
FT                   /translation="MNDVQQAINSDDIPLTDELVVSYLQDNPEFFNRNNSLMTGLRLND
FT                   EQRGTVSLVERQQQQLRQKVYGLEDEITQLMSVANHNEQLFVLYSDLYLRLLDCQSAEE
FT                   LLDCLHQATTELLSLSSFKLWLVSGNNTEVAHHSLSTNDCAGVMQNRLTNDEYYFGRLQ
FT                   ESEQTLIFSKPCLGSVVLIKLTHDEQAVGFLAIGSEDAHHFDPRMDTLLLNQFKRLVAK
FT                   LLHQQLSM"
FT   gene            80867..81640
FT                   /locus_tag="CPS_0079"
FT   CDS_pept        80867..81640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0079"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1 family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28734"
FT                   /db_xref="GOA:Q48AR6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AR6"
FT                   /protein_id="AAZ28734.1"
FT                   /translation="MQFYRRLTAIKAISFDLDDTLYNNRPIMQSVEQQMAHYFTEKFAI
FT                   LLPELLVEPKQVFNRRFWAPYRQQAIKAHQDISHDVVRLRFESYRLGLLAHNLSAEAAR
FT                   KEAQAGLDYFINLRSDFTVPKESHELLASLSKAFPLVSISNGNVDTRALGIDHYFQHIY
FT                   HAGFQTGNCHDESEHLLKQKPETDMFSLVCQQLDILPEQLLHVGDCGFADIHGALNAGC
FT                   QTAWLPQYGVGKSLQQIPHIELSLVSDLSQLIRKA"
FT   gene            81800..83974
FT                   /gene="uvrD"
FT                   /locus_tag="CPS_0080"
FT   CDS_pept        81800..83974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="CPS_0080"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01075"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25218"
FT                   /db_xref="GOA:Q48AR5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AR5"
FT                   /protein_id="AAZ25218.1"
FT                   /translation="MDVSELLDSLNDKQRDVVAAPKQNMLILAGAGSGKTRVLVQRIAW
FT                   LMQVEGISSHSILAVTFTNKAAAEMRARVEQVTNGNTHGMWIGTFHGLAHRLLRMHFQE
FT                   ANLPQSFQVLDSDDQLRLIKRIVRSLELDEKKWPPKQFVWYINGKKDEGLRPQHIDAQF
FT                   DPTEELFVKVYKAYQETCDRAGLVDFAELLLRAHELWLKNPALLDHYQQRFGHILVDEF
FT                   QDTNAIQYAWLTMLGKARSKVMIVGDDDQSIYGWRGAKIENIERFLQEYDDAKTIRLEQ
FT                   NYRSTANILKSANQLICNNNNRMGKELWTDGEAGEKISIYTAFNEIDEARFIAGRIKQW
FT                   RDDGGKLDEIAILYRSNAQSRLLEEALLQGQLPYRIYGGQRFFERQEIKDALAYMRLIN
FT                   NRDDDAAFERVINTPTRGIGNQTLSLVRDAARGLEVTMWQACQQMLKAEQLKGRGAKTI
FT                   TAFIQLIEQLEDDTTNLDLDQQANFIINHSGLKAMYQAEKGERAAQRIENLNELVTACQ
FT                   TFESDPELAEEQTPLTAFLTHAALESGESQADEFEAAVQLMTMHSAKGLEFPLVFIAGL
FT                   EEGMFPSQQSVEEIGRLEEERRLCYVGMTRAMSKLYLCHAESRRLYGQEKFHKASRFLR
FT                   ELPEDCIEEIRMQSQVKRPSKVGKFSNTFTLETFENTGFKLGQQVKHAKFGEGVVLNYE
FT                   GSGAQSRIQVNFADVGSKWLVVEYANLQAV"
FT   gene            84067..85326
FT                   /locus_tag="CPS_0081"
FT   CDS_pept        84067..85326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0081"
FT                   /product="response regulator/GGDEF domain protein"
FT                   /note="identified by similarity to GP:27361327; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00990; match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24911"
FT                   /db_xref="GOA:Q48AR4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AR4"
FT                   /protein_id="AAZ24911.1"
FT                   /translation="MSQRLLIVEDSKPIATVIKQIARSLKFEVVIATDLAQVENILSTD
FT                   TDFFAATIDYALPDTLDGEAIACVLSHGIPSIVMTGKMDDETRQKILSQPVIDYIPKEN
FT                   SQAFLYLKRVLHWQQTNNKNTILVVDDSSSARNHIVELLKRRNFNVITANNGVQALEKL
FT                   AQHKNIKMVITDLEMPAMDGIELTNEIRRVYTREQLAVIGISGASNGIHSARFIKNGAD
FT                   DFLRKPFCPEEFYCRITQNIESLNNIAKIQHAANTDYLTDLANRRAFFRSAESRIKEYI
FT                   NKKVPYCLAMIDVDFFKKVNDTYGHDSGDQVLKVIALYMRKHFGAGLTARLGGEEFAVL
FT                   LHGLDADYLHNKLDDFRREIAVSSIPAGDTSISITLSLGVVFDSEDELSKQMNEADNAL
FT                   YAAKENGRNQIVVFGAELDD"
FT   gene            complement(85484..86386)
FT                   /gene="rarD1"
FT                   /locus_tag="CPS_0082"
FT   CDS_pept        complement(85484..86386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD1"
FT                   /locus_tag="CPS_0082"
FT                   /product="rarD protein"
FT                   /note="identified by similarity to SP:P27844; match to
FT                   protein family HMM PF00892; match to protein family HMM
FT                   TIGR00688"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27884"
FT                   /db_xref="GOA:Q48AR3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AR3"
FT                   /protein_id="AAZ27884.1"
FT                   /translation="MSASAINQLEENSNRNGALSALSAYLLWGFAPIYFKLLTAIEPGE
FT                   IMMHRVIWSTVFLLVMIIVMKKWSQLVAIFQQPKILLQLSLSASFLAVNWFLFIWAVNN
FT                   NHLLDASLGYYINPLFNVILGMIFFHERLRRNQLIAVGLALVGVLVQLIALGTLPIISL
FT                   ALASTFAIYGLIRKKLPINSFIGLFIESLMMLPIALIYWFFFVESSTSNMAINAASLNF
FT                   TLIMAGIVTTAPLLFFTIAAKRLALSTLGFFQYLGPSIMFLLATFYYQETMKSAELITF
FT                   VFIWAALALYSLDSFKKRT"
FT   gene            86632..88479
FT                   /gene="recQ"
FT                   /locus_tag="CPS_0083"
FT   CDS_pept        86632..88479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="CPS_0083"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM TIGR00614;
FT                   match to protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28429"
FT                   /db_xref="GOA:Q48AR2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AR2"
FT                   /protein_id="AAZ28429.1"
FT                   /translation="MNSSVANAQTSAEISTELSAENNALLLDTLKHYFGYESFREGQAK
FT                   IINSLLQGQDSLVLMPTGGGKSLCYQLPAVLLPGVTVVVSPLIALMKDQVDGLTRQGIS
FT                   AAFINSSLEQSEISDIFARLGRGEIKLLYVAPERLTNYYFLQSLNQLPLSLFAIDEAHC
FT                   ISQWGHDFRPAYTKLQCLKQNFPTVPVMALTATADVTTRKDILNQLALPNPYIHLDSFD
FT                   RPNIRFTLAPKYNGEKQLLGYIKKKGEDSGIIYCNSRWQVEKLAKYLAASGINCAAYHA
FT                   GLENEIRSLVQEGFTKDNIQIVIATVAFGLGINKPNVRYVIHFEPPRTLESYYQEIGRA
FT                   GRDGLNAEALFLVDDKDVARIKKRISEGDNPQRVNVEMQRFAAMDAFIDAQTCRRQVVL
FT                   NYFAEYTEKGCGNCDICLDPPSQFDGTIEAQKVLSCVYRVEQQGDINHVIAVLRGELTE
FT                   KVKQLAHDKVSTFGIGKGKTVGYWFSIIGQLIHLGYLQQDIEQQSILCLTQASGVVLKA
FT                   QEPLMLASPRLQKASYWQEKSPQKSYDRVLFAKLRELRKAIADGEDIAPFIVFNDATLS
FT                   ELARIKPKTSREMLSISGIGDVKLSRYGQPFLALIKEHK"
FT   gene            88771..88884
FT                   /locus_tag="CPS_0084"
FT   CDS_pept        88771..88884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27143"
FT                   /db_xref="GOA:Q48AR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AR1"
FT                   /protein_id="AAZ27143.1"
FT                   /translation="MIEENGYSLVKINNAACMPFKLALRELISKLITSQNE"
FT   gene            complement(88978..89085)
FT                   /locus_tag="CPS_0085"
FT   CDS_pept        complement(88978..89085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0085"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25672"
FT                   /db_xref="GOA:Q48AR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AR0"
FT                   /protein_id="AAZ25672.1"
FT                   /translation="MGCCGGCGGEGHDEKKEQEQAQDKSTEQTEAAEKE"
FT   gene            complement(89242..91413)
FT                   /locus_tag="CPS_0086"
FT   CDS_pept        complement(89242..91413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0086"
FT                   /product="prolyl endopeptidase"
FT                   /EC_number="3.4.21.26"
FT                   /note="identified by similarity to SP:P27028; match to
FT                   protein family HMM PF00326; match to protein family HMM
FT                   PF02897"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24022"
FT                   /db_xref="GOA:Q48AQ9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ9"
FT                   /protein_id="AAZ24022.1"
FT                   /translation="MKKQSLFLTSILVTSVLAGCTGNSVEQTSDKVAAAQKQTQKISYP
FT                   VTKKGDVVDTFFGTDVADPYRWLEDDRSEETGAWVKAENKVTFDYLSQIPYRGQLKSRL
FT                   AELWNYEKVGAPFKKGDYSYFYKNDGLQNQYVVYRQKEGGTAELFLDPNTFSEDGTTSM
FT                   GQLSFSKDGSIAAYAISEGGSDWRKIIIIDVETKKVLETPLIDVKFSDISWFKNEGFYY
FT                   SSYDKPEGSELSAKTDQHKLYYHVLGQPQKEDKVIFGNTAEQKRRYVGGTVTDDNRFLL
FT                   ISGAISTSGNDLYLKDLTKPNSPLLTITDNFDADTYVIENEGDKLFLVTNLGAPNKKIV
FT                   TVNAKAPASKNWTDFIAETDYVLSASTGGGFFFTEYMVDAISKVYQYDYQGKQVREINL
FT                   PGVGSASALEGDKDESTLYYSFSNYKTPGTIYSYNIDKGNSDVYRKSGAKFDSDAYESK
FT                   QVFYPSKDGTKVPMIITYKKGIELNGKNPTILYGYGGFNISLTPRFSVSRAVWLEQGGI
FT                   YAVANLRGGGEYGKTWHKAGTQLDKQNVFDDFIAAGEYLIKQDYTSSDYLAINGGSNGG
FT                   LLVGAVMTQRPDLMQVALPAVGVLDMLRYHTFTAGAGWAYDYGTAEQSEEMFTYLKGYS
FT                   PVHNVKAGVSYPATMVTTGDHDDRVVPAHSFKFAAELQAKQAGNAPTLIRIETNAGHGA
FT                   GTPVSKTIEQYADIYAFTLFNMGFTALPK"
FT   gene            complement(91611..93935)
FT                   /locus_tag="CPS_0087"
FT   CDS_pept        complement(91611..93935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0087"
FT                   /product="fatty acid cis/trans isomerase"
FT                   /note="identified by similarity to GP:5257178; match to
FT                   protein family HMM PF06934"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24945"
FT                   /db_xref="GOA:Q48AQ8"
FT                   /db_xref="InterPro:IPR010706"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ8"
FT                   /protein_id="AAZ24945.1"
FT                   /translation="MEFDKLYGPSNVENRLVQVKATTAEAIHFNRQIQPIIENRCVVCH
FT                   GCYDAPCQLKMESRAGIERGANKAMVYNGERLLTANISASLTKLTELKRDNLEPLRQQG
FT                   YFPVLNERQQTEQANTQSSLFYQMLQLKKQHPLPSEPILNESFDVALDRSQQCPTIEEF
FT                   EQYKDKYPLGGMPYALPALSTTEHDQLTDWIARGAIMPDSVPPNAKEQQMINRWEKLLN
FT                   GSSAKEQLIARYLFEHLYLANLYFDKAQSSYFKLVRSSSPSGEKVAVITTRRPFDSPYA
FT                   DGSTDAIVDKPQVYYRLIKHNDTIIAKRHMPYPFGESKLARISELFYQPDYPVTTLPDY
FT                   QLANASNPFKTFQAIPDKARYQFLLDQAQFSIMNFIKGPVCRGQIALNVIEDNFWVFFL
FT                   SPNNFDHYPSEQFIKANTELLQLPAGTSDKSLSLLYWRQYAKSQQEYVKNKLAYVEGLN
FT                   LQPNQLNLDLIWSGKGNPNASLTVFRHFDSASVLQGFVGPTPKTAWLISYPLLERIHYL
FT                   LVAGFDVYGSVSHQLKTRLYMDFLRMEAESNFISFLPKDERKAIHEYWYRETGDDIKDY
FT                   IFSDGFYQLPETGMNYQSNKHQEELFQLVGQHTKNTNVSQFNLSSLAQSSADKIIANLS
FT                   QLPNESVALLPQVSYVMVSNGDDNQVYSLINNSAHSNVAHLFSEENRRLPREDNLAILR
FT                   GVVGTYPNAFFKVEQAQLSEFVSNLNAIKTEQDYRKLKDQFAIRRTNPKFWIFADELHA
FT                   WYKTNQPKSAGLLDFNRLENR"
FT   gene            complement(94117..94533)
FT                   /locus_tag="CPS_0088"
FT   CDS_pept        complement(94117..94533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0088"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28427"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ7"
FT                   /protein_id="AAZ28427.1"
FT                   /translation="MITLEHINLVVKDIEKSLQFYRAAFPHWHVRGGDKGEWSGKPRNW
FT                   LHFGDDYQYIAFADNGVGDNRDLAGHQVGLAHFAYVTSDLKGTIARIEKAGFAIHKDGT
FT                   PDKYRENIYFLDADGYEVEFVQYHTDLPELRNRY"
FT   gene            complement(94589..94999)
FT                   /locus_tag="CPS_0089"
FT   CDS_pept        complement(94589..94999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0089"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27373"
FT                   /db_xref="GOA:Q48AQ6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ6"
FT                   /protein_id="AAZ27373.1"
FT                   /translation="MNLNQVTLTVLNMDESTEFYRRLGFLHIVDTPHYARFACPDEGAT
FT                   FSLSLAETDSLSNTQNKLSSGTTIYFEHEKLDEWVATVQSRGIEFEQLPISQSYLWREA
FT                   ILTDPSGNKIKLYWAGENRLNPPWRVEKKYQE"
FT   gene            complement(95064..95696)
FT                   /locus_tag="CPS_0090"
FT   CDS_pept        complement(95064..95696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO3585"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28223"
FT                   /db_xref="GOA:Q48AQ5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ5"
FT                   /protein_id="AAZ28223.1"
FT                   /translation="MNLLIISASQRIESQSAKVAKYLTNSSNKFRKTSHIELCKQRLPL
FT                   WDGEESSKQNDNSDWLAINSQLQTMDALILITPEWGGTASPLLKNLLMMSDAADIGHKP
FT                   VLLVSVVNGISGAYPIAELRMNAFSNNKLVAIPDHLIIRNVEEILNTVNETNLQQSIAI
FT                   ARRDKRIRHRIGYSLHTLLHYSQAMKSLRETLQVSTYDNEHLYQYGM"
FT   gene            96139..96756
FT                   /locus_tag="CPS_0091"
FT   CDS_pept        96139..96756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO3584"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24069"
FT                   /db_xref="GOA:Q48AQ4"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ4"
FT                   /protein_id="AAZ24069.1"
FT                   /translation="MKTHEKIIQLLKTQGPLTAKILASELGLTTMGIRQHVQGLEDSGD
FT                   VVFKDEKAARGRPTRYWSLTDKGNSRFADRHDELTVQLLDSVITLFGDDGMEKLISHRE
FT                   ETAMTNYTLALADRYGVQEKLQTLAKLRSDEGYMASVEEHDGIFWLMENHCPICAAASK
FT                   CLSFCRSELQMFQTLMNDIAVVSREEHIIDGARRCAYKVIPV"
FT   gene            complement(96846..98627)
FT                   /locus_tag="CPS_0092"
FT   CDS_pept        complement(96846..98627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0092"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:TM0385"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25470"
FT                   /db_xref="GOA:Q48AQ3"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ3"
FT                   /protein_id="AAZ25470.1"
FT                   /translation="MLRLNEEQITNKKDFIKQYFSAKNAADGSKMDANANVSHKNIATL
FT                   EAELLKDCFVQINRALVHDKIRDTFDADLAKEYLRQIEDHEIYVHDETSLKPYCTSISM
FT                   YPFLLDGLTKLGGESKAPKHLESFCGSFVNLIFAISAQFAGAVATVEFLTYFDYFARLE
FT                   YGNDYLSTHKSEIENHLQHVVYAINQPAAARGYQSVFWNISLFDQHYFASMFGEFVFPD
FT                   FSKPNWQTVDQLQQFFLGWINKEREQAVLTFPVVTAAMLTENGQCKDLDFARKLAQQKA
FT                   EGNSFFIYLSDSADSLASCCRLRNEISDNTFSYTLGAGGVATGSINVITVNMNRLVQDG
FT                   RDLKTEIEKIQKYQVAYRKLMQEYQAQGALSVYDAGFISLDKQFLTIGINGMAEAAEFA
FT                   QIKVGNNEEYKQFVSTHLKVIYQANQAAKKEFGYMFNTEFVPAENLGIKNAKWDKKDGY
FT                   QVSRECYNSYFYVVEDEATNHIDKFVMHGQEMTQYLDGGSALHLNLDESLSTDAYLKLF
FT                   NVAAATGCNYFCINVKITICNECDKIDKRTLHLCSSCGSENIDHGTRVIGYLKRVTAFS
FT                   QGRQKEHALRHYHTESA"
FT   gene            complement(98614..99234)
FT                   /locus_tag="CPS_0093"
FT   CDS_pept        complement(98614..99234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26028"
FT                   /db_xref="GOA:Q48AQ2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014191"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ2"
FT                   /protein_id="AAZ26028.1"
FT                   /translation="MTFNCITPSVVFQEVPNEISLCFSITGCKVGCKGCHSTELWQEDN
FT                   GVLLTNTNFTQWLKKYQGLISCVVFFGGEWQANALIEKLIIAKNHGLKTCLYSGEKHID
FT                   INISQHLNFLKTGAWHETLGGLDSPTTNQVFRNVISGEKLNHLFNKAIDVNTFKVNTVD
FT                   ASHSQTTILETNSFKTNSLETSAFEISTFEPYQFTQGANNVAA"
FT   gene            complement(99529..100497)
FT                   /locus_tag="CPS_0094"
FT   CDS_pept        complement(99529..100497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0094"
FT                   /product="membrane protein"
FT                   /note="identified by similarity to GP:29895288; match to
FT                   protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26846"
FT                   /db_xref="GOA:Q48AQ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ1"
FT                   /protein_id="AAZ26846.1"
FT                   /translation="MTVTSPRIATILLLIVCFIWGVEFVPIDLAIEVMPTNTFNAIRFA
FT                   VATLSMLPLLWFVQKKNKGNSKPIDYVLLIRSGMLLGFFLFIGFYTQTEGMRFTTVTNA
FT                   GFITGLCVPLVPVLGFLIFRNVVPKSVWIGVVTATAGLYMLTIGDKLVFNKGDILVLIC
FT                   AFGFAGHIIMTDRFVDNLPIIPLSIVQIFAVSIYSTIAIFIGPDPVFYYQDAEPVSWYQ
FT                   QLFTPLMIFAILVSGILGTAYAFWAQSVSQTLLKPHKVALIFAAEPVFACIAAWVFLDE
FT                   VLGEKGMIGAGLILAGMLVSELGDRKKQPELRALDQTAALK"
FT   gene            complement(100869..102281)
FT                   /locus_tag="CPS_0095"
FT   CDS_pept        complement(100869..102281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0095"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02SC5439"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27474"
FT                   /db_xref="GOA:Q48AQ0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AQ0"
FT                   /protein_id="AAZ27474.1"
FT                   /translation="MMKQHLDALKDSKYCPLWHDQDIRPETLPALSADTSCELLIVGGG
FT                   FTGLWGALQAKERQPDADIILIEKTTISDGASGRNGGFLSSSLAHGETNTDHQFPGEAD
FT                   KLHQLGQQNLKEFIETLEHYNIDARYEKVGETSVATDQASVDALRATYESEKAQGEDVV
FT                   WFNQEEMQAQVNSPTYLAGLWYRGGQDGVVDPARLCWGLKRVILELGVRIYEETPLTSL
FT                   KKLGQDKMEVTCSDVKIISDKVLMATNAYRNPIGQARRSIIPVWDYQIATQPLSQEQLD
FT                   SIGWHKSRHALSNHANMFHYYRFTKDNRITWGGGGAVRYYFNNGIDQSYADIPERFAQL
FT                   SEEFFETFPQLKGIKFTHRWSGIIATSTRFCVVPGVAYDGRVAWAIGYTGLGVGASRFG
FT                   ARIGIELLGYKPSEILDMQFVKKKPIPWAPEPLRWIGVYLTHKALEKADANGGKRGLWL
FT                   KLLDMLNLGFTC"
FT   gene            complement(102338..103813)
FT                   /locus_tag="CPS_0096"
FT   CDS_pept        complement(102338..103813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0096"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /note="identified by similarity to SP:P71016; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28154"
FT                   /db_xref="GOA:Q48AP9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP9"
FT                   /protein_id="AAZ28154.1"
FT                   /translation="MNNKHYINGTWVSPATSETFSVINPATEAVIAEIPAGNSVDIDAA
FT                   VKAARTAFDQGPWPRLSGAERAVYLRKIAAIIIRRLDELAKLEVLDNGKPYPEAKWDIE
FT                   DTAATFEFYAGLAEQLDNTSEQVIELPEPGFSSKAIKEPLGVAGAIIPWNFPMLMAAWK
FT                   VAPALAAGCSIILKPSEITPLTALALAEIADEAKLPAGVLNIVTGLGKDAGQALVEHPD
FT                   VDKLAFTGSIPTGSKIMATAARDIKNISLELGGKSPFVIFEDSDIEKAVEWIMFGIFWN
FT                   QGQVCSATSRVLVAKEIYPALLERLVEETKKITIGPGDQDGVLLGPLVNSDQYKKVLAA
FT                   IERGVSDGATIATGGQRPPGLDVGYYLEPTILTDIDENSWVWNEEIFGPVVCIKPFQSE
FT                   SEAIRLANDSRFGLAAAVMSKDEDRCDRVSRAFRAGIVWVNCSQPTFVEAPWGGYKQSG
FT                   IGRELGQWGLNNYLETKQITRFNSSEPWGWYLK"
FT   gene            complement(103871..104653)
FT                   /locus_tag="CPS_0097"
FT   CDS_pept        complement(103871..104653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0097"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28747"
FT                   /db_xref="GOA:Q48AP8"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP8"
FT                   /protein_id="AAZ28747.1"
FT                   /translation="MSNQKIIRLSPNPQDFGHDCDDLDPQMFASELPVQHTHVYYEDDN
FT                   LGLYIGVWDTSTMVEAAAPSPCDEFMYLLEGEVEIKNSKTGTMEKVQAGEAFVIPKGYD
FT                   CQWHQTGYLRKFFVISEHPKEDIPTTPVVEGIIKLKVNNSSQMAIEDSTGVEIEPTNTP
FT                   FVIKGKEPAQKHLPSYKDHTGKFIAGTWHSEAFNSEMQPFPRNEFIYLQSGSLVITEQE
FT                   GDEQVFTAGDAFFVPQGALCSWRSIGDVHTFYAILQSS"
FT   gene            complement(104755..106251)
FT                   /gene="mmsA1"
FT                   /locus_tag="CPS_0098"
FT   CDS_pept        complement(104755..106251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA1"
FT                   /locus_tag="CPS_0098"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24206"
FT                   /db_xref="GOA:Q48AP7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP7"
FT                   /protein_id="AAZ24206.1"
FT                   /translation="MNEVNVIGHLINGEMVNDDVRTQAVFNPATGAAEKKVALASKQTV
FT                   EQAISAAQTAFPAWRNTPAIKRARVMFRFKELLEQHADTICRLIGEEHGKISHDAAGEL
FT                   QRGIENVEYACGAPELLKGEHSKNVGPNIDCWSEFQPLGVVAGITPFNFPAMVPMWMFP
FT                   LAIVCGNCFILKPSERDPSSTLYIAQLLKEAGLPDGVMNVVNGDKEAVDVLLSDERIKA
FT                   VSFVGSTPIAEYIYATANANGKRCQALGGAKNHAIIMPDADMDNAVNQLLGAAFGSSGE
FT                   RCMALSVAVAVGDEAADALVEKMTEAMKNLSVGAHDKASNDFGPVITQAHKDKVEGYIT
FT                   SAQNQGATIVVDGRQPHVEGYENGFFVGATLIDGVTADMDSYVAEIFGPVLQVMRVKTM
FT                   QEAMQLINDHEYGNGTCIFTRDGEAARYFSDNIQVGMVGINVPLPVPVAYHSFGGWKRS
FT                   LFGDLHAYGPDGVRFYTKRKTITQRWPSSGVREGASFAFA"
FT   gene            complement(106294..107631)
FT                   /locus_tag="CPS_0099"
FT   CDS_pept        complement(106294..107631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0099"
FT                   /product="omega-amino acid--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.18"
FT                   /note="identified by similarity to SP:P28269; match to
FT                   protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28690"
FT                   /db_xref="GOA:Q48AP6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP6"
FT                   /protein_id="AAZ28690.1"
FT                   /translation="MNNNQTKHGITQAQLDAHWMAFTGNREFKKDPRIIVSAQGNYYTD
FT                   ADGRKIFDGLSGLWCCGAGHSRPEITEAVSKQLKQLDYAPAFQFGHPKAFQLAEKIVEF
FT                   MPKGINRVFYTGSGSEAAETSLKMARAYWRKKGLASKTKLIGRGLGYHGVNFGGISVGG
FT                   IGANRSLFGPAVDADHLRHTMLDENKFVKGQPQTGVELANELLDLVALHDASNIAAVIV
FT                   EPMAGSAGVIPPPVGYLNRLREICDQHNILLIFDEVICAFGRMGANTGAEAFGVTPDII
FT                   NIAKQMTNGTIPMGAVIAKQEIYETFMEQGGPEYMVEFPHGYTYSAHPVACAAGLAALE
FT                   ILQTDKLIERVKDHSPYFEESVHNLKGCKHVTDIRSYGFAAGFTIDPVPGEPALRPYQI
FT                   AMKMWQKGFYVRYGGATIQLGLPFTSEREEIDSLLSALGETFNEIA"
FT   gene            107752..108672
FT                   /locus_tag="CPS_0100"
FT   CDS_pept        107752..108672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0100"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by similarity to SP:P77559; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28137"
FT                   /db_xref="GOA:Q48AP5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP5"
FT                   /protein_id="AAZ28137.1"
FT                   /translation="MNNIKNILPHRLGDSHIRILRIFKAVIESGGFAAAEAELNISRPA
FT                   ISNAMSELESLLNMRLCHRGRTGFSITEQGEHVYNATLQLLGSLDTFKSQINAINTKLV
FT                   GDLNIGITDNLVTNPQMRITRSLSTFKHRAPEVIFNIQMMPPYDIENAVLEGQLHIGVV
FT                   PDLRALSGLNYLPLYKEKSLLYCSAQHPLFNQDLNTISDYALEKYDAVLPCYPQPADIK
FT                   QQQKRFKGSATSTDREGIAFLILTGRFIGFLPTHFAERWVVQDLLRAIEPHKRNFYTNF
FT                   SAITRKGARPNLITEAYLEELQKTA"
FT   gene            108699..108839
FT                   /locus_tag="CPS_0101"
FT   CDS_pept        108699..108839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0101"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27620"
FT                   /db_xref="GOA:Q48AP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP4"
FT                   /protein_id="AAZ27620.1"
FT                   /translation="MNNHWFQIYTELLMPVVPKSRLMQNSLAFISAKLRTRVFFILFNN
FT                   D"
FT   gene            complement(109052..109183)
FT                   /locus_tag="CPS_0102"
FT   CDS_pept        complement(109052..109183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0102"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25276"
FT                   /db_xref="GOA:Q48AP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP3"
FT                   /protein_id="AAZ25276.1"
FT                   /translation="MTTCSSLALTLPTNIPALINAIAVTVAFLKSLIIYPFVASQIN"
FT   gene            109086..110195
FT                   /gene="potF1"
FT                   /locus_tag="CPS_0103"
FT   CDS_pept        109086..110195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF1"
FT                   /locus_tag="CPS_0103"
FT                   /product="putrescine ABC transporter, periplasmic
FT                   putrescine-binding protein"
FT                   /note="identified by similarity to SP:P31133; similarity to
FT                   GB:AAK15487.1; match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24631"
FT                   /db_xref="GOA:Q48AP2"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP2"
FT                   /protein_id="AAZ24631.1"
FT                   /translation="MRLFKKATVTAMALISAGIFVGSVSASEEQVVKMYNWSDYVAEDT
FT                   LENFRKETGIRVIYDVFDSNEVLEAKLLSGRSGYDIVVPSNSFLTKQIKAGVYSKLNRD
FT                   QLTNHSNLDPELMSKLQTADPGNQHAVPYLWGTNGIGYNVAQVKAALGDDAPTDSLELI
FT                   FNPKYAEKLGKCGLAVLDSPDEMIPQALLYLGLNPNSHKASDYKAAGKLLAEIRPHITY
FT                   FHSSRYITDLANGDICVAYGFSGDVFQAKARAEEAGNGHIIEYKIPKEGANLWFDMLAI
FT                   PKDAPNKENAHKFVNYLLRPDVIAGITNYVAYANGNVASTKLIDKEVRENPAIYPSDDV
FT                   INNLYIQEVRPLKAQRAMTRVWTGVKTGR"
FT   gene            complement(110265..111194)
FT                   /locus_tag="CPS_0104"
FT   CDS_pept        complement(110265..111194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0104"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24194"
FT                   /db_xref="GOA:Q48AP1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP1"
FT                   /protein_id="AAZ24194.1"
FT                   /translation="MTDPKTDKTETLTNTITDTAQQAVDLPAELLRHEIEQASAIYKIV
FT                   IDFFTNYSFQLIGALLIFLLGFYVAGKIAKTVLRLCEKHKLDVTLSRFIASTTKMVVMV
FT                   MISIMALSKIGISVTPFIAALGAISLGAGLALQGLLANYAAGFNIIIIRPFVVGDTIEV
FT                   QGVTGIVKEVQLAYTIIQNEDSAEITIPNKHIVGEVVLNSRKDTLLKLSVGISYQDNPI
FT                   EIVALVERTLAKLDIYTDEVRMQVGIDAFADSAINIGIRLWIPTTNLYAAKYSAYKAIY
FT                   LAFEEEKITIPFPQQDIHLIEPKSLKQA"
FT   gene            complement(111245..112414)
FT                   /locus_tag="CPS_0105"
FT   CDS_pept        complement(111245..112414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:27359325"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28579"
FT                   /db_xref="GOA:Q48AP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AP0"
FT                   /protein_id="AAZ28579.1"
FT                   /translation="MGNYLSLISFLFCSLFTLSAQGAEQKLTTEPAESLKKISTAPESN
FT                   NESAIILSEQQQNQCAQYCSEAKTNESYKQQVSDRQNPISSVGYELVIPEALPPRNRWS
FT                   DFLPFLGKEAREAGYLLPLPFGISLVGLTQEQPFTVSEIGLEIDGQQSELINDFIDNSI
FT                   SAKNLKVSDTTYNLRFDAWILPFWNVYGLVGKTKGKAELELDVDLELPTLLLAAAGIGS
FT                   GLNDKRCTSINLPFQGPAPGHCLVSAEGIPTTLNFHGTVLGYGTTIAGGYGDFFGMFDV
FT                   NYTEADINIAIEKSKQTVYSTRLGWNGSIGAFQGQIWLGAMKQDIKQQLAVSTPGNKVA
FT                   VLIDQHASSPWNYLIGAQWNITEEWAIIAETNLAFSDRQQFMMQLGYRF"
FT   gene            complement(112533..113198)
FT                   /locus_tag="CPS_0106"
FT   CDS_pept        complement(112533..113198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:28809591; match to
FT                   protein family HMM PF04337"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26005"
FT                   /db_xref="GOA:Q48AN9"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AN9"
FT                   /protein_id="AAZ26005.1"
FT                   /translation="MITLSAEQCRIIGVMLEKETTTPEQYPLSLNGITTGCNQKSNRDP
FT                   VMSLSESDVQNLVDELVQMNQLMVDQKASTRVNKYFHRFCDTEFGNLKFTPQQRAVICV
FT                   LFLRGPQTPGELRTRTNRLADFADVSEVDNTLTQLQDLNGLTLVRKLEREPGKRESRYV
FT                   HLLSDVDESSFTQAVTTQTEVVLSEEQTSLTQRVTELEQQVASLTEQINCITELLNDD"
FT   gene            complement(113347..114210)
FT                   /locus_tag="CPS_0107"
FT   CDS_pept        complement(113347..114210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0107"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /note="identified by match to protein family HMM PF03755;
FT                   match to protein family HMM TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24614"
FT                   /db_xref="GOA:Q48AN8"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AN8"
FT                   /protein_id="AAZ24614.1"
FT                   /translation="MIYSMTAFSRIEIKGDWGNAVWEIRSVNQRFLETYFRLPEQFRGI
FT                   EPVLRERFRKQLNRGKVECNLRFNANPANKSELALNENLALQLIQHANWINEQTLNSKV
FT                   NPLEVMRWPGVMEAPESDMSAIQAELLAAFDQALKDFIAARASEGENLKAMIEQRLDAI
FT                   ASEADKVAAHMPDVIAWQRNRIIEKFTDAKIDLDSGRVEQELVLLAQKMDVAEELDRLN
FT                   SHVTETKKILKKGGAQGRRLDFMMQEFNREANTLGSKSINTDITASAVELKVLIEQMRE
FT                   QIANIE"
FT   gene            complement(114323..115252)
FT                   /locus_tag="CPS_0108"
FT   CDS_pept        complement(114323..115252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28076"
FT                   /db_xref="GOA:Q48AN7"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AN7"
FT                   /protein_id="AAZ28076.1"
FT                   /translation="MAYKLLISSALVLCLTACGSDSSTSEAPITPEPALPEVSTYTGQF
FT                   FDSAVAGLNYKTTSQSGQTNQLGKFQFQGKESIIFSIGGIELPSTVANLYLTPLDIYQT
FT                   QDTNQIEVVNLLRLLQSLDADGDASNGIEIEESVHQLAANLTIDFSASDFEQQVADLVS
FT                   KSGAVNQALISATMAIDHFKLTLNEIGQNNLSSCTKEHEKIGHTGFFSTFAHNVSGKAT
FT                   IIDDCTIEISQFSYDGGGPDVYFYGAIDHEYTSVDAFPMGQKLNGKIYNNARIFIKLPQ
FT                   NKSLDDLNGLSVWCTEFEANFGQVEFTP"
FT   gene            complement(115603..117324)
FT                   /locus_tag="CPS_0109"
FT   CDS_pept        complement(115603..117324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:27355774"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28513"
FT                   /db_xref="GOA:Q48AN6"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AN6"
FT                   /protein_id="AAZ28513.1"
FT                   /translation="MSYDICIIGSGAGASPIAHQLSKAGAKVLVLEKGPWLTEKEFFKD
FT                   ELTISIHDAYNPKLTDEQHVIEEEYFDENDKPFWQGEKTSDSGWSWWNGNVVGGSSNFM
FT                   SGYFHRLKPIDFRLKSEFGAISGANVEDWPISYDELEPYYAKVEREVGVSGRVVEHPHQ
FT                   EPRSTDFPYPPIAELPMSSWIDKAAQKIGYHAIPVPRAILSKPAMGRRSCEYSGYCSSY
FT                   GCASGAKGSGRAALLNNAVASGNCTIQANAKVYKIATDKQGEITGVHYYDKIGRKKSVT
FT                   AKIYVVACQAVETSRLLLASTGEKFPQGLANNNGQVGKNLLFSGGGTGQGDFNYADLSD
FT                   KQVGELKQVGPFINRALQDWYQIADKSFTGANAKGQAKGGTIDFLFHQNPIARARGTQW
FT                   GSDQNGDDKLLWGEDLKQSLKTEFTSYKTLRFEVFNDWLPTDDCFVSLDNEVTDQWGDP
FT                   VAKVRIGYHDHDLEVGEYLSKKAEKLLEALGAKNVSSSVSGYPSTNLMAGGCRFGNDPK
FT                   TSVLNKTCQAHEVDNLYVTDGSFMPTGGSVPYTFTIYANAFRVADKIKAHWLTLKS"
FT   gene            complement(117321..118055)
FT                   /locus_tag="CPS_0110"
FT   CDS_pept        complement(117321..118055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0110"
FT                   /product="Tat (twin-arginine translocation) pathway signal
FT                   sequence domain protein"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27491"
FT                   /db_xref="GOA:Q48AN5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AN5"
FT                   /protein_id="AAZ27491.1"
FT                   /translation="MTNDDKCTSFFDKNYQTPEFIENKKRQAQQGRRRFLKSAAGMGAL
FT                   ASLPALSVSAKAQTSLNELLKTLVKTDPWLTLDATLNQLLPSSPTGPSASEIRATAYLY
FT                   QVMTVQPTEQDEKDFILKGVGWLNGYANSEKSANFAQLSFADKEQLLRGISNSTAGQNW
FT                   LNTLLGYIFQAMLSPASYGGNPDGIGWAWLEHQAGFPMPEKGQRYFELPTRARIDLISR
FT                   VNYDAKRLASSRNKSHQGTKKS"
FT   gene            complement(118108..118647)
FT                   /locus_tag="CPS_0111"
FT   CDS_pept        complement(118108..118647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0111"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01XF01490"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24494"
FT                   /db_xref="GOA:Q48AN4"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AN4"
FT                   /protein_id="AAZ24494.1"
FT                   /translation="MRIFTTFVISLSLLLSSIATANTSAPVITPNLPAYSKIYDDQRDP
FT                   FKDAAAALTLAQETNRQVLIEIGGNWCSWCHKMDAFLAKNPDVYEALHSQYVLLKISVS
FT                   DSNENNDFMKSLPPVLGYPHMYVSTAQGKMILSKDTAELLTGNNYSKSQWLSFLSDWSV
FT                   STTKAQAQLATTASVE"
FT   gene            119037..119750
FT                   /gene="rph"
FT                   /locus_tag="CPS_0112"
FT   CDS_pept        119037..119750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="CPS_0112"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by similarity to SP:P03842; match to
FT                   protein family HMM PF01138; match to protein family HMM
FT                   PF03725; match to protein family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24239"
FT                   /db_xref="GOA:Q48AN3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AN3"
FT                   /protein_id="AAZ24239.1"
FT                   /translation="MRPSGRTLGQIRPVTITRQFTTHAEGSVLIEFGDTKVICTATVEV
FT                   GVPRFLKGQGKGWVTAEYGMLPRSTHTRMRREAASGKQSGRTLEISRLIARALRAAVDL
FT                   KALGENTISVDCDVIQADGGTRTAAITGACVALVDALNYMRAKDIIKTNPLKHMIAAVS
FT                   VGIYKGEPVADLDYPEDSAADTDMNVVMTDTGKLIEVQGTAEEEPFSFEEMQAMLELAK
FT                   NGINELFDLQKAALS"
FT   gene            119779..120444
FT                   /gene="pyrE"
FT                   /locus_tag="CPS_0113"
FT   CDS_pept        119779..120444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="CPS_0113"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by similarity to SP:P00495; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24822"
FT                   /db_xref="GOA:Q48AN2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AN2"
FT                   /protein_id="AAZ24822.1"
FT                   /translation="MKDYQREFIEFAIEKQVLRFGEFTLKSGRVSPYFFNAGMFKTGGD
FT                   LARLGRFYAATLMDAKIDFDLVFGPAYKGIPIATTTTVALYDHHNVDVPYCFNRKEAKT
FT                   HGEGGSLVGAELEGKIMLVDDVITAGTAIRESMEIIKAHGAQLSGVLIALDRQEKGQGQ
FT                   LSAIQEVERDFGTQVAAIVTLGDVVTYLEEKLEGKVANQPELAENLASIKKYRLNYGI"
FT   gene            121025..122386
FT                   /locus_tag="CPS_0114"
FT   CDS_pept        121025..122386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28007"
FT                   /db_xref="GOA:Q48AN1"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AN1"
FT                   /protein_id="AAZ28007.1"
FT                   /translation="MKIANKYTILLLWLVSTLSFAQGQQDCLSIQGDYVSLIESGKYRF
FT                   ANEVEGELLAHIDFKKLSSYQEYLTNAYQVVVNKNPRANMPCPIVTETYQQLAKKNLWS
FT                   KTPKISQLVAPFELTQNNNDKAILLIHGLTDSPFSFHDLSQFFYQQGFTVRTLLLPGHG
FT                   VAPSELLNTDYQAWQQAATFAIDQTLNDYQQVYLGGLSTGGALIFNYLMQQKQVDEKIK
FT                   GLFMWSPATKAKSDLAWLAQYIDGIPFVDWIDLDADIDFAKYESFPYNAGAQVHALMNL
FT                   VVGEGANASRQMHDIPLFVVASEHDQTIDTAHTLQLVQQWQLASPQEQMKKSVLIYYGD
FT                   NNKLPKKLVDVMEVIVPECSAESLCNEIFDVAHIATTNSPDNPHYGVNGQYRNCGHYVT
FT                   DAPRYKACKHNKQVIKGEVTAMNLTRDLPMQRLTYNPYYQEMLEAMTTFLKATK"
FT   gene            122491..122607
FT                   /locus_tag="CPS_0115"
FT   CDS_pept        122491..122607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28717"
FT                   /db_xref="GOA:Q48AN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AN0"
FT                   /protein_id="AAZ28717.1"
FT                   /translation="MVDNVIYWMGIDFILSNINAHTLTKVYKKQHCRFYYHP"
FT   gene            complement(122543..122863)
FT                   /locus_tag="CPS_0116"
FT   CDS_pept        complement(122543..122863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27155"
FT                   /db_xref="GOA:Q48AM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AM9"
FT                   /protein_id="AAZ27155.1"
FT                   /translation="MNYIIAILTLTLTLVSFSSDAKNRASGDISHLISQEVFASYHDVA
FT                   DFIEQSPKVTITVLPSKADIDEYGQQVAKSLTGSDCDRDGVMDDNKTCNAVFYKLWLKY
FT                   AR"
FT   gene            complement(122866..123642)
FT                   /gene="kdkA"
FT                   /locus_tag="CPS_0117"
FT   CDS_pept        complement(122866..123642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdkA"
FT                   /locus_tag="CPS_0117"
FT                   /product="3-deoxy-D-manno-octulosonic acid kinase"
FT                   /note="identified by similarity to SP:O86224; match to
FT                   protein family HMM PF06293"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27632"
FT                   /db_xref="GOA:Q48AM8"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AM8"
FT                   /protein_id="AAZ27632.1"
FT                   /translation="MSQTITSAQFSKFEQGNVTCVYNQTLITNFNAAMLSPSYWQQSNA
FT                   VTGSAQGRGTTWFVEYNDNSNTPHDWVLRHYYRGGLIGKIIKDSYWFSGVEKTRAACEF
FT                   ALLRHMNTLQLPTPEPIAYRVMQHGFHYQADLLSSRIEHAQDLVAILSEKALTDDIWHN
FT                   IGATIKRFHQHGIYHHDLNSHNILLNDKKQVFLIDFDRGELRTNPVETNWKQANMARLQ
FT                   RSFLKELNKLEQFNFTEQNWQALKDGYQDADVERQN"
FT   gene            complement(123639..124994)
FT                   /gene="kdtA"
FT                   /locus_tag="CPS_0118"
FT   CDS_pept        complement(123639..124994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="CPS_0118"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="identified by similarity to SP:P23282; match to
FT                   protein family HMM PF04413"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25835"
FT                   /db_xref="GOA:Q48AM7"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AM7"
FT                   /protein_id="AAZ25835.1"
FT                   /translation="MRYVLALFFYRVFLLLLTPIVLLVLLIRSFNHPEYRQRLFERLGF
FT                   FPKPYKQGGIVVHAASVGEVIALKSFIEKLLVNYPDLPITITSFTPTGSAQITKLFGRR
FT                   VQHGYLPLDIFPCTTLFLHRLKPKMIIFMETELWPNLIAQCDQHQIKLLLINGRLSKKS
FT                   LTSYQKLSALMAPCLNRFDMILTQSQENLTHFLQLGAHQSRCVNSGNLKFDISVNEQVI
FT                   NKKAELAKLLFADDSQAKRTVWLVASTHEGDEAITLTAFKELLSQYPSLLLVLVPRHPE
FT                   RFEQVANLCLTKQLSLAKRSENTIINNEQVWLLDSLGELMAAFALSDIVTMGGSFSEVG
FT                   GHNPLEPALFNKPVIVGHNMSNFNEIMQQLRQENAIIELTNNTPTNESSAQLVNEVSAL
FT                   LQQPTRQKTLGENALKVVLKNQGASEKTLAQVVNLLPTRVNITSTTPLGDNS"
FT   gene            complement(125095..125523)
FT                   /locus_tag="CPS_0119"
FT   CDS_pept        complement(125095..125523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0119"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24079"
FT                   /db_xref="GOA:Q48AM6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AM6"
FT                   /protein_id="AAZ24079.1"
FT                   /translation="MLTEKDEELLSILRLNARASVSDIARATGVSRTAIQNRLNKLENN
FT                   NVIKAYSVVLDSAYTSGLISSNVSLKVKPNLRQTICIALRKVHQISHIHSISGEYDLLV
FT                   TIQASTLEKLSEVLNMVCSTEGVERTNSAIILDTIFER"
FT   gene            125702..126910
FT                   /gene="kbl"
FT                   /locus_tag="CPS_0120"
FT   CDS_pept        125702..126910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="CPS_0120"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01822"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24696"
FT                   /db_xref="GOA:Q48AM5"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AM5"
FT                   /protein_id="AAZ24696.1"
FT                   /translation="MTGSVSTKGFYTHLTAQIEQVKEDGLYKAERIITTAQQPQIAVNT
FT                   GEEVVNFCANNYLGLANHPELIAAAKTGLDEHGFGMASVRFICGTQDIHKTLEQGISKF
FT                   LGMEDTILYSSCFDANAGLFETLLGPDDAIISDALNHASIIDGVRLCKAKRFRYANNDM
FT                   AALEQSLIEADAAGARFKLIATDGVFSMDGVIANLKGVCDLADKYDAMVMVDDSHAVGF
FT                   VGEQGRGSHEYCEVMGRVDIITGTLGKAMGGASGGFTSAKKEVVEWLRQRSRPYLFSNS
FT                   LAPAIVNASLKVLELLAQGDALRKTLKDNAAYFRNSMEAAGFTCAGADHAIVPVMLGDA
FT                   KVASAMADRLLAEGIYVIGFSFPVVPKGQARIRTQISAAHTKAQLDHAIAAFIRIGKEM
FT                   AVI"
FT   gene            126942..127967
FT                   /gene="tdh"
FT                   /locus_tag="CPS_0121"
FT   CDS_pept        126942..127967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="CPS_0121"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR00692"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28577"
FT                   /db_xref="GOA:Q48AM4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AM4"
FT                   /protein_id="AAZ28577.1"
FT                   /translation="MKSLAKLKAEPGIWLTRTEKPKLGHNDLLIKIKKTAICGTDIHIY
FT                   NWDEWAQKTVPTPMVVGHEYAGEVVGIGQEVKGFTLGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTVGVGVNRAGSFAEYLVIPAYNAFKLPDEISDDLASIFDPFGNAVHTALSFDLV
FT                   GEDVLITGAGPIGIMAAAVAKHVGARHVVITDINEYRLDLARKMGATRAVDVSKESLKD
FT                   VMTDLGMTEGFDVGMEMSGVPMAFTSMLESMNNGGKIAMLGIPGSDMAIDWSQVIFKGL
FT                   TIKGIYGREMFETWYKMASLIQSGLDLTPIITHHYNIDDFQQGFDMMRSGQSGKVILDW
FT                   T"
FT   gene            128125..128451
FT                   /gene="glpE"
FT                   /locus_tag="CPS_0122"
FT   CDS_pept        128125..128451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="CPS_0122"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="identified by similarity to SP:P09390; match to
FT                   protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26058"
FT                   /db_xref="GOA:Q48AM3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AM3"
FT                   /protein_id="AAZ26058.1"
FT                   /translation="MSENSFKHMSVSDLQEVMANKSHVVVDIRDANSFANGRIAESIHL
FT                   TNESLPDFLREADLDAPVVVCCYHGISSQQAAEFLISQDFTEVYSLDGGFTQWQTQFPD
FT                   NIER"
FT   gene            128482..129369
FT                   /locus_tag="CPS_0123"
FT   CDS_pept        128482..129369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0123"
FT                   /product="putative glpG protein"
FT                   /note="identified by similarity to SP:P44783; match to
FT                   protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27848"
FT                   /db_xref="GOA:Q48AM2"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AM2"
FT                   /protein_id="AAZ27848.1"
FT                   /translation="MDTLQPLVQLKDHNIALLFSNYLQSLGIQAQLKSSQEDGHVILCP
FT                   EDKIAQAKVEFDAFILKPYDDKYQQAAWDRGETVTLNSGDFSLLSSFKDSFIAHAGIVT
FT                   LLVFALCWLVFIFSELGWAQQIFYALQFYPQLSIDALLADPVRLIGPAFFHFSWLHIVF
FT                   NTMWWWQLGGSIEKILGKSTLINLLLLSAIVSNVGQYLVSGSNFGGLSGVVYALVGFVW
FT                   WFGYLAPDRGLFLAKPLVGFLLFWLVLGFADLLPVNVANTAHLLGLLSGCFLAVFTVKV
FT                   IGVNSKNNIKKDSK"
FT   gene            complement(129394..129783)
FT                   /locus_tag="CPS_0124"
FT   CDS_pept        complement(129394..129783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0124"
FT                   /product="putative flagellar protein FliL"
FT                   /note="identified by match to protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24986"
FT                   /db_xref="GOA:Q48AM1"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AM1"
FT                   /protein_id="AAZ24986.1"
FT                   /translation="MFKNLFLFSLLLTLSASVAQAKASDYAYFGFEPDIVTNYVAVKKK
FT                   MGYVRLTVELMVEGDNLTIVEHHSPLLRDAIINIIGQQSEAKVKSIKGRAEIQLACEEQ
FT                   VKELLIKETGEPLIKKLLFTQWLDN"
FT   gene            130014..130589
FT                   /locus_tag="CPS_0125"
FT   CDS_pept        130014..130589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0125"
FT                   /product="putative chorismate--pyruvate lyase"
FT                   /note="identified by similarity to SP:P26602; match to
FT                   protein family HMM PF04345"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28672"
FT                   /db_xref="GOA:Q48AM0"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AM0"
FT                   /protein_id="AAZ28672.1"
FT                   /translation="MSGQWQSPSAVSFSSLSTPLKDWLLDEGSLTARLKKHCDNFQVKV
FT                   IGEQQQPCSAAESCDLIKVGEPVLVREVILYCDDVPQVFARSLLPIASLTGEEQILANL
FT                   GEQPLGQVLFNNPSLQRLRLELSPFVNDSSVVALAAKLTAQHASNSPLVKASVIPKQEL
FT                   WGRRSIFMLENKPLMVAEVFLPDAFAYQ"
FT   gene            130627..131490
FT                   /gene="ubiA"
FT                   /locus_tag="CPS_0126"
FT   CDS_pept        130627..131490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="CPS_0126"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01474"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27577"
FT                   /db_xref="GOA:Q48AL9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AL9"
FT                   /protein_id="AAZ27577.1"
FT                   /translation="MLKRIQQKWLAIKLITRMDKPIGTYLLLWPTYWALWIASDGWPNL
FT                   QLLLVFSLGVFIMRSAGCVINDYADRKIDGEVERTKNRPLVNGMMTSGEAINLFGVLIG
FT                   MAFGLVLMLSWSTIYLSVVAVLLAAIYPFMKRHTQLPQLFLGAAFSWGMIMAFSEAQGE
FT                   IPLVAWLLFTANLCWTIAYDTMYAMVDRDDDVKIGVKSTAILFAENDKRVIGFLQLMTL
FT                   ALLWTVGDILAFGWPYQLCIIAAAGLFSYQQLLIVNRERDACFQAFLHNHWVGLVVFVG
FT                   IAIEYL"
FT   gene            complement(131503..133269)
FT                   /locus_tag="CPS_0127"
FT   CDS_pept        complement(131503..133269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0127"
FT                   /product="GGDEF/EAL domain protein"
FT                   /note="identified by similarity to OMNI:SO0341; match to
FT                   protein family HMM PF00563; match to protein family HMM
FT                   PF00990; match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24638"
FT                   /db_xref="GOA:Q48AL8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AL8"
FT                   /protein_id="AAZ24638.1"
FT                   /translation="MAIGNKLDLKAMLKIFLKVCFNRLDLTSAHIYVYCDQSGMPSKLL
FT                   PLKGTSYQYFLSIPKNKRGQSWSKSSILTNFARQLNSSQKTLSFQCENGQYLFGFIIPD
FT                   YGLLTFETHYAIADEVQKALQPILQKLATSCYTSIVHDSLVKEVLSRQLIEEKVAFQAQ
FT                   HDGLTHLFNRQHINHLLGNAIEDARINNKIGSVLFIDLNRFKPINDAMGHTVGDKILLT
FT                   LAHRLHSLSSEHIDIGRFGGDQFTILLKNLKDDYQETINLLIAQINQLLTAPFVIDTNS
FT                   YKLTCSIGYSLFPLQSSTVNNLIKFADIAMYEAKRAKTQQGKQYQRVMSEKIKRRLAYV
FT                   DDMKQGLEQGDFKLYYQAQYNHHGDIIGAEALLRWQHPVHGKESPAVYIPIAEESDLIL
FT                   AIGQWVLEQACRDIKKLEQLSLPESFNKIAINISAKQLIQHDFQEIVLNAVKQNDIPAK
FT                   RLALELTENLLVENIEDSIKLIASLKENAIDCAIDDFGTGYSSLTYLKRIPASVLKIDR
FT                   SFVTNIAQSSESAAIASMIISLGKTLNMDILAEGVETQEELNCLKELGCFHYQGFYFSG
FT                   PLPFDEFAKLLN"
FT   gene            complement(133328..134467)
FT                   /locus_tag="CPS_0128"
FT   CDS_pept        complement(133328..134467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0128"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24115"
FT                   /db_xref="GOA:Q48AL7"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AL7"
FT                   /protein_id="AAZ24115.1"
FT                   /translation="MATELFTWHTLSDTLSDFKSGLSLAQNSGAESLLVLTCSQNNYPE
FT                   EELNALFHACPLKLFGGIYPMLTLKGDLIKQGALIIGFKEAVDVTLFAQLNQVTNESCL
FT                   EELITSTLKEKNNFCGQDDFLMFYDALISNIEGFIDCLFEHLDHGINIAGGGAGNLDFI
FT                   QRHCIFTNSGVHSDAILLVALPRTLNTSVAHGWETFDEPFLVSEAQGQTVQSLNYQPAY
FT                   EVYCQTIESATEYTFNNTDFFDIAKNFPLGIKDINNNIIVRDPILAKNNHLQCFGNIPI
FT                   NSMVYLLESNIDSLVASTEKAAIALLSKLNKTTITTTMVFDCISRALFMEDEFEKELNV
FT                   IAEHCHLGALFGVLSLGEIANSQSGAIRLLNKSIVISSW"
FT   gene            134739..135827
FT                   /locus_tag="CPS_0129"
FT   CDS_pept        134739..135827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0129"
FT                   /product="extracellular solute-binding protein, family 7"
FT                   /note="identified by match to protein family HMM PF03480"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28655"
FT                   /db_xref="GOA:Q48AL6"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="PDB:4PET"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AL6"
FT                   /protein_id="AAZ28655.1"
FT                   /translation="MKKSIFVKAALVVSLGLSSLGLSALAHADDDKKYRWKLAETWGPN
FT                   FPIFGDATKNMAKMVKEMSNGRLTIRIDSSNKHKSALGIFDFVKSGQYQMGHSASYYWK
FT                   GKNFNTMFFTTVPFGMIASEQHAWFYYGGGMELMKKVYDQYGIMSFPGGNTGNQMGGWF
FT                   KKEINSVEDLKGLKMRIPGFAGEVLAKLGAKPTNIPSGELYTALERNTIDALEWVGPSL
FT                   DLRMGFHKIAPYYYTGWHEPGTELQFMVNQKAYNSLPKDLQKILTVAMKAAAYDMYSQS
FT                   MHASGVNLASLKKDYPNVQMRSFPKPVMEAIVQANDELLEEFAAKDPMTAEILKSLNDY
FT                   KHQIRAWTNLSDRAYLDNFDGK"
FT   gene            135956..136477
FT                   /locus_tag="CPS_0130"
FT   CDS_pept        135956..136477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0130"
FT                   /product="C4-dicarboxylate transporter family protein, DctQ
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF04290"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25564"
FT                   /db_xref="GOA:Q48AL5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AL5"
FT                   /protein_id="AAZ25564.1"
FT                   /translation="MDKVLKISGKIIDVLGNFCSLLMILMIINVFYDVIMRYFFNDVSI
FT                   GMQELEWHLFAAMFMFGIAYTLKEDGHVRVDIFYETMTAKNQALINIFGSLVLALPITI
FT                   LTLYYSWDYTFEAYQMGEGSGDPGGLPHRWIVRSVIPLSSLFLILAIFHVVVTQLKTFT
FT                   APTQPETGEQ"
FT   gene            136477..137757
FT                   /locus_tag="CPS_0131"
FT   CDS_pept        136477..137757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0131"
FT                   /product="C4-dicarboxylate transporter family protein, DctM
FT                   subunit"
FT                   /note="identified by similarity to GP:28806901; match to
FT                   protein family HMM PF06808; match to protein family HMM
FT                   TIGR00786"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27455"
FT                   /db_xref="GOA:Q48AL4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AL4"
FT                   /protein_id="AAZ27455.1"
FT                   /translation="MTGIVLFAIALVCLFLGYSVAFTFAGVSLIVGAIVLGADLFAFMP
FT                   YRIMSIMENTILMAVPMFIFMGIVLQKTGLAERLLESAAKLFGGIAGGVAISTIIVGAL
FT                   LAASTGVVGASVVAMGVISLPVMLKNNYHQPTATGVICASGTLGQIIPPSIILIILGDV
FT                   MGVPVGDLFRAAILPGMLLVVTYVIYILILGKFKPEFVPPLVVTENKRELLVQALKDIV
FT                   PPLVLILTVLGSIFAGIATPTESAAIGAVGAVILSILYGSFSFGKMHEISKETVKVTSM
FT                   VFAVLIGATAFSMVFSYSGSEYLIEEFFMELPGGKWTFIALAMLAILILGFFIDFIEIA
FT                   FLVVPILLPVAIALDINLVWFAILISMNLQTSFLTPPFGFSLFYLKGVAPKYLKTTTIY
FT                   KGVIPFILMQIAVLLLVVFFPEHLIIT"
FT   gene            complement(137816..138592)
FT                   /locus_tag="CPS_0132"
FT   CDS_pept        complement(137816..138592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0132"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26730"
FT                   /db_xref="GOA:Q48AL3"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AL3"
FT                   /protein_id="AAZ26730.1"
FT                   /translation="MLKGPYTAITISVLLHLLLLLALIYGATQQPKIIKQDKPKITSIK
FT                   SFLYSAPKKTVSEPAITPKSVEERKTPQKVEQKQAAPKKTIRTEPSKTAVKTPPNTPVN
FT                   KPVTKTPSTQVTNAVKSETVTTKNKVLGASRGSFSSYDRLSRLRQKLDDQQREQAFSEL
FT                   TQPRSTSEMDGEPFPVPKTIVPLTVEQRQKLNTSSSHVGSITKNDNGTCTIYREQVLGS
FT                   PVHATTAYFACGESKFDKSFREHMEKVQAKFKVPNK"
FT   gene            complement(138966..141401)
FT                   /gene="plsB"
FT                   /locus_tag="CPS_0133"
FT   CDS_pept        complement(138966..141401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="CPS_0133"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="identified by similarity to SP:P00482; match to
FT                   protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27641"
FT                   /db_xref="GOA:Q48AL2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AL2"
FT                   /protein_id="AAZ27641.1"
FT                   /translation="MLALRSFFYLLLKFPLKLLVRCKIITDSQNITDQPNQPIFYIVRH
FT                   QSASDLLALQSACKKQNLPDPLGKVTINGESFNRTLCLAKSTPLCSWRKSSKTTATAQG
FT                   LALLNQHVIDENIDAKLIPANLIWGRTPTKERKNLNIGTLLADQESPNWLRKFFIVLFL
FT                   GRDTLVRFSEAFSLRNISDNHGSDEAAAHKFLRVARFHFHRQTIAAKGPRLMHRKQMFT
FT                   ALFANPSVKRIISDEAKNKKVSEAEIKKKALVMMNEIAGDYSVSWLRFGEIILHWLWKR
FT                   LYSAIKVSNAKVLRKLAQDGHEIIYVPCHRSHMDYLLLSYVILQEGLVMPRIAAGINLN
FT                   FWPAGTIFRKGGAFFIRRSFGGNRLYSTIFREYLGLLFERGYGVKYYTEGGRSRTGRVL
FT                   APKTGMLAMTIQSLLRGIDRPLTLVPVYLGYEHVMEVGTYHKELSGSEKKGESMFGVLK
FT                   AIKSLRNYGNGYVNFGEPMNINEFLNKQVPDWKDSIDPIDPQKPSWLTPTVNVLADQVM
FT                   ENINKSAALNGVALIALILHASKNKALSKLELETQLDFFLNIQRQAPFSEQLTIPEETG
FT                   AELLTHVISLNKVTITEDSFGSLVSLSETANTEMRYYRNNILHTYVVPALVCRLLDKHS
FT                   KINQDELVIKVQNVTALLKEDLYLYQDSTHVEQQTLRVLTVLKEMEIAKQTKAGFWSLS
FT                   DDVGLLSQVHAMAECIDESLQRLAIITSLTSRLAPLSKRDLETKVVAIAKRLSVLNNIN
FT                   APEFIDKRAQSTLIATIREQGYIDLDDDGLLIASSTMAEIKATVINLVDIEVLQSIAR"
FT   gene            141747..142220
FT                   /locus_tag="CPS_0134"
FT   CDS_pept        141747..142220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01936"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24783"
FT                   /db_xref="GOA:Q48AL1"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AL1"
FT                   /protein_id="AAZ24783.1"
FT                   /translation="MKKIAVFVDVQNIYYTTRDTYAKQFNYRLLWQELMAQGEITIANA
FT                   YAIQRSDDQQHKFQKALKHIGFDVKLKPYIQRSDGSAKGDWDVGITIDIMEAAAEVDTV
FT                   ILLSGDGDFDLLLRKVREKYGVSTEVYSVEKLTAKSLVEAADIHHKIEHSLLL"
FT   gene            complement(142262..143014)
FT                   /locus_tag="CPS_0135"
FT   CDS_pept        complement(142262..143014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0135"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:SO4689"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24997"
FT                   /db_xref="GOA:Q48AL0"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AL0"
FT                   /protein_id="AAZ24997.1"
FT                   /translation="MLSKFLLFSARLSTTKILASLIIIMILATGLYQWLIHTPAFSPQV
FT                   SAVSTTTENDFSLTDWTINLVDKLNWQQGGSSTFFNAGLLFVFLSLATSVGLPRQIAAL
FT                   VAGINLGAFIGIIVATLAATLGCFITFSVARYLLSDCITRKYPSKLAQLSAFLGEQTFL
FT                   KAIVIRILPLGSNFITNIIAGVSKVSMPAYVSGSFVGFIPQMVIFSLAGSGIRLGAQNE
FT                   LIASATLFVIALILTTYLVKKHKAKTKN"
FT   gene            complement(143174..145333)
FT                   /locus_tag="CPS_0136"
FT   CDS_pept        complement(143174..145333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25730"
FT                   /db_xref="GOA:Q48AK9"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AK9"
FT                   /protein_id="AAZ25730.1"
FT                   /translation="MLIAKRATFFIFSLCLFFVSGANGAGKEKQYLLQKIAQAPQLETA
FT                   DDQWLLLLEQPGNSQFYYLANKRGKIYQLEQDSPDNTTLLLDLQHFSTKESALQLTAFT
FT                   LHPNFSLRDQAGYGTFYTAHVEKVINNRKRKRLKDPAVTTPLSYDAIVTEWQLNVTKQV
FT                   DESSQREVLRIAVPTLESGIRQLNFNSYSKSWHEDFAQLYISLSHNLELQQHPLYSGAI
FT                   LRIHPQRKGIKSYSVPHDNPYYANEKFEKALYLFGAGNINQFIWPDRYATKLLISHQYS
FT                   VNGIVRHWISYSDGGEDWRKKAPRNFLYQNQNTLAANSLLVYRGQNAPTLRNKLLLLTK
FT                   NKKEWQLNSLSHEISPEIALENNQSSNQQKALSAPTIEWLLKQQALQANHLTLYRDNRG
FT                   ELLFFNEDTGAIYQLFQQDISLAIKESQQSGSNGLTFLFILMLFLLLGYILYQMKTQQK
FT                   SAKAFVRREFSNLVLTEDKLSIKLFKRHEKKAEKVIALADINQCQVLLGDLVIATINTT
FT                   MGHGFDEEHEQALRDIFHIEQIAKMTDGKVRRINLALHTESKKRHIICLYLRKGSDRIT
FT                   KKGYFTVVDEAIDWCWLIAKNINSEQTGTRSFKPKFTADIARTEHKTHDDTPLHTQASI
FT                   IRPATRLHSVVDDIEPEKVAEVTISEKSNDEITLVDKHDATAIELARVETDLVNALEKL
FT                   VKLQQQGFLTIDEFEQAKAKLYHFK"
FT   gene            complement(145388..146086)
FT                   /locus_tag="CPS_0137"
FT   CDS_pept        complement(145388..146086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0137"
FT                   /product="single-strand binding protein family protein"
FT                   /note="identified by match to protein family HMM PF00436"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27347"
FT                   /db_xref="GOA:Q48AK8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AK8"
FT                   /protein_id="AAZ27347.1"
FT                   /translation="MSLSDAVNKHPKSPNPQLCAVTLLGNLVATPDIRYRANPATAVTE
FT                   IVLATSSKWLDKITNKYKEWTSYHHVKVEGELVELALLNANKGDIILLHGYLSNIKPKS
FT                   TDKSTNHLGIVHANFVQKFEKGYTQAINQIHCSAQLTSKPKLMLTEQNKNITQANIVIN
FT                   QHIYNTDKQAWQTISVERAIHVWGKQAQYLAEHGDIGDELMLEGKLSYTSGVSKDQFIE
FT                   VKNVHLFKGT"
FT   gene            146362..147180
FT                   /locus_tag="CPS_0138"
FT   CDS_pept        146362..147180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:28805055; match to
FT                   protein family HMM PF04445"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26823"
FT                   /db_xref="GOA:Q48AK7"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AK7"
FT                   /protein_id="AAZ26823.1"
FT                   /translation="MSPIIASEHLSNIALGYVDSVDSEYAKRLAKKWQFNYLGHVAAAS
FT                   KQPKLEFMLQMHHHALELCKLDEPKLGAIKVDFVEGAVAHRRKFGGGRGQDIAKAVGLK
FT                   HGFKPHVLDATAGLGRDAFVLASLGCKLTLLERMPVVAALLDDGIERAKLNHEVADIAN
FT                   NMQLIHGSSLEEVDLAIEPDVVYLDPMYPHREKSAAVKKEMRIFQSLVGEDLDADDLLE
FT                   PALALAKYRVVVKRPSYAPPLANKKPSMSINMKKNRFDVYVKQAIPKPIT"
FT   gene            147284..149236
FT                   /locus_tag="CPS_0139"
FT   CDS_pept        147284..149236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0139"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27122"
FT                   /db_xref="GOA:Q48AK6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AK6"
FT                   /protein_id="AAZ27122.1"
FT                   /translation="MRVSSFSRLSVTAISIFTAIFMATMYHVGESLSESRAQYKGYQAL
FT                   ISLTTVEFNRTIVEYLQTGDAALLNKAQKQLTGIVKKTYSLNIDKLSKQIDSQAQALAN
FT                   NIDTKFRAMGKLSGDPLVLLRNGEQEMIALNNDLSNHVQNTQVLSVKEQFNYLVTIQTI
FT                   GKLLADLVSAREAIFTQAQPNIQSVNPLLKELKGLGSFLSLQKALAIYEESDDDLFDDS
FT                   ENLLGDDEEKQDLSLEAINELQSLFNRYQRELENTLAQQQQRKMGFALLAKQVGNIEKA
FT                   IMQGEAEISQQQEKINEQLYIIVIGLLIFLVVFLLANYWLQRSVILQPLRNLRDSFVQL
FT                   VEQGKVDNIINIDNRTEFGEISTSFNHMVNKLAQDDKDKAQQLDLVAKALTTMESQVKS
FT                   IYQSSHTTSEHVQGARKIMEALGEATETVNTLSGQVVNNAQATKQAMEVSQHHVSQVLA
FT                   ASESTNLAAKESKGAITSLFHSVESVTSIVDVISAIADQTNLLALNAAIEAARAGEHGR
FT                   GFSVVADEVRQLAGKTQQSLKQISARLTQLQSASNSIEGIINDIEKASNNQRIIADELQ
FT                   ETALAVTGQAQVSATVAQDTLEQITLQRTHFIAFEQAMANVDKEVSDSQQLSNVISVDV
FT                   SNQVNDIGLTLKKAS"
FT   gene            149202..149393
FT                   /locus_tag="CPS_0140"
FT   CDS_pept        149202..149393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0140"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25422"
FT                   /db_xref="GOA:Q48AK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AK5"
FT                   /protein_id="AAZ25422.1"
FT                   /translation="MISVLHLKKRLNKSKFVKLGLINFYLRKSLNDLYKFLTNSQRCFH
FT                   DRIEPTNASRRTARIKKR"
FT   gene            149335..149808
FT                   /locus_tag="CPS_0141"
FT   CDS_pept        149335..149808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0141"
FT                   /product="antioxidant, AhpC/Tsa family"
FT                   /note="identified by similarity to OMNI:SO4640; match to
FT                   protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27823"
FT                   /db_xref="GOA:Q48AK4"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AK4"
FT                   /protein_id="AAZ27823.1"
FT                   /translation="MIELNQLMPVGELQELKNGEMTTHNTAELFAAKKVVLFAVPGAFT
FT                   PTCSAAHLPGYVVSADELKAKGVDAIICLSVNDAFVMNAWGESQNAENIMMLADGDGSY
FT                   TKALGLSMDTATFGGVRSQRYAMIIDNGEVISLHVEEPKSFEVSKAEVILDQL"
FT   gene            150023..150550
FT                   /gene="ftnA"
FT                   /locus_tag="CPS_0142"
FT   CDS_pept        150023..150550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftnA"
FT                   /locus_tag="CPS_0142"
FT                   /product="ferritin 1"
FT                   /note="identified by similarity to SP:P23887; match to
FT                   protein family HMM PF00210"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25327"
FT                   /db_xref="GOA:Q48AK3"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AK3"
FT                   /protein_id="AAZ25327.1"
FT                   /translation="MLKAEMVEKLNQQLNLEFYSSNLYLQMSAWCEEKGFAGGAEFLRK
FT                   HANEEIQHMNRLFTYVSETGALPIIGAIDAPPHEFESLGQLFELTYEHECLITERINSL
FT                   AHEAFTNQDYSTFNFLQWYVAEQHEEETLFKGILDKINLVGNDGHALFFVDKDLAELAK
FT                   TGSSSIMTEASA"
FT   gene            complement(150647..150985)
FT                   /locus_tag="CPS_0143"
FT   CDS_pept        complement(150647..150985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0143"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to SP:P16244; match to
FT                   protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24598"
FT                   /db_xref="GOA:Q48AK2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AK2"
FT                   /protein_id="AAZ24598.1"
FT                   /translation="MLTAEEHLTPNKLVIAQVELNFLNRSVRFLGESVTTTGLEFNLLA
FT                   VLMIDAGSLISREIIAQRIFQRKLDSCDKSINSHIANLRKKLLVISSRPVIKTVKGQGY
FT                   IFLTSSCV"
FT   gene            complement(150991..152511)
FT                   /locus_tag="CPS_0144"
FT   CDS_pept        complement(150991..152511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0144"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:SO4018"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26607"
FT                   /db_xref="GOA:Q48AK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AK1"
FT                   /protein_id="AAZ26607.1"
FT                   /translation="MMTLKTLQALKSCLAAGILLFILLGCDSSDDGSGEGYVKLYNLSK
FT                   DSPSIYLTLDEDLTEDNDDDDHFEQTFSAISYGNAHSNISLTSQDYYYQLAWQDDDSSA
FT                   TDDLSVIYENSIALTEDTIHMIVLSDSILSPQVMVHSIPVIDDDDDTIDDLFNLRVLNM
FT                   HSNQQAVDFYLSKDDGSFNEAVLVGQYTYQQLSDNQKLDQDDYIFYITKAGNEEVLFTS
FT                   SSIPFAYSSQNIMIVRENNGAGTSPYVLDIMSDSTVINYVDDKSEAQFSAYNAVANHEL
FT                   LSNYQEAFALHINGVDDTPVIAFLPYGEMSNALILASGDYSVDLTTTENNTPLLSNHLL
FT                   SLVENTNKTLFFYAEQEYIDTDNDGNIDENGDGIIDEIEVNLFSLMVENSSLTSIYEHE
FT                   IEIINLIQSDDFSQVTVFFVRQDETINSATYYRETNYKNTSSILLKNNSYQVFVVAKDN
FT                   GSSIILNSFELILNEQSIEQFLILESSDSSATGYKTTMFTQTSAQESE"
FT   gene            152800..153984
FT                   /locus_tag="CPS_0145"
FT   CDS_pept        152800..153984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0145"
FT                   /product="conserved hypothetical protein TIGR00275"
FT                   /note="identified by match to protein family HMM PF03486;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26225"
FT                   /db_xref="GOA:Q48AK0"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AK0"
FT                   /protein_id="AAZ26225.1"
FT                   /translation="MITTDVLIIGAGAAGLMCAAQAGYRGKSVVVVDMGKKPARKVLIS
FT                   GGGRCNFTNENTTPENYLCQNPHFAKSALSRYSAQDFIDLVDRHGLKYHHKTLGQLFCD
FT                   DSAQDLVDILMTECEWAGVEVNLRSEVLSVTKIDDGYSVTTNDKSYQCKSLVVASGGLT
FT                   MPKLGATPIGYKIAEQFDLNVLETLAALVPFTLHEHDKQRFDGLSGISLLTEVTSEDGT
FT                   SFKENILFTHRGLSGPAILQISSFWRAGQAVTINLLPECNLSETLIQWQNEQGQKSVKN
FT                   LLATLLPKRFVEVLVKDGIIADKPIKQLNHPEITALSEYLHAWQIKPNGTEGYRTAEVT
FT                   LGGVDTDELSSKTFESKKQQGLFFIGEVIDVTGWLGGYNFQFCWASGYACGQAV"
FT   gene            154101..154949
FT                   /locus_tag="CPS_0146"
FT   CDS_pept        154101..154949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27476"
FT                   /db_xref="GOA:Q48AJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ9"
FT                   /protein_id="AAZ27476.1"
FT                   /translation="MKVIHLNHPIDDQERAELLFSGHLLVYTQRESMIELIEFTKALLK
FT                   EHLGELDPTHAQHQLNKQDFLKATGAAQTQFRCSEKARQLFFHVLNECGIDPKVCYYDH
FT                   FPLRVVPFAEQHKGADRAAIGHHRDTWGSNINCQQNWWAPIFDLTTERTIAIYPDYWGK
FT                   PLANTTATWCFDTLLEKRNEAQRERIFDYPSAPSPIEKVNEDGVVKLIIQPGDVLNFAS
FT                   AQLHASVPNTSSETRFSVEMRTISVEDLNTMRQAPNLDNAGTKPMYSWFKNIETKQALV
FT                   Y"
FT   gene            complement(155197..157203)
FT                   /locus_tag="CPS_0147"
FT   CDS_pept        complement(155197..157203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0147"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26737"
FT                   /db_xref="GOA:Q48AJ8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ8"
FT                   /protein_id="AAZ26737.1"
FT                   /translation="MVPTNRTLIASAIIATSLLAACGDSSSKSNVTTDKAVTTPVNSFK
FT                   TVACKSMLPSAKVALLTEGSSCGYLTVPEKHALYGQTASDKKIEIAVLKLASTSTNKQA
FT                   DPVVYLQGGPGGSASSSIAQVIKTATFINDRDVYLVDQRGTGYSKPALLCTEFDEAGTP
FT                   DQVQACKARLENSGVDLNAYHSVHNAMDIIQLRTALKISQWNLYGISYGTRLATTIMRE
FT                   NSEGIRSVILDGMFPIEVNGISDTPWANYESLNQIIKNCENTDDCPPEEVKAVIEDIIA
FT                   RMHNEGMVKESREFIQTLLNMSSESVILDYLLAVNKDISKYASALDTITEEQNEGDEQG
FT                   EEELFYNAMGLSTVCAEEYPFLNITALVDDNSQGWSASTQLAVNGMFHMGFDAASCKAW
FT                   DVASANDIETQAVTSDLPVLILNGLQDPQTPAAWGTLVAKNMPNAQSVTNPQGGHGQLF
FT                   SGLSCFDTMAANFLANPNKTLETSCVSDIAELSYEASDQEESANFTFKGDDSSADTVYM
FT                   NGVIGSDTLKVMQKLFSDYPQVKTIVMQNVPGSMDDEINLLASTELRNHGINTHIPADG
FT                   MVASGGTDMFLAGVKRTVEAGARLGVHSWSDGSGTAALDYPRDHQEHVKYLDYYRVMGI
FT                   PADFYWYTLEAASAENIHWMTTQEITQYGILAE"
FT   gene            complement(157758..158363)
FT                   /locus_tag="CPS_0148"
FT   CDS_pept        complement(157758..158363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0148"
FT                   /product="cold-shock DNA-binding domain family protein"
FT                   /note="identified by similarity to SP:Q47130; match to
FT                   protein family HMM PF00313; match to protein family HMM
FT                   PF06961"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27782"
FT                   /db_xref="GOA:Q48AJ7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ7"
FT                   /protein_id="AAZ27782.1"
FT                   /translation="MRLTGKLIRWNTDKAFGFITPNGSGDTIFIHKTALKNRNRTPKIN
FT                   DIISFSVIQDNQGRYCADQATFAGEKSHKKQTKNISTFSIYLSLIFITLVAIAYLLDYL
FT                   PQKILLVYLGVSLMTFLVYAFDKSKAQRGKWRTQESTLHLLALLGGWPGAALAQQLLRH
FT                   KSKKKEFRVTFWFTVVINTATLVWLMTAHGRPFLSYFS"
FT   gene            complement(158416..159726)
FT                   /locus_tag="CPS_0149"
FT   CDS_pept        complement(158416..159726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0149"
FT                   /product="leucine-rich repeat protein"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF00560"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26715"
FT                   /db_xref="GOA:Q48AJ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ6"
FT                   /protein_id="AAZ26715.1"
FT                   /translation="MYTSAVFNHIYGRFMLHTLSQLRSGELAGISQLKLSENLNTFPLE
FT                   ILTLADSLEILDLSNNALSSLPDELAQLTKLKIIFASQNQFEHLPEVLGQLPNLEMVGF
FT                   KSNQIKQVAEHSLPAQLRWLILTDNLIETLPNSLGERPRLQKLALAGNQLTHLPQTLAQ
FT                   AHNLELVRISANKLTECPEQLLNLPNLAWFAFAGNPFTAVEPTTHSESYTKVKSVPELS
FT                   STSYTLENVLGQGASGVISKAHWNSPQSQFPEDIAVKVFKGEITSDGYPQDELQACLQV
FT                   GYHPNLVESLAQVNEDNYLALIMTLIPENYQNLGLPPCFNSCTRDTFSQGFRLPITLIS
FT                   NIVSQMQDVFAHLHKNQVCHGDLYAHNTLFDSQGNIIFGDFGAATSYQMLTPAQQEKVK
FT                   NIESKALNHFIDDLLSICAEQDKTTKAFDTLKAHISA"
FT   gene            complement(159818..160114)
FT                   /locus_tag="CPS_0150"
FT   CDS_pept        complement(159818..160114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28770"
FT                   /db_xref="GOA:Q48AJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ5"
FT                   /protein_id="AAZ28770.1"
FT                   /translation="MKVFALITALLFSVSALAMPKITVKHQRNALGFAQVQVSNDTMEN
FT                   LICHVAIDGNKVLFRLQAMGYSRWFTATDIRYNHTNFSVWCDYLRLHPKYQKK"
FT   gene            160286..161065
FT                   /locus_tag="CPS_0151"
FT   CDS_pept        160286..161065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0151"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO3512"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24516"
FT                   /db_xref="GOA:Q48AJ4"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ4"
FT                   /protein_id="AAZ24516.1"
FT                   /translation="MANFVPVRKEQHQNLKLASKRDLAHAAGQHIVSLTAAEYAQASAS
FT                   FPVLLVKNPESPRYRSVAMLGLEAGENLYYKDDKWSGLSLPQSIGMAPFALGLDPDKEN
FT                   TLTACVDIDSALVAEDKELALFEADGKESELLANVQNSLGRLYENEKMTENFIKELEEN
FT                   DLLQELELNIDLSSGEKKKLTGIFTVNEDKVKALADDKVLDFHKRGLFVPIYAMLGSLG
FT                   QMNRLVQLRNLTGKAQISNIQIAPLAKEEVKEGVAES"
FT   gene            161228..163048
FT                   /locus_tag="CPS_0152"
FT   CDS_pept        161228..163048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27286"
FT                   /db_xref="GOA:Q48AJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ3"
FT                   /protein_id="AAZ27286.1"
FT                   /translation="MVDKSKFSKDVEEQIQSLASDIYIQVEDKLTHLIASAIKTETSKN
FT                   TDQQNQYLSEKEQSLQKNFTEKQQSQLKEVTQLKQALAEKEADEATNKQNFQVELTQNT
FT                   INYSETIESLEKEIVNLKQQKTQQQDKKQSSNNKLDEKLLETEQTLNDKNQEIDGLNGR
FT                   IMVLTEQEQSLMSQLTVAKEKIQLNEKQHNEALTTVKNQAEATAKQKIDALTEKLQLNE
FT                   KQHSEALTTIKNQTEATAKQKIDALTEKLQLNEKQQSEAVITIKSQTEATAKQQIDVLT
FT                   EKLRKLEDDSSRMQAEAMQSSDSKVKDLEQKISQLAEQAQQEQNGKAELQQQLSAQQKS
FT                   IDTEQDKNKQTEQKSQDFQAQIIKLTKQAAIDKQKLLDEIKSINEGSEKIKQQHLDEKE
FT                   AVNEGAEQVKQRHLDEIKAIHEGAEQVKQQHLDEIKVIHEGADQVKQQHLDEIKVINEG
FT                   AEQVKQQHLDEIKAIHEGAEQTKQLQASAQQNIIELEKTNEQLSHKLATEQNDIKLYQQ
FT                   EVTVLNEQVKVAQEGQENILQRFNKNRDKQEIENNKVRETIKFLRDENHQLISDNGEQK
FT                   AQFNDQTSELEHKLTEYRLKFEYAQKQLTS"
FT   gene            163420..164055
FT                   /locus_tag="CPS_0153"
FT   CDS_pept        163420..164055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0153"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:P32680"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27667"
FT                   /db_xref="GOA:Q48AJ2"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ2"
FT                   /protein_id="AAZ27667.1"
FT                   /translation="MTIHLPFAKLSHWHQIAFSAALLERMLPNYQMFSEAADFGNAKVL
FT                   RNQLDIIWQWLDNSSTVKINSEAQLLKLEAETPDPEAFDSFGVFPALDACMAFSALWQL
FT                   MQVKPSKKQKTSEIDIDDIQSISRLSHNSVSYYVELLLLEEVEESADEELTITTEQMDE
FT                   HPLMQWEKDTQNELFDFLKFAAADKRTCKLAKQMSLSEGLSNLGIEII"
FT   gene            164134..165714
FT                   /locus_tag="CPS_0154"
FT   CDS_pept        164134..165714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0154"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26586"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ1"
FT                   /protein_id="AAZ26586.1"
FT                   /translation="MKLFSCALFAVTLILSVVTPVHASNVVDKNIKIEQAITKAMSTFQ
FT                   VPGVAVAIIKDNKVVMSKGFGVVEHGKSAQVTSDTLFGIASNTKAMTAALLANLVDEGK
FT                   LTWQTKVIDIIPEFQMPDAYVTREFTITDLLAHNSGLGKGAGDLMIWPHTTLTNADVIK
FT                   GIKYLPEASSFRSEFSYDNLLYIVGGEVIARITGQTWNEVVQASIFTPLGMKNTRAAFS
FT                   LIDESNKNVARAHVPLKGKLNVVGGNFIERFGAAASVASSANDMSLWLQTQLNKGAYAI
FT                   KQDEKSPRLFSAEQSRFMWQARTILPVTAEATQQDKTHFAAYGLGWFMKDYHGVKLLHH
FT                   GGGILGMVSKVVLVPEEELAMVILTNQQSSFAVNAIYHQILNEYLELPKKDWIAYYHTK
FT                   QTTKTAKEQKRLAKAADSVHKNSAHSLVLREYAQTYVDDWYGEIHITFKNNKLHMQFGN
FT                   TPELKGTLEHYQHNTFIVRWHDKTLKADAFVNFNLNEDGGINYATMKAVSRATDFSFDF
FT                   HDLKLVPKN"
FT   gene            complement(165803..166351)
FT                   /locus_tag="CPS_0155"
FT   CDS_pept        complement(165803..166351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0155"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by similarity to SP:P11742; match to
FT                   protein family HMM PF01035; match to protein family HMM
FT                   PF02870; match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26987"
FT                   /db_xref="GOA:Q48AJ0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AJ0"
FT                   /protein_id="AAZ26987.1"
FT                   /translation="MFIDYLDTPLGLFEFMATEQGICQAIFCGDQSYDDKKGERKANDI
FT                   TALCKQQLIEYFAGQRQTFTVPLDPQGTEFQQSVWGCLAKIPFGTVKSYGEIAKMLDKP
FT                   KASQAVGGANGRNPITLIVPCHRVIGGDGSLTGYAGGIERKLWLLNHEGVEVKQTNNNA
FT                   NLDIKNVINKRQEKTQFLR"
FT   gene            complement(166384..167022)
FT                   /locus_tag="CPS_0156"
FT   CDS_pept        complement(166384..167022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0156"
FT                   /product="putative methyltransferase"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26323"
FT                   /db_xref="GOA:Q48AI9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI9"
FT                   /protein_id="AAZ26323.1"
FT                   /translation="MNQAKKQLSKKLLSGRGQGKSAGKIRIIAGKYKGRKLPVLMAEGL
FT                   RPTTDRVKETVFNWLMPYIAQANCLDCFAGSGSLGFEALSRGADEVTLVELNRAAANQL
FT                   LENKDLLKADNINVINDNALVFLKKDPLKVGLTAKSDKPFDLVFLDPPFRKQLVEQTAQ
FT                   LLNHFGLADQALIYVEMEADSTQVIPANWQLIKEKISGQVVYQLYQYQG"
FT   gene            167160..168605
FT                   /gene="ftsY"
FT                   /locus_tag="CPS_0157"
FT   CDS_pept        167160..168605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="CPS_0157"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by similarity to SP:P10121; match to
FT                   protein family HMM PF00448; match to protein family HMM
FT                   PF02881; match to protein family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24378"
FT                   /db_xref="GOA:Q48AI8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI8"
FT                   /protein_id="AAZ24378.1"
FT                   /translation="MSKKKGMLSWLGFGKKEKQPSTEENNNEALSVAESVEQLDEKMVE
FT                   SVVNEAEKSITEHAVEQEATADVVNDDVNVLEDSAAETTEAVAIAAVTVDSVTEDSVSE
FT                   ENAQVVETELTSEELPEAKLLAEMEAVEQQVESIDDVEAVEETLEDVSKTQADTAADSE
FT                   PKVEEIVDEKAESKLGFFARLKQGLSKTRQNLGGGLIDLFRGKQIDDDLFEELETHLLL
FT                   ADVGVETTMKIIESLTQSANRKQLKDASALYDLLKIELKKVIEDVSQPLVIPEDDGPFV
FT                   ILMVGVNGVGKTTTIGKLAKQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNNIPVIAQ
FT                   HTGADSASVIFDAISAAKARKVDIIIADTAGRLQNKAHLMEELKKVVRVMKKLDVNAPH
FT                   EVMLTLDAGTGQNALSQTKLFDEAVGLTGLTITKLDGTAKGGVIFAVADKHSIPIRYLG
FT                   VGEGIDDLRPFNSDDFIDALFSK"
FT   gene            complement(168688..168789)
FT                   /locus_tag="CPS_0158"
FT   CDS_pept        complement(168688..168789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24915"
FT                   /db_xref="GOA:Q48AI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI7"
FT                   /protein_id="AAZ24915.1"
FT                   /translation="MVEENGYLEEYCPVLRTTELLMITAHLLLRQNH"
FT   gene            168906..169613
FT                   /gene="ftsE"
FT                   /locus_tag="CPS_0159"
FT   CDS_pept        168906..169613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="CPS_0159"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by similarity to SP:P10115; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27883"
FT                   /db_xref="GOA:Q48AI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI6"
FT                   /protein_id="AAZ27883.1"
FT                   /translation="MINFNKVNKTYPGGFLALKQVSFSLESGEMAFLTGHSGAGKSTLL
FT                   KLISLMEKPSSGSIQVNHTELSDIQYKQVPYVRRGIGMIFQSHNLLKDRTVFDNVALPL
FT                   IIEGVSHSEIKKRVATALDKVHLSAKLKCYPHMLSGGEQQRVGIARAIVNKPPILLADE
FT                   PTGNLDPKLSLDIIRLFEEFNAAGVTVLIATHDLGLIARMKYRTLTLKEGTMINDGIVD
FT                   GLQAQGTSDEQYS"
FT   gene            169597..170571
FT                   /locus_tag="CPS_0160"
FT   CDS_pept        169597..170571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0160"
FT                   /product="putative cell division permease protein FtsX"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28465"
FT                   /db_xref="GOA:Q48AI5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI5"
FT                   /protein_id="AAZ28465.1"
FT                   /translation="MSNIHSSGLKARSSLLARLLTLPIRHFQQAVGSLGNLWRTPFTTA
FT                   MTIFVLGISLALPATLHLFVKNAEQVSEQWDSASQITLFLKLSTSEKSAQNLIKRISLY
FT                   NDVAEVRYISAKQALKEFKILSGFGQSLEYLDKNPLPATLLVTPTQRASQAQAANALLA
FT                   KLSKEREVEQGKLDLEWLTRLEAMARLLEDIVLGVALLLCLSVVLIVGNTIRLAILNEK
FT                   DAIAIMKLVGATDSFIQRPFLYSGIWYGIFGGILSCIAVTLLAWYLGYAISDLSELYQS
FT                   NFQLQGLSGSEALMLIGFAIVLALVGSYISVSQHIKAIEPNAD"
FT   gene            170906..171763
FT                   /gene="rpoH"
FT                   /locus_tag="CPS_0161"
FT   CDS_pept        170906..171763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="CPS_0161"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="identified by similarity to SP:P00580; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545; match to protein family HMM TIGR02392"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26576"
FT                   /db_xref="GOA:Q48AI4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI4"
FT                   /protein_id="AAZ26576.1"
FT                   /translation="MSEAMQLTLPKSGSIEAYMQSAYSIPMLTAEKEHDLATRLYNEND
FT                   LQAAQELIMSHLRFVIHVAKGYSGYGLPHADLVQEGNVGLMKAVKRFNPEVGVRLVSFA
FT                   VHWIKAEIHEFVLKNWRIVKVATTKAQRKLFFNLRKNKKRLGWFSTEEVNTVAENLGVT
FT                   TKDVMEMESRMSSHDQAFELSKDDDDNLGSSSFSPAQYLQDKQSDLAVEVENDNWDNHA
FT                   NKRLSTALVTLDERSQDIIKTRWLTEDKTTLQELANKYQISAERVRQLEKNALSKLKNT
FT                   MVFD"
FT   gene            172025..174478
FT                   /locus_tag="CPS_0162"
FT   CDS_pept        172025..174478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0162"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27037"
FT                   /db_xref="GOA:Q48AI3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI3"
FT                   /protein_id="AAZ27037.1"
FT                   /translation="MSLRTARKNIVNRAVMIALAATSVTSVQAVAEEGAEEVERIAVTG
FT                   SRINRTDIESASPVTVISSDFITKSGFTSVQEILSMQPAAAGMSLGSTSNNGSGGSATV
FT                   NLRGMGVQRTLVLLNGRRMVASGTGADSSVDLNTIPVSMIQTIEILKDGASAVYGSDAI
FT                   AGVVNIITKKDFQGTEITADGSITDKGDGESGGFSLLHGRDFAGGNLVVGAQYSNRGEI
FT                   IQSDRDFVPAGESSFVPGGSLGGMVPDGEGGFVPREESYDYTDDSYAQTPNELLSLFTN
FT                   FNSEIADDTELSVEFMYTRRESNQQMAPQPASIDLDTSLLDDNYTDQFKDENGVLPEEL
FT                   EYRRRMTDAGPRIYGQETDTYRASVGLTGYLSNDSQWDMSATYGRNDSKDSVGNSIHAG
FT                   NMEKSIYNHQDDWFSGDPMSNDFLASEGVMYTEQNEGGNEQFILAAGYSGVNEHDIGYA
FT                   VGVESRFESGYYTPDLITQAGESTAAQQDPTEGNYSVQSIYGEISVPVTDSFTVEAATR
FT                   YDNYSTFGGAATWKLGATYSITDGLMFRAVAATGFRAPSVSELYGGNSGSFDYLTDPWD
FT                   NEQDSQILVNYTSDADLKPEESESFTAGVVWEITEGLSTTMDYWQFDITNAISRVNVQN
FT                   EMNKCFGDDLVACDTIGITPGGDLSEMTSTLTNIGQQNTSGIDWNVSYTAGMFKVMFDT
FT                   TYLLEFEEDGISYEGTIGGNMGGYSQLKSNLTVSADLTEDVNLLYTANYIQGMDGDGYT
FT                   TDDVIYHNVSAAYHINDAWQVTGGIKNLFDTEPEEVPDGNDMNTVPNIYDVVGRTFFVN
FT                   TSYKF"
FT   gene            174742..174999
FT                   /gene="tatA1"
FT                   /locus_tag="CPS_0163"
FT   CDS_pept        174742..174999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA1"
FT                   /locus_tag="CPS_0163"
FT                   /product="Sec-independent protein translocase protein TatA"
FT                   /note="identified by similarity to SP:P25895; match to
FT                   protein family HMM PF02416; match to protein family HMM
FT                   TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24000"
FT                   /db_xref="GOA:Q48AI2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI2"
FT                   /protein_id="AAZ24000.1"
FT                   /translation="MGGIGIWQLVIVAVIVVLLFGTKKLRNIGGDLGSAIKGFKSAIGE
FT                   DKEQKNSAEKTSDTLADSSKSTTEEVVKTTESKTKESDQA"
FT   gene            175003..175476
FT                   /gene="tatB1"
FT                   /locus_tag="CPS_0164"
FT   CDS_pept        175003..175476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB1"
FT                   /locus_tag="CPS_0164"
FT                   /product="Sec-independent protein translocase protein TatB"
FT                   /note="identified by similarity to SP:O69415; match to
FT                   protein family HMM PF02416; match to protein family HMM
FT                   TIGR01410"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24647"
FT                   /db_xref="GOA:Q48AI1"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI1"
FT                   /protein_id="AAZ24647.1"
FT                   /translation="MFDVGFWELILIAIMGLVILGPERLPVAIRTLRGWISGARKFSDT
FT                   VKSELTEELRIHELHANLKKAEESNLENLSPEVAASLKSLQEAADSVAEPFKKVDRQPL
FT                   ESMIASSLASAPQAKVEPEMAQDSEEPKISSAPIENEKKPDQLVNPESDKPQP"
FT   gene            175473..176240
FT                   /gene="tatC1"
FT                   /locus_tag="CPS_0165"
FT   CDS_pept        175473..176240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC1"
FT                   /locus_tag="CPS_0165"
FT                   /product="Sec-independent periplasmic protein translocation
FT                   protein TatC"
FT                   /note="identified by similarity to SP:P27857; match to
FT                   protein family HMM PF00902; match to protein family HMM
FT                   TIGR00945"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25197"
FT                   /db_xref="GOA:Q48AI0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AI0"
FT                   /protein_id="AAZ25197.1"
FT                   /translation="MSTPPTPVASLFDHLLELRNRLLRSILGVLIVFCCLVYFAQDIYQ
FT                   YVAQPLLATMPEGSQMIATDVASPFFAPFKLTLVLSLFIAMPFVLYQVWSFVAPGLYSN
FT                   EKRMIAPLMFGSTLLFYSGIAFAYFLVFPVVFAFFTSVAPEGVVIATDISSYLDFILKL
FT                   FFAFGAAFEIPIAIILMCWTGMTTPDSLREKRPYVVVGAFVIGMLLTPPDIISQTMLAV
FT                   PMLILFEVGIIIASFYHKEEDEDESNNIKENDK"
FT   gene            176237..176728
FT                   /locus_tag="CPS_0166"
FT   CDS_pept        176237..176728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO4205"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25915"
FT                   /db_xref="GOA:Q48AH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH9"
FT                   /protein_id="AAZ25915.1"
FT                   /translation="MTKSIKLTYFTVITSLLLSPTVLAKEENLADRVQDCVKITQDTER
FT                   LTCFDQLTSKRSAVIVEPEITDLTAEQVDTFSKGQVKKTTEELANQINSITLTISKLSK
FT                   TPYGQWKITFENGQKWQQKDSYKLSLKTGQRVVLTKGAITSVFLQKENTNKRIKVKRLK
FT                   "
FT   gene            176756..177568
FT                   /gene="tatD"
FT                   /locus_tag="CPS_0167"
FT   CDS_pept        176756..177568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="CPS_0167"
FT                   /product="deoxyribonuclease TatD"
FT                   /EC_number="3.1.21.-"
FT                   /note="identified by similarity to SP:P27859; match to
FT                   protein family HMM PF01026"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26936"
FT                   /db_xref="GOA:Q48AH8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH8"
FT                   /protein_id="AAZ26936.1"
FT                   /translation="MIDIGVNLTNKRFEKDREDVIRRAQKAQLDGLLITGTSVAESQKA
FT                   LALCQHYQTSFPDFLFSTAGVHPHDADHVTADYLEQLKLLAKQQQVKAIGECGLDFNRN
FT                   FSAPAQQQKVFSEQVALASELQMPLFLHQRDAFEPWFSTLSPYFSEVPAMVAHCFTGTK
FT                   SELTQCIAADMYIGITGWLCDERRGQSLRDIVSLIPLNRLLIETDAPYLTPRTIRPKPK
FT                   SSRNEPCYLPFIVKEIASITGLDQEEIAWQTSRNAAKVFDFPSKKEMI"
FT   gene            177644..178450
FT                   /locus_tag="CPS_0168"
FT   CDS_pept        177644..178450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0168"
FT                   /product="GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25320"
FT                   /db_xref="GOA:Q48AH7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH7"
FT                   /protein_id="AAZ25320.1"
FT                   /translation="MTEQNAEHLCFGMGIFLGSLITLLLGLYLNRHYRRKYLKMLQQLK
FT                   LAKSNVTIAEQTMKTLANEQQDSQDLLEERVQERTLELNIALQELESANQELERKNVLD
FT                   ELTGLHNRRFYDQKIVAEYRRSRRNLTALSLVLIDVDLFKAVNDTHGHLAGDQCLIWLA
FT                   SHIKQSLKRSTDRAFRYGGEEFCLILPNTDAEGALLFAEQLRVQVDAQAFQFRDVEIPL
FT                   TISCGISTYQQQVDIGPEQIFSGADNALYQAKHNGRNQTKQHIFTE"
FT   gene            178463..179509
FT                   /gene="hemB"
FT                   /locus_tag="CPS_0169"
FT   CDS_pept        178463..179509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="CPS_0169"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="identified by similarity to SP:Q59643; match to
FT                   protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26913"
FT                   /db_xref="GOA:Q48AH6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH6"
FT                   /protein_id="AAZ26913.1"
FT                   /translation="MSHNGNSAFGQYPARRMRRMRVDDHTRRLMAESQLTVNDLIYPVF
FT                   VLEGDNQREAIASMPGVERKSIDLLLEEAQELVDLGIPAIALFPVTPSDKKSLMAEEAY
FT                   NPDGLAQRAVRALKAKFPQLAVITDVALDPFTTHGQDGILSESDDNKAGKTGYVVNEVT
FT                   KDILVKQALSHAEAGADIVAPSDMMDGRVGAIREGLEENGFVNTKILAYSAKYASNYYG
FT                   PFRDAVGSSGNIKGGNKHTYQMDPANSNEAMHEVAQDIAEGADMVMVKPGMPYLDIVRR
FT                   VKDTFQVPTYAYQVSGEYAMHMAAIQNGWLAEKPCVMEGLLAFKRAGADGILTYFAKQV
FT                   ARWLKEDA"
FT   gene            complement(179683..180330)
FT                   /locus_tag="CPS_0170"
FT   CDS_pept        complement(179683..180330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0170"
FT                   /product="putative glutathione S-transferase"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28686"
FT                   /db_xref="GOA:Q48AH5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH5"
FT                   /protein_id="AAZ28686.1"
FT                   /translation="MTVDPVHIYGPRFSNFVRSVMLVCEEKEIAYTVGFEVDGSNIAFK
FT                   GEQHLKWHPFGKIPVLLEGKLALPETASICRYLDEDKQLQPHQNSQVHAQHDALCALIS
FT                   IDIDKILVRDYLLEFAFPKGENNSIRFDVVKEVQPKAAAIFAIIEQVLQQETALTSKDF
FT                   TIADALLAPMLHYISCLPAGFDLITDYPKVEQYLANVMARPSCQKVLTAKEF"
FT   gene            180462..181031
FT                   /locus_tag="CPS_0171"
FT   CDS_pept        180462..181031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0171"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24347"
FT                   /db_xref="GOA:Q48AH4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH4"
FT                   /protein_id="AAZ24347.1"
FT                   /translation="MAWHETHKEQSKDRILKSAAMLFTHYGFEKISINQVMKNAELTRG
FT                   AFYSHFNSKSDLYAQAISKGAKVASKRKPENCPQNMKDFAKYYLSTEHRDNNYEQACPL
FT                   AFLVSDINQQNEQVKETYTKTLKAFIAQAQSLTVSREKALQSAVLMIGGLALSRALDDK
FT                   NFSNELLAACKAGVTSLSTEEGVNVS"
FT   gene            181021..181323
FT                   /locus_tag="CPS_0172"
FT   CDS_pept        181021..181323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26654"
FT                   /db_xref="GOA:Q48AH3"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH3"
FT                   /protein_id="AAZ26654.1"
FT                   /translation="MSAEWSIILLNAVIIVIAYVWVYPKLAGKNSNKVAIFDCVTSGLA
FT                   VLIVANKYWGTGAEFNFLQFELNWFWFTLLSYSVIEIPIALWYFRASLIKGNADK"
FT   gene            complement(181367..182359)
FT                   /locus_tag="CPS_0173"
FT   CDS_pept        complement(181367..182359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0173"
FT                   /product="phosphatase, Ppx/GppA family"
FT                   /note="identified by similarity to SP:P25552; match to
FT                   protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27325"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH2"
FT                   /protein_id="AAZ27325.1"
FT                   /translation="MTDILSQNQALPKTIPQYDESHYAVVDLGSNSFHLLITQLITSPT
FT                   GKSIKTVNKVKQKVRLAAGLTSHNLLTDEAITRGLDCLKNFALYLNSIPVNNTLIVATA
FT                   ALRIAKNNQVFFDAAKKILPKEIKLLSGEQEAKTIYAGVAHTSISNIQQSATKQLVLDI
FT                   GGASTEIIVGLGCTAKKVVSLDIGCVSFIGKYFTNDLLNKENFNQCIAGAADIINTVKA
FT                   EFIQLGWQSAVGSSGTMQAMAEILIQRQQTPIITLEFLYEIQQTLIKCKTIDSIEIAGL
FT                   RADRKAILASGLSILIALFQCLHIEALCLSSGALREGLLFELVPDAKII"
FT   gene            complement(182390..183676)
FT                   /gene="rhlB"
FT                   /locus_tag="CPS_0174"
FT   CDS_pept        complement(182390..183676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="CPS_0174"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /note="identified by similarity to SP:P24229; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27711"
FT                   /db_xref="GOA:Q48AH1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH1"
FT                   /protein_id="AAZ27711.1"
FT                   /translation="MKKTHLTETKFADLNLAPQVVTGLEAMGFDYCTSIQAKSLPVLLQ
FT                   GTDLAGQAQTGEGKTIAFLAATFHHLLQKEAPTHNQPRALIMAPTRELAIQIHRDATEM
FT                   AKSTGLRLGVVYGGEGYESQRLELEAGVDILIGTCGRLIDYMKQGIYNLKNIEVIVLDE
FT                   ADRMFDLGFIKDIRYMFDKMPPATERLSMLFSATLSFRVKELAFDHMNDPTSVEVEPEQ
FT                   KTNSRISEELFYPSNEDKMTLLQTLIEEDWPEKAIVFANTKHVCEKVFDHLNADKIRVG
FT                   LLTGDVPQKKRLKILEEFTDGTVDILVATDVAARGLHIPSVTHVFNYDLPDDCQDYVHR
FT                   IGRTGRAGETGHAISLACEQYVFNLPEIETYIGHDLPVTKYDHDALLTDLPRPKPRQRR
FT                   PRTGANRQGGRANPRQGNRGSTPNRGTRS"
FT   gene            184024..184350
FT                   /gene="trx1"
FT                   /locus_tag="CPS_0175"
FT   CDS_pept        184024..184350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx1"
FT                   /locus_tag="CPS_0175"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28387"
FT                   /db_xref="GOA:Q48AH0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AH0"
FT                   /protein_id="AAZ28387.1"
FT                   /translation="MSDKIVQLTDDSFEADVLKASGLVLVDFWAEWCGPCKMIAPVLDD
FT                   IATEYDGKVTVGKLNIDQNSATPPKYGVRGIPTLLLFKDGEIADTKVGALSKTQLKEFL
FT                   DKNL"
FT   gene            184591..185850
FT                   /gene="rho"
FT                   /locus_tag="CPS_0176"
FT   CDS_pept        184591..185850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="CPS_0176"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by similarity to SP:P03002; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF07497; match to protein family HMM PF07498; match to
FT                   protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24621"
FT                   /db_xref="GOA:Q48AG9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AG9"
FT                   /protein_id="AAZ24621.1"
FT                   /translation="MNLTELKEKSINELVDLAATMKLENLARTRKQDIIFAILKAHAEG
FT                   DNDIFGGGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFSMRTGDTIQGKIRSP
FT                   KKGERYFALLKVTEVNFDRPENTRNKILFENLTPIHPTDRFSLARGNGSTEDITARILD
FT                   LASPIGKGQRGLIVAPPKAGKTLLLQNIAQSIAHNNPDAELMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKILTGGVDANALHRPKRFFGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGN
FT                   MELHLSRKISEKRVFPAININRSGTRREELITKPDELQKMWILRKIVHEMDEIGAIEFL
FT                   IDKLAMTKTNDEFFDSMKRK"
FT   gene            185928..187421
FT                   /gene="ubiD"
FT                   /locus_tag="CPS_0177"
FT   CDS_pept        185928..187421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="CPS_0177"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="identified by similarity to SP:P26615; match to
FT                   protein family HMM PF01977; match to protein family HMM
FT                   TIGR00148"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25184"
FT                   /db_xref="GOA:Q48AG8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AG8"
FT                   /protein_id="AAZ25184.1"
FT                   /translation="MVTYMKYSDLRDFISQLEKIGQLKRITQPISTHLTMTEISDRTLR
FT                   AKGPALLFENAVSESGEPYNMPVLTNLFGTPDRVALAMGQKDVGALRDVGKLLAMLKEP
FT                   EPPKGFRDALGKIPVYKQVLNMPVKVIKKPLCQQIVLSGDDVDLTKMPIQSCWPGDVAP
FT                   LITWGLTVTRGPHKERQNLGIYRQQVLSKNKVIMRWLSHRGGALDFQEFKKENPGEKYP
FT                   VSVALGADPATILGAVTPVPDTLSEYAFAGLLRGAKTEVAKSISNDLEVPATAEIILEG
FT                   YLDPEEMAPEGPYGDHTGYYNEVDNFPVMTVTHITMRKDAIYHSTYTGRPPDEPAILGV
FT                   ALNEVFVPILQKQFPEIQDFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFM
FT                   YTKFVIVCDDDINARDWEDVIWAMTTRMDPSRDTVLIENTPIDYLDFASPVSGLGSKMG
FT                   MDATNKWPGETNREWGEPIEMTQEIKNQVDELWDELDIL"
FT   gene            187630..188349
FT                   /locus_tag="CPS_0178"
FT   CDS_pept        187630..188349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0178"
FT                   /product="oxidoreductase, NAD-binding"
FT                   /note="identified by match to protein family HMM PF00175"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25711"
FT                   /db_xref="GOA:Q48AG7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AG7"
FT                   /protein_id="AAZ25711.1"
FT                   /translation="MKTVSCQIQSLSSLTPHVYKVLLKPDEKIDFIAGQYLNFIMSDED
FT                   KRPFSIASSPNSDLIELQIGAFAADSYPMQVIECIKASHASGEKVTIEIPLGHAQLRTE
FT                   SERPLLLLAGGTGFSYIKSMFEYLAEQKSQRHIMVYWGLREESAVYELEKTIATIAKLP
FT                   HANFIPVIENIKESNENPWQGKTGLVHQAAMHDIVGFEPYDIYLAGRFDMVGAIRSDFV
FT                   EHGALLEHMYADAFAFI"
FT   gene            complement(188462..189121)
FT                   /locus_tag="CPS_0179"
FT   CDS_pept        complement(188462..189121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0179"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by similarity to SP:P29369; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26123"
FT                   /db_xref="GOA:Q48AG6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AG6"
FT                   /protein_id="AAZ26123.1"
FT                   /translation="MIQPEKIIIADDHPLFRQALLGTLKAKLTYTVWLEAQTIEELEQQ
FT                   LTNNNDSDLLLLDLNIPGAHGFNTLIHVRNHFPQIPVVIVSAHEDHDTISKAMSYGAAG
FT                   FVPKSTPVDDIYSAIVAVLSGDTWLPASFEQKQRDNSDGDIAERVASLTQQQYRILMMF
FT                   AQGMLNKQIAYDLNVSEATIKAHATAIFRKLDVRNRTQAVIAIAQLSLTETGFKQG"
FT   gene            complement(189694..191157)
FT                   /gene="pepD"
FT                   /locus_tag="CPS_0180"
FT   CDS_pept        complement(189694..191157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="CPS_0180"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="identified by similarity to SP:P15288; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01893"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27390"
FT                   /db_xref="GOA:Q48AG5"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AG5"
FT                   /protein_id="AAZ27390.1"
FT                   /translation="MSTLSQLKPASLWQLFEKICSIPHPSKHEQKISLWIQDWAKELGL
FT                   AIKEDAVGNLFIKKPATAGMEDRKGIILQAHMDMVPQKNNDTDHDFITDPIKPYVIDSG
FT                   DWVTAEGTTLGADNGVGLASALAILASDDIPHGPLEVLVTIDEEAGMTGAFGLEAGWLD
FT                   GDILINTDSEQEGEVYMGCAGGIDGNATFALTLEDVPSNYQAFNLSISGLKGGHSGVDI
FT                   HTGRANANKLLVRFLLSASIDFDISLTELNGGSLRNAIPREANASFVVAKDKVEALKVA
FT                   LADYLSTISANLGAIETDIDMLLISPEDFEQCWTKATQASILRALNACPNGVIRMSDDI
FT                   EGIVETSLNLGVIHTRGSKLNAMVLIRSLHDDGRLETQRMVQSVFELAGANVVFSGAYP
FT                   GWKPNTDSAIMQTVRDTYESIFNKVPAVMVIHAGLECGLFKTAYPHWDMVSIGPTIKFP
FT                   HSPDEKIEIATVEQYWQLLVAVLANIPKK"
FT   gene            complement(191621..192217)
FT                   /locus_tag="CPS_0181"
FT   CDS_pept        complement(191621..192217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0181"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27936"
FT                   /db_xref="GOA:Q48AG4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AG4"
FT                   /protein_id="AAZ27936.1"
FT                   /translation="MVATQNKNLKPNRKHQILESLALMLQNCPGQRITTAKLAAEVGFS
FT                   EAALYRHFPSKARMFEGLIDFIEESIFSRINLILADHKEALVRCHHILHVLVVFAERNP
FT                   GMCRILAGDALMGENERLRGRVHQFFEKLESQFKQVLRERKLREGKTFTINEAALASLL
FT                   VSFAEGKISQYVRSGYSKKPSTDFNEQWQFLMANK"
FT   gene            complement(192296..193507)
FT                   /gene="coaBC"
FT                   /locus_tag="CPS_0182"
FT   CDS_pept        complement(192296..193507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="CPS_0182"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM PF04127; match to protein
FT                   family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27886"
FT                   /db_xref="GOA:Q48AG3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AG3"
FT                   /protein_id="AAZ27886.1"
FT                   /translation="MQILQDKKIVLGITGGIAAYKTPELVRRLKDHGADIRVVMTEGAK
FT                   AFITPLTLQAVSGNHVSDSLLDSQAELAMGHIELAKWADLIIIAPATADIIARITAGMA
FT                   NDLLSTLCLATSAPIAIAPAMNQQMWHAKATQVNISTLKQWGFHLWGPGAGEQACGDIG
FT                   LGRMLDVNELVTLSSDFFVDKYLQDQHWVITAGPTREAIDPVRYISNHSSGKMGYAIAH
FT                   AALRAGAQVTLISGPVNIPAPAGCELIQVTSAEQMHQQALIYVPQATTFVACAAVADYR
FT                   VADIADEKIKKDSEHMQISLIKNHDIVADVANLANKPFIVGFAAETQNVEHYARGKLMR
FT                   KNLDLIAANDVAKAGQGFNSDDNALTLYSAIDKIEIPLANKQIVAKQLVSLINQHYLAK
FT                   NAKK"
FT   gene            193642..194136
FT                   /locus_tag="CPS_0183"
FT   CDS_pept        193642..194136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0183"
FT                   /product="DNA repair protein RadC, n-terminal fragment"
FT                   /note="The radC gene has been interrupted by a phage
FT                   insertion; identified by similarity to SP:P25531"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25967"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AG2"
FT                   /protein_id="AAZ25967.1"
FT                   /translation="MLKESRFKESALNESPLNQNALKNWPEMERPREKLVSLGSSSLSD
FT                   AELLAIFLRTGVRGCNVVDLARQLLKSFGSLGAIFAASQEDFCARHGLGMAKYVQLQAC
FT                   LEMSKRYLAENIKDIDCSLTSSQATRDYLLSELRLETREIFAVLFLDIIPVKTSYYFNL
FT                   H"
FT   gene            194250..195698
FT                   /locus_tag="CPS_0184"
FT   CDS_pept        194250..195698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0184"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24058"
FT                   /db_xref="GOA:Q48AG1"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AG1"
FT                   /protein_id="AAZ24058.1"
FT                   /translation="MTISIQPIKVNVLVRIDNTDKTYELPAVYVPGEGYLGSFLCYIVK
FT                   HRTKSKSWKDKAIQAMILLIEYTYANEGCFDTKQQMFEEFTNSLHAGTINKDGDDKTGL
FT                   RWRPLSVENANALKGHITKFSDHLFKETGGESALLNPIRTATGAEKMVNLAAYHHKKNA
FT                   VFLSHLFDKNKNNDIDTSRNVRNRKEFRTPQVDQSVNFSEEHIDALLWDGFIQPGSTYL
FT                   SPVHERYKLAPLLITMLIHYGGIRPCEAFHLYAEDIHLDPSERVVIRVYHPIQGRAPEY
FT                   YRDQPGNKGATRIEYLNKKYGLDDRFSDSRKAYHAGWKEPALADSKAKFFYVYFAPTEK
FT                   GILFYQLFKQYMIHQRKVRKLGGQDTKHAPEAHPFLFTNRNGDPLSMRSFEDFHKEAVK
FT                   AIGLEAFRANGTSQYCHRHAFKKRLEGMSVPEVLRMDLMHHKSIYSQNEYGKASNQEIY
FT                   DKLSNANALSSHETALLSNLKNAQ"
FT   gene            195714..199034
FT                   /locus_tag="CPS_0185"
FT   CDS_pept        195714..199034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0185"
FT                   /product="putative site-specific recombinase, phage
FT                   integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25294"
FT                   /db_xref="GOA:Q48AG0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR024965"
FT                   /db_xref="InterPro:IPR028229"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AG0"
FT                   /protein_id="AAZ25294.1"
FT                   /translation="MSNHRDKFYITWEEASKATIVLDCAYKKDYLEKYKSDPKLPSNPQ
FT                   RSYPEFKEKGGWSAYLSTGDKFYRTWAEASKAAIALGFNRSGHYFNGYKKDPKLHSDPS
FT                   VHYPDFYKKGGWAGFLGNPVPTPKHETWEEASAAAIKLGITNTHEYKALYKKDPLLPSD
FT                   PQRSYQDVWDKNGGWSGFFGRQLGSIDTSKMLKVLEIIDIEGYAEIDHVKLPKDPLKTY
FT                   DLETFEELLTLKVYDLAQVKAYCERKGFQEVAEYRKASSDQQHLNNATPIGIKGYVSGK
FT                   SIISKLTNFERATKEHPDYSQWFDMAIKFALLGKNIRKKKVILFNFVMEYLVDLEQPTQ
FT                   PAAFFARKHAPPLLTSFMEKQPKFAQSITGINILKDFIEDTFHRCCQDEDDDGISVVLP
FT                   GFINKWSRIISTVEPVKIDRPDKSEKWPLAMNYIDRAAKFLVPDSAKTFQDVMQLECDW
FT                   FIVDESIIDKDDLNCVWRTKMINSGYGKKMRYQMWSPVRTLALFVLFSMPLRGQQICWL
FT                   DSGEADTEIPIINAQDEVVWVKNDHHLINDVNKRTERQGFLRRFKDAKKTTVTNDKGIE
FT                   ETRREDIIGSYITTNKTSKDGKGYEVAYMPIHLIKWMIRLREWQSKYNPIDKLTSWESV
FT                   ALINEKNNKILKAMKSQAFLFRDPDTLHAEDKCQPIGRDKAMSNTFSWVLYQIQDKDIP
FT                   LAYLPEGKSDCQMNNYKSDFTPHGMRVSFISAYILDAKLPISIVAALVGHASIVMTIYY
FT                   TVTTNQDYYEMLSAGHQAALTAAPARIAGLIKNKQLKLSSSDFFDSNGQPVKPMYDKAP
FT                   YAALGFKDFGICPVACSKCHEGGDEVKPGLNVFGPVRSGYLGPSNCFVCRFFITGPGYI
FT                   GGLKTMLAEVGLEAKESGKRMEKFREEREELEYLQYRSRKDDLPFEHEAKLNNILTLHQ
FT                   QEQEKFDALSYDASTIAIMGYRCSKLLQNQSENAENKGHQLILQEGNPMLGVKIDEVSE
FT                   FAHMTEICQNAEIYACANPSRALPKRTKMLDMFALNNGFSPKIFLLSDEDQLKVGNQIT
FT                   SIMLNRLNGSWDDAERLMDGTVTLKDLGLSGKEIMEPVTLALNHWTPEAQVRIEVINV"
FT   gene            199027..199722
FT                   /locus_tag="CPS_0186"
FT   CDS_pept        199027..199722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25834"
FT                   /db_xref="GOA:Q48AF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF9"
FT                   /protein_id="AAZ25834.1"
FT                   /translation="MYNEKIEDVINSVKADASSTISQKIDVLVGICESQIERGSSDFSV
FT                   TMIGKLFKKQGGVAAQAIRNKTGAKYKAVISAFEKYHGMQLAALNNAPNSNLPDWVVKI
FT                   TDSNARWLVKDLIEENARLTRTLQAHKIRDKEHAQLVDMRPKFNAPTLVTKALDDFEVK
FT                   LLSEFFSEDNLEQLGLAPDERGCLVDSSEGKRAITPPGFIDIINKLCGYDSQGNSLALK
FT                   TSVKRNKNG"
FT   gene            199715..200194
FT                   /locus_tag="CPS_0187"
FT   CDS_pept        199715..200194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0187"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28842"
FT                   /db_xref="GOA:Q48AF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF8"
FT                   /protein_id="AAZ28842.1"
FT                   /translation="MVDKKLNGTQQARKDEAEFKHWADAFETEIDLNPEKVAARVKALL
FT                   NKASGCLLRKRLAIEVGFKDSQPFSKNIVIKGRLTNLEDKLRPKFLPAKKDVLPQKKQP
FT                   KCNNQDTPVGTISDKEAAKLTQRILELESENRALKGDYGRFSEVAEVYRRLGDMK"
FT   gene            200194..202560
FT                   /locus_tag="CPS_0188"
FT   CDS_pept        200194..202560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0188"
FT                   /product="putative helicase"
FT                   /note="identified by similarity to GP:28809634"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26895"
FT                   /db_xref="GOA:Q48AF7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF7"
FT                   /protein_id="AAZ26895.1"
FT                   /translation="MNAIPNVTIRVTKVLATYNSGKMRFSGVPVCPNTHQKLSKRDFYL
FT                   ITATPEQAVFEPEIGQVWKINGEAYTEEKPSYKKHGVDLFHEIRRAKQCVCVLPKTEDA
FT                   FIAFIKEIAAFKGVGAKWAKKLWTEFKLETLKHMEHRRAATLETVVTPNIAKSLINGYS
FT                   KYRNLKYATWLTSKEIPIKIQKMIFEFQPISNEIRIHQSGYKYAIDPRTIIEENPYILA
FT                   SSFSMGFFDVDKLVRRKFEPNILSEDPRRMIAAVSEAIRLCVKGDYETGGHTTVPYKKL
FT                   LKALTEILQETEQLASIDKSYTKPLFTMEELAITALQAHQKDAYVIYPDGQYQLTPTYL
FT                   MENVIALRMLNMKSQIVTFGEEESEACKKAFDLSPFPLLSKQKEAVFTAIESSISAIIG
FT                   GAGTGKTTVLHAVLTAFEALGYVSDASLCPDKTTTNHNIKTMALSCRAAKRMRDCINKS
FT                   SDGSRRERQISATSIAQFIHQTVIEDAEGKYLVVIDEASMLDVATMYNIITNIHPNVRI
FT                   LLVGDHYQLPPIGGGNVLADVVNSGVIPTVELDIVKRQKGNSGIPEYSKFVREGTVPPK
FT                   LSSGAVYFHEVESDFIADKCASLFALSPLDSMVVGSTNAVVKEVNKFCQDEVNPDGERY
FT                   AEGKHSDFIKIVLGGLRQGDSVLFKENISLDVTNGSLGKLVSVECKKDTFGLVVMDDDD
FT                   IEVRLEEEIMPALMLGYSMTVHKAQGSQFPIVIIALAGGYIDRSWLYTAITRAECELHI
FT                   VSTKKKLLTAINKPPSALGRRTRLKMLLQEGADQI"
FT   gene            202649..202888
FT                   /locus_tag="CPS_0189"
FT   CDS_pept        202649..202888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0189"
FT                   /product="putative plasmid replication protein RepB"
FT                   /note="identified by similarity to GP:5123475"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ23992"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF6"
FT                   /protein_id="AAZ23992.1"
FT                   /translation="MEVKELKNVFDAGGLKHAVVSPAFGTKGYEVILTTSKNQNVVLTA
FT                   QRSDNQPRVFKSIDAAISVTTKIGFRRVLFQLPN"
FT   gene            complement(203326..204564)
FT                   /locus_tag="CPS_0190"
FT   CDS_pept        complement(203326..204564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24285"
FT                   /db_xref="GOA:Q48AF5"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF5"
FT                   /protein_id="AAZ24285.1"
FT                   /translation="MDEREGFFSLPKKNTFEILLTVGFFIGVVVCIFIISSDDLTSRES
FT                   SIVSLFLTFLSIIASWLLANIYGDSQHIKAIEEVKEMHNEKVKTFALKAAEKVNNLSLN
FT                   INKLSIYLESELDAEYDLDTESLIGKEKIIESAIHSLTMLKSVNDTSLSDWHGIIDEEI
FT                   EERREAQEEKEERLNQLTYRLESLTLKKDEDNKDDRLEQQIETMKKDMRLLMAGVSGAH
FT                   ISVGKRKRREEIIKECPSCENKLKFSQRSMKNSIKTIHCSSCDSLISSSFVPAKDDFLL
FT                   TLKVKQKKETHCSDCGEKISFELDTEVKSRSVVNCGKCHKQVTAIRLENGEVKYTEGNE
FT                   YMSSTLTENDIENVSKALPLQPWPQGIHKKVATELNMSNSAVRRSMKILISRGIVKNQV
FT                   DGQLFDNVVQVKN"
FT   gene            complement(206369..207238)
FT                   /locus_tag="CPS_0191"
FT   CDS_pept        complement(206369..207238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24722"
FT                   /db_xref="GOA:Q48AF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF4"
FT                   /protein_id="AAZ24722.1"
FT                   /translation="MKSDSKNERTLLPFVVLTGVVVAPIIFIAGIIFGTELNASIVLTS
FT                   DSLSSWVAAIATVSIAVLTFILAKETWHLRNAQIEQLNEIKKESMRPNVVVNVQPSMVS
FT                   ISFWDVVIQNLGKGIAQNVNFEFKNIDGTVATDENNHLITIFSKLSLFENGCSSLGLGQ
FT                   SIKSFLFGFGDLKRDVGDADLFEQKIRLIIKFEDAEGNPYINSLDIDFNDYKGVSTLGG
FT                   ATDPTYSIFKELENIRKLFEPVFKTGFKRLKIDSFNSKDREQEVENRRLQEQEFLKQQE
FT                   KLQSTANK"
FT   gene            complement(207292..207462)
FT                   /locus_tag="CPS_0192"
FT   CDS_pept        complement(207292..207462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24972"
FT                   /db_xref="GOA:Q48AF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF3"
FT                   /protein_id="AAZ24972.1"
FT                   /translation="MVTPLIHSILLLCYRPMDYFALGRLKQQIHWVCILAYKQLKRDKI
FT                   QFAAFRFASQF"
FT   gene            complement(207350..207943)
FT                   /locus_tag="CPS_0193"
FT   CDS_pept        complement(207350..207943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28418"
FT                   /db_xref="GOA:Q48AF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF2"
FT                   /protein_id="AAZ28418.1"
FT                   /translation="MKASDVLKEIRQALKQTKVQGHATVSIDAMENYLMLFDKDVENDT
FT                   YYKSQNHEAQLAKFKAENDRSIAHANNETAHSLEMFKSVITAGQSALKSSMVVNGGAAA
FT                   ALLAFTGKIWETSTSELVANSLTSSIFIFCLGVLCAALATGTTYLSQMSFANGWLKLGH
FT                   SINTFNIAVVLSSYGLFCFGAFKAANSLGVHFGL"
FT   gene            complement(208074..208511)
FT                   /locus_tag="CPS_0194"
FT   CDS_pept        complement(208074..208511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0194"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26351"
FT                   /db_xref="GOA:Q48AF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF1"
FT                   /protein_id="AAZ26351.1"
FT                   /translation="MTAQLPKIQFKAKGSVTEPEEFSKDYLLYRRNILISFSLSFLLFM
FT                   SVSLKPVIMGISISPKVMWLCLGIGHIYQFIMWRLTSSIEQDSDKRFFNFRGIFRQAIG
FT                   AGTKRFPSKTKAQMWFLRALPIWAFIFGILFISIGFIQTIK"
FT   gene            complement(208990..209109)
FT                   /locus_tag="CPS_0195"
FT   CDS_pept        complement(208990..209109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0195"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25492"
FT                   /db_xref="GOA:Q48AF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AF0"
FT                   /protein_id="AAZ25492.1"
FT                   /translation="MEYGKSYSFGHWFQKGESGYTTAVIGNIVIYCGFLFVLL"
FT   gene            complement(209316..209624)
FT                   /locus_tag="CPS_0196"
FT   CDS_pept        complement(209316..209624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0196"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25537"
FT                   /db_xref="GOA:Q48AE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE9"
FT                   /protein_id="AAZ25537.1"
FT                   /translation="MNYEQAFKKAKRRQIIWILIYCPIVVVIYVLSVEFGAIYHNVYVW
FT                   LILLVAVLTVFSMRYGIKKIAEGVKCDSCGCNIYNNYLSCKNDGIKLNFCPSCGLKL"
FT   gene            complement(209905..210414)
FT                   /locus_tag="CPS_0197"
FT   CDS_pept        complement(209905..210414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0197"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25051"
FT                   /db_xref="GOA:Q48AE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE8"
FT                   /protein_id="AAZ25051.1"
FT                   /translation="MHNTKECIMCFSEIDERAKKCPKCTSLQAKFSNLENNPILVSILG
FT                   LFIAGIFAFMLYQNFYVRALEEKAIQNLKVTVTEISTKDESDGLYVACIGQIQNETDFK
FT                   FKEIKFQVDFFTEKNELADTFSITDEDIDILSNSSTNFRVRGVAHKEATEYNRCEVKIA
FT                   DAWSHT"
FT   gene            complement(210462..210881)
FT                   /locus_tag="CPS_0198"
FT   CDS_pept        complement(210462..210881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0198"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:P09162"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26835"
FT                   /db_xref="GOA:Q48AE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE7"
FT                   /protein_id="AAZ26835.1"
FT                   /translation="MRPRDMIKKLFTVDLYIKVRKNRFEAKNLSSSGSWETIQSEHPFT
FT                   TERLLVGTFSAAESALTKLIKSVTPRSFFKKSPQIIIQPMELLDGGLSEVEERIFKELA
FT                   LGSGAFKVILHTGSELTDSEAMQLIRSASMSTGQF"
FT   gene            211504..213966
FT                   /locus_tag="CPS_0199"
FT   CDS_pept        211504..213966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0199"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26151"
FT                   /db_xref="GOA:Q48AE6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE6"
FT                   /protein_id="AAZ26151.1"
FT                   /translation="METISKEFKSKVSLFWEAFNKNDFESAKTQCNQMKKSFSDEANPH
FT                   YLLGIIYFEEKRFDKSIIELKLALKKDSERKLGGYIYYVIGLNYSKNTFSNMENLNSIY
FT                   DIELARNAFESALTYENFNESNITELSQIYRNKFKLIQLFQKGLKKFPTKTSFYIKLSA
FT                   IYKKNGNISERESLLLDAKENIKSFHILFELGELYLEKSQYKCSREHFYLAEKLREGSG
FT                   LEFAVQVMIGNTHVNEGNPNLANEYYINAFHKEKNSCNFWFGLFGILASSAETSFADLK
FT                   NILEEMEVTSQLTIEEWYGEMPLYYGSNYFSFDFPIDEKHLINRLNLFKKQQRDTDILG
FT                   KIELIKASLYEFSSEDTKYIKCLKSAINYFSQHSYDFIFNKLAARYDYLLSHLQEEGKS
FT                   VNTLINEIVDYLEDDYSFRKEYIEYLPTIVTILFEEKKHKKIIEIKNIFTEKQIDKADI
FT                   WFHVGYAFNELGRPKESKYAYECNIKINGECTSTHNNLALLLENEGKNSDAVAMFQKAL
FT                   MINVDDEKLQSNLQNALDKQKAKSLLTYKNEAIDKSFVGAVGLLKSETFFSMETLLNFI
FT                   DRSKKENSFNDGILSIQDEMFPDLLRTNLVKSLELKNDWLIKNYIALTEEIDEYGIPYY
FT                   QVNPYLEPEIVKLKRMTVESELPKEWTEGIGNITIFKLDELDYFSIKHKISKINKKFKP
FT                   LVMRDFNELIFNHLVGNRKAVVVLSGSFVELLLTYYCEKKRIKAVEYTCKDSAKPKKKK
FT                   LYDCVLFDLISFIEEKRIFGNDFFLLSNLSRVYRNFIHPGVELKNSLDKSKSDLCFISS
FT                   LEILKKII"
FT   gene            complement(214165..214779)
FT                   /locus_tag="CPS_0200"
FT   CDS_pept        complement(214165..214779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0200"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27273"
FT                   /db_xref="GOA:Q48AE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE5"
FT                   /protein_id="AAZ27273.1"
FT                   /translation="MFRFRFASHYNQQLLSLLFGRWYYHRGSLVTILYFFTLLMAVPFL
FT                   IFPFLKEKHGAFMWIGTILGANILFAVGTFKSCVSGWISSSIGSRGACSHHGGVTSNMN
FT                   DIGYIILALSLLFLLVKFVIYQNKNTSDETINIKEITSVNEVKEFPDIPHQQTKFQGYD
FT                   KYISVWHNSGLSIEDIVVHLRSKNVFVSSQDVREYIEHKHS"
FT   gene            214798..214926
FT                   /locus_tag="CPS_0201"
FT   CDS_pept        214798..214926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26618"
FT                   /db_xref="GOA:Q48AE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE4"
FT                   /protein_id="AAZ26618.1"
FT                   /translation="MACYTLLAQGQAFDNAIIIRSSSEKCNIPGVSSANFNITRRD"
FT   gene            complement(214806..215183)
FT                   /locus_tag="CPS_0202"
FT   CDS_pept        complement(214806..215183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24334"
FT                   /db_xref="GOA:Q48AE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE3"
FT                   /protein_id="AAZ24334.1"
FT                   /translation="MHKIIVFISLVLFSFPILATDGNALIVNIKNAIKYMESPSNYGST
FT                   SNFVDSVHLIGKVKGVLSTVKFSKAALNSSLFCPPDMIDVTQSLRVILKFAEDTPGMLH
FT                   FSEDDLIIIALSKAWPCANNV"
FT   gene            complement(215219..215713)
FT                   /locus_tag="CPS_0203"
FT   CDS_pept        complement(215219..215713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25474"
FT                   /db_xref="GOA:Q48AE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE2"
FT                   /protein_id="AAZ25474.1"
FT                   /translation="MDAMTWGFVGTVVGATASIATTAITNWNTFKISQNTKIQDREERA
FT                   RVFQRETLLELQLELRNYIRASSLAYRADTKSFKDTDYWGVALPEGLSDQLLELNGKTS
FT                   ILIQRISNDDLRKNLSDLKSSVTNCQMAKNEYDAGAYYIEFIDLYGKSSEKLGEVLRNS
FT                   Y"
FT   gene            215846..215965
FT                   /locus_tag="CPS_0204"
FT   CDS_pept        215846..215965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27487"
FT                   /db_xref="GOA:Q48AE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE1"
FT                   /protein_id="AAZ27487.1"
FT                   /translation="MVSFNALLDKACFYLVFSGESVQKSIRKYIATFLLLTSV"
FT   gene            216167..216451
FT                   /locus_tag="CPS_0205"
FT                   /note="DNA repair protein RadC, C-terminal fragment; the
FT                   radC gene has been interrupted by a phage insertion;
FT                   identified by match to protein family HMM PF04002"
FT   gene            216546..216860
FT                   /locus_tag="CPS_0206"
FT   CDS_pept        216546..216860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO2807"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28584"
FT                   /db_xref="GOA:Q48AE0"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AE0"
FT                   /protein_id="AAZ28584.1"
FT                   /translation="MTDSSNEEMERRKSFRLDMEKELVDIVWTDENDQEHNKKIACLDF
FT                   ARGGLKLDCDQSIAVNTAVTVVFQSANASSQKLYGRVLRSIKQENGWFEIGLALDMDAE
FT                   "
FT   gene            216967..217635
FT                   /locus_tag="CPS_0207"
FT   CDS_pept        216967..217635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0207"
FT                   /product="parA family protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28024"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AD9"
FT                   /protein_id="AAZ28024.1"
FT                   /translation="MMILVGGEKGGSGKSCLAQNLAVYFAGNKKAIVLMVDCDPQRTTS
FT                   DWIQARNSDPSLPAINCIQLYGKIRNDLLSLVQHYDYVIVDCGGQDNLALRAAMSVADH
FT                   VIIPLRPKRRDLKTVPHMEDMLSTCKMVNPKMIASFVITQCPALPNQMGRILEAKEVCR
FT                   SYGINVLDAITYNRNIYDDSEEQGSSVIEIDPTGKAAHEMMTIAEELLAMEPDNSHEFN
FT                   "
FT   gene            217622..218059
FT                   /locus_tag="CPS_0208"
FT   CDS_pept        217622..218059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0208"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO2809"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24213"
FT                   /db_xref="GOA:Q48AD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AD8"
FT                   /protein_id="AAZ24213.1"
FT                   /translation="MSLTDLKKGKGNKVKKKNFTIDEFISDAENYARGTPKIVSELTSN
FT                   EETSHKLSLKQAISEARRYVEMTEIEHQQAVEVKAGVRARVVKPFRRATFTLSEEAIEQ
FT                   LQGLSEGSDLAKSHILRILIDELCNKEQNEQLKKLLQSGIG"
FT   gene            218319..218555
FT                   /gene="rpmB"
FT                   /locus_tag="CPS_0209"
FT   CDS_pept        218319..218555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="CPS_0209"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by similarity to SP:P02428; match to
FT                   protein family HMM PF00830; match to protein family HMM
FT                   TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26146"
FT                   /db_xref="GOA:Q48AD7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AD7"
FT                   /protein_id="AAZ26146.1"
FT                   /translation="MSKICQVTGKVPMVGNNRSHARNATRRRFLPNLQSHRFWVESENR
FT                   FVKLRLTPKGMRIIDKKGIDVVLTDIRARGEKV"
FT   gene            218580..218735
FT                   /gene="rpmG"
FT                   /locus_tag="CPS_0210"
FT   CDS_pept        218580..218735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="CPS_0210"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by similarity to SP:P02436; match to
FT                   protein family HMM PF00471; match to protein family HMM
FT                   TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25304"
FT                   /db_xref="GOA:Q48AD6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AD6"
FT                   /protein_id="AAZ25304.1"
FT                   /translation="MRDKIRLVSSAGTGHFYTTDKNKKTMPEKMEIKKFDPTIRKHVIY
FT                   KEAKIK"
FT   gene            218893..219393
FT                   /locus_tag="CPS_0211"
FT   CDS_pept        218893..219393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0211"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27310"
FT                   /db_xref="GOA:Q48AD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AD5"
FT                   /protein_id="AAZ27310.1"
FT                   /translation="MKLSRTGWNNVIIFSVMTIILLINATNDKLFPNEESAHNGERLIL
FT                   PQHGVILTLAIDFSESQRVLLERVGRSWQLTAKGITLEKSEQQIEQMMFAWQQSSGLVQ
FT                   AAEIMIDSAQGVAVKIALAGESQVRTFILYPLDDQLLVYQQRDNVWLALPATLAQQLLP
FT                   VSL"
FT   gene            219444..220259
FT                   /gene="mutM"
FT                   /locus_tag="CPS_0212"
FT   CDS_pept        219444..220259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="CPS_0212"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26060"
FT                   /db_xref="GOA:Q48AD4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AD4"
FT                   /protein_id="AAZ26060.1"
FT                   /translation="MPELPEVEVCRLGISPHVIAQEVSEVIIRNKRLRWPIPDEVCSAV
FT                   GLPVLKVERRAKYLLLRFSTGTLLLHLGMSGTIRVIEQDTPVAKHDHFDLVFKHGKSLR
FT                   LNDPRRFGAVLWLANDEDELGLLAKLGPEPLSDDFAEGYLFSKAKNRKVPIKTFLMNNH
FT                   VVVGVGNIYANEALFQAGILPTAKAKDIDEHRMNSLTAIIKKVLSAAIAQGGTTLKDFT
FT                   QADGRPGYFAQSLMVYGRAGEACVTCKTKLQEIRQSNRSSVFCPSCQQD"
FT   gene            complement(220263..220733)
FT                   /gene="coaD"
FT                   /locus_tag="CPS_0213"
FT   CDS_pept        complement(220263..220733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="CPS_0213"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ23966"
FT                   /db_xref="GOA:Q48AD3"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AD3"
FT                   /protein_id="AAZ23966.1"
FT                   /translation="MIRAIYPGTFDPVTNGHSDLIVRASKLFSEVIIGVASSPSKQPRF
FT                   DLEQRVAMLEQVTQDLTNVTVVGFSGLLVDFAKQYQAKVLIRGLRAVSDFEYEFQLANM
FT                   NRRLSSELESVFLTPAEENSFISSTLVKEVALHKGDVGQFVHPVVKAALDKI"
FT   gene            220974..221630
FT                   /locus_tag="CPS_0214"
FT   CDS_pept        220974..221630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0214"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27976"
FT                   /db_xref="GOA:Q48AD2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AD2"
FT                   /protein_id="AAZ27976.1"
FT                   /translation="MKTRDKIIQASIELFNEQGERNVTTNHIAAHLAISPGNLYYHFRN
FT                   KEDIILSIYEEYARSLLLETLPKVSSEVKPLDSLILYMDSVFQTTMKFRFFYSNLPVLL
FT                   DKNPILREKYVEVQQSISERVSQLLISLRAADYIDFNDDELADIVSILRLINTFWVSFH
FT                   QTQTIVNEVNDSVFYQGVLKILVILRPYTKAHAISELNHARDVYQQRYREEAETA"
FT   gene            complement(221637..222677)
FT                   /locus_tag="CPS_0215"
FT   CDS_pept        complement(221637..222677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0215"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO2439"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28675"
FT                   /db_xref="GOA:Q48AD1"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AD1"
FT                   /protein_id="AAZ28675.1"
FT                   /translation="MNITPHTANLPLATVVNPPTEGLRRENHQREIITKVAATNPSAAD
FT                   KGVASDKDRARTPAQANEQVDFANLRKQAEHAASSISEQENQQDNQQDDQQGKSQQDEQ
FT                   NSKQNQEDQHSSTNSSTSENDRAEKNSNQVRADEKIITQLQQRDKEVRSHELAHATAGG
FT                   AATGSPSYTFEIGPDGKKYVTDGEVAVDLSNVAGDPQATIVKMQKIHAAAMAPTNPSAQ
FT                   DTRVAASAAQNILAAQSELLALKGNEATQSDSADKSLNTQTNATSAYENNHDKRNEFDA
FT                   LINQTLSAQDAVISDSSNQKLASNLGVKSVQTSDVQQRAQRIESFYFTVSQGYEKPDNF
FT                   QFKITA"
FT   gene            complement(222703..223005)
FT                   /locus_tag="CPS_0216"
FT   CDS_pept        complement(222703..223005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0216"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:PP0367"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26950"
FT                   /db_xref="GOA:Q48AD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AD0"
FT                   /protein_id="AAZ26950.1"
FT                   /translation="MEIPSAMNSGLQGLQNARATADQAAEDIVASTTLSNETQKNPANN
FT                   GEVNTELSNPSRNNELPDLNQAIVNLKVAEYQAKASTEVIKSADDSLGTLLDVTA"
FT   gene            complement(223111..223932)
FT                   /gene="bioH"
FT                   /locus_tag="CPS_0217"
FT   CDS_pept        complement(223111..223932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="CPS_0217"
FT                   /product="bioH protein"
FT                   /note="identified by similarity to SP:P13001; match to
FT                   protein family HMM PF00561; match to protein family HMM
FT                   TIGR01738"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27521"
FT                   /db_xref="GOA:Q48AC9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AC9"
FT                   /protein_id="AAZ27521.1"
FT                   /translation="MAKSLTFSTFSPNNTLKKNVIPIVLLHGWGLNSGVWQPLLELFHR
FT                   NDESIYQLITIDLPGFGINSAVDIKPYSLANICHHIEQVIDQPAIYLGWSLGGLIATEM
FT                   SLKYPEKVLASITVASSPYFVEQPTDNWPGIKENVLESFHKQLAQDTAKTISGFLKIQA
FT                   MGSPHIRQDLKLITQLVMAHTLPSQQTLADSLALLSNSDLRLHLSKIKQPLLRLYGHND
FT                   SLVPKEVMEKISYLAPNSDQHLFADASHAPFISHLDDFYQVLVVWLDSHFN"
FT   gene            223957..224778
FT                   /locus_tag="CPS_0218"
FT   CDS_pept        223957..224778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0218"
FT                   /product="competence protein, homolog"
FT                   /note="identified by similarity to SP:P31773"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25928"
FT                   /db_xref="GOA:Q48AC8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AC8"
FT                   /protein_id="AAZ25928.1"
FT                   /translation="MVLVYIIRQKVSNMAWKLDSNIFKRYYIDTLKSISCCDLCGANVS
FT                   DSYLLGYSLSQALLCQSCVNDLPYFNQSLIAGNLLRWPAVHRALPNIHFEQLFALSPYI
FT                   YPFNKWLAQMKYLGRFELASLFSVLLCAQWQAMIMNQTIIPINLVLAVPLHIKKWQVRG
FT                   YNQAHLIAKTFAETLSLPYDANLVLRVKNNDSQMGKTGSQRRKNLANAFALQRKLGSHI
FT                   KHVLIVDDVVTTGTTVSEISKLLKQAGVETVTLVTVCLTVPNAKDNGPVIS"
FT   gene            complement(224791..227367)
FT                   /locus_tag="CPS_0219"
FT   CDS_pept        complement(224791..227367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24887"
FT                   /db_xref="GOA:Q48AC7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AC7"
FT                   /protein_id="AAZ24887.1"
FT                   /translation="MLLLRILILSITLLCSNCIIAMPAQDYLPAGSKFNSKISLPSSSL
FT                   GFEIGQRHVRHDQLKSYFYQLAKDSERVNITSMGTTSQQREQLLVTISSSENLANLSSI
FT                   LSERNLFSQKKGQLDNQKSDKAPLVIWLGYSVHGDEISGANAAMIVAYYLAANTDKSLT
FT                   EMLANTVIVLEPSINPDGMDRFVNWVSTYRNSTDNSDANHIEHHQGWVTGRTNHFWFDL
FT                   NRDWLLLSQQESQHRLEYFHQYQPHVVGDFHEMGHNSSYFFQPGIQSRTHPLTPKRNVD
FT                   LTTTLSKFHASALDKQKRLYYSEENFDDFYYGKGSTYPDINGSIGILFEQASARGMQQE
FT                   TINGLLTLEFSIENHVTTSLSTINGAWENRKQLKQYRSEFYQQSNKLAKKEDFTGYLLH
FT                   EGSDKFRLNTLLSKLAQHKIKVYPLIADFEFEDTEYQKDNSYYVPLAQPQFRLIQALFN
FT                   QQTNFKDNTFYDVSGWTMPLAMNIESIPVNRTRRLKLAKQAWAMPSTTKPNNKSISAYG
FT                   YIFEWHHFLAPKLLNKLLNNNIKAKVATKPFTSLINGETKQFEAGSIVIPAGIQQIENW
FT                   QETLISASNSAGIKLSSISTGLTMKGVDIGSSSLKPISKAKTLLLGGAGISQYEAGEVR
FT                   FYLDETLNIPLSIIDHNQLRQVDLSSYSHIILVDGDYQHVTDDTAKKIKAWVKQGGVII
FT                   SQKRASLWLAKQEILRARFVTKEQINQLFDDEKLNYQDKESLASRKRIAGAIFQVQLDT
FT                   SHPLAYGYQQSLLPLFRNSNLIMEHPQQPFITLAKYTPAPLLSGYTDKNLVNRLAHNAA
FT                   IVAHNVGKGRVIATTEVLAFRGYWHGSAKLLANSLFFSKAFSAPYK"
FT   gene            227552..228130
FT                   /locus_tag="CPS_0220"
FT   CDS_pept        227552..228130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0220"
FT                   /product="HesB-like domain/NifU-like domain protein"
FT                   /note="identified by similarity to SP:P46847; match to
FT                   protein family HMM PF01106; match to protein family HMM
FT                   PF01521"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24833"
FT                   /db_xref="GOA:Q48AC6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AC6"
FT                   /protein_id="AAZ24833.1"
FT                   /translation="MITISENAQQHFIKLLSQQAEGTHIRVFVVNPGTAKAECGVSYCP
FT                   PDAVEADDIQLPFEGFSAMVDADSKGFLEDAEIDFTTDQMGSQLTLKAPNAKLRKVADD
FT                   APLFERVHYFLQAEVNPQLAGHGGECTLVEITDDGYAVLQFGGGCNGCAQIDVTVKDGI
FT                   EKQLIELMAGEIKGVKDATEHERGDHSYY"
FT   gene            228143..228415
FT                   /locus_tag="CPS_0221"
FT   CDS_pept        228143..228415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24317"
FT                   /db_xref="GOA:Q48AC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AC5"
FT                   /protein_id="AAZ24317.1"
FT                   /translation="MNKILEKIGQNPQYSLTLFLRGLGLFVIGLLFVALGYFYHHLWQI
FT                   VGIITLAIACLLAAWGYLGIFANRWLNILYRTRPANKRPTEKNSH"
FT   gene            228416..228778
FT                   /locus_tag="CPS_0222"
FT   CDS_pept        228416..228778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0222"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:29340958"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28862"
FT                   /db_xref="GOA:Q48AC4"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AC4"
FT                   /protein_id="AAZ28862.1"
FT                   /translation="MILITDFIKQYWLHLTVFLLTAIATLSLWPAEYLPQVPGSDKTHH
FT                   FISYGALMFPVALRKPKYWLWITLGFAGFSGAIELIQPYVNRYGEWLDMAANVAGLACG
FT                   IMFAKIIEYFTVSNTK"
FT   gene            228893..229174
FT                   /locus_tag="CPS_0223"
FT   CDS_pept        228893..229174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0223"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27735"
FT                   /db_xref="GOA:Q48AC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AC3"
FT                   /protein_id="AAZ27735.1"
FT                   /translation="MSKETPAHHLPVAHPPKRLWQKISSIIAKGSFGLAAIGAVVTIIY
FT                   GNDVEADIKAALGATTFFCVAVGVVCQAMGSTSIPNLKPTPKELDDKK"
FT   gene            229199..229372
FT                   /locus_tag="CPS_0224"
FT   CDS_pept        229199..229372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27064"
FT                   /db_xref="GOA:Q48AC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AC2"
FT                   /protein_id="AAZ27064.1"
FT                   /translation="MSMAPMLMPLNDYAYSSCLIAAVSTKPYSGIVIFDRINEKTDKIG
FT                   AYVVRTASFNPK"
FT   gene            229443..230516
FT                   /locus_tag="CPS_0225"
FT   CDS_pept        229443..230516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0225"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26630"
FT                   /db_xref="GOA:Q48AC1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AC1"
FT                   /protein_id="AAZ26630.1"
FT                   /translation="MKYMLRTLVSVSLLLSVALSSHAAVILQYHHVSDSTPASTSISPK
FT                   QFEVHLQYLKDNNFKVVPLSELIEGIKNQQALPDKSVAITFDDAYIDVLTQAKPILDKF
FT                   AFPYTIYVNPGIIARNEKNDASHYLSWIQLKALSDEGVIIANHGYEHDSMARITEGLTQ
FT                   TQWLSKQTELLLKAEAVIKENTGQSWRYYAYPYGEYDVAIQAWAKENDFVAFSQQSGAI
FT                   DLSTDLTSVPRFPASKPYDKISGLRDKLNSLAFNIRLEGEQAETIFKHKEAKSINFVIE
FT                   TGDFYKSALNCYISGLGKQKITWNDDKSFSINFSKDLPVGRVRANCTAASISKPGRYYW
FT                   YSKPWFILKDDGSWYHL"
FT   gene            complement(230593..230766)
FT                   /locus_tag="CPS_0226"
FT   CDS_pept        complement(230593..230766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0226"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26249"
FT                   /db_xref="GOA:Q48AC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AC0"
FT                   /protein_id="AAZ26249.1"
FT                   /translation="MITENGCSILKINNDVSIVSSPIAEALEQSSFYCCVKEIGNDHDL
FT                   IDAPQTDIAQVL"
FT   gene            230699..230845
FT                   /locus_tag="CPS_0227"
FT   CDS_pept        230699..230845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0227"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25569"
FT                   /db_xref="GOA:Q48AB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AB9"
FT                   /protein_id="AAZ25569.1"
FT                   /translation="MGLETIDTSLLIFRMEQPFSVINALSQSFFSPTETCILNGHGYSA
FT                   TIF"
FT   gene            complement(230818..231486)
FT                   /locus_tag="CPS_0228"
FT   CDS_pept        complement(230818..231486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0228"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by similarity to OMNI:SO4615; match to
FT                   protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25103"
FT                   /db_xref="GOA:Q48AB8"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AB8"
FT                   /protein_id="AAZ25103.1"
FT                   /translation="MNKHIYTIIALLSICAGAAGFYLINKTKQLSLPEYALHYQQARPI
FT                   SAFTLTDELGQPFNNEQLQDKWSLVFFGYTSCPDVCPTTLQNLNFIYEDLTNIASNSQV
FT                   LLVSVDPKRDSREKLEQYIGYFNPNFKALRAEHDVLFPFSRNLGLMYAITSKEASKDKV
FT                   EVPAGDEDYWVDHSASLVLINPAGKIAAIFRPEQVVGDVPSIDNEKLLSDYQKIVALYP
FT                   "
FT   gene            complement(231565..232518)
FT                   /gene="cyoE"
FT                   /locus_tag="CPS_0229"
FT   CDS_pept        complement(231565..232518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="CPS_0229"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24423"
FT                   /db_xref="GOA:Q48AB7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AB7"
FT                   /protein_id="AAZ24423.1"
FT                   /translation="MSKVINKTITPMPSVINTGHHHFSISNIFANWRAYYDITKPKVVA
FT                   LLVLTALVGMSLSVPGALPWQRLIPAMLGIGLLSSAAAAINHIVDEKIDTVMGRTHNRP
FT                   LPAGKISVTNAIVFATSIALLGFIILYALVNPLTAFLTLAGLVGYSFVYTMYLKRATPQ
FT                   NITIGGLAGAIPPLLGWTAMTNEVVPNALLLVLIIFTWTPPHFWALAIHRKNDYAKVNI
FT                   PMLPVTHGVSFTKTQILLYTVLLFVVCLLPYLVGMSNWLYLIGACSLNLIFFGYAWQLK
FT                   FNAKEGTAMATFKFSIIHLMLLFIILLLDHYWLPMG"
FT   gene            complement(232511..233572)
FT                   /locus_tag="CPS_0230"
FT   CDS_pept        complement(232511..233572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0230"
FT                   /product="cytochrome oxidase assembly protein"
FT                   /note="identified by match to protein family HMM PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26255"
FT                   /db_xref="GOA:Q48AB6"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AB6"
FT                   /protein_id="AAZ26255.1"
FT                   /translation="MTEHSKNTQTLRRLVLTSLLLAVVVIGLGAYTRLTHAGLGCPDWP
FT                   TCYGLIDVPETSIQIAAAEQAFPERPVEPAKAWNEMIHRYFAGSLGLLIAVIAIFSIKL
FT                   RFSKSSKVRYPIFLPLCILCIVTFQAALGMWTVTLKLMPIVVMGHLLGGFTTLCLLFLL
FT                   YLRINARSKKTQGESLTESQLKKYSGYALIGIIILTAQIALGGWTSSNYAAMSCVELPI
FT                   CQGDWLSDLSFEQSFDLIPPKQESYEFGHLAHNERVTIHVSHRFGAIITGVFLAWLAIT
FT                   IFIKTKTPAIKSTATILLSLLIIQISLGVSNIWFSLPLKVAVAHNLVAACLMLSLITLA
FT                   YKLRQNSKESLYE"
FT   gene            complement(233577..234212)
FT                   /locus_tag="CPS_0231"
FT   CDS_pept        complement(233577..234212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:27358560"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27228"
FT                   /db_xref="GOA:Q48AB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AB5"
FT                   /protein_id="AAZ27228.1"
FT                   /translation="MARSINTDDSSNNSTLTSTNKLDHTSNHASQKRSRRSLLLLITVF
FT                   ILPILLAKLALDNQWLNLGVTNQGKLLAQPLTLKELGIDESELAKQWLIIYRLPNTCPE
FT                   MCLHSIETVHNSYVALGKDMPRVSAVLLKENIFSAQQSKQLAKSQWKILALTPQMNNLL
FT                   HGPQVLIADPLGNVILRHQLPEQEQLQPAFGKAIVADMKKLLKYSKVG"
FT   gene            complement(234257..235075)
FT                   /locus_tag="CPS_0232"
FT   CDS_pept        complement(234257..235075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0232"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO4611"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27651"
FT                   /db_xref="GOA:Q48AB4"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AB4"
FT                   /protein_id="AAZ27651.1"
FT                   /translation="METINKRKKIFTQSLIRSALWLGLTIIVFAGLVKLSFWQYNRGFE
FT                   KEKRAIRITQLNQQSPLTLSEIVKLSQDKQFTGKESINDFPVTITGQFNDDFVFLLDNQ
FT                   VENNSLGYRVFQVVQTPTNSVLINLGWVQGSIDRSILPDVTPLNGQHNFRGHVRIIEQG
FT                   IMLTAQDFTQPSWPLRVQQIELDKFSALISPLIDKPLLPFVIYVDPEDNLGYKKNWHPM
FT                   VMPAEKHFGYAFQWAALATAWLILMICLRIKTQKSARVSSKNAPDALQNI"
FT   gene            complement(235086..235970)
FT                   /locus_tag="CPS_0233"
FT   CDS_pept        complement(235086..235970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0233"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by match to protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28335"
FT                   /db_xref="GOA:Q48AB3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AB3"
FT                   /protein_id="AAZ28335.1"
FT                   /translation="MTNKEYESYYVPSQSHWPIVGAIALFMIAFGAANYVTDLANEKSG
FT                   YGGYLLLAGIALVVYMLVGWFSDVISESLTGKYSHQMDNSFRQGMSWFIFSEVMFFAAF
FT                   FGALLYLRVFSVPWLGGAGNNVSTGAVLWPDFVAQWPLLTTPDGTTTTAMGWYGLPLIN
FT                   TVLLLTSSITAHFAHSALIKNNRGPLKAWLGLTIVLGLAFMFFQVEEYAHGYSEEMRLF
FT                   LDSGVYGNTFYLLTGFHGMHVTLGCIMLIVMWFRVLKGHFTPENHFAFQAASWYWHFVD
FT                   VVWVMLFVFVYIL"
FT   gene            complement(235998..236567)
FT                   /gene="ctaG"
FT                   /locus_tag="CPS_0234"
FT   CDS_pept        complement(235998..236567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaG"
FT                   /locus_tag="CPS_0234"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /note="identified by similarity to SP:P56940; match to
FT                   protein family HMM PF04442"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24432"
FT                   /db_xref="GOA:Q48AB2"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AB2"
FT                   /protein_id="AAZ24432.1"
FT                   /translation="MSTDDDKANINTSTGISNNNKTVRKLLLVVVAMFGFGFALVPLYD
FT                   VFCDITGLNGKTNDTAATYEADGIDKLRTVKVQFITRNAKGIPWEFEPVINEISVHPGE
FT                   MKLVSFYAKNNASHDIIGQAVPSVSPGLAANYFHKIECFCFTQQPLAAGKEVEMSLQFY
FT                   VDLELPADINTLTLSYTLYDITEKSS"
FT   gene            complement(236573..238195)
FT                   /locus_tag="CPS_0235"
FT   CDS_pept        complement(236573..238195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0235"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by similarity to SP:P31833; match to
FT                   protein family HMM PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25538"
FT                   /db_xref="GOA:Q48AB1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AB1"
FT                   /protein_id="AAZ25538.1"
FT                   /translation="MTTDVIEQDSHDEHYGDHKMTGIKRWLYTTNHKDIGTLYLWFAFI
FT                   MFLTGGALAMVIRAELFQPGLQIVEPDFFNQLTTVHGLVMVFGAIMPAFTGFANWMLPM
FT                   MLGAPDMALPRMNNWSFWILPFAFAILLGSFFMESGAPNFGWTFYAPLSTTYSNGSTAF
FT                   FVFAVHIMGISSIMGAINIVVTIMNMRAPGMTYMKMPLFVWTFFITAYLLIAVMPVLAG
FT                   VVTMLLTDTYFGTSFFDAAGGGDPVMFQHIFWFFGHPEVYIMILPAFGIVSTTIPAFSR
FT                   KRLFGYSSMVYATSSIALLSFIVWAHHMFTTGMPLFGELFFMYCTMLIAVPTGVKVFNW
FT                   VATMWRGSLTFETPMLFSIAFVILFTIGGFSGLMLAMTPVDFQYHDTYFVVAHFHYVLV
FT                   TGSLFSLYAGAYFWLPKWTGHMYNDTLSKWHFWCSLISVNLLFFPMHFLGLAGMPRRIP
FT                   DYALQFADFNKWVSIGGFAFGLSQLIFLAVVIKCIRGGEKAPAKPWDGAIGLEWTVASP
FT                   APYHTFSTPPSQQDIDNADQHEH"
FT   gene            complement(238207..239766)
FT                   /locus_tag="CPS_0236"
FT   CDS_pept        complement(238207..239766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0236"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by similarity to SP:P08306; match to
FT                   protein family HMM PF00034; match to protein family HMM
FT                   PF00116; match to protein family HMM PF02790"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27294"
FT                   /db_xref="GOA:Q48AB0"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AB0"
FT                   /protein_id="AAZ27294.1"
FT                   /translation="MGKHKLIWLVLVSLFANSAWAETQLNLTKGVTAVSRDVYDLHMLV
FT                   LYICTAIGILVFGAMFWSIAFHRKSKGAKPADFHESTKVEILWTAIPIVILIAMAVPAT
FT                   QTLIAMEDNENSDVTIQITGSQWKWHYKYFDQDIEYYSVLSTPREQYQNQQETSAIKGK
FT                   NYLLEVDKPLVIPANKKVRFLITSDDVIHSWWVPAFAVKQDANPGFINEAWTRVEEPGV
FT                   YRGQCAELCGKDHGFMPIVVEVKSAEDYDIWLNEQQQRIAAAASAEQDSLNASVSKEEL
FT                   MQLGETTYTAYCSACHQPTGLGLPPAFPALKGSPIATTGTIEEHLNIVFNGKAGTGMQA
FT                   YGKQLSLKEIAAVVTYERNAWGNDTGDIVQASDVKSAVDNTSQDAKGVVTIETNVEDAV
FT                   ETMTEEAPVEDLAKVYSQDELMAMGEKVYMTACVACHQPTGAGLPPAFPALKGSLIAMG
FT                   DIAIHLDMVLNGSKKNPAMAAFGSQLTKTEIAAVVTYERNAWGNNTGDLVQPAAVDAAS
FT                   AK"
FT   gene            complement(240332..240967)
FT                   /gene="lexA"
FT                   /locus_tag="CPS_0237"
FT   CDS_pept        complement(240332..240967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="CPS_0237"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM PF01726; match to protein
FT                   family HMM TIGR00498"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27640"
FT                   /db_xref="GOA:Q48AA9"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48AA9"
FT                   /protein_id="AAZ27640.1"
FT                   /translation="MIDSTTELRPLTKRQQQIYDLIKAKIQDTGMPPTRAEIANFFGFK
FT                   SANAAEEHLKALAKKGYIEMLAGTSRGIRLVEEMLEAEGLPLIGRVAAGEPILAQEHIE
FT                   EHYKMDGNLFHPAADYLLRVNGESMKDIGILDGDLLAVHQTTEVQNGQVVVARVENDVT
FT                   VKRFKREGNVVYLHAENEDFSPIKVDLANQEFNIEGIAVGIIRSGRWM"
FT   gene            241810..244641
FT                   /locus_tag="CPS_0238"
FT   CDS_pept        241810..244641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0238"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01782"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25715"
FT                   /db_xref="GOA:Q48AA8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AA8"
FT                   /protein_id="AAZ25715.1"
FT                   /translation="MFKKNTLSTAIIAILASTASVQAHAEDSKTAEKDVEKITVTGIRG
FT                   ALGRALDTKREASGVVDSISAEDIGKFPDTNLAESLQRITGVSIDRSGGEGQKITVRGF
FT                   GPQFNTVLVNGRQQASEDPGRDFSFDTLAAEMVKTLDVHKTSSATVQSGGIGATVNIET
FT                   AKPFAINGFKLAGSVKATYDGNSEETSPQASLLISDTFNDDTFGALFAISYLERETKLN
FT                   RAQSAGWRENSSFGKGAPVTESGDVYTGNIFIPQNFDSLVTTEKRERTNANLVLQYAPS
FT                   DNLVITADALYSDFDVKSDTTSYGHWFTSDNVENAVVDANGTITSMYQETGLATDFHAK
FT                   KADRLTDSLSIGLNFDWDVNDNLNMKFDLSNSTAKREPNNGRGGSLALLGYANRVQWNV
FT                   DGNILPYYSDFATPDPSIYSGQQEGDGVNQDPNSPDYVSPTGVSDYLDPANSRAHVMIR
FT                   DSKEIEDVVTQVKWDSLWLSDGDTGFSAARFGAMYSTETKTVNSWDNTTSGIHCTYCNY
FT                   QDFPDVSAFPQEVFDAGSDFLSDVSGSGRTPSQWLKFDGEALFDFLGAVEGVDFNAVKT
FT                   NNSFEVKEETTAFYLELDFEGEIAGMPLYTTGGFRYESTDVTVGATQANVQRLDILDAT
FT                   EMLAVYGPASDFDESSSYAQILPNFSTKLEITDELVARVAASRSISRPTLSSLRPITSL
FT                   DTVRQGNLQSSSGNAALVPFSSDNLDLSIEWYYADASYVSAGYFRKHVANFITSSKNPK
FT                   TFVTADSSLLTDPSTGSDVSAPDADDQVAVFTNTAPSNGESAVVDGWELAAQHTFDSGF
FT                   GLLANATLVNSDAELDNADITQVFALTGLSDSTNLIAFYESGAFQGRIAYNWRDTFLQN
FT                   LTQGGGDGVTYVEAYSQWDASASYDLTDQITVFVEGINLTEEYTHNRGRFSNQILEVVD
FT                   SGRRISFGVRGSF"
FT   gene            244777..246390
FT                   /locus_tag="CPS_0239"
FT   CDS_pept        244777..246390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0239"
FT                   /product="putative tryptophan halogenase"
FT                   /note="identified by similarity to GP:1710898"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28359"
FT                   /db_xref="GOA:Q48AA7"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AA7"
FT                   /protein_id="AAZ28359.1"
FT                   /translation="MHIMNKLTKTVVIVGGGIAGWLTAGRLAAKHKSNTEQGLNVILIE
FT                   SANIPAVGVGEGTWPTMRSTLRALGISESDFIRECEASFKQGAKFAKWFDGTEDDFYYH
FT                   PLVLPQGFGKTDLAAHWLAKQTQTKQKNSHVNSFSNEVCYQEAICEQGLAPKTIRHAEF
FT                   SDVANYAYHLDSAKFAVFLQKHCQEKLGVTHIVDDVTGVNCDVNRADKDIIDETIDKGD
FT                   ILSVSTQNHGDIAGELFVDCTGFSSLLLGKHYQVPFKKCDDILFIDTALAVQVPYDSKD
FT                   SPIASHTISTGQKAGWIWDIGLQHRRGVGYVYSSKHSTEAEARAVLAEYVGDKFSSLNV
FT                   RKIPIVSGHREKFWQNNCVAVGLSAGFLEPLEASALVMVELAAQMISEQLPASREVMDV
FT                   VAKRFNETALYRWDRIIDFLKLHYILSERTEPFWTDNRESATIPQSLQDLMTEWKYRSP
FT                   ADHDFTSNNEVFPAASYQYVLYGMGFKSDYCHTPYAFDDCDFADGQFKQNKVLIDKALS
FT                   SLPSNRELLDKIKSYGFSRI"
FT   gene            246456..247184
FT                   /locus_tag="CPS_0240"
FT   CDS_pept        246456..247184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28001"
FT                   /db_xref="GOA:Q48AA6"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AA6"
FT                   /protein_id="AAZ28001.1"
FT                   /translation="MAQLVAIDNKNHLNLKVDAAKAELHGAGLHLVPAVMAEFTSMAVQ
FT                   YPLVITKNADTGQFVVAAMLGFESGENLFWRGGQWQGLYLPLQIRRQPFFVGNPEQNSE
FT                   QKVAGDYVVCFDSESPAIVSNDGQALFSEDGVDTEYFQQAKYCLAQLLEGELANKKLLE
FT                   QLQSMELLQVMQMEVTFANQQSTTLNGLYTIDTEKLAALSAEKIASLHKAGLLQAIYTL
FT                   ITSLGQIHHLIDLKNKQLGC"
FT   gene            247194..247904
FT                   /locus_tag="CPS_0241"
FT   CDS_pept        247194..247904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24855"
FT                   /db_xref="GOA:Q48AA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AA5"
FT                   /protein_id="AAZ24855.1"
FT                   /translation="MFDFSVNNQAILSKHIIGDEKIPLLIIDNFANSVTDLVEFAGDGS
FT                   SFQADEKNFYPGKRKLMPSEYGEQVCRQYLPLFHSFFDCPQTSAAKTVLSALALADTPV
FT                   KQLRPMQMLPHIDTPQSNQFAVVHYLCNQDHGGTSFYRHKETGYQTITQDRLYHYAQQV
FT                   KKEAIANQIHKAPRYMSGSDKLFEQLYSVEARMNRAIIYPSNLLHSGNVNAALGLSSLP
FT                   KKGRLTIGSFILLE"
FT   gene            complement(247796..247915)
FT                   /locus_tag="CPS_0242"
FT   CDS_pept        complement(247796..247915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24437"
FT                   /db_xref="GOA:Q48AA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AA4"
FT                   /protein_id="AAZ24437.1"
FT                   /translation="MTKSYSSKIKLPIVKRPFFGSDDKPKAAFTLPECNKLLG"
FT   gene            248046..248615
FT                   /locus_tag="CPS_0243"
FT   CDS_pept        248046..248615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0243"
FT                   /product="putative RNA polymerase sigma-70 factor FecI"
FT                   /note="identified by similarity to SP:P23484; match to
FT                   protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26240"
FT                   /db_xref="GOA:Q48AA3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AA3"
FT                   /protein_id="AAZ26240.1"
FT                   /translation="MIKESTLHISFMAVRQTMRRVISRIVPPREVEDIVQETYVRICQV
FT                   ENKEAIKQPRSFLLKTAKNLAIDHLKRADIRLVDTVDNMAEFEHLVSADDAIYQQVATD
FT                   KEFAQFCEAIRQLPIQCRKAFVLKKVYGYSQKEIAKKLAISESTVEKHIGLGVKRCTYF
FT                   MMQLTKEERTETMKNSKKTHQVRRDL"
FT   gene            248615..249652
FT                   /locus_tag="CPS_0244"
FT   CDS_pept        248615..249652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0244"
FT                   /product="putative regulatory protein"
FT                   /note="identified by similarity to SP:P23485; match to
FT                   protein family HMM PF04773"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27156"
FT                   /db_xref="GOA:Q48AA2"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AA2"
FT                   /protein_id="AAZ27156.1"
FT                   /translation="MTNVYSLNNDDEVMFDQASIWIARMDRSLTELEQAEFKAWLSESE
FT                   QHQKLIIEMASMWDKMDSLDRLADLFPTSDKTDSKFKTAPKTAQWPLALAASLVLALFV
FT                   VFFTDITLNSLWQEEQQFVRYETAVGESSTIYLPDNSKVLLNTDSVLLVRYTDDYRLLD
FT                   LQRGELHVEVAHDKSRPLSVVANHKVIQAVGTAFSVQVKTSEVELIVTEGRVIIGQLNE
FT                   KQEVNETALVIPSSSLAVSKGEIASLAVANSVSVIDNKAIKKSLSWRQGNLVFNGETLA
FT                   EAMEEVSRYTSVTFEIADEDLKKIRIAGRFKTGDVKGLISVLKHNFNIKTDRVNKGLVV
FT                   LRKQS"
FT   gene            249842..251278
FT                   /locus_tag="CPS_0245"
FT   CDS_pept        249842..251278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0245"
FT                   /product="sugar transporter family protein"
FT                   /note="identified by similarity to SP:P09098; match to
FT                   protein family HMM PF00083; match to protein family HMM
FT                   PF07690; match to protein family HMM TIGR00879"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26492"
FT                   /db_xref="GOA:Q48AA1"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AA1"
FT                   /protein_id="AAZ26492.1"
FT                   /translation="MTSSEPDNSIQKLHDTEEVQTSFLYVLFISSVAAIGGFLFGFDSG
FT                   VINGTVTALGNAFNASDVASGFNVASVLLGCAVGALMAGPISDRFGRKPIMIITAIIFA
FT                   ISAFGSGISSSSAEFIFYRLIGGLGIGAASVLAPAYIAEVAPAALRGRLATLQQLAIVL
FT                   GLFAAFLSNFLIASVSGGAEAMLMLDIAAWRWMFWVELLPAVLFLVGVIFIPESPRYLV
FT                   AQGKIEEARTIFKRIATGVENEQIEEVKKSLHGDKKPSIRDLFIDGKKKIHPIIWIGIG
FT                   LSVFQQFVGINVVFYYGAELWQAAGFDESQSLFINLIAGTTNIISTFIAIALVDKIGRK
FT                   PLLLVGSVGMFISLGALTFIFGTGGLDEAGKLALSDTTGTVALIMANLFVVFFGLSWGP
FT                   IVWVLLGEMFNNRIRGAALAIAASAQWLANFAITMTFPILLGSFGLAGAYGLYTVSALL
FT                   SIFFVIKYIKETRGIRLEEM"
FT   gene            251317..251415
FT                   /locus_tag="CPS_0246"
FT   CDS_pept        251317..251415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0246"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28482"
FT                   /db_xref="GOA:Q48AA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q48AA0"
FT                   /protein_id="AAZ28482.1"
FT                   /translation="MVIINGCLCVPKPLEVASSCGLSREISHIHLE"
FT   gene            251497..252462
FT                   /gene="glk1"
FT                   /locus_tag="CPS_0247"
FT   CDS_pept        251497..252462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk1"
FT                   /locus_tag="CPS_0247"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="identified by similarity to SP:P46880; match to
FT                   protein family HMM PF02685; match to protein family HMM
FT                   TIGR00749"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25574"
FT                   /db_xref="GOA:Q48A99"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A99"
FT                   /protein_id="AAZ25574.1"
FT                   /translation="MNLVADIGGTNIRLGVSDSSNIIIDIETYQCRDFTCLLDVIQYYL
FT                   TEKKIAQGNINACLAIACPVDTDIISMTNLPWQFSQTELKKALKLNKLVLINDYTAIAM
FT                   AIPMLTDEQKVKIGGGTALSDKAIAVCGPGTGLGVANLIPIVNKWYCLGGEGGHVDYAP
FT                   IDDKEIQVLRYIQGFKKRVSYEQLLSGYGLEQIYQALLIIEQGDSSPQQPTKLTAQEIS
FT                   TQALIETCTLSQQALDLFCKVLGSFAGNLALTMNTQGGVYIAGGIVPCFIDYLRNSDFR
FT                   LRFEAKGRMSPLNKEIATYVITEKQPGLLGASVYLNQVMA"
FT   gene            complement(252516..253112)
FT                   /locus_tag="CPS_0248"
FT   CDS_pept        complement(252516..253112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0248"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BMA0365; match
FT                   to protein family HMM PF05962"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27218"
FT                   /db_xref="GOA:Q48A98"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A98"
FT                   /protein_id="AAZ27218.1"
FT                   /translation="MLTIFSPENYKTIPWKNGLGHTTELAISDGGTLDNFDWRLSIASV
FT                   VNDGDFSNFSGYLRNLVLIKGNGLTLDHRNGDVDKLTQLLDIARFDGASKTHGALTNGA
FT                   IKDFNIMTNQLSFSPKVNGYIEQQTVTVRLSAASIFFAYSLTEKMLVTTPQDNSCSVPV
FT                   GHLIKLSAMNEKLQDDQLTVKVTGKNMIIVQLEVM"
FT   gene            complement(253121..253231)
FT                   /locus_tag="CPS_0249"
FT   CDS_pept        complement(253121..253231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0249"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28593"
FT                   /db_xref="GOA:Q48A97"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A97"
FT                   /protein_id="AAZ28593.1"
FT                   /translation="MSSTRIASANVNIKIKPYKNNLAYEDKLSNMAKKLR"
FT   gene            253519..255495
FT                   /gene="thiC"
FT                   /locus_tag="CPS_0250"
FT   CDS_pept        253519..255495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="CPS_0250"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28309"
FT                   /db_xref="GOA:Q48A96"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A96"
FT                   /protein_id="AAZ28309.1"
FT                   /translation="MNNSTDAVNPAKKPQTRREKREAAEAFLKNVSDQSFPNSKKVYVQ
FT                   GEIHDIKVGMREITLSDTLVSGSKDKPVYEKNEPLCVYDTSGFYTDENVEIDVHKGIPR
FT                   LRETWIDARDDVETFTSTHSEFAQQRLDDEGVDEIRFEHLPKMRIAKKGKNVTQMHYAR
FT                   QGIITPEMEYIAIRENLKREEVKDATLLLQHKGQSFGASIPEQITPEFVRDEVARGRAI
FT                   IPVNINHPECEPMIIGRNFLIKVNANIGNSAVTSSIEEEVEKLVWSTKWGADTVMDLST
FT                   GRNIHETREWIMRNSPVPIGTVPIYQALEKVNGVAEDLTWEIFRDTLIEQAEQGVDYFT
FT                   IHAGVLLRYVPMTAKRVTGIVSRGGSIMAKWCLAHHKENFLYTHFEDICEILKQYDVSF
FT                   SLGDGLRPGSVADANDEAQFAELHTLGELTKIAWKHDVQTIIEGPGHVPLHMIKENMEE
FT                   QLEHCGEAPFYTLGPLTTDIAPGYDHITSGIGAANIGWYGCAMLCYVTPKEHLGLPNKE
FT                   DVKEGLMTYKIAAHAGDLAKGHPGAQIRDNAMSKARFEFRWYDQFNIGLDPERARTYHD
FT                   ETLPQESGKVAHFCSMCGPKFCSMKISQEVREYAANLDKNAIKIQLLDETITLTSDEAI
FT                   ERAMQEKSAEFKATGSEIYQLAE"
FT   gene            255512..256693
FT                   /locus_tag="CPS_0251"
FT   CDS_pept        255512..256693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0251"
FT                   /product="oxidoreductase, FAD-dependent"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24538"
FT                   /db_xref="GOA:Q48A95"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A95"
FT                   /protein_id="AAZ24538.1"
FT                   /translation="MNIAIVGAGLMGRLLALSLLRGKQSESVTITLFDKDNKLAHNSAA
FT                   YAAAGLLTPLGESLHCEPNIVSMGFESLRLWPALLDSLDEYTLFQQTGAIMVSHEQDKG
FT                   DYQRFVRHLNNNYPEHKLHTLDRAQLLELEPEIGRSFNHGLYLPQEGQIGNRRLLIALR
FT                   KQLEKEGMSINGVNSLNWLSECQVFAIENTDSNSKVSYQQYGVNCSQSFDLVIDCRGTG
FT                   ASRKNSHSACAPLSDLRSVRGELFQLFAPDVNISRPIRLMHPRYQLYIAPKQKGFYVVG
FT                   ATEIESDDDAPMTVRSAMELLSAAYSVHPGFAEANIRQHVSQCRPTFSDNQPKITHKGS
FT                   LIQVNGLFRHGFLIAPVVLKQVLTLVDNLINNTNNELPYRDYLHTEQRQEEVI"
FT   gene            256693..256905
FT                   /gene="thiS"
FT                   /locus_tag="CPS_0252"
FT   CDS_pept        256693..256905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="CPS_0252"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25826"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A94"
FT                   /protein_id="AAZ25826.1"
FT                   /translation="MNIHINGKAYSLSHEVHISVSSALTLHFIEPQQSTFAVALNGDFV
FT                   GKADYDTTLVKNGDSLDVLLPIQGG"
FT   gene            256905..257702
FT                   /gene="thiG"
FT                   /locus_tag="CPS_0253"
FT   CDS_pept        256905..257702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="CPS_0253"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27504"
FT                   /db_xref="GOA:Q48A93"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A93"
FT                   /protein_id="AAZ27504.1"
FT                   /translation="MVALNIYGQQLDSRLLIGSALYPSPHVMKQAILASGSQVVTLSLK
FT                   RQNPAEKAGQQIWRYLQEVVTEVNGHLLPNTAGCKTAKEAVTLAKMSREIFQTDWIKLE
FT                   VIGDDYNLQPDPIELLHATEQLINDGFKVLPYCTDDLVLCQRLYDLGCQVIMPWASPIG
FT                   TGKGLMNPYNLETIRLRLPNATLILDAGIGKPSDACLAMEMGYDGVLLNSAVALADNPV
FT                   LMAKAFGQALQAGEQGYVAGIMDQRQTAHPSTPTLDTPFWHQN"
FT   gene            258003..259592
FT                   /gene="thiDE"
FT                   /locus_tag="CPS_0254"
FT   CDS_pept        258003..259592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiDE"
FT                   /locus_tag="CPS_0254"
FT                   /product="phosphomethylpyrimidine kinase/thiamin-phosphate
FT                   pyrophosphorylase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25695"
FT                   /db_xref="GOA:Q48A92"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A92"
FT                   /protein_id="AAZ25695.1"
FT                   /translation="MKTEQQVAIKPIIWTISGSDCSGGAGIAADIKTGHGLGVEVCHLI
FT                   TANTVQNSHQLLSVNAISVELLQQQAAVLMDDKPPSVIKIGLVANAEQVQWLAQLIEQI
FT                   KQVIPTLISVYDPVGQASVGGSFNNLTLEQLSPLLLKIDVITPNLMEAKSLAKLDGLPD
FT                   KNSAEKLANKIHQNFAINSIIVKGGHIHSDDRYSIDFCLHQLNQLNGKQDNQDKAQTAI
FT                   SYQLGALRIDSHYSHGGGCSFASALASFLAQGYLIRDAFTLAKAFISQGLSTSKQVSEL
FT                   HGHQYYGAFEQQGWPRNAECFPQVIDELSQQYQNLPAFNSLDLAEKKLGLYPVIDSLYW
FT                   LKRLLSLGLEIIQLRVKNLAESELEQVIITAIALAKKYDTRLFINDYWQLAIKHGAYGV
FT                   HIGQEDLQDADLTAIQQSGIRLGISTHGCYEFLSAQRLQPSYLAIGAIFPTKTKDMTGQ
FT                   IQGIDNLRQVLSLRPENKHKIPVVAIGGINLERAAEVIATGVESIAVVTAITEAECSHG
FT                   ISPEQAVTRLQF"
FT   gene            259660..260121
FT                   /locus_tag="CPS_0255"
FT   CDS_pept        259660..260121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0255"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   family protein"
FT                   /note="identified by similarity to SP:P87014"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24245"
FT                   /db_xref="GOA:Q48A91"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A91"
FT                   /protein_id="AAZ24245.1"
FT                   /translation="MKVLENKIPPPLVGLLIGLGMWGLSTVTPVILLTNTVKSVLVIGF
FT                   ISLGIFFDLAGIISFRRAKTTVNPLKPNKASSLVTSGIYQVTRNPMYVGFVAFLLAWAS
FT                   FLGSAWGLILIPLYILYIQRFQIAPEERALTVLFKEEFTQYKAQVRPWL"
FT   gene            complement(260234..261085)
FT                   /locus_tag="CPS_0256"
FT   CDS_pept        complement(260234..261085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24297"
FT                   /db_xref="GOA:Q48A90"
FT                   /db_xref="InterPro:IPR018883"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A90"
FT                   /protein_id="AAZ24297.1"
FT                   /translation="MKTNIIALTVAAALIPLTAFAGSEPTNVSDNVIKKQRAMLENNTV
FT                   SKGYGPQSPRDLSMKQGDNPRIFGLAPESTNMNLCNIHMHKNAEHKGGEFSKYAGNGDG
FT                   TGYQTGFVYTGKLSSKETKKVNKDICPNPHGGLLPGDTIEVHYVHSTAQAAPGNTLGAC
FT                   LGESTINPQFRVETQVFVVVNDKNALDFGELTTHSIKNDKHQAPNIPNNTGTPIQYAGS
FT                   TTGPSYNEKGSPFQVTWSVRPKVAKVNIESVGEWCKGNAFKEDHAHGVRNLVVNPRLLS
FT                   AM"
FT   gene            261457..262164
FT                   /locus_tag="CPS_0257"
FT   CDS_pept        261457..262164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:28808561"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27670"
FT                   /db_xref="GOA:Q48A89"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A89"
FT                   /protein_id="AAZ27670.1"
FT                   /translation="MIGNKLLSYKKISVAKVFEKETQLIAQIQAGELKQCLMLWQAKEA
FT                   TLVLPAGKKWLASDELKAGLLADEWLLQARKTGGAPVPQCPGIINLSHLYLWSNDTPYS
FT                   ITQAYENLCTVLHGFFGQFNLISQAHATEFSYCDGDYNINLNGKKIVGTAQRVILKKGG
FT                   GKIVLAQAFILIDVLLEEIIKPVNLCYQLSDKTDRVKAQVHTTLFEHINQKPTIDKLYQ
FT                   QLTQAFVDSGLYQ"
FT   gene            complement(262232..262819)
FT                   /locus_tag="CPS_0258"
FT   CDS_pept        complement(262232..262819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0258"
FT                   /product="AhpC/TSA family protein"
FT                   /note="identified by match to protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27121"
FT                   /db_xref="GOA:Q48A88"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A88"
FT                   /protein_id="AAZ27121.1"
FT                   /translation="MNRKIYSRINKKISISVFSLLLLLTNNAFANTSINVGPTLGEQAP
FT                   EISVVNTQEQAVNIKEISGEQGLIILFFRSADWCPFCKKHLIELNEHAEQFTKLGYGLA
FT                   AISYDNTDILKTFADQKNINYPLLSDQKVQTMLAYGIVNSEYAVDSDHYGIPYPGVVII
FT                   DNKGKVIHKHFFKGYKKRVKFADLYQQLKKGS"
FT   gene            263150..263365
FT                   /locus_tag="CPS_0259"
FT   CDS_pept        263150..263365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0259"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:PSPTO4246"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26425"
FT                   /db_xref="GOA:Q48A87"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A87"
FT                   /protein_id="AAZ26425.1"
FT                   /translation="MTDKNDDSICPLCQQNNRCDVKAGSGCWCMNTPVPEELLAQIPAH
FT                   LKGVSCVCNACIGRYQRQQHLNANVE"
FT   gene            263495..264982
FT                   /locus_tag="CPS_0260"
FT   CDS_pept        263495..264982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:27358284"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26401"
FT                   /db_xref="GOA:Q48A86"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A86"
FT                   /protein_id="AAZ26401.1"
FT                   /translation="MNKTSKAYQPLLSSKAKIAIIGGGVAGSTIALRFAELGLDTTLIE
FT                   KGPSLVNGPPICHLHAGGNLYREICDEQCLTLLKQSIDTVKVYPQSVNIRPTVIALPKT
FT                   DNGQPEDLLPRLEKLRAKYSELVAQDSRNKVLGEPENYFKFYSRTELDALLDLPLPKTA
FT                   KNDSDWLVAFAQHVDLDSLKFPVLLVQEYGLSAFRFAAIASLAIEGLPSCHLQTNKQVI
FT                   AIVQQKNSLGWQVSTQALPQHQQSPTIIHQHFDYVINACGFKSGEIDDMVSAKRKRMVE
FT                   FKAAYVAHWPQCQGLWPEIVFYGERGTPQGMAQLTPYPDGYFQLHGMTQDITLFDQGLV
FT                   ASSLESAQPQLAKRFIEKIDKKWPEQLVHNRTLGSIEHIAQFISAFSSAEVAAKPLFGA
FT                   QQIPGEDADLRAADVSFYGQHYARAEIVKASSALAAGDAILKNLVDCGLIAALELGRYL
FT                   TEHYFPVSQQCSEIEVTERAIMLAKQREYPIALAKNL"
FT   gene            complement(265002..265682)
FT                   /gene="gph"
FT                   /locus_tag="CPS_0261"
FT   CDS_pept        complement(265002..265682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="CPS_0261"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01449; match to protein
FT                   family HMM TIGR01509; match to protein family HMM
FT                   TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25705"
FT                   /db_xref="GOA:Q48A85"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A85"
FT                   /protein_id="AAZ25705.1"
FT                   /translation="MKLQEKEVLLFDLDGTLVDSAPDLALAVNRTLKDLNKATFDQDTI
FT                   HHWVGNGAKVLIERALSGSAIIDKELDETLTKDALTIFLAHYQQCLCIESVLYDDVQEG
FT                   LLSLKAAGFRLAIITNKPAIFIQPILTGLGIDNLFELLIGGDTLADKKPHPAPLHYAMK
FT                   QLNVVAEQCVMIGDSKNDILAAKAANIDSVGLTYGYNYGEDINQYGPQWCFDTFNELLI
FT                   SLKR"
FT   gene            265937..266257
FT                   /locus_tag="CPS_0262"
FT   CDS_pept        265937..266257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01XC3548"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24104"
FT                   /db_xref="GOA:Q48A84"
FT                   /db_xref="InterPro:IPR022109"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A84"
FT                   /protein_id="AAZ24104.1"
FT                   /translation="MSYLLNNINCSSPRWAVFSRSVAATLGGYALATSSSLFIGQLLLN
FT                   SAGKYQAIHIGLLLSFLVYACAAMWVFSVSSATKAWIGLIKANIFLAIGTWLLMQSTGA
FT                   NS"
FT   gene            266257..267888
FT                   /locus_tag="CPS_0263"
FT   CDS_pept        266257..267888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0263"
FT                   /product="putative iron-regulated membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01XA0270; match
FT                   to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27918"
FT                   /db_xref="GOA:Q48A83"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A83"
FT                   /protein_id="AAZ27918.1"
FT                   /translation="MKDNFRQSMKWFHTWVGLSVGWILFFMFLTGTLGYFYQEITRWME
FT                   PERPFIQHNISTEQLITIAQTYLQKNAQGVDEWDINLPTVRNQNLRVGWRNPSEAGKKR
FT                   GRYKTTVLDITTGEKVESRATGGGRLLYRMHYRLHYLSTKISYWIVGFCAMLMLLAVIT
FT                   GVVIHKKIFTDFFTFRAKKGLIGWLDIHNVLSVIALPFHFMITYSGLLFFLFTYMALST
FT                   NLQTNEDEYREMRKEIYPRTSHADSANQPAEMQDIASLYQQAKNTWKNDELNAVEVFAA
FT                   NDINAQFLFIRHETDITYNPNDQVMVNAITGEVIQQTPREYTAAGMIHNGFYSLHEGQF
FT                   AGPLARWIYFLTGLIGTAMIASGLILWTTKRKPKQLKKPDGPDFGYRLVEQLNIGTIVG
FT                   LPIAIAMYFYANRLLPVGMVDRVDWEANVMFISWALLLIYPAFRSPTRAWLEQLQLAAL
FT                   VYMALPLVNALTTDKHLVNSLQQQDWGLAAFDLTFFTVGCCFAFSAYKYKTLQPEKAMS
FT                   RKAIRQDSAIDNESRLQLQCISKENG"
FT   gene            267888..268211
FT                   /locus_tag="CPS_0264"
FT   CDS_pept        267888..268211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0264"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01XC0250"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24950"
FT                   /db_xref="GOA:Q48A82"
FT                   /db_xref="InterPro:IPR021762"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A82"
FT                   /protein_id="AAZ24950.1"
FT                   /translation="MFLLTSLSFLVMVLFCLAMNKHREQVLTKTLPKVAILLFRPLAWL
FT                   ALLFIAYLSVALFGWSIGPAFLFGALTMATLLLIMVLTYRAKIIPQLALASLLIAGVSV
FT                   LSH"
FT   gene            268319..269077
FT                   /locus_tag="CPS_0265"
FT   CDS_pept        268319..269077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0265"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:SO2846; match to
FT                   protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25688"
FT                   /db_xref="GOA:Q48A81"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A81"
FT                   /protein_id="AAZ25688.1"
FT                   /translation="MEFAGLTIEIALFLFTIAIIAGFLDTLAGGGGLLTLPALMMSGIP
FT                   PLVALGTNKLQSCVGAGTASVMMLRNRRVRWRQVKELMPAAFIGSAIGTVIVQFVNTEA
FT                   LTFIIPVVISVIGIYFLVTPTVDADNKPAKVSTSGYRNFVVPLIGCYDGILGPGTGSFF
FT                   TLAGRALRGQKFLEATAIAKTLNFSTNIASLIVFLFAGQVIWLVGITMMFGQLIGAWLG
FT                   SHCLFKIPINYLRYLVVIMCFGMLAKYITT"
FT   gene            complement(269136..270863)
FT                   /locus_tag="CPS_0266"
FT   CDS_pept        complement(269136..270863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0266"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25337"
FT                   /db_xref="GOA:Q48A80"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A80"
FT                   /protein_id="AAZ25337.1"
FT                   /translation="MKIKKNIFTMIWTTLSVVIFTLTQLSICQAEQVSEEPIANIPEVV
FT                   EQKIVIRNITFVDPAKKKKSTTANLVITNKLFDLVTQDDIDVGHGDIIFDAQNGFILGS
FT                   LESGKIANFLILDVDPHENIEALLDTKKHVLLAIHNGVIIRNNLRAESNISALAEQKRV
FT                   KPKRTGWLSYTPPPIVLPSNYKDADWIKFDNDYFSTILIGALALDRQSWESQDKDSLAQ
FT                   VGDLQDFNGGEIRALRFGIAGAIKFDKPWIYMITGATNTFDKGFDTNTTDNVSFMDWRL
FT                   DIPTIYNTTLSIGKQKEPISMERLMSMTFLPMQERALVSDALLPSRNFGAVLSGITLNQ
FT                   KLTWAGGVFNNWIEDEGSLSENSTELVGRTTWLPYLSEDENELIHLAFGLRYSNAKEGL
FT                   RYASEPEFNKSTTFVDTGNIDADNSVTYNLEASWRKGPVWLIGEYTKSKVAADYLQNPE
FT                   LSGYHVSAVFSVTGEMREYNKRSGTFSPLRVARSVEQGGWGALEVSTRWSVFDGSDGGL
FT                   AAGDTSILSVGFAWWLTPKFNVNFNYRWIDLDRCSFISEACNLQGRSSGFNTRLALFL"
FT   gene            complement(270913..272142)
FT                   /locus_tag="CPS_0267"
FT   CDS_pept        complement(270913..272142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0267"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24752"
FT                   /db_xref="GOA:Q48A79"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A79"
FT                   /protein_id="AAZ24752.1"
FT                   /translation="MLTNKTLLTLVITGLLATASTYATEDNSTQDHLVKGQSANFGSPD
FT                   AVDNQIAEDNKRSKPDFKTQLEHNNINMGVDYSTVFLGANNVLTGSDDNAGSSMIRFYG
FT                   SWNPIGVGTKEVGGLVWKVEHRHSYTDTSVKDFEFGTGGLGLVTPPFSDQGFRVTNLYY
FT                   KQKYMNGRASFVAGFLDITDFVDVFAMASPWTGFMNFAFSTGTTTMALPGDAALGAAGG
FT                   IMLSDEYYIVASLVDMNSDPTNIIDGLETFFKENKYFKSIELGWTKSQGEIYVDNIHAT
FT                   LWHADESVEQGSNRGYGINFSASRLIDGQWLPFVRAGYSQDAGTLMEKSISAGFGYYGL
FT                   GGEENNLGAAINWGQVKGNDDQYTTEVFYIMKPLDYLEVTADLQYIANPALNTLDNSTL
FT                   IYGLRLRLAI"
FT   gene            complement(272252..273607)
FT                   /locus_tag="CPS_0268"
FT   CDS_pept        complement(272252..273607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0268"
FT                   /product="putative Xaa-Pro dipeptidase"
FT                   /note="identified by similarity to GP:4887599; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26345"
FT                   /db_xref="GOA:Q48A78"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A78"
FT                   /protein_id="AAZ26345.1"
FT                   /translation="MKLKNTLISKATSKLVISAVAAFSLTSAAFAADQTLIKNVKIWDG
FT                   TSSGLSKQQDVLIEGELIKSIGSGLKVAADVEVIDGQGKTMIPGLIDMHSHLCLQEGML
FT                   VGRDNYDQMAMGARTAHSLTQYLDQGFTTARDVGCNVLGVAKAINNGLLPGPRIFPAGG
FT                   FLSQTGGHADTGRFNDQPGAIDDLERHGFGYIVDGKTEVRRAARQNLRAGATHLKLMAG
FT                   GGVASEFDPLHSTQFSVEEFEAAVEVAKDYGTYVTVHAYHDRSVNRAIDAGVRVIEHNF
FT                   LVSEKTIKRMKKEGIALSAQSVMSLQAFGDPDSITFFSADQKMKAKKVNSGATQMFKWA
FT                   LKHNLLIVTGGDMFGPAYNTKQAENMTWMGKVGAKPLQIMKMGTSNAAEVLTWSGGMNP
FT                   YKYGALGVIKKGAYADLILIDGNPLKNIEVLNEYKTKFKLIMKNGQVHKNTL"
FT   gene            273875..274870
FT                   /locus_tag="CPS_0269"
FT   CDS_pept        273875..274870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0269"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24043"
FT                   /db_xref="GOA:Q48A77"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A77"
FT                   /protein_id="AAZ24043.1"
FT                   /translation="MKTDITVVKASHLQPFISFLDKVGAPLDRLLNQVNLHADYFSDQE
FT                   NLIAEAPFWALLEHASYSQGIEDLGFQVTEQLSLDSFGVFGAKVMQADSLHQALTTFIR
FT                   DMGQQSNCPPFWLMEQGAFVWFCRLGTQGIKKGHWPIEQHVISLMIQLVRGFTTATWTP
FT                   PKVHLQTHTLKGADNTASFSNSQILINKAFTGICISKSLLLNGAVIKPKDRVAEEVAHQ
FT                   MTISTVNSHVIKELLMQSCANQPLNAQQIANSLGLNIRHMQRLLKEEGCSYRELSEQVL
FT                   FKQSQVMLSTEQLSVLEVALALGYSDAANFTRAFKRWSGLSPTQYKLLLN"
FT   gene            274878..274970
FT                   /locus_tag="CPS_0270"
FT   CDS_pept        274878..274970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24576"
FT                   /db_xref="GOA:Q48A76"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A76"
FT                   /protein_id="AAZ24576.1"
FT                   /translation="MFIATTSQYEVVAKLSLNWPVPQKTDHLKK"
FT   gene            275090..275284
FT                   /locus_tag="CPS_0271"
FT   CDS_pept        275090..275284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28079"
FT                   /db_xref="GOA:Q48A75"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A75"
FT                   /protein_id="AAZ28079.1"
FT                   /translation="MAVMAKLGSAVSATKALAEVIIINKTQEISNAFSVKMFFIMSIPY
FT                   RSTYNSGKIITQARSTICQ"
FT   gene            complement(275221..275841)
FT                   /locus_tag="CPS_0272"
FT   CDS_pept        complement(275221..275841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0272"
FT                   /product="cytochrome c oxidase subunit III family protein"
FT                   /note="identified by similarity to SP:Q06475"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28601"
FT                   /db_xref="GOA:Q48A74"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A74"
FT                   /protein_id="AAZ28601.1"
FT                   /translation="MTITATGFNLNGSGSVTKEPETLNKIPGNRAIWVGIFAEMTEFAL
FT                   FFLVYFIAKAHYPEQFNQGPQQLNTLAGTLNTFALISSSYFVAKALASIRMDDPEQSIK
FT                   WLWRAVSCGCIYLVIKVWEYHWNVDQGIVTNTSKFYTMYYYMTFNHLLHVGWASGSLLW
FT                   AIHQLKVGRYTKKNHIGLTAIACYWHMVDLAWVIIFPLLYVLR"
FT   gene            complement(275966..277348)
FT                   /locus_tag="CPS_0273"
FT   CDS_pept        complement(275966..277348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0273"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27032"
FT                   /db_xref="GOA:Q48A73"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A73"
FT                   /protein_id="AAZ27032.1"
FT                   /translation="MKFDIKEEHLIIKPYKSQTSVYVREQKGFYQKIRRYINWLLMFAF
FT                   IAMPFVQFNDQQAVLLDVVKQEFRIFNLTFWPQDFILLAGILMVAAFALFFITTWLGRV
FT                   WCGYVCPQTVWTLAYVWVEHRIEGTRNKRMALDKAPWTLNKAYKKTLKHIIWQLMSIFT
FT                   ATTFISYFVPVSELYSTMLTFDWSGAVTFWVVFFALATYGNAGWMREHVCIHLCPYSRF
FT                   QSAMFDKNTLLVAYDAERGENRAPRKRKDDPKALGLGDCVDCNLCVDVCPAGIDIRNGI
FT                   QYECINCGLCIDACDQTMEKFNYPKGLIKYTSEQQLAGKESSRFNLKLVSYAGLTLMFT
FT                   LLLGIWIDSRIPLEANIIRDRTALYRVNYEGVVENTYTLKILNKTQQPLHFDIKVENLN
FT                   DIEIKLPKNVRIGAGVMEEIPVTLAIDGYKLEKKITNFDFIIQAVEQPNILVQKNTVFF
FT                   RN"
FT   gene            complement(277531..278955)
FT                   /locus_tag="CPS_0274"
FT   CDS_pept        complement(277531..278955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0274"
FT                   /product="sigma-54 dependent transcriptional
FT                   regulator/sensory box protein"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF00785; match to protein
FT                   family HMM PF02954; match to protein family HMM TIGR00229;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27557"
FT                   /db_xref="GOA:Q48A72"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A72"
FT                   /protein_id="AAZ27557.1"
FT                   /translation="MPANIKEFLADSQLLLNAVGEGVYGFDKEGNAVFVNPASEQMTGW
FT                   KSEELLGKNIHKYHHHTYANGEVYPSEECSIYNTMRDGVERKITDEVFWRKDGTSFPVE
FT                   YTSTPVYKDGELIGAVAVFRDVSQQRLADSNLRAALKKVQDLTEKLQAENSYLQEEINE
FT                   NWHGSGLEGNSPKFLAMLQQIKLVAQTDSTVLILGENGTGKELVARNLHQLSQRHNTPL
FT                   VKVNCAAFSSNLLESELFGHEKGAFTGASEKRRGRFELADKGTLFLDEIGELSPDAQSK
FT                   LLRVLQEREFERVGGSKTIKVDIRIIAATNQDLLAMVEQGKFRMDLYYRLNVFPIVMPA
FT                   LRERIEDIPLLCHSILAQLNTKLNKDIKSISKHSLNKLASYHWPGNIRELQNILEREVI
FT                   LSTSTTLQIQQKFDKSQSVVRTFNKPLADIEKAYIIEVLNDCHWRIGGKNGAAKILGLP
FT                   DSTLRSRMIKLKIKRG"
FT   gene            279110..279331
FT                   /locus_tag="CPS_0275"
FT   CDS_pept        279110..279331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26109"
FT                   /db_xref="GOA:Q48A71"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A71"
FT                   /protein_id="AAZ26109.1"
FT                   /translation="MKQGDDREKKWYKELNILLSSFSRYYCLFKADNSFLAKKLSIFER
FT                   NSLYNKIDPSISSFRLVKLSIFKPKGKS"
FT   gene            complement(279184..280161)
FT                   /locus_tag="CPS_0276"
FT   CDS_pept        complement(279184..280161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28479"
FT                   /db_xref="GOA:Q48A70"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A70"
FT                   /protein_id="AAZ28479.1"
FT                   /translation="MSTQSELQARYNDIYRGVYFIGTTPPKSDTPLDKVSEIAEKLLDR
FT                   VSDIDFDGLIVYDIQDENSRISKPRPFPFKSTHDTRLYSSLLNKKSTRPVITYKSVVQS
FT                   NSDDFNEWANEAWQKYGVKDVVLVGSPSKDNKISLSLADAYKTLVDNPHDFFIGGVTIA
FT                   ERHASNKNEHERLMAKHQQGCSFFISQAIYNPQATIDLLTRYAIECQKQGVKPQRLILT
FT                   FSPCGSEKTLEFIEWLGVNVPEATSLRILNAQSPLYESIQFCVNSLQQILDAILPYDLP
FT                   LGLNIESLTNRKEEIDGSILLYKLLRSKMDNFLAKKELSALNKQ"
FT   gene            complement(280582..282834)
FT                   /gene="iorB"
FT                   /locus_tag="CPS_0277"
FT   CDS_pept        complement(280582..282834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorB"
FT                   /locus_tag="CPS_0277"
FT                   /product="isoquinoline 1-oxidoreductase, beta subunit"
FT                   /EC_number="1.3.99.16"
FT                   /note="identified by similarity to SP:Q51698; match to
FT                   protein family HMM PF01315; match to protein family HMM
FT                   PF02738; match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27928"
FT                   /db_xref="GOA:Q48A69"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A69"
FT                   /protein_id="AAZ27928.1"
FT                   /translation="MNAIENVSRRGFLKVAGITSGTFVLGMNLPLATAQVKSSTAALSH
FT                   ELNFFVSIASDSMVTLVCHRSEMGQGIRTSVPQIIAEELEADWQKVTVVQAKADAKYGS
FT                   QGTAGSASIRSHFTSIRQIGAVARDMLEQAAANIWQVQRNSVKAEKHFVVHTATGEKIS
FT                   FGELASHAAKLTPPDSSKVKLKNSADFSLIGKDVKLVDLDNIVAGKAQYAQDIQLPDML
FT                   IATIVRPPVVGGSLVSFDASETLKIKGVVDVIALKPRGIPVTTNPLSGVAVLADNTWAA
FT                   IEGRKKLKIKWQHGDKASHNSAKFIKQLAKQVNQQGEMVAKKGDIYNHKYLDENTVEAT
FT                   YTVPYIHHAPMETPAATAIVKGKKCTIWAGTQNPQWAKSNVATELGLGKDEHDNIELNV
FT                   TLMGGAFGRKSKADFIIEAVELARASKRPVKVIWSREDDIQHGFYHSISANYCKAELTG
FT                   NGSADYWVSRNAYPPIGWLWNPEAKMPSDDQLALGFGDIPFALNNLSIEKHAVDSFVRP
FT                   GWVRSVACINNGFALGSFVDELAVKAKLPTRQMWLNLLGDDRHVDPNKNGFKYSNYNLS
FT                   LTDHPVDTKRMKDLINLISDKANVEQELPENQGWGISFLRSFGSFVAAATKVEVVNNKV
FT                   TVLEMHTAVDCGIVVTPDRVKAQMEGAMVFGLSIALMGEITVDEGKVQQSNFHDYPVTR
FT                   MNQVPEMHVHIVKSDAPPGGIGEPGVPPVAPSITNAIYHASKTRIRDLPVNKVFTV"
FT   gene            complement(282837..283382)
FT                   /gene="iorA"
FT                   /locus_tag="CPS_0278"
FT   CDS_pept        complement(282837..283382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorA"
FT                   /locus_tag="CPS_0278"
FT                   /product="isoquinoline 1-oxidoreductase, alpha subunit"
FT                   /EC_number="1.3.99.16"
FT                   /note="identified by similarity to SP:Q51697; match to
FT                   protein family HMM PF00111; match to protein family HMM
FT                   PF01799"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24896"
FT                   /db_xref="GOA:Q48A68"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A68"
FT                   /protein_id="AAZ24896.1"
FT                   /translation="MIKITLNNKPVELDVDPQMPLLYALRDELKLTGTKFGCGAGQCGA
FT                   CTVHLNGTAIRSCITPVSAVAEQAITTIEGLADSTGRLGESAVQVAWREFKVPQCGYCQ
FT                   SGQMMSAAALLKATPQPTDEQIIEHMQGNICRCGTYQRIKAAIKSAAAHSPNSDLSASH
FT                   SPVNKNGVEIFDASKQGA"
FT   gene            complement(283456..284112)
FT                   /locus_tag="CPS_0279"
FT   CDS_pept        complement(283456..284112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0279"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:PP2483"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24365"
FT                   /db_xref="GOA:Q48A67"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A67"
FT                   /protein_id="AAZ24365.1"
FT                   /translation="MQVNIILLAAGKGQRFQSSSPNKIGCATIKQLARINDKPLIVHSI
FT                   DKLQPLLKNAYVHNFFVTLGANKNAIQTVLPQDISVIASQHWAEGMGHTLAESVHSIKA
FT                   TSSHVLVALADQALITTEHYQELLSASKEQPNKIIATLCEGQLMAPAIFPEKYFPLLVK
FT                   IQGDKGAGKLLLQHAKKADAITCEDAKIDIDTFSDLERVRQHLEYALQDNQQSSL"
FT   gene            complement(284102..285145)
FT                   /locus_tag="CPS_0280"
FT   CDS_pept        complement(284102..285145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0280"
FT                   /product="putative xanthine dehydrogenase accessory factor"
FT                   /note="identified by similarity to OMNI:PP2480; match to
FT                   protein family HMM PF02625"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25737"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A66"
FT                   /protein_id="AAZ25737.1"
FT                   /translation="MSNRLAALLASWFPDKDSCQWVLASIIETQRSSYRKSGAMMLINS
FT                   LGKSYGLLSGGCLEADLMRQAQKCWHQNSNITVCYDMQDDSDIAWQLGIGCGGLVKVLL
FT                   QPINHDNNYLDLLTLKSQLDNRNACFYHIDTLNTQNTSVSNNQVLSKSVSSLEPLITIK
FT                   PSPALVIFGGGVDAQPLVKIAQTLGWFICLIDCRTAYARAAYFKEADIVINQDYTSLEK
FT                   NLVLPKADAIVIMHHNVSLDAHALQLVKNQENLAAASYIGLLGPQHRTEKVLKKAQLNS
FT                   TDLPNKLANKLANPIGFDLGGDLPESIALAILSQAHATLEQASGNSLGYFQSQITNNIK
FT                   QVISHAG"
FT   gene            complement(285249..288356)
FT                   /locus_tag="CPS_0281"
FT   CDS_pept        complement(285249..288356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0281"
FT                   /product="PqiB family protein"
FT                   /note="identified by similarity to SP:P43671"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25034"
FT                   /db_xref="GOA:Q48A65"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A65"
FT                   /protein_id="AAZ25034.1"
FT                   /translation="MTDKKDFAASEHNNNDNIHAEVVPRQGISIIWFVPFIALIFGLWL
FT                   TAKVVSEQGTFITIEFDNGSGIIPNKTEIRYKGLVTGLVKKVVPSADLQRVIAEVEISK
FT                   NFTDYLTENTRFWLVSADISLQGVSGLDTLISGSYITIMPDTNQEADSQDHFVALTEAP
FT                   TLDMSTPGLHLTLHTDVLGSISENSPISFKQIPIGHVTGYHYKESSKKIGINIYIKPEF
FT                   AHLVKENSLFYNTSGVQVTASLTGGVKVNTESLASIMAGGISVDNLSYQTELAPAKNGQ
FT                   TFPLHADFQSAEMGHEVELTLEWNSGIDHNAAILFQGLTIGVIESFSKIDPVSRKITAT
FT                   AKVNPRVVPYLTDQSQFYIVAPQISLAGLTNAKTLLTGNYLSIRPSLAGNPSNKFNVFS
FT                   SKPPYKYTEPGLHLMLTSSDRSSLQIGSNVYYKQQVVGNIQAIETTAPERHLIHIHVQP
FT                   KFSHYVNHSSRFYNNSGVKISANLLGVDIQAQSLQSILTGGIAFTSQNSTQESQKKLVK
FT                   NGDSFSLYANNKLAEQNISFTLNYMASEHISSDTRLLYRGIEIGAIHQTKIQGNKQQLQ
FT                   LGLLPEYEHILKADTQFYIVKPNLSLSGASDTDALFGGTYITFNLGQGKAKNQFTLFSQ
FT                   PPVKLASSPGLQLSLSTDHANVATPGSAISYRGITIGQVDNVSLNKIDDEIKVNITIDE
FT                   EHRGLLKSTSRFYNAGGMTISGGLSDFVVKTESIDAILRGGISFYNPEVLLPTSLITNT
FT                   QVEELSNFTLFKHEEHAKDAGQTISIHFNDISGLKVNTKVIYQEQTLGTIERLIFTADK
FT                   VGVTALVLLNDSGSQFARKGTKFWKIEPQIGLVGSKNVAALLDGAFIGLLPSHNVEAKL
FT                   KNEFEALELAPTVEQLSYGLNIKLTTARLGSVRVGNPVLYRQIKVGKVIGIDLSATADQ
FT                   VNIFINIAKRYAPLVNGNSQFWNTSGINIEASIFSGINIDSESIETLIAGGIAFATPDI
FT                   DENNDKEQNDETKSLPASFILHQDVDEDWLEWQPKIAINNQTTSAE"
FT   gene            complement(288359..289694)
FT                   /pseudo
FT                   /locus_tag="CPS_0282"
FT                   /note="paraquat-inducible protein A, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to SP:P43670"
FT   gene            complement(289807..290763)
FT                   /locus_tag="CPS_0283"
FT   CDS_pept        complement(289807..290763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0283"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24352"
FT                   /db_xref="GOA:Q48A64"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A64"
FT                   /protein_id="AAZ24352.1"
FT                   /translation="MKKIIFSLFVALSSVSAVQAADANAGKEKAGACSACHGPTGVSGS
FT                   PMFPNIAGQNDAYIIKQLKDFKSGARTDAMMAPMAANLSDADMADLAAHFSSLPSANEQ
FT                   AAASSSADTSTGAAPAAAPAAGNVEIVSSTPAAAIYAGNVAAGQNKSAACAACHGADGN
FT                   SLVPTYPSLAGQSANYIAKQLADFKSGNRNDPIMAGMVAGLSQEDMDDLAAYFAVQNTK
FT                   AGTGESNSAGHKLYLGGDAAKGITACIACHGVTGKGMKQAGFPSLTGQSKDYLKKQLAS
FT                   FRDGSRGNDNSGIMRNIAIKLSDADIEAVSQYITSLK"
FT   gene            291009..291683
FT                   /locus_tag="CPS_0284"
FT   CDS_pept        291009..291683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0284"
FT                   /product="putative GTP-binding protein"
FT                   /note="identified by similarity to SP:Q8X8H0"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24219"
FT                   /db_xref="GOA:Q48A63"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A63"
FT                   /protein_id="AAZ24219.1"
FT                   /translation="MSSTKIHLTKAAFTISAPDIRRLPADSGIEVAFAGRSNAGKSSAL
FT                   NTLTNQRGLARISKTPGRTQLINVFEVAENRRLIDLPGYGFAQVPLAMKKKWQKALGEY
FT                   LEKRQCLKGLVVLMDIRHPLKDLDMDLIQWAADSDLPVLALLTKCDKLSQGKRSSEVLA
FT                   VKKALSSLNADIQVQAFSSLKYTGKEQADAIICQWLEQEAQEYELPEEDDFDDSDEFTE
FT                   EE"
FT   gene            complement(291797..293602)
FT                   /locus_tag="CPS_0285"
FT   CDS_pept        complement(291797..293602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0285"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM TIGR02204"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28464"
FT                   /db_xref="GOA:Q48A62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011918"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A62"
FT                   /protein_id="AAZ28464.1"
FT                   /translation="MSDQPAASDLAENASIDTAEKKKISILLELIQFIRPYKSQVLAAF
FT                   IALIFTAGVMLSVGQGVRMLIDEGFAQQSIEQLQQAVLFILAITVLIAGGTFFRFYLVS
FT                   WLGERVSADIRLAVFNHVITLHPSYFETNGSGDIMSRITTDTTLLQSIIGSSFSMAIRS
FT                   VLMLLGALVMLFATNIKLTFIVLLSVPFILVPILFYGRKVRKLSRKSQDSMADVGSYAG
FT                   EAIEHIKTVQSYTHEQHERRSFGKEVEKSFNIGRNRIKQRATLIAGVIIIVFGAITGML
FT                   WVGGSDVIQGKMSGGDLGAFVFYAILVASSLATISEVLGELQRAAGATERLIEILQVES
FT                   HILPPVENAISAKDLNAQIVFEAVSFNYPSRPDQAATQALNLTAQQGKVLALVGPSGAG
FT                   KTTLFELLQRFYDPQVGRITLGGTDIRQLDPKDLRQQMALVPQQPALFSSDVFHNIRYG
FT                   KPEASDEEVISAAKKAHAHEFIVNLPEGYNSFLGERGVRLSGGQRQRIAIARAILKDPH
FT                   ILLLDEATSALDSESEQHVQQALEELMRGRTTIIIAHRLSTIQHADKIAVLEQGRIIDM
FT                   GDHQSLLQNCELYQRLVELQFKKLG"
FT   gene            complement(294102..294857)
FT                   /locus_tag="CPS_0286"
FT   CDS_pept        complement(294102..294857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0286"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27411"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A61"
FT                   /protein_id="AAZ27411.1"
FT                   /translation="MKLHHIDGHIQTILLAEYPDKLLLLDGCCRSDILMLKHFITKTLQ
FT                   RSFNDLTLVVVTHMHPDHAGAADKLRKLTGCKVATANVSGQWYSGIDGRLMHLTDILLA
FT                   KWVAKRMKKPRMNFWYSSQLTADYKLNDNEQIPGFSEWVALATQGHTDRDLSLHHLPSN
FT                   KVYVADLIVKVKNKFIPPFPIFYPNRYRASLHKIIELKPQSIILAHGGEVTPTEDDYQH
FT                   LLSLAPKIPKTHWRSVKARLFKPFKNSRS"
FT   gene            295220..296320
FT                   /locus_tag="CPS_0287"
FT   CDS_pept        295220..296320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO0013"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26465"
FT                   /db_xref="GOA:Q48A60"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A60"
FT                   /protein_id="AAZ26465.1"
FT                   /translation="MFKAMLKLLFPSIKNNKKPNYFYYEKDKNTEEETQQQALEKVQRA
FT                   GPVKLLRLASVEETHCQEFYDFLFGQSPATTQRDELSHYVADKIEAVLRKPNTIIEAMP
FT                   VLPASLSKVMDQLSDNNFDTQELINLIQQEPSIAAKVIELANSSFYNRTNKEVSDLKSA
FT                   FMLLGSNGLMEGVINGFVSKMTPQAQIYFKQYGNKIWQHSFGTGVIAKALIKASPYKAE
FT                   AAQGYLIGLICNLGDMIIYQLLMEAFSFIHPDCQPNSYAFKELMQQKSKKLTYHIAKHW
FT                   QFPQSILDALALQVKVTNASMLAGVFSKRPIACFVYEANIISELIMMLEHNDKTEGEIK
FT                   ESVEILLYSNEAKQYVERLLVDRVNN"
FT   gene            complement(296529..299621)
FT                   /locus_tag="CPS_0288"
FT   CDS_pept        complement(296529..299621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0288"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25970"
FT                   /db_xref="GOA:Q48A59"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A59"
FT                   /protein_id="AAZ25970.1"
FT                   /translation="MQESKPSVMDIFVRRPVVAIVLSIIICIAGIWSASKIPVLQFPKI
FT                   DSASLVIETYYIGASADVVKGFITEPIERAAATVPGVEYVDSTSTSGSSKVTAWLKLNE
FT                   NSTLALAELTARLGQIRFELPQGAQDPVVSVSRADRPFAVFYLNVQANGNDLSRITDYL
FT                   TRQVNPVLNAIEGVQRVGIEGARTPAMRVWLNAQALQIFNLSASDVYQALATNNTIATM
FT                   GYVENSRQKIDIVANTQLSSVEEFQQLVISEVDGATIHLKDVAKIELAAEDTSVTARLN
FT                   DKDAVYISIWPLPGANEIAIGDRLYEKVDELNKTLPHGISIDYAYDGTLYMRDALKEIF
FT                   TTLAETVILVGLVVVLLMGSFRSAIVPLITIPISILGAIAAMGIMGFSLNLLTVLAIVL
FT                   SVGLVVDDAIVVVENVARLMRQGLSKFDAALISSRQLLVPIISMTLTLAAVYAPIGFLS
FT                   GLTGVLFKEFAFTLAIAVIISGIVAITLSPIMSAYVSPKGGEESWLTTKVNHLFERLQR
FT                   RYGQLLTHIFKWQGQVFLIALVVSLLTVPFYLYSKKELAPIEDQATVMFVIQSPPDASM
FT                   AYNVAQMNPVVESLQEIEGGKKIWQIIFGGGGFGGLELVNADKRDYSAQSLVPQIYGKL
FT                   SQIPGLNMFPILPSSLPSSGQFEIEMIVKATAPYSEMKQYADQLVGAAFSSGKFLFADT
FT                   DLKIDLPQVELQLNREKIADLGMNVGEVSEQLGILLSSNFVNRFDANGKAYRVIPIVND
FT                   EVRSKTEAILSLDIKLPTGELLPVSAVADLKWKTVPRQLGTFAQQASFRIYGGVAPGSN
FT                   KEAALSAIEDAAKEILPLGYSIDYAGESRQLRKEGNTLVMVLGISLLIVFLVLSIQFNS
FT                   FRDPLVVLLGCVPLALSGALLIPYIELTTINIYSQIGLITLIGLIAKNGILIVEFANHA
FT                   QELGANKLAAVTEAATTRLRPILMTTAATILGHFPLVLVTGAGAEARNSIGIILVAGMF
FT                   IGTIFTLFILPSFYLLLAEKRDKLMLDEIQVSDEALQKVHS"
FT   gene            complement(299631..300767)
FT                   /locus_tag="CPS_0289"
FT   CDS_pept        complement(299631..300767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0289"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26317"
FT                   /db_xref="GOA:Q48A58"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A58"
FT                   /protein_id="AAZ26317.1"
FT                   /translation="MNITKWLLVIIILAGTIFGLYSYKTSLQQAANEQAASMPEMAATV
FT                   TAVKVANISYQKRIKVSGEVQAFKFLMLNNELAGEIIRLNAASGQVVNKGQLLLELDHR
FT                   DEDARLMAAKATLTLNQQTLDRNIKLHKNRGISEEQVDQARAAVQIAKANISVIATAID
FT                   KKTLTAPFTAKVGIHTLEVGQYLDKNSQVLELVGVNDFTWIDFNLPQLYQELGLSSTVK
FT                   ISPISQDSVFEAKIIAIDPQLSRLSRHLKYRAQLPSATLALKPNTLVSVIVPIANKATL
FT                   AVVPDLAIKRDALGNYVFVLEADEAGSYRAKQVAVELGERQGEQVMILAGVEAGQLIAN
FT                   KGAFKLFPGMKVYLADATATDVTKETTQAVVSDASAQD"
FT   gene            complement(300872..301618)
FT                   /locus_tag="CPS_0290"
FT   CDS_pept        complement(300872..301618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0290"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25777"
FT                   /db_xref="GOA:Q48A57"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A57"
FT                   /protein_id="AAZ25777.1"
FT                   /translation="MAPAPRFSAEEQERLIICAAIKAIEESSLLDFSMSAIAKLAGLSM
FT                   GSVYKFVQCKEDVLIALATRMYQERQSVFKKVLALPLTTPERIIATSLLDFSKVQMYNF
FT                   DNQLESIVNTEAMMKRCSERWLTQMIACGERCQTMFQQFLQNAADSGELTSGSRDIEEI
FT                   NLGTWSLSVGYFQTVRLHQCWHNDLDENIDGINDEENEKNTLVLAADNAHIRTMKRLVN
FT                   TYDWQQKISDDDIEKVCLHLADAALR"
FT   gene            complement(301768..302226)
FT                   /locus_tag="CPS_0291"
FT   CDS_pept        complement(301768..302226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0291"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24877"
FT                   /db_xref="GOA:Q48A56"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A56"
FT                   /protein_id="AAZ24877.1"
FT                   /translation="MEIRIGSLTHPAVIALLEQHHQDMLLHSPEESVHALDLSALAQEN
FT                   ISFWCVWKDDALAGCGALKELDNAHGEIKSMRTSPDFLRQGVAKLLVEYIISQATNRGY
FT                   QKLSLETGTMAAFLPAQKLYQQLGFHFCQPFGNYQEDPFSTFMSKSIC"
FT   gene            complement(302274..302951)
FT                   /locus_tag="CPS_0292"
FT   CDS_pept        complement(302274..302951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:VCA0042"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28029"
FT                   /db_xref="GOA:Q48A55"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A55"
FT                   /protein_id="AAZ28029.1"
FT                   /translation="MADISIEQSMQLFELQPGKSLDLQINNPVSLRLKLPLIGYELGKY
FT                   IILKYPKSANTSEYKDVLIEGNVLIVRYLMEGNKGECFAFRSSIKNITQYPEKFIFIEY
FT                   PNKIENRQLRLQQRTSIHLPAIIMLESSGDNKKTQINGIIGDISAKGCGFTFKTKSTST
FT                   KVNKRDIFVCLRSPIDGEVQIPARVCNSRNDNGTVNVGIQFIDNEKLVPKLLSELFIEN
FT                   TMS"
FT   gene            complement(303135..303527)
FT                   /locus_tag="CPS_0293"
FT   CDS_pept        complement(303135..303527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0293"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:28806154"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28775"
FT                   /db_xref="GOA:Q48A54"
FT                   /db_xref="InterPro:IPR021284"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A54"
FT                   /protein_id="AAZ28775.1"
FT                   /translation="MSISSEQLNTIEKYDEEKRLSYLLQQVVSNKEIWILADEHGCVML
FT                   NTEDEDCVPVWPNEEFAQRWATDEWQECKAEAISLDKWYSRWSTGLVDDELALVTFPNQ
FT                   DNQGLVLFPEEFEEALLKETKKQNRK"
FT   gene            304056..304871
FT                   /gene="ubiE"
FT                   /locus_tag="CPS_0294"
FT   CDS_pept        304056..304871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="CPS_0294"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P27851; match to
FT                   protein family HMM PF01209; match to protein family HMM
FT                   TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27000"
FT                   /db_xref="GOA:Q48A53"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A53"
FT                   /protein_id="AAZ27000.1"
FT                   /translation="MSPTDQNSQASDLSTTPQTSVEADNESTTHFGYKTIEKDDKISMV
FT                   AGVFHSVAKQYDVMNDLMSFGIHRLWKRFTIDASGVRPGNKVLDLAGGTGDLTAKFSKL
FT                   VGREGKVILADINSSMLNVGRDKLRDKGLVQNIEYVQANAEYLPFEENTFDIVTIAFGL
FT                   RNVTDKDKALRSIYSVLKPGGRLLVLEFSKPEHELLNKAYDFYSFNILPKMGELVAKDG
FT                   ESYQYLAESIRMHPDQETLKDMMEKAGFEQTSFKNLTGGVVALHKGYKF"
FT   gene            304874..305581
FT                   /locus_tag="CPS_0295"
FT   CDS_pept        304874..305581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02YP0443; match
FT                   to protein family HMM PF06843"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27301"
FT                   /db_xref="GOA:Q48A52"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A52"
FT                   /protein_id="AAZ27301.1"
FT                   /translation="MKPSNNKAVTLSSNQLSTQFSTKLSDSLLLPQVATATLELIINKA
FT                   LSLNNKPLSFTAVAHKTLTLELSEISFPLCFTIDNTASPVVIIVRSTTEYSDCSIKTSV
FT                   STLKKLKANQSLTDLIKQDELDVSGDIKIAQQFANIAQSLEIDWQTELAKHLGDVPTHK
FT                   LLQFGNKITKSLAATGKQLEADISEYLVHEKRLVVTSSQINAFNQQTKDVASKVDSLSA
FT                   RIDKLAADIIGKQ"
FT   gene            305650..307218
FT                   /gene="ubiB"
FT                   /locus_tag="CPS_0296"
FT   CDS_pept        305650..307218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="CPS_0296"
FT                   /product="ubiquinone biosynthesis protein UbiB"
FT                   /note="identified by similarity to SP:P27854; match to
FT                   protein family HMM PF03109; match to protein family HMM
FT                   TIGR01982"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25251"
FT                   /db_xref="GOA:Q48A51"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A51"
FT                   /protein_id="AAZ25251.1"
FT                   /translation="MSSQRLYQIVKTFLNFGLDEMVPADMLPWYANVGRHSLFWLRNKH
FT                   KDKTPEQRFRLAIESLGPVFIKFGQMLSTRRDLLPPELADELALLQDKVTPFDGEQARQ
FT                   LIIDAMGIDVFEQHFKDFDLVPLASASIAQVHTATLLTAEKNENIVIKVLRPNISKTIL
FT                   ADIKVMSLFAGVVARWLPDGKRLRPKEVVEEYRKTILDELDLNREAANAIQLKRNFEQG
FT                   SEYDKALYVPEIYSEYSFENVLVMERIYGIGVGEIETLNQLGVNMKLLAERGVEVFFTQ
FT                   VFRDSFFHADMHPGNVFVDATHPEDPTWIAIDCGIVGTLNREDKRYLAENFVAFFNRDY
FT                   RKVAQLHVDSGWVPANTSVDEFEFAIRTVCEPIFNKPLSEISFGQVLVNLFNTARRFNM
FT                   EVQPQLVLLQKTLLYIEGLGRQLYPQLDLWQTAKPFLENWVKEQMGVKAVLSKIKANLP
FT                   FWNEKLPEMPDLIYDYLKTSRENQHQQTQIMQTLLASQSKNNQRIIYSIVAAAIIIAGA
FT                   ILLSH"
FT   gene            complement(307282..307383)
FT                   /locus_tag="CPS_0297"
FT   CDS_pept        complement(307282..307383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25505"
FT                   /db_xref="GOA:Q48A50"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A50"
FT                   /protein_id="AAZ25505.1"
FT                   /translation="MVYWELGVTKKKTVEHVEKANQHAMFTCLSILN"
FT   gene            complement(307487..308095)
FT                   /locus_tag="CPS_0298"
FT   CDS_pept        complement(307487..308095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26199"
FT                   /db_xref="GOA:Q48A49"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A49"
FT                   /protein_id="AAZ26199.1"
FT                   /translation="MKKINNMANFKGVLLTLIIFWQATLSANTLPESLAENTNNQPIEV
FT                   PMSDTVLALKKALVIQLEIVELTDNSGLIYVGGKVNAADIELYLSQMKKILGDDFPRYR
FT                   QHQSERDHQTFHMTLINPYEYQSVTKEIDIGTILSVSLSGLGRVSIKDKTTYFVVAQSP
FT                   QATSYRQHLMLPDKDFHITLGFYPSDIYGVDKGIATLIK"
FT   gene            307980..308123
FT                   /locus_tag="CPS_0299"
FT   CDS_pept        307980..308123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0299"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24553"
FT                   /db_xref="GOA:Q48A48"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A48"
FT                   /protein_id="AAZ24553.1"
FT                   /translation="MVFSAKDSGSVLADKVACQNIIRVSKTPLKLAMLLIFFIYYHHLI
FT                   RH"
FT   gene            complement(308267..310300)
FT                   /gene="rep"
FT                   /locus_tag="CPS_0300"
FT   CDS_pept        complement(308267..310300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="CPS_0300"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01074"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24947"
FT                   /db_xref="GOA:Q48A47"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A47"
FT                   /protein_id="AAZ24947.1"
FT                   /translation="MKLNPGQNEAVKFVSGPCLVLAGAGSGKTGVICQKIAYLIQKCDY
FT                   KARNIAAVTFTNKAAREMKERIQKMLGRDLTRGLTVSTFHSLGLDIVRREIKILGYKPG
FT                   FTLFDDQDSLALLKELTIDELDGDKDLLSKLQSKISNWKNDLFLPDDALKSASDADSSE
FT                   YAEFYQRYHKHMKAYNALDFDDLILIPTLLMKNYPEVRERWQNKIRYLLVDEYQDTNAS
FT                   QYELVKNITGERGRLTVVGDDDQSIYSWRGAKPENLILLGKDFPALKLIKLEQNYRSSG
FT                   RILKCANVLIANNPHVYDKALFSELAYGVELRVIQAKNEENEIERVIGELIGHRFMNRS
FT                   QYKDYAVLYRGNHQSRLLEKALMQNRIPYKISGGTSFFSRPEIKDVMAYLRVLVNPDDD
FT                   NAFLRIVNVPKRELGPATLEKLGTYANMRQISMFAASFELGLEQTLTGRSLMKMQAFTQ
FT                   WVVDIADQAERGDTAAVLRSMIRQINYEDFLYDTSMSAKAAEMRMKNVTELFSWVTQML
FT                   EGSDDEEPMTLPQIVTRLTLRDMMERNEEEDSNDQVQLMTLHASKGLEFPYVFLIGMEE
FT                   GLLPHQTSIDEGSVEEERRLAYVGITRAQRELIFTYARERRQFGELSRTEASRFLHELP
FT                   QDDLNWELGAAKKKTVEHVEKSNQQGMAGLRAQLAKAKEAKK"
FT   gene            310414..310665
FT                   /locus_tag="CPS_0301"
FT   CDS_pept        310414..310665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0301"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:VC0163; match to
FT                   protein family HMM PF04380"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26724"
FT                   /db_xref="GOA:Q48A46"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A46"
FT                   /protein_id="AAZ26724.1"
FT                   /translation="MLNAKKIEEIAKQVTESIPPGLKSMANDFEDKAKSVLQSKLSQLD
FT                   VVTREEFDVQTQVLIKTRAKISELEAKLAELEEKIASS"
FT   gene            310746..312158
FT                   /gene="manB"
FT                   /locus_tag="CPS_0302"
FT   CDS_pept        310746..312158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="CPS_0302"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="identified by similarity to SP:P26341; match to
FT                   protein family HMM PF00408; match to protein family HMM
FT                   PF02878; match to protein family HMM PF02879; match to
FT                   protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27192"
FT                   /db_xref="GOA:Q48A45"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A45"
FT                   /protein_id="AAZ27192.1"
FT                   /translation="MSYSKVALTSGPSAITCFKAYDIRGKLGEQLNTDVAYRVGRAFAQ
FT                   HTKAKSVVVGGDIRLTSEELKHALAEGLMAGGTNVIDLGLAGTEHIYFATSHLQCDGGI
FT                   VVTASHNPIDYNGMKLVRENSKPISGDTGLFDIQALAEKNDFIDVETVGTLTTVDITQP
FT                   YTEHLLTYIDDKNITPLKLVVNAGNGTAGPALDAIESAFKALNVPVEFIKVHHQPDGSF
FT                   PNGIPNPLLIENRAATRDAVIEHGADMGIAWDGDFDRCFLFDENGEFIEGYYIVGLLAD
FT                   NFLNRIEGSKAEAKIIHDPRLTWNTIDIAEKAGGQAIQSKTGHAFIKERMRSEDAIYGG
FT                   EMSAHHYFRDFFYCDSGMIPWLLIAELVCLRKQPLSSLVKQRIAAYPSSGEINNTIADP
FT                   KAAIARVFAFYQEQAQVIDKTDGISMEFGNWRFNLRSSNTEPVVRLNVESKADVALMQE
FT                   KTEQVLALLLAE"
FT   gene            complement(312328..312462)
FT                   /locus_tag="CPS_0303"
FT   CDS_pept        complement(312328..312462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0303"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25035"
FT                   /db_xref="GOA:Q48A44"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A44"
FT                   /protein_id="AAZ25035.1"
FT                   /translation="MIKNNTLHTLMISINGQAMFNTRALALSLCDTNSERLLGCFQGA"
FT   gene            312616..313101
FT                   /locus_tag="CPS_0304"
FT   CDS_pept        312616..313101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0304"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27729"
FT                   /db_xref="GOA:Q48A43"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A43"
FT                   /protein_id="AAZ27729.1"
FT                   /translation="MLSLIDGVLLLQSDFNGKCFVQQFKCIALASGLTQDNSTQANKSK
FT                   NTAADEDETVEIAGYLMNANLLDELAGQNINKLADFDIDFHWFEWQAQSEELSPSRIKQ
FT                   QQALANKNNKLLVQQVDDVKFWQATELQIAQSFLTQEQLIFSQLAFSILVLSKTETN"
FT   gene            313101..313496
FT                   /locus_tag="CPS_0305"
FT   CDS_pept        313101..313496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:DR1053"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28298"
FT                   /db_xref="GOA:Q48A42"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A42"
FT                   /protein_id="AAZ28298.1"
FT                   /translation="MNEQGVIFNSNGKQLVGIEHLPEPIHQGQTNKGVIIVVGGPQTRV
FT                   GSHRLFVHLARALAKQRIVVFCFDYSGAGDSEGTVSTFTDIQDDIEAAFTPLSSAIVIL
FT                   LSWLDGAYAMLHRPFCFTSMSALNKRR"
FT   gene            313457..313705
FT                   /locus_tag="CPS_0306"
FT   CDS_pept        313457..313705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28295"
FT                   /db_xref="GOA:Q48A41"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A41"
FT                   /protein_id="AAZ28295.1"
FT                   /translation="MLYFNERPQQAKIKQVFLVNPWVRQSQTQAKAYLRSYYIKRFLVR
FT                   RFGKNCCQEKYNLHLLIFKTFINKAEPATILTNKRTL"
FT   gene            313606..313941
FT                   /locus_tag="CPS_0307"
FT   CDS_pept        313606..313941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0307"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26702"
FT                   /db_xref="GOA:Q48A40"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A40"
FT                   /protein_id="AAZ26702.1"
FT                   /translation="MLSGKVQSAFTDIQNFHQQSRTSNDINKQENFVTQMLRGLNQFSG
FT                   TCDIFLSGNDLTADEFKLLIKSNKHWREVMARATINQQIICQADHTSSQRDKQSQLIEL
FT                   VCKALAK"
FT   gene            314058..316340
FT                   /locus_tag="CPS_0308"
FT   CDS_pept        314058..316340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0308"
FT                   /product="UDP-N-acetylglucosamine
FT                   2-epimerase/UDP-N-acetyl-D-mannosamine dehydrogenase"
FT                   /note="identified by similarity to SP:P27829; match to
FT                   protein family HMM PF00984; match to protein family HMM
FT                   PF02350; match to protein family HMM PF03721; match to
FT                   protein family HMM TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25607"
FT                   /db_xref="GOA:Q48A39"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A39"
FT                   /protein_id="AAZ25607.1"
FT                   /translation="MKIGIIVGTRPEIIKMAPVIRECKKRGIAYFIIHSNQHYSQEMDS
FT                   IFFKELELPAPDYNLGVGSGLHSNQTGNILIEMEPILLQEKPDVVLVQGDTNTVLAGAL
FT                   AASKLDIKVGHIEAGLRSYDRTMPEETNRILTDHMSEYLFAVGPNQHAILAKEGIDSDK
FT                   IFTVGNTVSDSLFQHLDISASTSTILADLDVTSGEFFLVTAHRASNVDIPANLLELLAL
FT                   FDKLHAKYSQTIVWPIHPRTQSKLKEFSIELPSYLKLIPPIGYLDFIQLQKHAQLILTD
FT                   SGGIQEEACLLGVPCITLRENTERPESIEVGANVLVGRDAVKALAAADKWLASDAASFS
FT                   WSNPFGDGHVAETILDIITNSVPNTLEEEIIAKNETLSVIGMGYMGLPIASLLAEAGYK
FT                   VTGVDLNSDKVSVINEAQCPFDEAGLPELITKVVSQGFLTASTEIPSSETYLVAVPTPH
FT                   KNNSCDRSYVFSAVDAIAKVAKNGQTVIVESTISPQTSVAVAQRFADAGLTIDVVHCPE
FT                   RAIPGQTLHELVHNDRIIGATSIEAQQKVKTIYQSFVKGEVFLTDLTTAECIKLVENTS
FT                   RDVGIAFANELSQICEELEVDVYEVIRLANRHPRVNVLTPGPGVGGHCIPIDPWFLVEN
FT                   TKAGEFVRLAREINDKRPSIVAEQALALLGDTKDNLAGKKVGILGVAYKANVDDCRESP
FT                   ADAILDHFKKAGVDVNYHDPFVPNWHCEKQETITEIDNWADVLILVTDHECYSNLKVSS
FT                   LLLNARA"
FT   gene            316424..319168
FT                   /locus_tag="CPS_0309"
FT   CDS_pept        316424..319168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0309"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719; match to protein
FT                   family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26126"
FT                   /db_xref="GOA:Q48A38"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014266"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A38"
FT                   /protein_id="AAZ26126.1"
FT                   /translation="MKFVKASLYLSIALAISACGEQVSVESHLENAKSYLNENKVNESI
FT                   IELKNAIRADTKNAEARFLLGQIYLSLGDGLAAVKELERAQSLKYPDNKVLPLLARAYI
FT                   LTDSDSDVIALSTAAKGLAAEERSQYLAYQTLAALRSEQPDLAKQSVELAQSIAQQSLY
FT                   SMLASAYLQLSENKYDEVKTLISRILTIEAKQVDALMLQGQVAMVTEEYQLAVDSFKQY
FT                   MELQPRFSMVELLLANALLKAGHDEEAEQHADAILAKVNNQPFANYIKAMVRFQAKDFD
FT                   KASEHAEAALSADFNQFNLKLVAGASAFYLKNWQQSYHHLSAIVKYLPNDHQARRMLAV
FT                   TQLELGLIDEISATIGDFDGNDEVNSQFLSSLSYKLLELGATTEAKKLLAQNGQNSSKN
FT                   AAHNARQGILKLMMNDPSGIENLQDAVKLNPELIEAELAIAFSALQRGDIAKANAIAEK
FT                   WQKQYPDKASSFNLLASIAIKEGKYDKAEQALKKSLSLEQDNFFALTEQLRIARKQENI
FT                   PLSKQRADYLITIAPTNNKVLRQYFGVYRNEMALAKLTAAYELDKTDINKAILLSEAMV
FT                   SLGQLKQAESILVSIADTAKLPKRYWQLLLLTYKKQKNFEKIRPTLEKWLKENPYHIEA
FT                   VVLLTDFYASQRNYERALTVIKRGLDNHKDNLVLQLVQMQLLLNNKQISPAKSLYKIIE
FT                   NKNINDALKQGLLGRIYLLEEDYVQALPKLTVFYQTYPSSQNAIYLAGAHLGNKDNAKA
FT                   VKVLEHYLTIDANNNRIETMLAGIYLENDSDKAIAVYDDVVKKQPKNVVAHNNLAWLYL
FT                   EQDNISKALEHAEKALELAPQIANIVDTYAKVLLGSGDKRAALQYASKASEIAKGKDVD
FT                   IQLNYVEALIANNRINEAKDLLAKVATATDEQKNKKSKLLAQL"
FT   gene            319256..321934
FT                   /locus_tag="CPS_0310"
FT   CDS_pept        319256..321934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0310"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25078"
FT                   /db_xref="GOA:Q48A37"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014266"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A37"
FT                   /protein_id="AAZ25078.1"
FT                   /translation="MKKYIKPSAILLTLILSACSETKTVQQLISSGNSFVQVRDFSSAV
FT                   IEFKNAVRLEPKNANARFELGNAYLEQGNFVNAEKEFSRAVELGLDFSNIAALMARVNT
FT                   HLDKADEVYQLVERSDELTDDDYVEVLTYAGITALKQNRISQGQDYLTQAIVINPDAAY
FT                   SRIAQAYVHYADREFSQGIVVISNLLNEKTDATEAMLIQGHLYYAQQEFEHASGAFALY
FT                   LNYHPQDHKIRFFEVNSLIKAEKFEQANVITNTLLKAFKDSSLALQFKAQLEYQKKNYS
FT                   AARDYAEEALQHGQDFLGAKIIAGVSSYFLGDVEQAYTKLNGIVERVPNNLLVKKILAV
FT                   TKFELGYYADAAENFSSLEGLTSADLQLLKSSSASLMGIGYVDNALSLINKAEEFSPDN
FT                   AQVAAQKGLMLLSQNDISGINSMKRAVELDPSLTYVQVALAIGYLNIGEENKAQKIADL
FT                   YKDKIDEADVGHVLEGFIYLNNKQSANAQVSFEKALSLNPKNIASLYNLGLLHKRAAEN
FT                   SKAIIYFDRLIALSPEHKGALKSLVSIAVNKEYLEEVLTILVRNHQTDNLYSIIALAQV
FT                   LRIDQQVAKAVTTLGGIDKSVKLTSNYFMLLGDSYLELEKYLKANAIFEQGLALEPKDY
FT                   LLNIRYISTLEWLGDYTAALDQTRRLHKYYPNNINITTSLIYLEVRNKNYQEAKYLLEA
FT                   IKGQKSNHHQLDAIAGEIYSYEKDYPQAIEHFSVVYEKEPTELNLLNLARTLGFDKQNK
FT                   QAERLLELYLDKNPNNSKIRFLLAELYNPQDRKKRVVQYQVLSTQIPNNAIVFNNLAWN
FT                   QFKLKQTAEALINIEKAYQLQPDSLAIQESYGVILIANNKLSQGINILESAILSGSTDA
FT                   AAKEYLIKAKTLLNNQGKSSG"
FT   gene            complement(322096..322209)
FT                   /locus_tag="CPS_0311"
FT   CDS_pept        complement(322096..322209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28778"
FT                   /db_xref="GOA:Q48A36"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A36"
FT                   /protein_id="AAZ28778.1"
FT                   /translation="MISDAEAEILDNTNAPAVNILENLFIIYCVLYLMCFY"
FT   gene            322364..322906
FT                   /locus_tag="CPS_0312"
FT   CDS_pept        322364..322906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0312"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28182"
FT                   /db_xref="GOA:Q48A35"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A35"
FT                   /protein_id="AAZ28182.1"
FT                   /translation="MLQGVGEITRFNGKTDFVCTTCELTVTFGGMLFDNDLTDGSVYDL
FT                   AASASTGFLNIYFDNTANFDLGGFASQVDSDAAADGSLFLSLGFDTLQQGPGYTAQVGH
FT                   LDSFWSVSGGAAAEYFDTDSQLFGSDLGFAATVDFQNNLYGIGGGVASGNSIPEPTSLA
FT                   IFGLGLLGLAGAAHRKA"
FT   gene            complement(323161..323463)
FT                   /locus_tag="CPS_0313"
FT   CDS_pept        complement(323161..323463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0313"
FT                   /product="cytochrome c552"
FT                   /note="identified by similarity to SP:P82903; match to
FT                   protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27345"
FT                   /db_xref="GOA:Q48A34"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="PDB:4O1W"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A34"
FT                   /protein_id="AAZ27345.1"
FT                   /translation="MNKLMFAVATATVMMASPVFAGDAAAGKAKSVMCAACHGAAGVSA
FT                   VPTYPNLAGQKEAYLTKQLNDFKSGKRNDPTMKGMVMALSPADMENLAAYYANMK"
FT   gene            323660..323977
FT                   /locus_tag="CPS_0314"
FT   CDS_pept        323660..323977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0314"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26800"
FT                   /db_xref="GOA:Q48A33"
FT                   /db_xref="InterPro:IPR022080"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A33"
FT                   /protein_id="AAZ26800.1"
FT                   /translation="MIMNSVTIPQSLESLTYQVDYLNVTFKNDWCQENIATLIDLLFLP
FT                   IMPVTMQEKIIGADRENIRFRWDNNNFVLNFDYYSQSCWIEGQDSPSTEQLATLHLAMT
FT                   K"
FT   gene            323977..324456
FT                   /locus_tag="CPS_0315"
FT   CDS_pept        323977..324456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SM00856; match
FT                   to protein family HMM PF04463"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25088"
FT                   /db_xref="GOA:Q48A32"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A32"
FT                   /protein_id="AAZ25088.1"
FT                   /translation="MKISEQPINKILISSCFLGERVRYNGVVKPLVNKLLQQWQKQGRL
FT                   ISICPEVISGLPVPRPPAEIDPNTKQVITIESIDVTEQFDKGAKIALHLCQQHNIQLAL
FT                   LKESSPSCGSNTIYDGTFSQKKIIGEGVTTKLLRVHGIKVFSEASIEELAAQIDK"
FT   gene            324602..327508
FT                   /locus_tag="CPS_0316"
FT   CDS_pept        324602..327508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24081"
FT                   /db_xref="GOA:Q48A31"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A31"
FT                   /protein_id="AAZ24081.1"
FT                   /translation="MNTNEATTNVNNLQSTQTYKAGSKVKHFHQFFTAYLIVIFLVIVV
FT                   GLSTIVFFLAQEYKHSQTSITEQLFSLQTQYLQQTYLINADKLIDSILKNIDSNDLIPL
FT                   QQALSLQSKKLSLLKSEYKNSYQQWFSSNNHAMDLLTRIESSHTNNELVKSKSLIQLDT
FT                   LLDAINIQLNKQQTNSKQAVLLSKVESQLTNVVAKLKRLDLNTTFRKFEQLSKQMDEMF
FT                   ITDYAKQLANQQYESQGMADIVRDFIRFEDLILKDDLLAKWQDNLHLIEKYQQQLLVQQ
FT                   EQLKNIIDKLLGSQQGGAVLAISDYAGINKEAVLFNLLPKWVVTAFTVVLISLAGLLLL
FT                   IRRKIKVASQFSVNCITRIIENETSSLTVEGKGSLSKLPNHALYSAETEQLIKKIQQIN
FT                   SYNHNEEEYLALTDKNQMLEERIIKFDSSEKSTSELLVEQQRCKDLHLAAIKQLVLLGV
FT                   SSIATKIGASNKDDAGEADNHLNNAHYQGLDLVRQLRQASYYRYLQSSDALLTLSDVNL
FT                   VALIQAIVLNSRNELILCNNKISVNIDEKILPKVNLDVALFSEMFSVFIMLLFSQQKNS
FT                   QLSLNLQLVDKNNGQQKICFTGQIQDEGDIVCLPQALQAFSDDSTEQSELGDYFFTLLK
FT                   NQHGYDVSAKLTEKAYNFSFTLPIAVADNQQGSHYPVLSLPDHLADIEKDVVKLAAKYF
FT                   VRPIEVLLAVTAPEKYQRLQQLLQGMGLQITFVSCELMLQQHWQSGRFAVLITEIECQP
FT                   FTRFTIDEGEEHSAIVAITRGVFSLENRVDIKAQSENYPLWVLGELSAESSVSELVTAM
FT                   TPWIKEQCCGSYTPEEQVTQVTSSSNNIGAIAEDELALTFLNQADSFNFERYLKHQGSA
FT                   ELAIFMLEEYTTENIVLVEELSQAFTVNDVEKVDAIIKALLVNGRILAADHLLQLCQHW
FT                   QTLLTTQGVDNNEKVQITLLSKTKQAVDEISQHAVTIA"
FT   gene            327558..327770
FT                   /locus_tag="CPS_0317"
FT   CDS_pept        327558..327770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0317"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO2792; match to
FT                   protein family HMM PF06945"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25846"
FT                   /db_xref="GOA:Q48A30"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A30"
FT                   /protein_id="AAZ25846.1"
FT                   /translation="MSNHNSNNQIKLTDSPCVRNCCLDSDDMCLGCFRYIDEITSWRSY
FT                   SDEEKQKITTLCQQRQEDEQSKLNS"
FT   gene            328008..328379
FT                   /locus_tag="CPS_0318"
FT   CDS_pept        328008..328379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0318"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25449"
FT                   /db_xref="GOA:Q48A29"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A29"
FT                   /protein_id="AAZ25449.1"
FT                   /translation="MKVTTSVASLEKNQYFVVFLLTCLILVGRLIVDYFSFKSRELLNL
FT                   ADDDFVNARDDQKFAQNTDIANVMATLTKTQQQLADSKAREKKVSAEKNEAIKKLLSLQ
FT                   HELDEAKADIDILNKITIN"
FT   gene            complement(328401..329597)
FT                   /locus_tag="CPS_0319"
FT   CDS_pept        complement(328401..329597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0319"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28489"
FT                   /db_xref="GOA:Q48A28"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A28"
FT                   /protein_id="AAZ28489.1"
FT                   /translation="MSPINYQELAEKIKCWSKELGFSDLGISNIDLSAHESMLERWLAN
FT                   GYHGNMDYMARHGLMRARPAELVPGTIRVISVRLDYLPHNAKFASILKDKNKAYISRYA
FT                   LGRDYHKLMRKRLQQLGKKIVEHCSDFNCRPFVDSAPVMERPLAEKAGLGWAGKHTLLI
FT                   NKEAGSWFFLGELFVDIPLPISRNEYSESAIKAIETQTKTNDCGTCVACIKICPTKAIV
FT                   EPYTVDARRCISYFTIESPDAIPIELRPLMGNRIYGCDDCQLICPWNKYAKLSLADDFQ
FT                   ARNNLDDISLLELFAWSEEYFLNTLQGSPIRRIGFQSWLRNIAVALGNAPYSDVIVTAL
FT                   TEKRPDASDLVVEHINWALVQQSDKKMLSEKVAAEQAKNHRLTLRLIRSVEKGLPRDA"
FT   gene            329926..331500
FT                   /locus_tag="CPS_0320"
FT   CDS_pept        329926..331500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0320"
FT                   /product="YjeF family protein"
FT                   /note="identified by similarity to GP:28809528; match to
FT                   protein family HMM PF01256; match to protein family HMM
FT                   PF03853; match to protein family HMM TIGR00196; match to
FT                   protein family HMM TIGR00197"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27877"
FT                   /db_xref="GOA:Q48A27"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A27"
FT                   /protein_id="AAZ27877.1"
FT                   /translation="MKLSLSLSQKPPVTSVYTANQVLKNEANVARSQGIAMYELMHSAG
FT                   AAVFTQLSLSWPNAKHLLILCGKGNNGGDGFVVAKLAHQAKIKVSVLLTCDVSQLKGDA
FT                   LSAYQAMIFAGVSLIVEDRVNKHAESLAIINDFSGEVIVDALFGIGFTGQLTPRLQEFV
FT                   TSINHQKAKVISIDVPSGLCATTGEVQGESIEGQAIIADITLTFIVYKQGLLTGQAANF
FT                   VGELFLAPLAMNNAFTKQVQTNNHYAQYKLPLNQPKRLPSSHKGDSGLLLTIGGSDTMP
FT                   GAIRLASESALRCGAGLVAVSCHKNNQMFIMNGRPELMLAPETSALLEASTQLYKAKAY
FT                   LVGPGLGQSDQAKQLFELISKTSQTQNKTTVIDADALILLSETKQQCNHWVLTPHPKEA
FT                   AALLQCDVASIEADRFSAVRAIAKQYGGICLLKGAGTLISDGERVVINNSGNSGMASGG
FT                   MGDVLSGIISALVMQSDNNFYSTCLAAYIHGAAADIIANKNGQRGLLASDLFIPLQQLL
FT                   NGKVPNH"
FT   gene            331539..332027
FT                   /locus_tag="CPS_0321"
FT   CDS_pept        331539..332027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0321"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25424"
FT                   /db_xref="GOA:Q48A26"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A26"
FT                   /protein_id="AAZ25424.1"
FT                   /translation="MKQLEYFLADEAATIAIGSGLAEVLKNATVQQALVVYLNGDLGAG
FT                   KTTLTRGFVRGMGHTGNVKSPTYTLVEPYELGEWRVFHFDLYRLADAEELEYMGIRDYF
FT                   NNDCCCFIEWPEKGTGLLAKADLIINIAYQDEQRVIKLQAETVHGEQVITALAEIIKL"
FT   gene            332045..333376
FT                   /gene="amiB"
FT                   /locus_tag="CPS_0322"
FT   CDS_pept        332045..333376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="CPS_0322"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by similarity to SP:P26365; match to
FT                   protein family HMM PF01476; match to protein family HMM
FT                   PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25558"
FT                   /db_xref="GOA:Q48A25"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A25"
FT                   /protein_id="AAZ25558.1"
FT                   /translation="MYRRILLSIARLRALSFLCVAVLSLLSVNTYAANSIDGIRVWPAP
FT                   ENTRIVFDVKKKPDYKFFTLSKPNRLVIDFTNTKNTVALKNLAVNDPRVKLFRSSVNKG
FT                   KTRLVLELTKSYQLTVFPLAPAGQYGHRLVIDLYDKNRSKKNVSKPKKSVGDIIIGIDA
FT                   GHGGEDPGSIGGKGTYEKRVTLAIAKKLQKVINKEKGMKAVMIRSGDYYVNLNRRTSLA
FT                   RDKHVDFLVSIHADAFHTPGPSGASVWVVTKSRAESELSRWLVNREKKSELLGGGGGVI
FT                   KNTSDSHLALALADMSKEHSLGVSFGVANNVIKELKKITKMHKSTPQNGNFAVLKSSDI
FT                   PSILVETGFISNHKEEKNLTWSKHQQRLANAIHGGIKKHFLAHPLTGSYFASVGYKKHK
FT                   VRSGESLSVLAKRYNISMSKLKSINKLKTNSLRIGQTLKIPRTG"
FT   gene            333383..335341
FT                   /gene="mutL"
FT                   /locus_tag="CPS_0323"
FT   CDS_pept        333383..335341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="CPS_0323"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="identified by similarity to SP:P23367; match to
FT                   protein family HMM PF01119; match to protein family HMM
FT                   PF02518; match to protein family HMM TIGR00585"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26944"
FT                   /db_xref="GOA:Q48A24"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A24"
FT                   /protein_id="AAZ26944.1"
FT                   /translation="MTIAILPARLANQIAAGEVVERPASVIKELIENSLDAGATSIHID
FT                   VDKGGIKKIKITDNGHGIVKEELTLALSRHATSKIKSLNDLEAIGSLGFRGEALASISS
FT                   VARLTLTSKPQSQATAWQAVAEGRDMSVNIKPAAHPDGTSIEVLDLFFNTPARRKFLRT
FT                   EKTEFNHIDEVVRRIALAHFEVSFSLTHNGNTVRQYRMASTHAQCIKRVAMVCGPKFIE
FT                   HAVEVDCPHDNMTLSGWLAKPSFSRSQNDLCYSYVNGRMMRDKLINHAIRQAYADLLPP
FT                   DTYPAFVLFLQLDHREVDVNVHPSKHEVRFHQSRYVHDFIYSVCHKALTSALAGEELFT
FT                   TADSDLALVPEQSYSSLGANDRQGSHSSNTPTLNYPSADYIRPLQHVNDASNSQSTSSY
FT                   SGYGQQHKTNAISKIAASNYQALMTPDKGSSAQVQNTSGSDQASAQKHETTTLQNSTDQ
FT                   SAFLSVHQPGYALYKTENGVRVLSLFKLAKSTYGKLVEQSWQNKTEQSDCPVECLVSQP
FT                   LLLPVILSLSEQQLSFVLAEQEILSNAGIVFIQQHKNKIQIRQFPALLREQDVSNALII
FT                   IIEELIEKRSFTEGEALCETNLHQSIGLAMVLAEYDETQADILLRLTKKLFHEQLSQQL
FT                   LLNSIPLDLTSHIKTLF"
FT   gene            335368..336318
FT                   /gene="miaA"
FT                   /locus_tag="CPS_0324"
FT   CDS_pept        335368..336318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="CPS_0324"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by similarity to SP:P16384; match to
FT                   protein family HMM PF01715; match to protein family HMM
FT                   TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28844"
FT                   /db_xref="GOA:Q48A23"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A23"
FT                   /protein_id="AAZ28844.1"
FT                   /translation="MSVQSITESNQPPVICLMGPTASGKTALAMALKDALPCDIVSVDS
FT                   ALIYRDMDIGTAKPTKSELVQYPHRLIDLRDASESYSAADFCRDALVEIAEIRSNGRIP
FT                   LLVGGTMMYFKSLIEGISPLPTANPEIRQAIEAEALSKGWQAMHDQLAEIDPVSAERIH
FT                   PNDPQRITRALEVYRLTSNTLTQLTQIKGAKLAGDVLQLAITPRERSTLHERIALRYQQ
FT                   MIDLGFEQEVIKLKSRDDLHQDLPSIRCVGYRQMWQHLEGEFDHDEMIFRGVCATRQLA
FT                   KRQLTWLRNWPDLHWLTTDDKTNLAQVLSLLEAKH"
FT   gene            336486..336737
FT                   /gene="hfq"
FT                   /locus_tag="CPS_0325"
FT   CDS_pept        336486..336737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="CPS_0325"
FT                   /product="host factor-I protein"
FT                   /note="identified by similarity to SP:P25521; match to
FT                   protein family HMM PF01423; match to protein family HMM
FT                   TIGR02383"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27874"
FT                   /db_xref="GOA:Q48A22"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A22"
FT                   /protein_id="AAZ27874.1"
FT                   /translation="MAKGQSLQDPFLNALRRDRIPVAIYLVNGIKLQGQVESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRAVNTAPVPGPDDQSSDA"
FT   gene            336790..338076
FT                   /gene="hflX"
FT                   /locus_tag="CPS_0326"
FT   CDS_pept        336790..338076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="CPS_0326"
FT                   /product="GTP-binding protein HflX"
FT                   /note="identified by similarity to SP:P25519"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24566"
FT                   /db_xref="GOA:Q48A21"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A21"
FT                   /protein_id="AAZ24566.1"
FT                   /translation="MFERYQAGEQAVLVHLDFPDESSREDLSEFKMLVSSAGVQALTVV
FT                   TGKRNTPHPRFFVGSGKAEEIRDAVHLVGANVVLFNHSLTPSQEKNIEALCECRVVDRT
FT                   TLILDIFAQRARTHEGKLQVELAQLRHMSSRLIRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRERMVNIRKRLGKVEVQRQQGRRARTRAELPTLSLVGYTNAGKSTLFNTLTQSDV
FT                   YAADQLFATLDPTLRKIDLFGVGRVILADTVGFIRHLPHDLVAAFKATLTETREAELLL
FT                   HVVDISDDRRSENIEQVEYVLKEIEANDVPQLIICNKIDNLDDIEPRIDRDDQGMPIRV
FT                   WLSAQANIGTELLFTALAERLDIQVVNHQLSIPPSAGKLRGELYKLNCVTSETYDEQGH
FT                   CHLEVNMPSREWERLISTKYSELVDYIEH"
FT   gene            338140..339288
FT                   /gene="hflK"
FT                   /locus_tag="CPS_0327"
FT   CDS_pept        338140..339288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="CPS_0327"
FT                   /product="HflK protein"
FT                   /note="identified by similarity to SP:P25662; match to
FT                   protein family HMM PF01145; match to protein family HMM
FT                   TIGR01933"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24340"
FT                   /db_xref="GOA:Q48A20"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A20"
FT                   /protein_id="AAZ24340.1"
FT                   /translation="MAWNEPGNNDKDPWKNKGGKNQGPPDLDELLNDLGKKVTGIFGGK
FT                   TTKGGSGSGKSFSSIGISILLIVASVVYAFSGFYTIKEAEQGIVLRFGEYSGTVEPGIN
FT                   WKWTFVDRIIPVDMQSTRDMPSSGFMLTKDENVVRVEMQIQYRVVDARKYIFSVTNADD
FT                   SLNQSLDSALRYVVGHAKMDDILTSGRESIRQSVWEELDKIIEPYNLGLIIVDVNFKDA
FT                   RPPNEVKDAFDDAISAQEDEVRFLREAEAYARGIEPRARGRVKRMEQEAIAYKSRIVLD
FT                   AQGEVARFEKILPEYQAAPKVTRERLYIATMEKVYGNVSKVMVDVEGGNNMMYLPLDKI
FT                   IQQQNTSNSSGKTTYAPVNDTNVNTSPTSSSGRSDRFNNGGN"
FT   gene            339292..340179
FT                   /gene="hflC"
FT                   /locus_tag="CPS_0328"
FT   CDS_pept        339292..340179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="CPS_0328"
FT                   /product="HflC protein"
FT                   /note="identified by similarity to SP:P25661; match to
FT                   protein family HMM PF01145; match to protein family HMM
FT                   TIGR01932"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26414"
FT                   /db_xref="GOA:Q48A19"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A19"
FT                   /protein_id="AAZ26414.1"
FT                   /translation="MKNFFIAIISLLLILAVSSVFVIYEGQRGIVFQFSKIKRDSATDE
FT                   MMVYEPGLHFKIPFIETVRKLDARIQTLDEPADRFVTSEKKDLMVDSFVKWRIVDFSTY
FT                   YLRTSGSVDNARALLKQKVNNGLRTEFGNRTIKEIVSGDRDAIMSKALESAASSREDLG
FT                   IEVVDVRIKAINLPTEISQSIYERMRAERTAVAKEHRSQGQEQAEIIRATIDAKVTVML
FT                   AEAQKNSFTVRGEGDALAAKVYADAYSKDADFYSFYRSLEAYEKSFNSKNDIMVVKPDS
FT                   EFFRFLKDGSDVKK"
FT   gene            340401..341000
FT                   /locus_tag="CPS_0329"
FT   CDS_pept        340401..341000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO0321"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26155"
FT                   /db_xref="GOA:Q48A18"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A18"
FT                   /protein_id="AAZ26155.1"
FT                   /translation="MTIIKYVIAVIVSLPMAASLLATEAPLVSIQTQDDFFNSIRKHCG
FT                   KSYEGKVTVDNAAGGSFANKKLIMHVRKCTDNQLQVPFHVGDDASRTWIITKTGSGLSL
FT                   KHDHRQKDGSNDKSTMYGGHTNDAGWAEMQSFPADQYSKELFVDQGIPQSIGNTWQMYI
FT                   YPEKFTYRLIRQGREFRVDFDVTKPISTPVTPWGYD"
FT   gene            341139..342434
FT                   /gene="purA"
FT                   /locus_tag="CPS_0330"
FT   CDS_pept        341139..342434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="CPS_0330"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by similarity to SP:P12283; match to
FT                   protein family HMM PF00709; match to protein family HMM
FT                   TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25616"
FT                   /db_xref="GOA:Q48A17"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A17"
FT                   /protein_id="AAZ25616.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTDKAKYVVRYQGGHNAGHTLV
FT                   IDGEKTVLHLIPSGVLRDNVKCLIGNGVVLCPKALMTEITMLEAKGVPVRERLLISDAC
FT                   PLILPYHNALDVAREVARGNKAIGTTGRGIGPAYEDKVARRGLRVGDLFCAETFAAKLK
FT                   EIVEYHNFSLVNYYKVEPVNYEEVLADALAVADTIKKMTADISEILDQARIAGESIMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGCGVGPRHLDYILGITKAYTTRVGSGPFPT
FT                   ELDDEVGNHLGTVGHEFGATTGRERRCGWFDAVAMHRAIQVNSVTGFCLTKLDVLDGLE
FT                   TLKICTGYKTEAGDIITVPPTAAEGYDKITPVYEEMPGWTESTVGATSVDVLPENALAY
FT                   IKRIEEITGIPVDIISTGPDRVETIIKVNPFL"
FT   gene            343265..344506
FT                   /locus_tag="CPS_0331"
FT   CDS_pept        343265..344506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0331"
FT                   /product="NADP-dependent malic enzyme, truncated"
FT                   /note="identified by similarity to SP:P76558; match to
FT                   protein family HMM PF00390; match to protein family HMM
FT                   PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27215"
FT                   /protein_id="AAZ27215.1"
FT                   /translation="MTDLRQQALDYHALPTPGKISVSLTTAAETSQDLSLAYSPGVAEP
FT                   CREIANNPDDVYKYTGKGNTVAVITNGTAVLGLGNIGPMASKPVMEGKSLLFKRFANID
FT                   SFDIEVKHKTVEEFVNTVANIADSFGGINLEDIKAPECFAIEKALIERCKIPVFHDDQH
FT                   GTAIVTAAGMMNALDIQGKDIKQANIVCLGAGAAAIACMELLIKCGAQREKIYMLDTKG
FT                   VIHTRRDDLNEYKKLFANNTDKRTLDDVIEGADVFVGVSGPDLLSQKQVKAMADRPIVF
FT                   ACSNPDPEIKPELALAARDDLIMATGRSDYPNQVNNVLCFPFIFRGALDVRARTINDAM
FT                   KIAAVHAIRALAKEPVPAEVLKASCEKDLSFGKDYIIPKPMDPRLCGAVARAVAQAAVD
FT                   SGVAALDMPENYMA"
FT   gene            344637..345041
FT                   /locus_tag="CPS_0332"
FT   CDS_pept        344637..345041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0332"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:SO0720"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26709"
FT                   /db_xref="GOA:Q48A16"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A16"
FT                   /protein_id="AAZ26709.1"
FT                   /translation="MRKTLTPTLLLSIMLTLALTGCSEASNEKIQIQETLRTGESQVAG
FT                   KKEQAWQQVTVNYYDFEGGFYGLTSEAGDKLLPMNLAKQYKLQGTVLKVKGEVIKDMMT
FT                   IQQWGQPFRIIDVELIKLGQSTGKNKGAEY"
FT   gene            complement(345369..345863)
FT                   /locus_tag="CPS_0333"
FT   CDS_pept        complement(345369..345863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:CC0476"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25185"
FT                   /db_xref="GOA:Q48A15"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A15"
FT                   /protein_id="AAZ25185.1"
FT                   /translation="MKKFSLMIAGILLTQPCLASDNFTLYLVRHAEKQADSKNPPLTQC
FT                   GEERAKQLAMLLSTANIKSVYSTNYQRTMSTAAPLSSRQNIAIKNYDPKQLEQFSLHLK
FT                   DHKENALIVGHSNTTPQLTQLLSNQKVDDLTEKEYQMLYQVQFIEGRSQLTLLNQPLSC
FT                   L"
FT   gene            complement(345948..347348)
FT                   /gene="sthA"
FT                   /locus_tag="CPS_0334"
FT   CDS_pept        complement(345948..347348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sthA"
FT                   /locus_tag="CPS_0334"
FT                   /product="soluble pyridine nucleotide transhydrogenase"
FT                   /EC_number="1.6.1.1"
FT                   /note="identified by similarity to SP:P27306; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF02852; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24633"
FT                   /db_xref="GOA:Q48A14"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A14"
FT                   /protein_id="AAZ24633.1"
FT                   /translation="MEKSFDYDVIIIGTGPGGEGAAMNLAKRQKKVAIIERYHQVGGGC
FT                   THWGTIPSKALRQSVSRLIEYNSNPLFNQNEQVKQLTFQDILSHASAVIQKQVSLRSGF
FT                   YNRNRVEHIQGQASFIDAHTISISHPDGSVEKISAKQIMIATGSRPYRPDDIDFDHPRV
FT                   YDSDSILSLKHAPQHVIIYGAGVIGSEYASIFRGLGVKVDLINTRERLLSFLDTEMSDS
FT                   LSYHLWNSGVVIRHGEEIERVESSEDAVIVHLKSGKKMRADCLLFANGRTGNTADLNLA
FT                   AAGLKADGRGQLKVNDCYQTEVDNIFAVGDVIGYPSLASAAFDQGRIAASAMVDSSSKA
FT                   KLIVDIPTGIYTIPEISSVGKTEQELTEAKIPYEVGRAQFKHLARAQISNNLVGSLKIL
FT                   FHRETKEILGIHCFGENAAEIIHIGQAIMQQTNGGNTIEYFVETTFNYPTMAEAFRVAA
FT                   LNGLNRLF"
FT   gene            347503..348135
FT                   /locus_tag="CPS_0335"
FT   CDS_pept        347503..348135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0335"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GP:28807967; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26238"
FT                   /db_xref="GOA:Q48A13"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A13"
FT                   /protein_id="AAZ26238.1"
FT                   /translation="MSGVRAQQKEKTRRQIINAALNQLSAERSFSNLSLREVAKEAGLA
FT                   PTSFYRHFSDMDELGLTLVDEAGLTLRQLMRQARQRIAKGGSVIQISVQTFMELIESNG
FT                   NIFRLLLRERSGTSAAFRAAVIREIRYFTMELCDYLQKANQLEADVAYMQANAAVTIVF
FT                   SAGSDALDIEDKAERDQLAQQTIQQLRFIARGALELSDRRKISRKSR"
FT   gene            complement(348137..349231)
FT                   /gene="trmA"
FT                   /locus_tag="CPS_0336"
FT   CDS_pept        complement(348137..349231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="CPS_0336"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="identified by similarity to SP:P23003; match to
FT                   protein family HMM PF05958; match to protein family HMM
FT                   TIGR02143"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25533"
FT                   /db_xref="GOA:Q48A12"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48A12"
FT                   /protein_id="AAZ25533.1"
FT                   /translation="MFSHIHPDNYDAQLSKKQQDMAKLFSDFNLPAPDLYPSVPLNYRQ
FT                   RAEFRVWHEGDDLYYIMFDSKTKEKFRVDDFPVASELINNAMKALLATIKDQRELRFKL
FT                   FQVDFLSTLSGELLISMLYHKPLEDNWQIEAEKLKAQLSTIAPVDIIGRAKKQKIIVDK
FT                   DYVMESLNVGGKTYVYQQVENSFTQPNAGVNEQMLLWAQQATQNAGGDLIELYCGNGNF
FT                   SIALAENFERVLGTEISKTSVRSAQINISENGIDNIDIVRMSSEEFSQAMNGERKFRRL
FT                   EDFDLTTYNYDTVLVDPPRAGLDRDSVELVRRFNKIIYISCNPETLKDNLALLVETHQI
FT                   DKFALFDQFPYTDHIETGVILTRK"
FT   gene            complement(349402..349536)
FT                   /locus_tag="CPS_0337"
FT   CDS_pept        complement(349402..349536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0337"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25539"
FT                   /db_xref="GOA:Q48A11"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A11"
FT                   /protein_id="AAZ25539.1"
FT                   /translation="MILLHFSTIAQPALFNVIELKLFLLIHIPLALTNKLLEWINLVT"
FT   gene            complement(349644..350126)
FT                   /locus_tag="CPS_0338"
FT   CDS_pept        complement(349644..350126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0338"
FT                   /product="RNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00076"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25528"
FT                   /db_xref="GOA:Q48A10"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A10"
FT                   /protein_id="AAZ25528.1"
FT                   /translation="MKSPTLQTVIIAVAFAIIAYIVTFAVPASSILIASLVFVSAFLAP
FT                   LLTGSPSTNTASSTSSNTIASDEDVRTLYVGNLPYRANETSVRELFSEHGSVHSVRLMK
FT                   DKHTGKRRGFGFVEMASDDLDKAISALNDTEFQQRTLKVREAKERPERTEDNNQDD"
FT   gene            350954..352465
FT                   /gene="rrsD"
FT                   /locus_tag="CPS_0339"
FT   rRNA            350954..352465
FT                   /gene="rrsD"
FT                   /locus_tag="CPS_0339"
FT                   /product="16S ribosomal RNA"
FT   gene            352566..352641
FT                   /locus_tag="CPS_0340"
FT   tRNA            352566..352641
FT                   /locus_tag="CPS_0340"
FT                   /product="tRNA-Ala"
FT   gene            352737..352940
FT                   /locus_tag="CPS_0341"
FT   CDS_pept        352737..352940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28755"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A09"
FT                   /protein_id="AAZ28755.1"
FT                   /translation="MRANLNSLTIWKADINIGIYKVSTVSRCCLHDYKYQAVISFSYRE
FT                   CGNGDSASPQGCIIKFILLARA"
FT   gene            353078..355971
FT                   /gene="rrlD"
FT                   /locus_tag="CPS_0342"
FT   rRNA            353078..355971
FT                   /gene="rrlD"
FT                   /locus_tag="CPS_0342"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(355947..356108)
FT                   /locus_tag="CPS_0343"
FT   CDS_pept        complement(355947..356108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0343"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24586"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A08"
FT                   /protein_id="AAZ24586.1"
FT                   /translation="MSYKYRLVFLVQVTRKYVMFSYLSVYVSLYTNHFSITSQQNYLGV
FT                   VWLSLTGN"
FT   gene            356139..356257
FT                   /gene="rrfD"
FT                   /locus_tag="CPS_0344"
FT   rRNA            356139..356257
FT                   /gene="rrfD"
FT                   /locus_tag="CPS_0344"
FT                   /product="5S ribosomal RNA"
FT   gene            356803..358316
FT                   /gene="rrsE"
FT                   /locus_tag="CPS_0345"
FT   rRNA            356803..358316
FT                   /gene="rrsE"
FT                   /locus_tag="CPS_0345"
FT                   /product="16S ribosomal RNA"
FT   gene            358417..358492
FT                   /locus_tag="CPS_0346"
FT   tRNA            358417..358492
FT                   /locus_tag="CPS_0346"
FT                   /product="tRNA-Ala"
FT   gene            358588..358791
FT                   /locus_tag="CPS_0347"
FT   CDS_pept        358588..358791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0347"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27355"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A09"
FT                   /protein_id="AAZ27355.1"
FT                   /translation="MRANLNSLTIWKADINIGIYKVSTVSRCCLHDYKYQAVISFSYRE
FT                   CGNGDSASPQGCIIKFILLARA"
FT   gene            358929..361822
FT                   /gene="rrlE"
FT                   /locus_tag="CPS_0348"
FT   rRNA            358929..361822
FT                   /gene="rrlE"
FT                   /locus_tag="CPS_0348"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(361798..361959)
FT                   /locus_tag="CPS_0349"
FT   CDS_pept        complement(361798..361959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0349"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28748"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A08"
FT                   /protein_id="AAZ28748.1"
FT                   /translation="MSYKYRLVFLVQVTRKYVMFSYLSVYVSLYTNHFSITSQQNYLGV
FT                   VWLSLTGN"
FT   gene            361990..362108
FT                   /gene="rrfE"
FT                   /locus_tag="CPS_0350"
FT   rRNA            361990..362108
FT                   /gene="rrfE"
FT                   /locus_tag="CPS_0350"
FT                   /product="5S ribosomal RNA"
FT   gene            362434..362535
FT                   /locus_tag="CPS_0351"
FT   CDS_pept        362434..362535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24019"
FT                   /db_xref="GOA:Q48A05"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A05"
FT                   /protein_id="AAZ24019.1"
FT                   /translation="MPKVSLKKPVAYATGFLRSRDQSTYDQYLKVKL"
FT   gene            complement(362868..362960)
FT                   /locus_tag="CPS_0352"
FT   CDS_pept        complement(362868..362960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0352"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24686"
FT                   /db_xref="GOA:Q48A04"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A04"
FT                   /protein_id="AAZ24686.1"
FT                   /translation="MLDLNTLFILTMIPASALFLISMVVGVFES"
FT   gene            complement(363280..364287)
FT                   /locus_tag="CPS_0353"
FT   CDS_pept        complement(363280..364287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0353"
FT                   /product="TIM-barrel protein, yjbN family"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00742"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25282"
FT                   /db_xref="GOA:Q48A03"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A03"
FT                   /protein_id="AAZ25282.1"
FT                   /translation="MTIITDSKPYIARATINHKLSVAPMLDWTDKHSRYFYRLMTQHTV
FT                   LYTEMVTTGAILRGKGDYLSYNDAEHPLVLQLGGSDVKAMTECAKIAEQYGYDEVNINV
FT                   GCPSDRVQNGRFGACLMAEPALVAQCVNQMQSATNIPVTVKSRIGIDDLDSYEFLHTFI
FT                   EEVSKADCRHFIIHARKAWLTGLSPKQNRDVPPLDYDRVYQIKNDFKDLEVSINGGIKT
FT                   FSEANEHLQHIDGVMIGREIYNSPYMLADADNEIYQSDTIKLSRSEVIDLMVPYIDETI
FT                   ANGGRAWHVLRHMLGLCNGLSGARKFRQHLSECAGKDGAGGQVLLDAFNKVTLP"
FT   gene            364395..365462
FT                   /locus_tag="CPS_0354"
FT   CDS_pept        364395..365462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0354"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25855"
FT                   /db_xref="GOA:Q48A02"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A02"
FT                   /protein_id="AAZ25855.1"
FT                   /translation="MASVTIDKRQKANGDFSYRCTVRVKKNGAIIHRESRTFSKKELAN
FT                   TWGRIRKDDIELNSIILQEKKISIAELIDLYINDADLWGNTGRTKRYVIDMLRDSPIAS
FT                   VLANELKTSDLISHCRMRRDAGAGGATVYHDIAYLRSIMKKALPVFDVKANWKIFEDAV
FT                   PVLIDMKLVGKSQKRTRRPTENELERLIEALTERQKQQSSKIPFVDILNFSILTCMRIG
FT                   EVCKIKWEDLNHEHKTVIVRDRKDPRKKEGNHMIVPLLAGSYDIVKKQLETDERIFPYA
FT                   SASVSAGFQRVRNTLGITDLRYHDLRREGASRLFEKGYSIEEVAQVTGHRNLNILWQVY
FT                   TQLFPHKLHDKFAEE"
FT   gene            complement(365551..365718)
FT                   /locus_tag="CPS_0355"
FT   CDS_pept        complement(365551..365718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25879"
FT                   /db_xref="GOA:Q48A01"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A01"
FT                   /protein_id="AAZ25879.1"
FT                   /translation="MTSEEFKRLNFLSEKSINGDPTHSELVELKRLLTMWNISTEYNLL
FT                   LSSYTTNTEN"
FT   gene            complement(366109..366768)
FT                   /locus_tag="CPS_0356"
FT   CDS_pept        complement(366109..366768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26600"
FT                   /db_xref="GOA:Q48A00"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A00"
FT                   /protein_id="AAZ26600.1"
FT                   /translation="MKFKFLKGTFASLALACCSLANAGLIIGADSVTAPNSNGSALAVN
FT                   IINQNGLSQNYTSGVTDFDTFLSTATHNNSCGSNCWANVPNVIFPINLDFSLGGLFELE
FT                   SIGIWNYHGALGLNEFELFAADNSSFLGSTSLGTFNVGMESSSAVASGQSFSFASTNAS
FT                   FIRMKLNSNYGSTGQVAIGEVVFEKASSTDIPEPSTLAIFALGMIGLASRRFKKQS"
FT   gene            complement(366796..366897)
FT                   /locus_tag="CPS_0357"
FT   CDS_pept        complement(366796..366897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0357"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25892"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Z9"
FT                   /protein_id="AAZ25892.1"
FT                   /translation="MEAIITLKLKGILILVCFMPKSMSYYYNRYLPK"
FT   gene            complement(366836..366943)
FT                   /locus_tag="CPS_0358"
FT   CDS_pept        complement(366836..366943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24123"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Z8"
FT                   /protein_id="AAZ24123.1"
FT                   /translation="MLGVSIIYNITLLKKRGSHHYIEIKRYFNIGMFYA"
FT   gene            367515..367649
FT                   /locus_tag="CPS_0359"
FT   CDS_pept        367515..367649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0359"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28338"
FT                   /db_xref="GOA:Q487Y7"
FT                   /db_xref="UniProtKB/TrEMBL:Q487Y7"
FT                   /protein_id="AAZ28338.1"
FT                   /translation="MNDIEAEIANTLKEIEELKEETRAIVAKMKTLNTADEKETNHAN"
FT   gene            367639..367887
FT                   /locus_tag="CPS_0360"
FT   CDS_pept        367639..367887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27692"
FT                   /db_xref="GOA:Q487Y6"
FT                   /db_xref="UniProtKB/TrEMBL:Q487Y6"
FT                   /protein_id="AAZ27692.1"
FT                   /translation="MLIKINESEPEFVAFVESLKQHYSEATAAGATKKAIVNHVSVTKE
FT                   LRKTKKKLEKLEAILEEIKTIKRQQKGLQQALDILTD"
FT   gene            complement(368165..369532)
FT                   /locus_tag="CPS_0361"
FT   CDS_pept        complement(368165..369532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0361"
FT                   /product="zona occludens toxin"
FT                   /note="identified by similarity to SP:P38442; match to
FT                   protein family HMM PF05707"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28631"
FT                   /db_xref="GOA:Q489Z5"
FT                   /db_xref="InterPro:IPR008900"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Z5"
FT                   /protein_id="AAZ28631.1"
FT                   /translation="MATKVFHGPPGSYKSSTAMWFEIVPALRIGRVVVTNLQGIKTLEE
FT                   IQRELKEVFPSTARLLRISIGNDTGMLLMRNFFHWLPIGALIFLDEIQDIYPNDKSFKA
FT                   SDYDYKTEGAFDDLLPQEFSEIYHEEQRKIKSNVNIEDYQDDIGESLFDERNYLRYPRT
FT                   LRECFMRHRHYNWDILLATPDIKEISSFIRSVCEVAYAHSSKDAIPIPYYKRRPRILEH
FT                   LPKTNGISVGKNDIVTFKKVPLDVFKLYKSTATGKSTKSGAGQSPITPSVIVGFAFVVA
FT                   YLVYMVFFFFDDESIEVDEPLANSLPNAISQSPKASAAAVQVANASVRTAQKSDGEINP
FT                   FSFRRASVSTVTAPNNFVALPFGATKMYINAVNTVYFNKHRVTRDYVFTAYINDEVLNV
FT                   GSESLIAMGYKIFFSSDCLVELRSNNHSNYVYCEPTKPSEPFQEARGNSPIQLSLL"
FT   gene            complement(369622..370026)
FT                   /locus_tag="CPS_0362"
FT   CDS_pept        complement(369622..370026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0362"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26864"
FT                   /db_xref="GOA:Q489Z4"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Z4"
FT                   /protein_id="AAZ26864.1"
FT                   /translation="MRLFIFVLLAFFSFDIFAAPQTGVTGFFETATIFFMSIYEFFTVI
FT                   IPTAIGDFFVWLTSYLLYLKFYLMYETLVFAHEVALSFIQMININEVVNTAISNLPPDL
FT                   RQAASDMRFFDALSLLIEALITRLVYQMSF"
FT   gene            complement(370023..371384)
FT                   /locus_tag="CPS_0363"
FT   CDS_pept        complement(370023..371384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27213"
FT                   /db_xref="GOA:Q489Z3"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Z3"
FT                   /protein_id="AAZ27213.1"
FT                   /translation="MFRLLLFILIFIFSFNVSAIVTITNKIGLASAFTFDYCSGDDAQS
FT                   ANCAQIAPSEIAYGDGNTYYKCPLIYSSSTRIKYRLGSQCNDSGNITATLYLSYSVGCQ
FT                   SPIECHELANLDCSSTSRVVTGFVYTSPNVYSYSCEDFKSESDKCNDVVKNQCANNWGV
FT                   KSSNYTDDGQGTTSCTGVCNDGSIPKEEDCSVYPFCDVPEPPSDLDFGSGGTGSSVDPS
FT                   TTTTEDVEHDIDYEADGTTSDTSSNISSLQGDKLINEVVATRNANTKNLASTTETTNQT
FT                   IVEKSDDISTTVSNSANGIIDAVNRIEKAVFDDKGIIGAVNSLGSGIDGLGDKIDGLGD
FT                   ELGGSYQSDFGVASFSAYDTLFINESDLTGLTDGFKASIGVENRLFINEVREKFNFTAG
FT                   NSGGYQANNLDLGKWGSHDISLARFSEYFGGVGNVVYFLAALSALTIVLGGIKS"
FT   gene            complement(371505..371732)
FT                   /locus_tag="CPS_0364"
FT   CDS_pept        complement(371505..371732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25497"
FT                   /db_xref="GOA:Q487Y2"
FT                   /db_xref="UniProtKB/TrEMBL:Q487Y2"
FT                   /protein_id="AAZ25497.1"
FT                   /translation="MNKLVSFLKTKKVKAVAAVSAIAGSSAAVQAADYTAQIGTAVTEG
FT                   SGNVTAVIAGVIGVAILGFGVGKMLGWFGR"
FT   gene            complement(371748..372002)
FT                   /locus_tag="CPS_0365"
FT   CDS_pept        complement(371748..372002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26775"
FT                   /db_xref="GOA:Q487Y1"
FT                   /db_xref="UniProtKB/TrEMBL:Q487Y1"
FT                   /protein_id="AAZ26775.1"
FT                   /translation="MSVCAANDGTGYLKIVAETDCTEFVLVSQSEFVELQSGSLQQMNE
FT                   TLHLLFAFDVEVFAIVELALIMAFLTSHFGGRVARWLGK"
FT   gene            complement(372009..372353)
FT                   /locus_tag="CPS_0366"
FT   CDS_pept        complement(372009..372353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0366"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25489"
FT                   /db_xref="GOA:Q487Y0"
FT                   /db_xref="InterPro:IPR035411"
FT                   /db_xref="UniProtKB/TrEMBL:Q487Y0"
FT                   /protein_id="AAZ25489.1"
FT                   /translation="MSIQTGIFLRGILVGTKLTKNRYIDKGGVAQENSYTEIGIEVSFV
FT                   NGFDQEQKMIRTARISAEKEKDAFFIKTLSESHGALVELPVNVGDYRNVYVDSKAVLLV
FT                   IEPAQQQKAG"
FT   gene            complement(372379..373812)
FT                   /locus_tag="CPS_0367"
FT   CDS_pept        complement(372379..373812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0367"
FT                   /product="putative phage replication initiation factor"
FT                   /note="identified by match to protein family HMM PF02486"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28776"
FT                   /db_xref="GOA:Q487X9"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="UniProtKB/TrEMBL:Q487X9"
FT                   /protein_id="AAZ28776.1"
FT                   /translation="MKTKPTTIPCLVDALSLTWSPKELLNIKQMAKIGACIKSELIVKA
FT                   KDAALNRELAKLENTKNKELLGTNAFNAHEYEAILSRYKESCSTITREYNNRRHKDLPL
FT                   KSLALSDNEVSARYELRDMLKGELEVDTGIKYGDRLNNLLDNIGVDLLDVLCCGEVERF
FT                   VCRLNNVFTQETFIWTVKNNPTGRFNYSYSATLYADGEQAGVICWGGKNLGCYVSFMGT
FT                   GCNALDMKRLYEEIKNIPALKITRIDLAHDDYAGKHSIKRALSKAKKGLFNSGGRPACY
FT                   MYVESGHLTEKMLKENFKDLKEISNESTKSTAKKTFGFIPSKGKTLYIGSRESGKLLRI
FT                   YEKGKQLGDMKSKWVRWEVELHSSQRVIPLDAMVKPSEYLAATYPALNFLSVEQCKIKT
FT                   LVKQATMTIEKIVENQVISTRKAINMMRVICGLSDSEIVEKFVKDIEEPDCRSSMPKRL
FT                   KASVIEEWVLQQQAQTAAA"
FT   gene            complement(373802..374032)
FT                   /locus_tag="CPS_0368"
FT   CDS_pept        complement(373802..374032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0368"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28054"
FT                   /db_xref="GOA:Q489Y8"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Y8"
FT                   /protein_id="AAZ28054.1"
FT                   /translation="MATSTRSLTMNNPNVYFQREDWGDVAIQHNGQVHHFCNLVSLIGF
FT                   LQTVYGHEFNLIEVDENNYHELQRQGAFDEN"
FT   gene            complement(374008..374265)
FT                   /locus_tag="CPS_0369"
FT   CDS_pept        complement(374008..374265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0369"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27698"
FT                   /db_xref="GOA:Q489Y7"
FT                   /db_xref="InterPro:IPR020518"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Y7"
FT                   /protein_id="AAZ27698.1"
FT                   /translation="MNTNFALLARFESPVIELKDVCQEFFGISVKTAKQKIKGQDFPVP
FT                   TFSLSKSERSPVFIKVEDLASYIDKQYEIASKEWQQVHVA"
FT   gene            374380..375012
FT                   /locus_tag="CPS_0370"
FT   CDS_pept        374380..375012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0370"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00717"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27002"
FT                   /db_xref="GOA:Q489Y6"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Y6"
FT                   /protein_id="AAZ27002.1"
FT                   /translation="MFLKENSVDDFDKQLDDLFKTTKTSRISELSEALGVSPTTIRTWR
FT                   GRNKIPASAFRKAELSIQNDSDVKTDTRISLSFYEISASAGGGALVEVEEQANLISFEP
FT                   EWLNKEIGVNANDVFLMLVDGDSMYPTLKNGAMIMVNKHFNGLSDGIYVMRHEQNLLVK
FT                   RLQMLPNGIIKVKSDNNLYEPWEINKENLDGTDIEIIGRVVWSGQRM"
FT   gene            375100..375306
FT                   /locus_tag="CPS_0371"
FT   CDS_pept        375100..375306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0371"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26502"
FT                   /db_xref="GOA:Q489Y5"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Y5"
FT                   /protein_id="AAZ26502.1"
FT                   /translation="MENFATTLELLEEEIGLEDLSQLLADMLLVCSTRIVGDVPNNWTV
FT                   KTEIVNGEVTAITDAALSKVNVL"
FT   gene            complement(375551..376081)
FT                   /locus_tag="CPS_0372"
FT   CDS_pept        complement(375551..376081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0372"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25831"
FT                   /db_xref="GOA:Q489Y4"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Y4"
FT                   /protein_id="AAZ25831.1"
FT                   /translation="MLTSETNYSECSYEELLDVLQHIDQDKYHERYQILLLEIDNRKKG
FT                   IPPKTSFKSKPSTYTVKKNDGVIVKVISELKLNTSRLLKTIFILACISTFLTAILVPQS
FT                   EGYGDLVATVAFIFLCPFLLVYCIHAIRIGEIEIKIITVKRSESPESFWFGILLYSVFS
FT                   ISILSILFWQTYT"
FT   gene            complement(376189..376581)
FT                   /locus_tag="CPS_0373"
FT   CDS_pept        complement(376189..376581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0373"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25430"
FT                   /db_xref="GOA:Q489Y3"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Y3"
FT                   /protein_id="AAZ25430.1"
FT                   /translation="MLGFASLHILANNYQPLKWALYLYRRMESLIMFPKCFNCSNNIPL
FT                   SWFLGAFMWTKHRCVACGELHEFTNSRRLYSGLVGAGVVLIPSLLDGIISSQGVRFLLI
FT                   GLILFLVLSIIPGQHRLIPNKSVDVK"
FT   gene            complement(376614..377030)
FT                   /locus_tag="CPS_0374"
FT   CDS_pept        complement(376614..377030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0374"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24743"
FT                   /db_xref="GOA:Q489Y2"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Y2"
FT                   /protein_id="AAZ24743.1"
FT                   /translation="MEVDYKNYSLDELYDIEENIDREKFPDRYSLVLSHINKKENCPVA
FT                   SSSTMDAKNEVVMEEHQQILKQNNGTWLFIRFSILAVFCSYLMFQEFAFYQLVIIVIAY
FT                   LAFIALVKQVFLQYHLFKTGKIEKQIRKSGIRKK"
FT   gene            377079..377285
FT                   /locus_tag="CPS_0375"
FT   CDS_pept        377079..377285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0375"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25833"
FT                   /db_xref="GOA:Q489Y1"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Y1"
FT                   /protein_id="AAZ25833.1"
FT                   /translation="MLAKISDEGAKANYFLSCFNDLLYAIYPKAPSSLNISKICTVKIL
FT                   SINNIGLPLYFKENTKYKIKTKS"
FT   gene            complement(377583..377960)
FT                   /locus_tag="CPS_0376"
FT   CDS_pept        complement(377583..377960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0376"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28824"
FT                   /db_xref="GOA:Q489Y0"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Y0"
FT                   /protein_id="AAZ28824.1"
FT                   /translation="MFLTFSYITLDALARMEWLGNSPYKVFQRAKLSGIKNKNQCLSHY
FT                   WDSYKECSGKFCDYKSITYVAICLRGSRGDKEAFCKGSGHSYFNQEYLDLNQKVGFCKL
FT                   LGIDDDRCLKMNKPLRSYCED"
FT   gene            378402..379430
FT                   /locus_tag="CPS_0377"
FT   CDS_pept        378402..379430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0377"
FT                   /product="ISCps1, transposase"
FT                   /note="identified by similarity to SP:Q45968; match to
FT                   protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27051"
FT                   /db_xref="GOA:Q489X9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X9"
FT                   /protein_id="AAZ27051.1"
FT                   /translation="MNKVNTIGVDLAKNVIQVSVLSPLNKELTNKELPRTKFAEFLAKQ
FT                   PISLVAFEACSTAHHWARLARSYGHRVKILPAKVVSSFRQGHKTDKNDALAVAEAANRP
FT                   NVKEAPLKELEQQGMQSIQRSRELLVQNKTCLSNHIRGLLMEFGVFIPKGFASLFKNIP
FT                   DILEDGENDIPDMFRATLNLMYQRLLDLRDDVGLLDEQVKQLVKNNEACSNLTKMEGVG
FT                   PISAILLFSTLGTGDAFKNGREFSAYIGLTPKQHSSGGKASLMGISKFVANKRLRSVLI
FT                   QGARSYVHRMKSVTTKKDEWLVKLIERAGYGKAAVALANKNVRTAWALLTQGTEYRKEL
FT                   IA"
FT   gene            379891..379992
FT                   /locus_tag="CPS_0378"
FT   CDS_pept        379891..379992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0378"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25660"
FT                   /db_xref="GOA:Q489X8"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X8"
FT                   /protein_id="AAZ25660.1"
FT                   /translation="MIEYPMVMVYLWSNLIYQSPGTKKHQSLQLMFF"
FT   gene            complement(380012..380629)
FT                   /locus_tag="CPS_0379"
FT   CDS_pept        complement(380012..380629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0379"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25965"
FT                   /db_xref="GOA:Q489X7"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X7"
FT                   /protein_id="AAZ25965.1"
FT                   /translation="MNMKMLKAALAGLVLSVSGFANAGLILEIGDTGDNLNTAQSLTGG
FT                   TTQVSGSISTNNDVDLFSFYWGGGLLDLNVSQDNSALDTQIFLFDSLGFGLFHNDDAPF
FT                   PNSIIQTALAAGEYFVGISSWSNDPLSVGGAIFPSDFSGQLTPTGPGGASSLSTWEYDG
FT                   NSSGAYLLNISSTASQVPEPSTLAIFALGIMGLASRKFKKQS"
FT   gene            complement(381185..381640)
FT                   /locus_tag="CPS_0380"
FT   CDS_pept        complement(381185..381640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0380"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25462"
FT                   /db_xref="GOA:Q489X6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X6"
FT                   /protein_id="AAZ25462.1"
FT                   /translation="MLIIKATKVHIPVIARLFDLYRQFYECKPDIALAEQFISERIEKG
FT                   ESTIFLVEKDGKTLGFVQMYPSFCSVDAVKIYILYDLYVDDSGRSLGVSASLMDKAKSY
FT                   AKAEGASRIDLMTAFSNKAGQHLYEKLGYKKVSEDFHNYSLQVEQGL"
FT   gene            complement(381729..382211)
FT                   /locus_tag="CPS_0381"
FT   CDS_pept        complement(381729..382211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27383"
FT                   /db_xref="GOA:Q489X5"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X5"
FT                   /protein_id="AAZ27383.1"
FT                   /translation="MDEKHELMGRFCGSFPNIKGMHDYLSKEVLNEEVPDEIQGQFNVA
FT                   KNMALYSYFFYALAPEVHLKTYTVIEHALRVKMKPKKTMMLKALINHAVAQRWISDAGF
FT                   RHIDKPNSDNEWCKTMVTVIPSLRNCKAHGSTMLVGDCLHHISSCADFINQLFPRN"
FT   gene            complement(382385..382519)
FT                   /locus_tag="CPS_0382"
FT   CDS_pept        complement(382385..382519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0382"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26858"
FT                   /db_xref="GOA:Q489X4"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X4"
FT                   /protein_id="AAZ26858.1"
FT                   /translation="MGGSSNDDRSDSMNPNNDAYDDSMDNHSNQLNPNNDEYQGDDED"
FT   gene            complement(383078..383695)
FT                   /locus_tag="CPS_0383"
FT   CDS_pept        complement(383078..383695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0383"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24265"
FT                   /db_xref="GOA:Q489X3"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X3"
FT                   /protein_id="AAZ24265.1"
FT                   /translation="MKFKFLNIALACLFLCVTSTSNAGLIFDITEYTDSKMAFSVTGTL
FT                   DQAYNSNRHDSLFYVGTDFSLSQMWNSSNMVFTGNSTVQGNSVTWDRANNGSTTGYALF
FT                   GWANSLNTILAAGTVINFDVTAVGTFNSIDYAPSDFELYIGTNTIRHAHHKIADAVDST
FT                   NKVPEPSTLAIFALGMIGFASRRFKNNLNLFSFVVNYRKHQL"
FT   gene            385149..386105
FT                   /gene="speB"
FT                   /locus_tag="CPS_0384"
FT   CDS_pept        385149..386105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="CPS_0384"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="identified by similarity to SP:P16936; match to
FT                   protein family HMM PF00491; match to protein family HMM
FT                   TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24263"
FT                   /db_xref="GOA:Q489X2"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X2"
FT                   /protein_id="AAZ24263.1"
FT                   /translation="MTDNNFNQPLGGNQMPRFGGPGTMFRLPSSEISNELDIGIVGVPL
FT                   DIGASNRSGTRFGPRSVRNESVLVRPYGMYTKAAPFDSFQIADIGDTPINTFNLADSIR
FT                   IIEAHYDTIMASNIKPVTVGGDHTISLPILRALHKKHGMMALVHVDAHADINDSMFGEK
FT                   ECHGTIFRRAIEEGLVDPKKMIQIGQRATGYSAGDFQWAVDRGVRVVQAEECWLKSLVP
FT                   LMEEVREVIGEDIPTYLTFDIDGIDPAFAPGTGTPEPAGLTSPQALEIIRGMWGTNLIG
FT                   ADLVEVSPPYDTSGNTSLLAANLIFEMLCSFPGCIRR"
FT   gene            complement(386355..386543)
FT                   /locus_tag="CPS_0385"
FT   CDS_pept        complement(386355..386543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0385"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28158"
FT                   /db_xref="GOA:Q489X1"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X1"
FT                   /protein_id="AAZ28158.1"
FT                   /translation="MNNRNEAKTSQELNTASNEESLSQEATFNSDVEFSSNFAVNLLKK
FT                   RLYVEQEANSCYVLGYN"
FT   gene            387059..388432
FT                   /locus_tag="CPS_0386"
FT   CDS_pept        387059..388432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0386"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:27355226"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28395"
FT                   /db_xref="GOA:Q489X0"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:Q489X0"
FT                   /protein_id="AAZ28395.1"
FT                   /translation="MELFTANESPEKLGIGKANILIQPNHKAYGQLNKHAYFSQSYADL
FT                   HARPFPVSNVPLRVSQVCFLHQEGDSQAVELAHLHELCHRYSVNPPLANASCFYQKMGE
FT                   YEIRWERHTEFSSYTFLIHDSGLKPFDCPPVALVPIDWLEGISGELIAAVHIDALSEGS
FT                   VTLERDHLRQYFEGQRLMGSELHNGEAIILSALRLHEDNFNRILLVNTSLNECQSGRVL
FT                   RALLEIEAYRNMTLLAFPLAQQVSIKVSKMESQLAMLLKKQKDIKSSNDEQKQLAELSA
FT                   MAANIAEIIASSRYRFDAGSAYYEMVRSRLAELEEKDINELQTFSAFIDRRLSPAYRTV
FT                   LAAKRRLDDLSSRVDRASDFLRTRIDMAIEAQNQALLTSMDKRAQMQFNLQQTVEGLSV
FT                   IIMTYYVLALCKYLLDASSSLGYTFNREVALTLLMPIVLISVWMFSRRIKNAVQKIAP"
FT   gene            388591..390012
FT                   /locus_tag="CPS_0387"
FT   CDS_pept        388591..390012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0387"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by similarity to GP:16209569; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26694"
FT                   /db_xref="GOA:Q489W9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q489W9"
FT                   /protein_id="AAZ26694.1"
FT                   /translation="MYTYNKLYINGDWQLPNTEDTIDVINPANSELCAKTPSASIADVD
FT                   KAIAAAKYAFAQWSATTPAERSQLITAIADEMQNRIDDFASAISTSMGCPKHLAFDIQV
FT                   QGAIDAFRGYADMTSYVDESSTEHGVMQCHSAVGVCVLINPWNYPLSQLVGKIGPALAT
FT                   GCTIVAKPAEQTPLQDLILAEIFDKVGVLAGVFNVITGYGFKIGEHLCSHPDVDMVSFT
FT                   GSTGAGIKVAQAASTTVKRVCQELGGKSPFIITDDADLAAAVRYGVEDVMINSGQTCCA
FT                   LTRMLVPESLYQQAIVIAKAVAEENVVGDPQDENVTMGPLSSSLQQKRVLDYINIGIKE
FT                   GAELVTGGPEIPARLQQGAYVMPTIFTNVTNDMTIAQEEIFGPVLCMIPYSDEQEAIKI
FT                   ANDTVFGLSSGVFAKDANAALQIARKIRAGQSYIQGTYFNSHAPFGGFKQSGNGREWGV
FT                   EGLREFIEVQSIIIT"
FT   gene            390021..391424
FT                   /locus_tag="CPS_0388"
FT   CDS_pept        390021..391424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0388"
FT                   /product="putative amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27259"
FT                   /db_xref="GOA:Q489W8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q489W8"
FT                   /protein_id="AAZ27259.1"
FT                   /translation="MSELHLHEKTLGKRDIFLFCISAVLLLDTLAAGAVMGPTVIFWWV
FT                   ILTIFFLVPFGAISTELGSAYPEQGGIYAWVKRAYGQKMASRISWYYWSNVAVWVPAIF
FT                   ILFAGVFSQIFMPDMSLTAQIIMGVVLIWVVVFVNIVALNVGKWIPNIGAAIKLIIFAL
FT                   LIIGGILYGMEHGIANEFTLDTMIPSTENGGLSLQYLPAVVYGMLGFELASASSAEMKD
FT                   PRKDLPKAVFSSIAVVVGAYILATTAILIAQPADKVDVVDGLMDTLGQFFGGSPLGDAF
FT                   VVVLGVGALYTFFSNGATWAMGANRAAAEAAIDDELPALFAVESKHGTPVGASILLGIS
FT                   ASILLILYGVMAGNNEDLFWSLFAFSGVIFMLPYVAVCTAFVKIRETHIGINGKIAEDG
FT                   TFRFPGSPKFVKTCAYLCAAILMVTITLFIYVPGEGVAWEVLWGAIGVIIMGEVVTYRG
FT                   MKKMKTATV"
FT   gene            391544..392368
FT                   /locus_tag="CPS_0389"
FT   CDS_pept        391544..392368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0389"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by similarity to OMNI:NTL03PA04807; match
FT                   to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25567"
FT                   /db_xref="GOA:Q489W7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q489W7"
FT                   /protein_id="AAZ25567.1"
FT                   /translation="MKLDKYSLALIELTQHVGTEHFYSKLKDFFKITFDFDELIVLQFH
FT                   KSADTKLHYRYGNDGKKNMLYGEESWRYLTRLYVLDPFYRVFADKGKEGFFSLDEIAPD
FT                   EFSNSYSSYFNFLSLTDEVGYLFPIDKDNCLHLDISRFGNSEKFSSLDKTLFAQLVTPI
FT                   QNLCNSHLAMMGESSETTHSNVENVLLNFGKDILTKKEYQVCQLLLQGHSTKAIGTIMT
FT                   IGYETVKMHKKNIYSKTFLSSQSELLALFIDILQSESLDKDVDHLSIYVDGQ"
FT   gene            392817..394214
FT                   /locus_tag="CPS_0390"
FT   CDS_pept        392817..394214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0390"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02SC5439"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26139"
FT                   /db_xref="GOA:Q489W6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q489W6"
FT                   /protein_id="AAZ26139.1"
FT                   /translation="MQDQAKLALENTKFTPFWLDNPDRPAAEAHLTTAITTDLLIVGSG
FT                   FTGLWTAVQAKEQNPDRAIVVIEANTAAIGASGRPGAILSTSLMHGMENSNRLFKNDME
FT                   ELERLGKENMDQFRDTIEKYNIDCDIEWTGELTVAVGKHGIDDIEGEHELYVKFGHDAH
FT                   LLDKKQIQAEINSPFFEGGLWSKKRSGTIHPAKMAWGLKRVAKDLGVVFYENTPMLTSK
FT                   TRGQQVFINTPEGSITANKVILATNAFTKHKKKISTRVAAIRDRIVMTEPLTEEQLAEL
FT                   GWKNRQGIYDTRTQLNYMRLTKDNRVLFGGRLGYFFDNDTDPEHDKTPEPFIKLVGMLY
FT                   KTLPALKDIKISHAWSGPIALTTRMAVHYQYYHGGKMIYAGGYSGFGVTASRFASRVAL
FT                   AIVDDVDIPERNLEFAKTVPAWIPPEPFRWIGAKITMYALDTCDAKGGWRIPWLTLVDK
FT                   MGFPLKP"
FT   gene            394363..395286
FT                   /gene="ppaC"
FT                   /locus_tag="CPS_0391"
FT   CDS_pept        394363..395286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppaC"
FT                   /locus_tag="CPS_0391"
FT                   /product="inorganic pyrophosphatase, manganese-dependent"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by similarity to SP:P37487; match to
FT                   protein family HMM PF01368; match to protein family HMM
FT                   PF02833"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24328"
FT                   /db_xref="GOA:Q489W5"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q489W5"
FT                   /protein_id="AAZ24328.1"
FT                   /translation="MPNYVVGHKIPDSDSICSAIALSYLKTTLGEETVPARLGELTPET
FT                   LFILDKFGFEQPELKTSYAGEGVYIVDHSDIELAPDDIDQATILGIIDHHKLGDLTTST
FT                   PLEIWVRPVGCTNTIIKMMYDFNNVEIPKNIAGAMLCAILSDTVIFKSPTCTTADIKCV
FT                   EALAEIAGIEDFKELGMDMFRVKSAVEGTPIRDLVKRDFKDFNMNGQKVGIGQLEVIDL
FT                   AVFDDIKDALYADIAELKAEGDRHSVFLLLTDIMKEGSELLIASDSDTLAEQAFGVTPK
FT                   DGKAWLEGVLSRKKQVVPPLQEILLK"
FT   gene            complement(395366..396526)
FT                   /gene="fadA"
FT                   /locus_tag="CPS_0392"
FT   CDS_pept        complement(395366..396526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="CPS_0392"
FT                   /product="fatty oxidation complex, beta subunit"
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by similarity to SP:P21151; match to
FT                   protein family HMM PF00108; match to protein family HMM
FT                   PF02803; match to protein family HMM TIGR01930; match to
FT                   protein family HMM TIGR02445"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25024"
FT                   /db_xref="GOA:Q489W4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489W4"
FT                   /protein_id="AAZ25024.1"
FT                   /translation="MNEVVIVDCIRTPMGRSKAGVFRNVRAEALSAHLMKQILVRNPAL
FT                   NPEDIEDVIWGCVKQTKEQGFNIARNASLLAGLPKSIGGVTVNRLCGSSMEALHQASTS
FT                   IMSGQGDVFLIGGVEHMGHVPMMYDVDFDPALNKNIALASGNMGLTAELLGKQHGITRE
FT                   MQDAFGARSHQKAHEAHLAGRWDNEIVATQGHDATGALTLVEHDEVIRPETTAESLSAL
FT                   RPVFDPVNGTVTAGTSSALSDGASAMLVMSAAKAKELGLTPRVKIRGMAVAGCDPATMG
FT                   FGPVPATKKALKRAGLSIADIELFEFNEAFAAQALSCVRSLKVEDKMDQINLNGGAIAL
FT                   GHPLGCSGSRISGTLINLMEGQDVNIGLATMCIGLGQGIATVFERV"
FT   gene            complement(396542..398710)
FT                   /gene="fadB"
FT                   /locus_tag="CPS_0393"
FT   CDS_pept        complement(396542..398710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="CPS_0393"
FT                   /product="fatty oxidation complex, alpha subunit"
FT                   /note="identified by similarity to SP:P21177; match to
FT                   protein family HMM PF00378; match to protein family HMM
FT                   PF00725; match to protein family HMM PF02737; match to
FT                   protein family HMM TIGR02437"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26244"
FT                   /db_xref="GOA:Q489W3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489W3"
FT                   /protein_id="AAZ26244.1"
FT                   /translation="MIYQGKSLSAQLLEDGIVEFKFDAQGSVNKFDQATFEEYIAVVAA
FT                   INNCSEAKGVIVTSGKSTFIVGADITEFLVSFSQPEDALASWAKKASDVFDSFEDIQLP
FT                   TIAAINGIALGGGCEMTLACDYRVAATTASIGLPEVKLGLMPGFGGTVRLPRLIGFDNA
FT                   ATWMSTGKAFKPAAALAQGAIDAVVEPENLQAAAISMLKLAIDGKLDWRAKRQPKLEAL
FT                   KLSPTELIMSSTTCKGMIAAKAGKHYPAPMVMINTLIASANLDRTGAMAAENTGFAKLA
FT                   KTDAATAQIGLFMADQVIKGKAKKASKLATKAVNKAAVLGAGIMGGGIAYQSAYKGTPI
FT                   IMKDINDQALDLGLTTATGILTKQVERGRMNAKKMAGVLNNITPSLSYDSVKDVDIVVE
FT                   AVVENPKVKGMVLAEVEGVIGEDAILTSNTSTISIDLLAQSVKRPQNFCGMHFFNPVNK
FT                   MPLVEVIRGKDTSDETVAAVVAYAAKMGKSPIVVNDCPGFYVNRVLFPYFAGFSQLVLE
FT                   GADFTAIDKVMEKQFGWPMGPAYLLDVVGVDTADHCTGVMSSGFPTRMKKIDNDPVSTL
FT                   YANERLGQKNGKGFYDHIKDKRGRPMKVPAPVAYELLGQHCADKKDFSSEEIIARMMIP
FT                   MVNEVVRCLEEGVVDTAAEADMGLIYGVGFPPFRGGAIRYLETLGLDNFIAMADKYTDL
FT                   GEIYHVTDGLREMAKSGKSYFTTDVKLA"
FT   gene            complement(399266..401488)
FT                   /locus_tag="CPS_0394"
FT   CDS_pept        complement(399266..401488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0394"
FT                   /product="response regulator/GGDEF/EAL domain protein"
FT                   /note="identified by similarity to OMNI:NTL01BS1343; match
FT                   to protein family HMM PF00072; match to protein family HMM
FT                   PF00563; match to protein family HMM PF00990; match to
FT                   protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24900"
FT                   /db_xref="GOA:Q489W2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR021800"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q489W2"
FT                   /protein_id="AAZ24900.1"
FT                   /translation="MQASENSHDDFLFIDDSDEDEILAFGSNETWQVLIVDDDPEIHSV
FT                   TQLALSDLVVLGRRLEYLHAYSGKDACQLIENNDDIVLVLLDVVMETDDAGLNVVKYIR
FT                   ETLQRKDIRIVLRTGQPGYAPEESVIKEYDINDYKTKTELTRRKLVTTVFAAIRSFQQI
FT                   ATVNENRQGLEKIVSGATELSSQHSLPTFSQSVLSQLRTLISDDISAVFCARGQGIIDN
FT                   IDDLSFYVLAQIGFDDSLLNQKIDTLQDNQANKQVKACFLQQKHQYLDDSLDLYVAKGD
FT                   YRAVIHVRLSSPLTEIQTQLLNVFLTGVAVGYENVHLFQKLTNAAYRDWLTNLPNRLEF
FT                   VRLLDSFAQNDCKNTVAALIDINHFSDINDALGQDIGNKLLSAVGQRIQSIGSDCQLAR
FT                   VGADVFGIIGPADCLTPESLIALFHQPFAAGEQHLPINACFGLCTKEHAQSSGVQVLNQ
FT                   INIALNIAKKNRLEHFAYYHSDIEDQMQWRLNMIRQLRNDFGNNCLELWYQPQLSLTTG
FT                   KVIGAEALLRWRTADGKFVSPAVFIPLAEYSGLIIEIGDWVISQACKQLKVLEENFSDL
FT                   SISVNVSIPQFRQDNFVDNIINTMTQYGIKPNKLELEITENILMDEPQIIIDALTKLKA
FT                   QGISIALDDFGTGFSSLSYLQKLPLNRLKVDRAFVTDINKEGQSVIAETIINLGKKMQL
FT                   KVIAEGIEEIEQQERLIELGCDEVQGFYYAKPMPADEFINFLHQQS"
FT   gene            401927..402934
FT                   /locus_tag="CPS_0395"
FT   CDS_pept        401927..402934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0395"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO3722"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24383"
FT                   /db_xref="GOA:Q489W1"
FT                   /db_xref="InterPro:IPR021254"
FT                   /db_xref="UniProtKB/TrEMBL:Q489W1"
FT                   /protein_id="AAZ24383.1"
FT                   /translation="MNRSEFLKRASSSRTGIGIKWNISAYFKGTKKGGNTVSKDKSDVV
FT                   ILEKNVNKDGDNTAIVKSNKSTQNSTEAGVSQQFLKLAKRFVIDGALLPEEKQMLIEDR
FT                   TVKRARLSQLRKQQNIENIMQKTLGYCASFEIGQRTDHDWFSRYIALSEEVSNPTMQDL
FT                   WAKILAGELTKPGAFSFKALQVFRDMSIYDAKLLAKACSLAIKDPNKKNIRLITGAYQQ
FT                   PGLFNFFSKQRQQYCNLSHYGLNYADLLALSENHLIYLQESESSLLSKDDSLQFTYNGL
FT                   PLKLTAKKSNVCLQFYKFTPLGAELAHLISDKSNDEFFDHLKNMLTHYFAVNSD"
FT   gene            403103..403483
FT                   /locus_tag="CPS_0396"
FT   CDS_pept        403103..403483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0396"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24869"
FT                   /db_xref="GOA:Q489W0"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:Q489W0"
FT                   /protein_id="AAZ24869.1"
FT                   /translation="MLDRIGITATSLCALHCILLPIILPMLPLLGLSFLADHAWEHVFL
FT                   LMTAALGTIALFSGFKRYHRRLYPFYLLYLGVTLYWIKHDFSEALEPFFIIGGASLIIA
FT                   AHFINIKLCNSCKQCDDETCSS"
FT   gene            complement(403563..404963)
FT                   /gene="ntrC"
FT                   /locus_tag="CPS_0397"
FT   CDS_pept        complement(403563..404963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="CPS_0397"
FT                   /product="nitrogen regulation protein NR(I)"
FT                   /note="identified by similarity to SP:P41789; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00158; match to protein family HMM PF02954; match to
FT                   protein family HMM TIGR01199; match to protein family HMM
FT                   TIGR01818"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26341"
FT                   /db_xref="GOA:Q489V9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V9"
FT                   /protein_id="AAZ26341.1"
FT                   /translation="MITEQVWIVDDDSSIRWVLEKAFANANISCAAFESAENLLIALEH
FT                   GQPEIIISDIRMPNIDGMELLKRLNKQHSHIPVIIMTAHSDLDSAVNAYQGGAFEYLPK
FT                   PFDIDEAINLSKRALTHAREQNEKNKNQKDIPLAVGLIGEAPAMQEVFRAIGRLSRSSI
FT                   SVLINGESGTGKELVAQALHSHSPRVNEPFIPLNMAAIPKDLIESELFGHEKGAFTGAN
FT                   AIRQGRFEQAHGGTLFLDEIGDMPLDIQTRLLRVLSDGQVYRVGGHLPVQVDVRIIAAT
FT                   HQHLEERVKKGEFREDLFHRLNVIRIHLPSLRERKEDIPQLSQHFLTQAANELSVEVKT
FT                   LSKKASNFLNNCHWPGNVRQLENICRFLTVMASGQEILIEDLPNELVEKSTSLKNDSNA
FT                   WQDVLSTWMDQELAQGKDAILDYAQIEFEKIMLERALIFTQGHKQDAAKKLGWGRNTLT
FT                   RKLKEFDK"
FT   gene            complement(404960..406075)
FT                   /gene="ntrB"
FT                   /locus_tag="CPS_0398"
FT   CDS_pept        complement(404960..406075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="CPS_0398"
FT                   /product="nitrogen regulation protein NR(II)"
FT                   /note="identified by similarity to SP:P06712; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26559"
FT                   /db_xref="GOA:Q489V8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V8"
FT                   /protein_id="AAZ26559.1"
FT                   /translation="MHSRSYIQDHKLSYQQSLANQLVTAVIILNEKLSIVYVNPAAEAL
FT                   LNKSLYRLFNTESEMIFANTSINRSRLIQLLATGQEFTDCDIVVELNESHRFTAEVTAS
FT                   SVEFERTPHVLLEFKQIDQQKQISLEVFQHQQWLAARDLIKGLAHEIKNPLGGLRGAAQ
FT                   LLSKEVTSEQQEYTSMIIEQADRLTNLVDRLLGPNQLPQMQAQNVHGILEKVCQLVGYS
FT                   NGQKIHLLRDYDPSLPAVECDQEKLQQAVLNIVNNAIQAIDEKHNITLRTRIASNRTIH
FT                   GKRIKLAIEISIIDNGPGIPTKIQDTLFYPMVSGRSNGTGLGLSISQTLINQHQGKLSC
FT                   HSRPGHTEFTILLPLKQQPLNRAPLSQESTL"
FT   gene            complement(406236..406754)
FT                   /locus_tag="CPS_0399"
FT   CDS_pept        complement(406236..406754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0399"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:6174690"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27083"
FT                   /db_xref="GOA:Q489V7"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V7"
FT                   /protein_id="AAZ27083.1"
FT                   /translation="MIKLLLFILLGVTLAAPVHPKTAKIYVWRNEQGVLVFSDSPMPGA
FT                   EEVKTKPGNIIQSSTSLDTEVLDITPQETVEEYEIAISTPKNNATIRDNTGSIYIGGGI
FT                   KPRFKPGLEVQLVLDGKPHQKPQKHSMFSLRDIDRGEHKIKMLLLDEKGKVIASSASVT
FT                   FYMHRASTN"
FT   gene            complement(407001..408407)
FT                   /gene="glnA"
FT                   /locus_tag="CPS_0400"
FT   CDS_pept        complement(407001..408407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="CPS_0400"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by match to protein family HMM PF00120;
FT                   match to protein family HMM PF03951; match to protein
FT                   family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24888"
FT                   /db_xref="GOA:Q489V6"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V6"
FT                   /protein_id="AAZ24888.1"
FT                   /translation="MSQAVFDLIKEHDVKFIDLRFTDSKGKEQHISIPHHQVTEDFFED
FT                   GKMFDGSSIEGWKGIDESDMVMMPDASTAILDPFTDAVTLNIRCDILEPSTMQGYSRDP
FT                   RSVANRAEEYLRSTGIADDVLVGPEPEFFVFDDVRFHTDMSGSFYKIDDKEASWNSGTE
FT                   YEEGNMGHRPGVKGGYFPTAPVDSSQDLRSAMCLVMEDMGLIVEAHHHEVATCGQNEIA
FT                   CRFNTLVKKADEVQIYKYVVHNVAHAYGKTATFMPKPLVGDNGTGMHVHMSLAKDGVNL
FT                   FAGDKYGGLSETALYYIGGIIKHAKALNAFTNPATNSYKRLVPHFEAPVMLAYSARNRS
FT                   ASIRIPLVPSPKAMRIEARFPDPACNPYLAFSALLMAGLDGIKNKTHPGDAMDKDLYDL
FT                   PAEEAASIPQVATSLDDALDNLEADFEFLTAGGVMDKDMIDAYIAIKREESRRVNMTTH
FT                   PLEFELYYSV"
FT   gene            408537..408641
FT                   /locus_tag="CPS_0401"
FT   CDS_pept        408537..408641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0401"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28540"
FT                   /db_xref="GOA:Q489V5"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V5"
FT                   /protein_id="AAZ28540.1"
FT                   /translation="MPRGRSLINKLFYSVHKLCCTLVVLAVRYIGARG"
FT   gene            408828..409946
FT                   /locus_tag="CPS_0402"
FT   CDS_pept        408828..409946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0402"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24275"
FT                   /db_xref="GOA:Q489V4"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V4"
FT                   /protein_id="AAZ24275.1"
FT                   /translation="MNNTIATLITFTFLLSLTLSTVSYAEDDKSKWQKPTPVFKQDFDW
FT                   IKLTSDEWLKGDIVSMYDEKLEFDSDELDMQTIDLEDVSELRSKSWQSIRMFDGTIAEG
FT                   YLVFKDGQLSLVKNGVTTHYEFSNLLSIASSGQNERDLWDGYVNLGINLREGNTVQFDY
FT                   TFSAGIQRRSSSSRFKVDYTSDYSSYEDQDTEVSTVTADSERLTSSYDWFFNPKIYFRA
FT                   ADFEYMADDFLNIDYRVHYGIALGYHIIDTSRTSWDINLGPSYQKTKFIDVGADDSDSE
FT                   NSLGVTLGTDFTFEVTGDIDYDASYSVQVIDEKSGGNIHHFQTGLEIDLANDFDLELTF
FT                   YADRTENPKEDSAGNTPDKNDYRLVVSFGYDF"
FT   gene            410004..411134
FT                   /locus_tag="CPS_0403"
FT   CDS_pept        410004..411134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0403"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26403"
FT                   /db_xref="GOA:Q489V3"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V3"
FT                   /protein_id="AAZ26403.1"
FT                   /translation="MYICNENNHGNFVNKYLLITLALLSFISHGAEKSQHTEVWSPSTP
FT                   VFSQQFDWLKLRSGEWLKGDIISMYDDELEFESDEFDTITFDWEKVTELRSRFNQQIRF
FT                   ANGEVKQGFLIVKDNHLVVISGGSEQHYPLSELLSITSSSDDRKELWDGKVSLGIDVNS
FT                   GNVNQLDYIVRANIQRRTPFTRFKVDFTYNYSKSTADENETVITDTSRLTSNLDWFYSR
FT                   KVFFRVFDYEHFTDLQQNIKSRDTLGLSLGYHIFQNKRLQWDVTLGPSYQQTVYHNTAD
FT                   ESDQKSGVVALGTLFDYSISSRLDYLFDYQLQFVEEKSGKRNSHLKTGFEFELQNDFEL
FT                   DVMLYLDRVANPVAPMGATPPKSNDYRLVLSLGYDF"
FT   gene            complement(411163..412284)
FT                   /locus_tag="CPS_0404"
FT   CDS_pept        complement(411163..412284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0404"
FT                   /product="oxidoreductase, NAD/FAD/2Fe-2S iron-sulfur
FT                   cluster binding protein"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25473"
FT                   /db_xref="GOA:Q489V2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V2"
FT                   /protein_id="AAZ25473.1"
FT                   /translation="MTLSSNTVTKQRFTLVCQKIQIETRDVKTFIFSMPKQQIGFNYHA
FT                   GQYLNFTVNMAGTMQTCCYSLSSSPTTSDYVSITIKRIPQGKVSNYFHDHFKVGQSIDV
FT                   QGVAGHFYLTDPMPKNVLLISAGSGITPMLSMLRFMVATQCKNQVIFVHSAKQKMDLIA
FT                   QAEISNLAKQHGNCQIIYTLTQGANSQWYGYQGRLNEQILGNIEQISHYQTFVCGPKLF
FT                   RKATQALLFKLGLQPSNCHEESFGAHEYSKEQTINTEESTPPLAPVIESQKVRPQNLEH
FT                   QSSKAKVSIYFSRWKKRVQGNKQDSLLDQGETAGLILPYSCRAGSCGSCKAKLISGQVK
FT                   QNSTDGLSAREQQQGYILLCSCSALTDVEISHE"
FT   gene            412394..413833
FT                   /gene="mpl"
FT                   /locus_tag="CPS_0405"
FT   CDS_pept        412394..413833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="CPS_0405"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /note="identified by similarity to SP:P37773; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01081"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26020"
FT                   /db_xref="GOA:Q489V1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V1"
FT                   /protein_id="AAZ26020.1"
FT                   /translation="MTNKIQHLHILGICGTFMGGIAAIAKQLGFKVSGSDANVYPPMST
FT                   QLEQLGIELMSGYQVDNFSDDIDLVIVGNAMSRGNPMVEYMLDRNIPYTSGPQWLLENV
FT                   LKDRWVLAVSGTHGKTTTSSMLAWILEYAHMSPGFLIGGVPQNFSSSARLGDTPFFVIE
FT                   ADEYDSAFFDKRSKFVHYRPRTLVINNLEFDHGDIFNDLSDIQKQFHHLIRMVPSNGLI
FT                   LSPANEEAITETLAMGCWTPTEFSNGELQQDEPSDAGWQVEKLNAQGSEFIVKFNGKEQ
FT                   GVVKWDLIGDFNIDNAVMAIAAARHAGVPSAVSIEALAEFINTKRRFELRGIVNNISVY
FT                   DDFAHHPTAIAKTLAGVRAKLSQQESEQEQVGRIFAVLEPRSNTMRSGVHKESLPKSLI
FT                   DADQVFIYQGEQVTWSVSDLIKQCKPACQVEDNVERLVESIAQQAQAGDIIVVMSNGGF
FT                   ADIHNKLLNRLANIPVPLEDA"
FT   gene            414060..414152
FT                   /locus_tag="CPS_0406"
FT   CDS_pept        414060..414152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0406"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26812"
FT                   /db_xref="GOA:Q489V0"
FT                   /db_xref="UniProtKB/TrEMBL:Q489V0"
FT                   /protein_id="AAZ26812.1"
FT                   /translation="MERVYSRINSKPLEIKQFNQFSLIKIVKRT"
FT   gene            414157..414657
FT                   /gene="def2"
FT                   /locus_tag="CPS_0407"
FT   CDS_pept        414157..414657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def2"
FT                   /locus_tag="CPS_0407"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by similarity to SP:P27251; match to
FT                   protein family HMM PF01327; match to protein family HMM
FT                   TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27395"
FT                   /db_xref="GOA:Q489U9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q489U9"
FT                   /protein_id="AAZ27395.1"
FT                   /translation="MTVLTILTAPNDKLIEQAKPVSDVSQIQMLIDDLIETMYDTEDGI
FT                   GLAATQVGRSEAVVVIDISDNRDELLVLVNPVITHGEATAKGQEGCLSIPGYYADVERF
FT                   THVTVEALDRNGKELTITSDEFLAIVMQHEIDHLKGKLFIDYLSPLKQQMALKKVKKTI
FT                   KNG"
FT   gene            414724..415344
FT                   /gene="ubiX"
FT                   /locus_tag="CPS_0408"
FT   CDS_pept        414724..415344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="CPS_0408"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM TIGR00421"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25171"
FT                   /db_xref="GOA:Q489U8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="PDB:4RHE"
FT                   /db_xref="PDB:4RHF"
FT                   /db_xref="UniProtKB/TrEMBL:Q489U8"
FT                   /protein_id="AAZ25171.1"
FT                   /translation="MNNDFNGKITLAITGASGASYAMRLIECLIAANYQLYILCSSAGR
FT                   IVLDTEVGVKIPSSPDAASKFLTEKYQAKDQQITVFGKEQWFSPVASGSSAPKQMVVCP
FT                   CSTGTMAAICHGMSDNLIERAADVVIKERGQLILMVRETPFSTLHLQNMLSLSQQGVTI
FT                   MPASPGFYHKVETIEDLIDFMVGRVLDHLGIEQDIMPRWGYNI"
FT   gene            complement(415440..415904)
FT                   /locus_tag="CPS_0409"
FT   CDS_pept        complement(415440..415904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0409"
FT                   /product="cheC-like family protein"
FT                   /note="identified by match to protein family HMM PF04509"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28016"
FT                   /db_xref="GOA:Q489U7"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:Q489U7"
FT                   /protein_id="AAZ28016.1"
FT                   /translation="MNVEFINPFLSSMLNVMSTMAQMELIPEKPRLKKNEVAMGDVSGL
FT                   IGMVSDQAKGSLSITFEGALALATMKKMVGEAPDEVNEEIIDLIGEITNMVTGGAKRML
FT                   SEKGIEFDMATPIVVSGPNHSIHHKAKGPIVIIPLKSELGRAYIEFSFDE"
FT   gene            complement(416029..416553)
FT                   /locus_tag="CPS_0410"
FT   CDS_pept        complement(416029..416553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24098"
FT                   /db_xref="GOA:Q489U6"
FT                   /db_xref="UniProtKB/TrEMBL:Q489U6"
FT                   /protein_id="AAZ24098.1"
FT                   /translation="MSKVFSKYLIAIGFYIGLVASATSHTYFFGVSDVSINPKTKHLEI
FT                   IHQFTTHDIENAIAEKKQVHFSAEHKNYDVYIQQFFEQQFSLEKNQMKIPLIWLGFEVT
FT                   SGKIIAYQESSQRNLLPQTVVKNAILIDTYPKQVNTVNFQGVNVKGEALFGSLTFDYRI
FT                   KEAIITSDTSQ"
FT   gene            complement(416553..418931)
FT                   /locus_tag="CPS_0411"
FT   CDS_pept        complement(416553..418931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0411"
FT                   /product="putative aminopeptidase"
FT                   /note="identified by similarity to GP:5524752"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24588"
FT                   /db_xref="GOA:Q489U5"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:Q489U5"
FT                   /protein_id="AAZ24588.1"
FT                   /translation="MKYSTSTALIGLVLAFSGLLSVDSQASKAAFDDKFRQLGEVLPTP
FT                   NIYRTASGTPGHKYWQQQVDYDISIAIDDKTQRLTGEQIMDYQNNSPDTLRYLWLQLDQ
FT                   NRMKRDSAYKMTSRAPSEKKVTFDSFRQLVESPIFDGGYGITKVSASNGKALHYVINGT
FT                   MMRVDLPKPLKSGASVEININWHYQLHEQKVLGGRSGYEYFKEDDNYLYEVASWFPRAA
FT                   AYYDAKGWQNKQFLGNGEFTLEFGDYDVKITVPADHIVAATGVLQNESKVLTSTQRKRL
FT                   KQAKKAKKPVLIITPAEALANEKSRSSKTKTWHFRAKNVRDFAFASSRKFIWDAQGYQQ
FT                   GNSNTMAMSFYPNEGNPLWEKYSTEAIIHTMEQYSKYTFDYPYPVSISVNGPVGGMEYP
FT                   MITFNGPRPTLDDETGEKTYSRRTKYGLVGVIIHEVGHNYFPMIVNSDERQWTWMDEGL
FT                   NTFLQFLAEQAWEEGYPSRRGHATNITSYMKSDNQVPIMTNSESILQFGNNAYGKPATA
FT                   LNILRETIMGRELFDFAFKEYAQRWKFKRPTPADFFRTMEDASAVDLDWFWRGWFYTTD
FT                   HVDLAIDNVYLYRPNSQNPDVEEAWERALDNEQPEFISDLRNKNQWIRTQDKPELLDFY
FT                   NDHDKFTATNADRNKYNEEHEKLESWQKDLLTNNSKFYVIDFSNHGGLVMPILLDITYA
FT                   DNTTEHIYIPAEIWRKNSKKVSKLLIRDKEISEIALDAKWQTADVNINNNYWPARPIQS
FT                   RFDLYKEKKKDMMRDYNEALKDISAEKINNEAEHQEEGK"
FT   gene            complement(419106..419546)
FT                   /gene="zur"
FT                   /locus_tag="CPS_0412"
FT   CDS_pept        complement(419106..419546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="CPS_0412"
FT                   /product="zinc uptake regulation protein"
FT                   /note="identified by similarity to SP:P32692"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26064"
FT                   /db_xref="GOA:Q489U4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q489U4"
FT                   /protein_id="AAZ26064.1"
FT                   /translation="MTAESLLQQAQFVCKKKGARFTTVREQVFLLLANRQGAVGAYDLL
FT                   AELKELDAAAKPATIYRALDFLSKQGFVHKIESINAFIMCHHFGECDHPVQLLICDECG
FT                   HVEEIQSNNFDLALRTMADANGFTISHQIVEAHGSCKNCNNV"
FT   gene            419864..420940
FT                   /locus_tag="CPS_0413"
FT   CDS_pept        419864..420940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0413"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GP:29340934"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25196"
FT                   /db_xref="GOA:Q489U3"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:Q489U3"
FT                   /protein_id="AAZ25196.1"
FT                   /translation="MTRYLALDAFRGITIALMILVNTPGTWSHVYAPLLHAEWDGATPT
FT                   DLVFPFFLFIIGSAMFFSFKKSNFSASPEQFRKIIKRGFIMFFIGFMLNVIPFTVNAED
FT                   WRIMGILQRIGIAYTVAACLVLTLNRTGVFIASAVILLAYWALLLSMGEGALTIEGNII
FT                   RQLDLAVFGANHMYTMRGVAFEPEGLLSTIPAIVNMLLGFELTRYLTSIEDKRSSVIKL
FT                   TLIGGLAVGFGALWGLVLPINKSLWTPSYVIYSTGFACLLLAAFIWLIDIMKQVKLAEP
FT                   LLVYGTNPLFVYVLSFLVVTMYLNINVGDVSMYAWLYKQLSGVFTPKLASFIFAFSHVA
FT                   FFWYVSLKLYQRKIFIKI"
FT   gene            421082..422437
FT                   /locus_tag="CPS_0414"
FT   CDS_pept        421082..422437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0414"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO0942"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28393"
FT                   /db_xref="GOA:Q489U2"
FT                   /db_xref="UniProtKB/TrEMBL:Q489U2"
FT                   /protein_id="AAZ28393.1"
FT                   /translation="MNKTKLSQDENLSFKVSHQLLPQDYQRIDLYFSLPVEMGINPSTL
FT                   NEEEFFYSNIKNHSAYYADQLHLPLVRSRFVSQKKGEQSDYRLNLNLYSYQVKKALDAD
FT                   IKQTLKLKAAEEFYPAAVELAEQTLSLTKKLRRYTPSDKKLNSFFENADNYLSWHIEQS
FT                   FLKLLSRGPKSSEFTAERELLLSLCRSENDYRIENKYNSQVTLDDANRITNKMRLLQRL
FT                   IEYGVVFQRKTRYLNVNLKRFVRGVVTAVIMAFVMLLVLNARTNFTEVTVALVAFLGLI
FT                   YGLRETFKEDLTSLIWRKIQKGRPKWQNLFTHSVTKKRILSQILWLEYISNKDLPKSVN
FT                   ALFQQRRQQNKQAAQLLHFRCDNKVMAKEFLPGYDEIQQQTFFNLTPFVRFLKKGAGRL
FT                   YSLEGQKISSQGVEQRYQINLILRHFCKGEESLQRFKITLNRSEIVNIESIN"
FT   gene            422630..423061
FT                   /gene="rpsF"
FT                   /locus_tag="CPS_0415"
FT   CDS_pept        422630..423061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="CPS_0415"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by similarity to SP:P02358; match to
FT                   protein family HMM PF01250; match to protein family HMM
FT                   TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28210"
FT                   /db_xref="GOA:Q489U1"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489U1"
FT                   /protein_id="AAZ28210.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVSGMIQRYTDLINAAEGKIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLMNIEAPQVVIDELETAFRYNDVVIRNMIMRTKDAVTEASPMAA
FT                   AKEERRDDRREVKKDVAAAPVEAKEDSVEEKSEEAASEE"
FT   gene            423069..423383
FT                   /gene="priB"
FT                   /locus_tag="CPS_0416"
FT   CDS_pept        423069..423383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priB"
FT                   /locus_tag="CPS_0416"
FT                   /product="primosomal replication protein N"
FT                   /note="identified by similarity to SP:P07013; match to
FT                   protein family HMM PF00436"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25030"
FT                   /db_xref="GOA:Q489U0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:Q489U0"
FT                   /protein_id="AAZ25030.1"
FT                   /translation="MIVSQENCLVLIGEVVRTPKQSTSPAGISHSQFSIDHKSIQNEAG
FT                   MNRQAFVRIQVVATGDLSHLTRELIAGNVVKVTGFINRHESRNGNPLLALHAQQIEMIN
FT                   "
FT   gene            423437..423664
FT                   /gene="rpsR"
FT                   /locus_tag="CPS_0417"
FT   CDS_pept        423437..423664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="CPS_0417"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by similarity to SP:P02374; match to
FT                   protein family HMM PF01084; match to protein family HMM
FT                   TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24350"
FT                   /db_xref="GOA:Q489T9"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489T9"
FT                   /protein_id="AAZ24350.1"
FT                   /translation="MSRFFRRRKFCRFTAEGATSIDYKDIATLKNYITESGKIVPSRIT
FT                   GTAAKYQRQLTRAIKRARYLSLLPYTDLHK"
FT   gene            423682..424134
FT                   /gene="rplI"
FT                   /locus_tag="CPS_0418"
FT   CDS_pept        423682..424134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="CPS_0418"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by similarity to SP:P02418; match to
FT                   protein family HMM PF01281; match to protein family HMM
FT                   PF03948; match to protein family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26192"
FT                   /db_xref="GOA:Q489T8"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489T8"
FT                   /protein_id="AAZ26192.1"
FT                   /translation="MEVILLDKIAKLGGLGDKVSVKSGYARNYLLPQGKAVFASEANVE
FT                   HFEARRADIEAKLADVLATAEARAAKVVALAEVTIASKSGDEGKLFGSIGTRDIADAIT
FT                   EAGVEITKAEVRLPLGAIRETGEFEIAIHLHHDVDTSIKVVVIAEA"
FT   gene            complement(424405..425592)
FT                   /locus_tag="CPS_0419"
FT   CDS_pept        complement(424405..425592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0419"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25520"
FT                   /db_xref="GOA:Q489T7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q489T7"
FT                   /protein_id="AAZ25520.1"
FT                   /translation="MTLLKKIISLILIPLSSFSTFAASGIFTDKLDGNLDASRYLSENA
FT                   YGFLPVPIIITDPAVDGGLGMMGLFFHESEEEQAARLKTMQDESNDRASHSLMPPSISA
FT                   AFGAYTGNDSYLIGGGHLGFFNKGSIRYMGGGGYGDINLNFYGFGDLTLPAPLKINTQA
FT                   TAIMQTLKFKLGNSAFYFGPMHRYVDAQVSIVNAGNIIGKIPSNLRPALSTNIVTSGAG
FT                   LTLEYDSRDNFFSPTDGLKYELNYLWFDDVIGSDVDYTLTELTALNYFKITDHWRTAIR
FT                   VEANYVDSEQILPPYATPYISMRGIPAARYQGQSVALSELEVAYRINLRWELSAFAGIG
FT                   KASDSFSDFSDSDSRVSKGAGFRYLIARRYDFNMGIDIAKGPEDTVFYIQAGSAW"
FT   gene            complement(425699..426628)
FT                   /locus_tag="CPS_0420"
FT   CDS_pept        complement(425699..426628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0420"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26688"
FT                   /db_xref="GOA:Q489T6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q489T6"
FT                   /protein_id="AAZ26688.1"
FT                   /translation="MALLEQKLARVDLNLLVSLSVLLKEKNVSRAAERLYLSQSAMSRT
FT                   LQRLRDLFDDPLFHRTASGIVPTEKAHSIEALLPDLLQKLESILHDDDFSPQTCDKHFS
FT                   ISLPSLTSHAIFLPLVQAINNEAPAVQLSEYSAKMSSNKSLESGFLDFAIHIEKPTDTA
FT                   FIATSLGKLSLSIFARKSHPLSAQHKVELADCLTYRFLELNVNEDSGAIFTNPIDSILL
FT                   KQGFKRDIQLKTSQLSILVELLKSSNTLLIAPSFFIHSSTYKEELVSVYQFEQTDSNMV
FT                   ELFLLQHQRTVNSAAHQWLRDKVLQQTL"
FT   gene            complement(426821..427696)
FT                   /locus_tag="CPS_0421"
FT   CDS_pept        complement(426821..427696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0421"
FT                   /product="transcription regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25993"
FT                   /db_xref="GOA:Q489T5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q489T5"
FT                   /protein_id="AAZ25993.1"
FT                   /translation="MFSVEQLQAFITTVETGSFSAAARRLNKVQSVVSQHVINLEVDCN
FT                   ILLFDRSGRYPALTEAGEKLLPHAQAVIDQHQRLKNSALSLTDNTPKEITIALDEGISF
FT                   KLISGIISNLQNEFPNITLEFLSASSPDIIDMLKNEKALTGIVFSELTIPSYLDFECIG
FT                   SIKFDLYVAKSHPLANQVCKNIDSLRLHRQLLIRSRNTQSSSFQLKLSPNVWYADNYFL
FT                   LLELALQGNGWCLLPNHIANESVESGQLVKLPLEFEEMGWQANVDVVQHQRHSNLAVFK
FT                   VLRLLLRNLL"
FT   gene            427783..428211
FT                   /locus_tag="CPS_0422"
FT   CDS_pept        427783..428211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0422"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GP:27362381"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25936"
FT                   /db_xref="GOA:Q489T4"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:Q489T4"
FT                   /protein_id="AAZ25936.1"
FT                   /translation="MNTIERIYQAVLFEVIALMIVVPTTVLIAGYETDKMAIAGIALSI
FT                   FAMFWNYIYNIVFDKLAGYNRVERGLTVRIIHAITFEFGMILITLPLLAWYLNITWLEA
FT                   TFLEAGFLVFILIYTFIFNWLYDRYQPYKRLISNEQYS"
FT   gene            complement(428350..429042)
FT                   /locus_tag="CPS_0423"
FT   CDS_pept        complement(428350..429042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0423"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3 family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26326"
FT                   /db_xref="GOA:Q489T3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q489T3"
FT                   /protein_id="AAZ26326.1"
FT                   /translation="MASINWSEISTVLIDMDGTILDLHFDNHFWLEHLPARYSEKMSIS
FT                   LDAAKAKLKADYLSVVGTIKWYCLDYWAEQTQMPITELKREIQHLIQLRTDARDFLIAL
FT                   KASGRDVVLVTNAHPESLSLKIERTQLDQYFDVLYSTHDFGVTKESQLLWQRLQEKHGF
FT                   DCDSTLFIDDSIEILQSAQQYGIKHLLAVANPDSKKTANVITDFPAITSFDLLTAQLSK
FT                   ELINSTSN"
FT   gene            429169..429720
FT                   /gene="nudE"
FT                   /locus_tag="CPS_0424"
FT   CDS_pept        429169..429720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudE"
FT                   /locus_tag="CPS_0424"
FT                   /product="ADP compounds hydrolase nudE"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P45799; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26283"
FT                   /db_xref="GOA:Q489T2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q489T2"
FT                   /protein_id="AAZ26283.1"
FT                   /translation="MADENQLPIITHRQQVAKSALFGIEQIDLTFSNGEQRQYERMMGS
FT                   GRGAVMIVPMIDDETLLLVREYCAGTHSYLLGFPKGLIDEGELAEQAANRELQEEIGYG
FT                   SEQMHQISEMMMAPAFFNAKMTIFLAKNLYSSELEGDEPEPLEVVSWPIKDYKELLQQT
FT                   DFTEARSIAALMLVRDLLAV"
FT   gene            429777..430598
FT                   /gene="cysQ"
FT                   /locus_tag="CPS_0425"
FT   CDS_pept        429777..430598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="CPS_0425"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by similarity to SP:P22255; match to
FT                   protein family HMM PF00459; match to protein family HMM
FT                   TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28382"
FT                   /db_xref="GOA:Q489T1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:Q489T1"
FT                   /protein_id="AAZ28382.1"
FT                   /translation="MSQDKLLSIALESAKKAGVEVMKYYRQGNYTEETKADESPVTSAD
FT                   LAANDILMDQLKTLTPDIPIISEEVGTVQLNERKDWSRYWLLDPIDGTGEFIIGSGDFA
FT                   VNIALVENGWPTLGVIHAPDHCLTYYGQKNLGAFKDNSQASHAIRVAEYQENRRIKVAI
FT                   SRRQQLELMGQYLNNDYDYDYVALGSCSLKNCLIAEGGADCYIRVGVTGEWDTGASQCI
FT                   LEQAGGDIIDSEFNPLSYNKRESLLNPDFVSLGARDFPWQKIIKAHRKVYE"
FT   gene            complement(430616..430714)
FT                   /locus_tag="CPS_0426"
FT   CDS_pept        complement(430616..430714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0426"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26424"
FT                   /db_xref="GOA:Q489T0"
FT                   /db_xref="UniProtKB/TrEMBL:Q489T0"
FT                   /protein_id="AAZ26424.1"
FT                   /translation="MNSANLAQIVSKTNFFITTVMKGDISRNNLIS"
FT   gene            430865..431035
FT                   /locus_tag="CPS_0427"
FT   CDS_pept        430865..431035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0427"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24792"
FT                   /db_xref="GOA:Q489S9"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S9"
FT                   /protein_id="AAZ24792.1"
FT                   /translation="MVDGACCQPKYHFVIFPTVLLSATISAINFICINAFICKVNCLSY
FT                   NHYYLINITNI"
FT   gene            431062..431859
FT                   /locus_tag="CPS_0428"
FT   CDS_pept        431062..431859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO0620"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27857"
FT                   /db_xref="GOA:Q489S8"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S8"
FT                   /protein_id="AAZ27857.1"
FT                   /translation="MAAQVTALFNEIWEQYLSVTPSAKKIHQLLGNGNDVINDHVAYRT
FT                   FNHPKINLAQLAKGLLALGYTECGQYDFSAKKLDAKHFEHADSTMPKVFISELRVEEFS
FT                   SEVQDIITGLIAQLPEDVSDRADFLYAGRLWEISSKDYDTLLNVSEYAAWLAAWGYRAN
FT                   HFTVSINHLANYEDIEVVNATLKDAGYALNANGGEIKGDEAVKLEQSSTLADKAPVDFS
FT                   DKTMEIPSCFYEFAKRYPLASGELYTGFVAASADKIFDSTNAK"
FT   gene            complement(432302..432538)
FT                   /locus_tag="CPS_0429"
FT   CDS_pept        complement(432302..432538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01YP0167; match
FT                   to protein family HMM PF06794"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24509"
FT                   /db_xref="GOA:Q489S7"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S7"
FT                   /protein_id="AAZ24509.1"
FT                   /translation="MIIPLDQLSHETLTAIIEGFILREGTEYGAEDVSKEAKIAQVKKQ
FT                   LEQGSAVLVYSELHESINILPSDQFKVGMEEEI"
FT   gene            432685..432783
FT                   /locus_tag="CPS_0430"
FT   CDS_pept        432685..432783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26184"
FT                   /db_xref="GOA:Q489S6"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S6"
FT                   /protein_id="AAZ26184.1"
FT                   /translation="MALSACLQRSKGHLPYNKVKGLNWLLKVLSTT"
FT   gene            complement(432885..433022)
FT                   /locus_tag="CPS_0431"
FT   CDS_pept        complement(432885..433022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26534"
FT                   /db_xref="GOA:Q489S5"
FT                   /db_xref="InterPro:IPR021494"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S5"
FT                   /protein_id="AAZ26534.1"
FT                   /translation="MNLLSMLTNDPVVMFSFGGIAIMLGICAFYVYYFIKHIQDDSKKN
FT                   "
FT   gene            complement(433101..433841)
FT                   /locus_tag="CPS_0432"
FT   CDS_pept        complement(433101..433841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0432"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:26111560"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27150"
FT                   /db_xref="GOA:Q489S4"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S4"
FT                   /protein_id="AAZ27150.1"
FT                   /translation="MRTKILLLTFTLLSSFSVLSQGNDLEQGMYELNRGEFKAAIEQFR
FT                   PLVNEGYAPAQYQMALVYLHGYSVRKDSMKALELFELSAAQNYPDAQFELALIYSDGKL
FT                   VKQNLKKAFELTHKAANKDLPSAQFNLAVMYANGTGIKQDDFKASRWYQRAANQNYALA
FT                   QFNLALLYSEGKGVEKSTELSYVWNTIASWNGYPNAEKSRLMDERDLSKLKIEKSIEKA
FT                   NDIYQKIRDQQEMKAKMAEKQNFY"
FT   gene            complement(433898..435823)
FT                   /locus_tag="CPS_0433"
FT   CDS_pept        complement(433898..435823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0433"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27726"
FT                   /db_xref="GOA:Q489S3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S3"
FT                   /protein_id="AAZ27726.1"
FT                   /translation="MIIATDLSLDRGAKNLIKSSSFTIHPNHKVGLVGSNGCGKSSLFA
FT                   ALLGDLSPDSGDLALPTSWDIATVRQETPSLEQTALDYVMDGDKEFRQLEHELEQARIM
FT                   DNGNLEATIINKIDTISGYSLPARAGELLHGLGFLQSQLDNPVKDFSGGWRMRLNLAQA
FT                   LISRADLLLLDEPTNHLDLDAVIWLQRWLKRFTGTLVLISHDRDFLDTVIGQILHIEHQ
FT                   RAKLYSGNYTAFERQRREHLAQQDAQFQKQQKEAAHLTAFVDRFRAKASKAKQAQSRLK
FT                   RLEKLPDLAPAHVDSQFTFSFAEPESLPYPLLSLDKSQCGYPKSDHGEQAIILDDVGLT
FT                   LIPGSRIGLLGRNGAGKSTLIKSLAGELALLGGERYCAQDLTVGYFSQHQLEQLHAPSS
FT                   PVDHILRAKPALGEPQARTFLGKFGFSGDQALSQVSTMSGGEKARLVLALIVLEKPQLL
FT                   LLDEPTNHLDLEMRQALVMALQDFGGAIILIAHDRFLLESCVDEFYLVANGRVSDFSGN
FT                   IDDYQQWLNDDKKQAIKSIKTDQQSGDKGLYKKQLRQQQAELRKKSAPMRKEADKLEKK
FT                   VHQWQEELTKIEALLSDSDIYQSERKAELTDLLKKQANLKGDIEENEMLWLELAEQIEE
FT                   MMSVTD"
FT   gene            436288..436491
FT                   /locus_tag="CPS_0434"
FT   CDS_pept        436288..436491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0434"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01YP0178; match
FT                   to protein family HMM TIGR02443"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24854"
FT                   /db_xref="GOA:Q489S2"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S2"
FT                   /protein_id="AAZ24854.1"
FT                   /translation="MSKALKKRFIAGAVCPKCKAMDTMALTKENGVEKVTCVSCGEQMV
FT                   QTEEQVEKVVRENEQVIGVFKP"
FT   gene            complement(436685..436948)
FT                   /locus_tag="CPS_0435"
FT   CDS_pept        complement(436685..436948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0435"
FT                   /product="slyX protein"
FT                   /note="identified by similarity to SP:P30857; match to
FT                   protein family HMM PF04102"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25523"
FT                   /db_xref="GOA:Q489S1"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S1"
FT                   /protein_id="AAZ25523.1"
FT                   /translation="MANHEITLSAHSTNANYIQQLEERVDSLESRNVFQDDVIDQLSEE
FT                   LAAHQHEISELKHQIQLVANRLKDAGSLSGDAEEIEPPPPHY"
FT   gene            complement(436930..437913)
FT                   /locus_tag="CPS_0436"
FT   CDS_pept        complement(436930..437913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0436"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:2160521; match to
FT                   protein family HMM PF00400"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26233"
FT                   /db_xref="GOA:Q489S0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniProtKB/TrEMBL:Q489S0"
FT                   /protein_id="AAZ26233.1"
FT                   /translation="MLNCNWIFPLVLLTTLTACKPVTQEPLQRWQQSVEGAYAGQISSD
FT                   AKFSVISSIHHGLSVWDLDKNQRIYNWAQEQNTSDNLVLSIDISDNASHVLTANRDNFA
FT                   LWNLQSGKSEGYWKVRESHIRDIAVSNNGDYLLIGKSNGTVVHVAVDTGRRLEFLGHKE
FT                   KINSVDMLPNGRVAISGGNDFTAYVWDTQSGQVVYQFNHSSRVSKVALDAKARYAFSAD
FT                   SMKGAYIWDLKTGKRISSLQGTKRHEVFSTVRFSPNGKTLITGAATRKVSVWDIATGKR
FT                   LSHWFVTPKEAKRPTGAVVYSVAFGDNNDLLTISSSGYVESWPITK"
FT   gene            438097..438864
FT                   /gene="fkpA"
FT                   /locus_tag="CPS_0437"
FT   CDS_pept        438097..438864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpA"
FT                   /locus_tag="CPS_0437"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   FkpA"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P45523; match to
FT                   protein family HMM PF00254; match to protein family HMM
FT                   PF01346"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26880"
FT                   /db_xref="GOA:Q489R9"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R9"
FT                   /protein_id="AAZ26880.1"
FT                   /translation="MKLFKPTLVALALFAVVGCNEKAVEEVKAPVLDTEVQKQAYGLGA
FT                   SIGMYMQRNLEEHDKLGLTLDKELIVRGFVDSIDGKSVIEKEEIQALLMNLDTSMKEKQ
FT                   QAAAIAASESSLADGAKFLEDNAKKEGVTVTESGIQYEVLTAAEGDTPLATDTVKVHYK
FT                   GTFLNGETFDSSYKRGEPAVFPLNRVIKGWTEGVQLMPVGAKYKFTIPSDLAYGPNGNP
FT                   PSIPGNSVLQFEIELLEIQKAEEAPKADEHAAH"
FT   gene            complement(438919..439017)
FT                   /locus_tag="CPS_0438"
FT   CDS_pept        complement(438919..439017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0438"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28100"
FT                   /db_xref="GOA:Q489R8"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R8"
FT                   /protein_id="AAZ28100.1"
FT                   /translation="MNLIKQIIKANAKYNYSNAGNKKPPVNDYGWL"
FT   gene            439169..440428
FT                   /locus_tag="CPS_0439"
FT   CDS_pept        439169..440428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28694"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R7"
FT                   /protein_id="AAZ28694.1"
FT                   /translation="MKKLLIIGYVWPEPNSSAAGSRMMQLIHFFQSQSYHITFASPAQQ
FT                   TEHMVDLRALNIDVENISLNCTSFDDFIKELQPNTVMFDRFMMEEQFGWRVSEQCPQAL
FT                   RLLDTEDLFCLRNARHQAYKLKRDITDEDLLTSDMAKREVASIFRSDISLMISSIEVAL
FT                   LKRLFKVDTSLIHYCPFMLSHAQLAQENPSFQQREDFMAIGNFRHAPNWDAVLWLKQQV
FT                   WPLIRKQLPNAKLNIYGAYPPPKATDLHDEKSGFLVKGWVDDAVLAMQSAKVCLAPLRF
FT                   GAGIKGKLAEAMYCATPSVTTDIGAESMQTDLPWAGAIANDPQAIADAAVKLYQDESTW
FT                   QVSSDLGQQNAMLMYQQNNVLTELADCLSKLEANLSSHRQANFIGSMLNHHHHKSTQYM
FT                   SQWIDVKTQLKVVEEKIAEE"
FT   gene            complement(440948..441424)
FT                   /locus_tag="CPS_0440"
FT   CDS_pept        complement(440948..441424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0440"
FT                   /product="thioesterase family protein"
FT                   /note="identified by similarity to GP:28809765; match to
FT                   protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24999"
FT                   /db_xref="GOA:Q489R6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R6"
FT                   /protein_id="AAZ24999.1"
FT                   /translation="MNAPQRDITLRFLAEPQDVNFGGKVHGGAVMKWIDLAAYACAAGW
FT                   SGRYCVTAYAGGIRFVAPIHVGSLVEVEAKVIYTGNSSIHIALEVNACDPKSLNRRLTT
FT                   HCIVIMVAVDQNGQSERVPQWQPQTEADKKQHESAVKLMEMRKQIGEEMQIFVD"
FT   gene            441595..442386
FT                   /locus_tag="CPS_0441"
FT   CDS_pept        441595..442386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ23970"
FT                   /db_xref="GOA:Q489R5"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R5"
FT                   /protein_id="AAZ23970.1"
FT                   /translation="MVRLLQLVHIFNFMVNYLMNKLQKILIALPLSVAFTSSAIAGLIS
FT                   EDFNSGSPAGVSFYGPSSVINQEAQLTPSSNSLLGGMSFTDQDNGQLIEAWDANFDFRI
FT                   DQNGNGGADGISLTFSRLGDVGAAGEEGLFSGLAIGFDTWSNGEVSGNHISLRYDGVSL
FT                   VEQNISTTILENGEVHSTSISMIDGLVSVSLDGTSLFTHDVANWAAYSGQFNFGARTGG
FT                   ARSRQVVDNFIGSTVAVPEPSMLAIFGLALFGLARRKTVKK"
FT   gene            442597..443040
FT                   /locus_tag="CPS_0442"
FT   CDS_pept        442597..443040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0442"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:4704563"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26381"
FT                   /db_xref="GOA:Q489R4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R4"
FT                   /protein_id="AAZ26381.1"
FT                   /translation="MHWWVMEVWQSLLLKGNDSFNKLSLPLAEEYYHQAIECLEHEWHA
FT                   DIENSNLLMAWISVFHNLAVLYEELGQPKIAFRYLQIPHQRMTELSQQSQYSDDLKFVA
FT                   LRTLKITLMPLLAFSKKYPACDGCLSSLKKMEITVNASQPVMH"
FT   gene            443065..443247
FT                   /locus_tag="CPS_0443"
FT   CDS_pept        443065..443247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27225"
FT                   /db_xref="GOA:Q489R3"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R3"
FT                   /protein_id="AAZ27225.1"
FT                   /translation="MKKVVIIFAGLGALLSNPLLAHPGHDHSASGSGLVNLLWLVPVIV
FT                   AAVVVVFKEVTAPKR"
FT   gene            443273..443776
FT                   /locus_tag="CPS_0444"
FT   CDS_pept        443273..443776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0444"
FT                   /product="putative nickel-containing superoxide dismutase"
FT                   /note="identified by similarity to SP:P80735"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26456"
FT                   /db_xref="GOA:Q489R2"
FT                   /db_xref="InterPro:IPR014123"
FT                   /db_xref="InterPro:IPR036502"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R2"
FT                   /protein_id="AAZ26456.1"
FT                   /translation="MLYDIIAKFDKKLHFPVVMAHCDIPCKIYDPIGAQISVLTIIRMV
FT                   DLLNELKAKSSLTLDEQAEFLRLVNQKENHGIKVKEEISVIWGDYIKAPQLTQFPELHE
FT                   LVHNIMLASSQAKQHISKEAAQILLQQVNRFAEIFWATKKVATFSAICPYPPEESLIYP
FT                   NLQG"
FT   gene            443799..444095
FT                   /locus_tag="CPS_0445"
FT   CDS_pept        443799..444095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28500"
FT                   /db_xref="InterPro:IPR014124"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R1"
FT                   /protein_id="AAZ28500.1"
FT                   /translation="MFGFHFCKVTGVSMSPLIPENSYIFVVPWLKIFNLKEGNLLKVFH
FT                   PRYGYIVKSLAQVDRNGFFWLKGHHKTSVPIEKLGPVGKSQIQGKVLWVFPPT"
FT   gene            complement(444163..444708)
FT                   /locus_tag="CPS_0446"
FT   CDS_pept        complement(444163..444708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0446"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO4561"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28565"
FT                   /db_xref="GOA:Q489R0"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:Q489R0"
FT                   /protein_id="AAZ28565.1"
FT                   /translation="MKLSIICLSASVALISLAGFTSFTASAIDLGTITKSSSEQLKTAA
FT                   KDIGVPLETSAMIGYAAKQLNLSEATVAASFGSLLKVAQDNLSPENFSLISKAVPDAQS
FT                   YVEKAPKVTKSSMSSLLSSAGEAGKKAESLDYLNSAFDKLGISSEQVPGLINSFSSYLD
FT                   KSGYEGAASALKKGLSFL"
FT   gene            444917..445030
FT                   /locus_tag="CPS_0447"
FT   CDS_pept        444917..445030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0447"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24868"
FT                   /db_xref="GOA:Q489Q9"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Q9"
FT                   /protein_id="AAZ24868.1"
FT                   /translation="MSYFCFLSVFVFIFCFYYCFSLAQAFYTKAFLPPQQL"
FT   gene            445407..446474
FT                   /gene="hemE"
FT                   /locus_tag="CPS_0448"
FT   CDS_pept        445407..446474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="CPS_0448"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="identified by match to protein family HMM PF01208;
FT                   match to protein family HMM TIGR01464"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27556"
FT                   /db_xref="GOA:Q489Q8"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489Q8"
FT                   /protein_id="AAZ27556.1"
FT                   /translation="MTELKNDTYLRALLKQPVDYTPVWMMRQAGRYLPEYREVRKNAGD
FT                   FMSVCKNAELACEVTIQPLRRFPLDAAILFSDILTIPDAMGLGLYFETGEGPKFERPIT
FT                   CKADVDKIAVPDPEDELGYVMNAVRTIRKELKGEVPLIGFSGSPWTLATYMIEGGSSKA
FT                   FTKIKKMMFAEPQTLHLLLDKLADSVISYLNAQIAAGAQSVMVFDTWGGVLSPRDYNEF
FT                   SLQYMAKIVDGLTRHNEGRQVPVTLFTKNGGMWLESIAATGCDAVGLDWTIDIENAKAR
FT                   VGDKVALQGNMDPSMLYAPLPRIEQEVSKILSGFGEGGTGHVFNLGHGIHPDVNPDHAG
FT                   HFIESVHRLSKPYHK"
FT   gene            447238..447597
FT                   /locus_tag="CPS_0449"
FT   CDS_pept        447238..447597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0449"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28354"
FT                   /db_xref="GOA:Q489Q7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Q7"
FT                   /protein_id="AAZ28354.1"
FT                   /translation="MTPQWDPEKPIYLQLYQQVVTRILDGYIKEGEALPSVRKVAAEYQ
FT                   LNPMTISKAYQMLQDEEVVEKQRGKGLFVMPGAQVLMLDRERESFLSHQWPEVLKQITR
FT                   LKLSPEQLLTSSWDG"
FT   gene            447600..448457
FT                   /locus_tag="CPS_0450"
FT   CDS_pept        447600..448457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0450"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28566"
FT                   /db_xref="GOA:Q489Q6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Q6"
FT                   /protein_id="AAZ28566.1"
FT                   /translation="MNSLISVNNVSKSFGNKQVLSSVNFSVNAGQIVGLVGPNGAGKTT
FT                   CLQAILGLTDFEGDISVLGHHPRKDRVNMLNDVAYIADVAILPKWLKVSQALSYMQDIH
FT                   KNFNLEKAHEFLAKTNIALGDKVKALSKGMVAQLHLALILAIDAKVLILDEPTLGLDIL
FT                   TRRQFYNHLLEDFYNEDKCIVVTTHQIEEIEHILTDVAFIQDGRIVLAQSTEEIKQRFN
FT                   IVAVANEQLPQADELNPLFKNSMMGLTTMLFDNQDKETLQGLGKVSIPSLADVFVGVMN
FT                   KETC"
FT   gene            448457..449362
FT                   /locus_tag="CPS_0451"
FT   CDS_pept        448457..449362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0451"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by similarity to GP:29541373"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24528"
FT                   /db_xref="GOA:Q489Q5"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Q5"
FT                   /protein_id="AAZ24528.1"
FT                   /translation="MNTTIMKASIKKELWEFNGMLTWVPVTLAGVFIFIPLLGVILNGV
FT                   DMKELMVGLENLAQFQSSDRISEVFFVSAIALFSPFIAIGFIVQVYYFVTCLFDERRDQ
FT                   SVMFWRSLPVSDKMTIASKVLTGAIVIPVIFFMAATLLMLFILVLAVIACSVLSIGFDI
FT                   SLWGMLAGADIISGVGYIWLTLVPIAIWLLPLYSWLMLASIYANKAPFLWAVLPIVALL
FT                   VIEAIVVHYLHLSQPFFGHFLMDYFSMTPEHLADVSVDQDASRSATLLMLISQIDYRTV
FT                   LVSAGLLFTTYWFRVNKQES"
FT   gene            complement(449451..450806)
FT                   /locus_tag="CPS_0452"
FT   CDS_pept        complement(449451..450806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0452"
FT                   /product="sensory box/GGDEF domain protein"
FT                   /note="identified by similarity to OMNI:VCA0939; match to
FT                   protein family HMM PF00990; match to protein family HMM
FT                   TIGR00229; match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25361"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Q4"
FT                   /protein_id="AAZ25361.1"
FT                   /translation="MLIYNLAIHSYLGCDSLALLPKANTLSKEKNINNADDTIKDQILA
FT                   SIDSFIYTKDLSGKYTYANQAVLDLFEKNLADVIGFDDTHFFDLALSKQLKANDRMVMD
FT                   QVIRIENEESNFIRAKNETRIFKVVKKPLFDHLGNVNGICGISTDITVEKQLQEQVNEQ
FT                   SYLLETMLNNIDAHIYVKDCERTFLYVNNRVAELFGDKAENIIGKKDTDILPKEIAEHF
FT                   YQSDKQVFETNQKQVIEETTHGENGDNCHYISTKVPFDRPDKLPALIGFSTDVTELFKL
FT                   KEEFKLLANTDPLTNLYNRRFFIEQAEKEYQRAKRYSLSMTLISIDIDHFKSINDQFGH
FT                   PAGDQVLIEIAKQLKASLRQTDILARIGGEEFSILLPETSAMSAMTFAERIKEEQSRLI
FT                   ITGDWQGEINLSVSIGVSSLIASDKAFDVLFSRADKALYQAKNTGRNTVCYL"
FT   gene            450857..450961
FT                   /locus_tag="CPS_0453"
FT   CDS_pept        450857..450961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26189"
FT                   /db_xref="GOA:Q489Q3"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Q3"
FT                   /protein_id="AAZ26189.1"
FT                   /translation="MQLSAMLCFFSFVDRGACLTQIFQIQSGNKKGTY"
FT   gene            complement(450999..451328)
FT                   /gene="metJ"
FT                   /locus_tag="CPS_0454"
FT   CDS_pept        complement(450999..451328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="CPS_0454"
FT                   /product="met repressor"
FT                   /note="identified by similarity to SP:P08338"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26457"
FT                   /db_xref="GOA:Q489Q2"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Q2"
FT                   /protein_id="AAZ26457.1"
FT                   /translation="MAQWNEEYINPYAEHGKKSEQVKKITVSIPLRVLKVLTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPDDEDLAKDNNEKLPASVRRLLEAKGITDFSAY
FT                   EVEDE"
FT   gene            451577..452743
FT                   /gene="metB"
FT                   /locus_tag="CPS_0455"
FT   CDS_pept        451577..452743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="CPS_0455"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="identified by similarity to SP:P00935; match to
FT                   protein family HMM PF01053; match to protein family HMM
FT                   TIGR02080"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27407"
FT                   /db_xref="GOA:Q489Q1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Q1"
FT                   /protein_id="AAZ27407.1"
FT                   /translation="MSITKKGNITTSAVRAGINTDQQHGAVVAPIYLSSTYSLKGFNNK
FT                   RQFDYSRTGNPTRATFAGAIAELEQGSVGIVTSTGMAAVHLICQLLSTQDTVVIPHDCY
FT                   GGSFRLFTHLAKRGQFKLIVVDQNDQQALDNALAHKPKLVLLESPSNPLLRLVDIEVVT
FT                   KACHAVGALVAVDNTFLSPALQQPLTLGADIVFHSTTKYINGHSDVVGGVVVAKTEELG
FT                   EQLAWWANCIGITGSAFDSFLALRGLKTLPVRMKQHQENALRVADFLKNHDAIDAIYFP
FT                   GFPEHTGHHIAKKQQYGFGAMLSFEIKGDVEAVKKLFENLELFTLAQSLGGVESLISHP
FT                   STMTHAGMTIPDQLEAGITQSLVRISVGIEDIDDILADLAHGLTQSQL"
FT   gene            452818..455316
FT                   /gene="metL"
FT                   /locus_tag="CPS_0456"
FT   CDS_pept        452818..455316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metL"
FT                   /locus_tag="CPS_0456"
FT                   /product="aspartokinase/homoserine dehydrogenase II"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by similarity to SP:P00562; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF00742; match to protein family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27304"
FT                   /db_xref="GOA:Q489Q0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:Q489Q0"
FT                   /protein_id="AAZ27304.1"
FT                   /translation="MSSNEIADIDFIAEVAAENKLAKHAIQVHKFGGSSLATPKCIKRA
FT                   LEIIRENCQLNDIVVVSANGKTTDRLFALYSLVERTIAEDTIQKSDELTQAIDELAKEQ
FT                   AQLITELLNANNTKQLLLRLHKDIEQLTTWLTADIVQHHNDVLALGEVWSARLLSALLN
FT                   EQVCPSNSIDSRDFLVIDNEQSCVVDTALSAAQLRQRRQFGKLAVITGYISKDSRGKSC
FT                   TLGRNGSDYSATIIASLVAAGNVTLWTDVDGIYSADPRVVPSARKLHRLPNGVAKELGR
FT                   LGNPVLHAKTLLPLINPLSEHHTHLHVASSFDAQVIGTEIGKFGQIAKQELSVTYLNDL
FT                   LLAQSVSFIGEAATRAKAEFSPICIDDQKGFMVITQGQQKALSDWLASHDVEITFKPVA
FT                   IIATVGHRVAERGDIRARFKRSLKAAKPLNLVGSDNNHSVIAILPEPCSIELLNTVHHE
FT                   MTKDARHIGLVVAGMGNIGERFLELLPAQLNKVYALENLHLVGLLSSKKALINNDGIDV
FT                   NQATSLFAQEAQSYDHEQLISWLTQNPYDELIVVDITPSEDFSLLYEQMFALGVHVIGA
FT                   NKWAASSSTAHYNNLVNTADSHNSLWLGNTTVGAGLPINYAIDDLRQSGDSISELSGIF
FT                   SGTLSWLFETYDGSSKFSELLLNALAQGITEPDPREDLSGRDVQRKLLILARKAGFELA
FT                   LDDIDCQNLVPEALQALSTSEFLARANELDEYFATALSEANRKGACIRYVARFQHNPET
FT                   GISAKVSLEVLPQSDAFANLTPCDNIFQISSHWYQDNPLIIRGPGAGRDVTAGGLHSDL
FT                   VKICQQLAHKQSQVKIKGIN"
FT   gene            455519..456898
FT                   /locus_tag="CPS_0457"
FT   CDS_pept        455519..456898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26770"
FT                   /db_xref="GOA:Q489P9"
FT                   /db_xref="UniProtKB/TrEMBL:Q489P9"
FT                   /protein_id="AAZ26770.1"
FT                   /translation="MAKDTPHQTHYTRQIHHLLAKVYGRSAVKDSLLDRAVGYFEQEEF
FT                   TPSDEKKSAEESPLKLMERTERHASLLAISLTIIELAEGDSYAENNRKSAQFLGTIQLL
FT                   SPTEGKRVATSNEQSKSIYKALLCLRLLDRLIIDGQMREPYINKFLTDISTEQFIDFAN
FT                   HDAEKYQRFVAQVKVPLVIAALLQDIGNYHPKAQTILCGAEGGLDPFRTLEIKQRKELL
FT                   QINYRETIKYISEGIGIPTFVGNTKAEREQFFLDEKDKLAFIKQLLKSSVNPKNTIGNI
FT                   LKVPQIYTSIILSTKASYNYKLLPKVFQVLNKNAELGACAQSVVDALYKITGMFPQGFG
FT                   VVYMPLGEFGDHSDCYEYAIVNRLYPKNPEQPNCRMATRQLTFIGYGQNSVIKNTSNLY
FT                   FTQTAKKLATLSKERLNEILALLSSNSQERQQLDLLPRCWHANEYFSIKANQNLWNNIE
FT                   S"
FT   gene            456939..458066
FT                   /locus_tag="CPS_0458"
FT   CDS_pept        456939..458066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0458"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:PSPTO2580"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25371"
FT                   /db_xref="GOA:Q489P8"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:Q489P8"
FT                   /protein_id="AAZ25371.1"
FT                   /translation="MTNKVKSKRIAAIDWMRGFVMIIMVLDHVSMAYNKEHLSTDSAAS
FT                   YIIGSPLPAFEFFTRWISHICAPVFVFLAGTALAISVERKLSRGFDSKAIDKDILLRGA
FT                   FIALLDPTITSFFSGKLIFQVLYAIGIAMMCMAFFRRLSSTQLLIIAMAWILGGELVTA
FT                   QFWFAGGQEQSIIVALLIGKYSSADLSISYALVPWLSVMILGWVFGRYILDYGDGKVTI
FT                   SPANLLFRLGFTALAAFIAIRYFNDYGNMFLLREDNSWQQWLHVSKYPPSASFIMLELG
FT                   LMAVILALMIKVEQRIGVRPNGVLLVFGQTSMMFYLVHRIFLTGTATYGGLSDFTNLTN
FT                   TYIISGVLLLLLFPFCIWYRSFKVKHPDSLWLKYL"
FT   gene            complement(458130..459278)
FT                   /gene="argE1"
FT                   /locus_tag="CPS_0459"
FT   CDS_pept        complement(458130..459278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE1"
FT                   /locus_tag="CPS_0459"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="identified by similarity to SP:P23908; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01892"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27015"
FT                   /db_xref="GOA:Q489P7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q489P7"
FT                   /protein_id="AAZ27015.1"
FT                   /translation="MTQLPNFSQSLSQLIACPSISSTQPSWDQGNKEVIQLLATWFEQL
FT                   DFNIEIQAVPNTSNKFNLLAKLGSGEGGLLLAGHSDTVPFDENRWQSNPHTVVNQDDKF
FT                   FGLGTCDMKGFFAFILQVCKNLRADQLKKPLYILATADEETTMAGARFFAKSQAIKPDV
FT                   AIIGEPTNLVPVVMHKGHMSHRISVEGKSGHSSKPNLGINAIEIMYKVIGQLIELKEKF
FT                   QLNYENQAFDVPAPTLNLGAISGGDNANRICGHCHLDIDLRSLPGMSDDELINWLSEAL
FT                   KPLAELYPGRISFEEMHPSSPSFEQKKPSTLIDIAQEISGHSCCAVNYATEAPYIQQLG
FT                   CQTIVLGPGSIDQAHQPNEFLAHSEIDKTEKLLTKMIQHYCL"
FT   gene            459400..460455
FT                   /gene="argC"
FT                   /locus_tag="CPS_0460"
FT   CDS_pept        459400..460455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="CPS_0460"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by similarity to SP:P11446; match to
FT                   protein family HMM PF01118; match to protein family HMM
FT                   PF02774; match to protein family HMM TIGR01850"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28635"
FT                   /db_xref="GOA:Q489P6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q489P6"
FT                   /protein_id="AAZ28635.1"
FT                   /translation="MTKAILDSNNSVQKVAIIGASGYAGAELVGLLYKHSQAHICHLVV
FT                   SENSSSEGKLFSELHGRFQGICDLPLEAFSAAWFDEYAAKLDVVFFATPHEFSADWAQA
FT                   FVEAGVKVFDLSGGFRLKDAADYPKYYGFEHANIDALSSAKYGLAEWQHDEIANTNLVA
FT                   VPGCYPTASLLCLKPLTSNNLVVENSLVVVNGISGVSGAGRNASLATNFNEVSLKAYNV
FT                   LQHRHQPEISQEAAIDVIFSPHLAPYKRGLLATVTLQLKAGVTTAQVQQAFQQAYSDKP
FT                   LVRLVASWPEIGNVAHTPFADVHWQFDEDKQVVVASCAIDNLLKGAASQAVQCFNISLG
FT                   LASEYSLISTC"
FT   gene            460529..461311
FT                   /gene="argB"
FT                   /locus_tag="CPS_0461"
FT   CDS_pept        460529..461311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="CPS_0461"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by similarity to SP:P11445; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27722"
FT                   /db_xref="GOA:Q489P5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489P5"
FT                   /protein_id="AAZ27722.1"
FT                   /translation="MNNPVLKPLVIKIGGAILEKESALNALLNVISQLKNKQVVLVHGG
FT                   GCVVDEMLAQAGFTTEKKHGLRVTPKEQVGLISGALAGTVNKAIVGTANSMDLAAVGLS
FT                   LNDGDMISCTLSTQDLGQVGVPQTNNSKLLDCLLKAKFLPVISSIGALDNGDLVNVNAD
FT                   DAAVAICQLLNAELLLLTDVNGVKDADGEYLSSLNAEQAQKLIEQGVIAGGMTAKVNAA
FT                   LHAAQQLRRSIAVASWQSPEQITQLLDGHGVGTQIQPN"
FT   gene            461364..462305
FT                   /gene="argF"
FT                   /locus_tag="CPS_0462"
FT   CDS_pept        461364..462305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="CPS_0462"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25094"
FT                   /db_xref="GOA:Q489P4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q489P4"
FT                   /protein_id="AAZ25094.1"
FT                   /translation="MSKNIALQQLNNFLADDQLNKSELLALIELAINIKQNPADYSQVL
FT                   AGKSVAMIFEKPSLRTHVSFDMGISKLGGHALYLGQQNGKLGERERVSDYAKNLSCFAD
FT                   AIVARVFSHDSIQGLAEHASVPVINALCDVYHPCQALADFVTLSETYPDLSQVKLAYVG
FT                   DGNNVSNSLMIMAAILGVDFTLISPEGHEAQADIVEKTKELAQESGCQLTLTNDINAIG
FT                   KQDVIYTDTWISMGDEDSSKKAEILAKFAPYQVNHDLMEKAQATMVLHCQPAHLEEEIT
FT                   TKLFDSELSKVFQQAENRMWAQNAVLVALFSK"
FT   gene            462423..463679
FT                   /gene="argG"
FT                   /locus_tag="CPS_0463"
FT   CDS_pept        462423..463679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="CPS_0463"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24202"
FT                   /db_xref="GOA:Q489P3"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489P3"
FT                   /protein_id="AAZ24202.1"
FT                   /translation="MALAKKTIKKVVLAYSGGLDTSAIIPWLKENYDGCEVIAFCADVG
FT                   QGDEELEGVKEKAIASGASECYVVDLKEEYVKEYIYPILKTGSVYEGQYLLGTSMARPI
FT                   IAKAHIEVALKVGADAVCHGCTGKGNDQVRFESCFAALAPELTVIAPWREWDMVSREDL
FT                   LDYLAERNIPCAASLTKIYSRDANAWHISHEGGELEDPWCEPSKEVWTMTVDPMDAPDV
FT                   PEKVQLSFKEGELVGIDGKDFSQHGAGAYEALMYLNEKGSAHGVGRIDIVENRLVGMKS
FT                   RGCYETPGGTILMAAYKGLETLILDKESLKYRESVGLEFSHVIYDGRWFTPLAKAQLAS
FT                   AASFAEKLTGDVVVKLYKGMAQVIQRRSPNSLYSEAFATFGADDVYDQKHAEGFIRLFS
FT                   LSSRITALSQKDSLKDKAE"
FT   gene            463682..465619
FT                   /gene="argHA"
FT                   /locus_tag="CPS_0464"
FT   CDS_pept        463682..465619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argHA"
FT                   /locus_tag="CPS_0464"
FT                   /product="argininosuccinate lyase/amino-acid
FT                   N-acetyltransferase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by similarity to SP:Q9K3D6; match to
FT                   protein family HMM PF00206; match to protein family HMM
FT                   PF00583; match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25821"
FT                   /db_xref="GOA:Q489P2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR011244"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:Q489P2"
FT                   /protein_id="AAZ25821.1"
FT                   /translation="MALWGGRFKGEASVQFKRFNDSLPVDYRMAVQDIVGSIAWAGAIN
FT                   SVGVISDEEHIRLVAALNELKASVEADPEQILLSDAEDIHSWVELQLIEKTGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKETGGDLLFALVNLQQAMMNLAEREKDTVLPGYTHLQRAQPV
FT                   TFGHWCLAYVEMFNRDIGRLKDALYRLDVSPLGSGALAGTAYPIDRNALAHSLGFRTAT
FT                   MNSLDAVSDRDHVIELLASASISMMHLSRFAEDLIFYNSGEAGFVEMSDLVSSGSSLMP
FT                   QKKNPDACELIRGKSGRVFGALTGMLTTMKALALAYNKDMQEDKEGLFDALDTWQECME
FT                   MAVLVADGLKVNRSRTLAAAQQGYANATELADYLVGKDIPFREAHHIVGEVVLAAIDKG
FT                   VPLEDLTISQLKEFSDKIEQDVYQHLSIESTLNKREALGGTSRSQVKKALATTQSGNEA
FT                   ILNEQVVGAPGKQRIEGALKQVKQRLNAQRAAAMSVRRARMSDVDCIHQLTNFWADKGE
FT                   ILPRTRDNIIHDIQNFVVAELDGNVVGTASLYIYQTGLAEIRSVVVQDDAQKQGQGEAL
FT                   VQYLLEFANQMELEQIIVLTYIPQYFEQLGFNVIDKNSLADNIIEDSEPSPHKDPADEV
FT                   AMEYIVGQSK"
FT   gene            465662..466972
FT                   /gene="argA"
FT                   /locus_tag="CPS_0465"
FT   CDS_pept        465662..466972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="CPS_0465"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /note="identified by similarity to SP:P22567; match to
FT                   protein family HMM PF00583; match to protein family HMM
FT                   PF00696; match to protein family HMM TIGR01890"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27406"
FT                   /db_xref="GOA:Q489P1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q489P1"
FT                   /protein_id="AAZ27406.1"
FT                   /translation="MNNSEQNYVKWFRNAAPYINAHRGKTVVLMFGGEAVTHPNFANII
FT                   HDISLLRSLGVKLVVVHGARPQIVDRMQQRGLEENVVSNIRVTDAQTLVAVKDATGSLR
FT                   LHIEALLSTGVVNSPMHGSQIRVSTGNFVIAKPMGVRNGIDYKYTGTVRRIDSDGINMQ
FT                   LDYGSIVLLSPIGYSPTGEVFNLALEDVATQTAISLKADKLIAFTEDEGLIDKSGKLIR
FT                   SCSVRTVKTLLDEKDCHVRQLLLRSIIQSGENGVERCHCVSYQSDTALLQELFTRDGAG
FT                   TLIAKDHKELIATATIDDVAGILELIQPLEEEGVLVKRSRELLEMEIEYFTVLKKEEVI
FT                   IACAALYPYPEAKMAEVACVVIDPDYRKGNRGERIINALELSAKKKGLTSLFLLTTVSG
FT                   HWFLEQGFVEASLERLPEGKKQMYNFQRNSKVFIKDI"
FT   gene            complement(467115..469706)
FT                   /locus_tag="CPS_0466"
FT   CDS_pept        complement(467115..469706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0466"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by similarity to SP:P02918; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912; match to protein family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27165"
FT                   /db_xref="GOA:Q489P0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q489P0"
FT                   /protein_id="AAZ27165.1"
FT                   /translation="MLSIKNLLKVSLILLILVSIAVYSLYLSMRSDLPSVELLKDLHWQ
FT                   TPLQVYSQDGLLISQFGEKKRTPLTLEEVPQQLIDALLATEDDRFYLHFGVDPIGMGRA
FT                   VLGKLMGQDKGGASTITMQVARNFFLTREVTYTRKIREIFLSFHIENLLSKDEILMLYI
FT                   NKIELGHRAFGFGAAAQVYYGKEIHELNLAQIAVLAGLPKAPSTLNPIRSPKRAQARRS
FT                   VVLQRMLVSGYISDLQYQTAKNAPITGKRHGAEIELNAPYIAEMAHNEVLKRYGKDKAY
FT                   TEGYKVFTTVTAKLQTAAEQALVNNLLNYDQRHGYRGPLSSLRPQVRSTDDTSEIQIVP
FT                   LLQKELSKALSDATYYQMLEPAIVLAVEEKSVSIQLRNKVTATIKWQGLAWARPYINDQ
FT                   KQGRPPKTAKDILTYGDVILVSKMTDNNYRLGQLPTASAAIVSLSPNDGAIKAAVGGFS
FT                   FKQSQFNRVTQAKRQVGSNIKPFIYSAALEHGFTLASLVNDAPINQWDKSSGVVWRPRN
FT                   SPEKYVGLLRVRLALAQSKNVIAVRLLKSIGVTNTIKHLTTFGFNANDLPRNETLALGS
FT                   ASLTPLEVATGFAAFANGGFLVEPYLIQRIENSDGEIIYQADPAIACDPCIQTDLSDDT
FT                   DQELDVLSNNIPDHNITIEDEQLSKQSEDDQTVEIKQASRIISPQNAFLITQALNSAIW
FT                   GADWNTKHVWQGTGFRARTLKRRDIAGKTGTTNEAKDAWFSGFSRNIVTTSWIGFDDPR
FT                   HILGQSVYNNNLGKNQTTGKEFGAKSAQPAWIDFMRIALADAEPEAFQPPVDIVSVRID
FT                   KTTGKLTTKTDKTSQFEYFRLGKVPTEYVTEDSSSEILSGGQQKEEEEELF"
FT   gene            469834..470913
FT                   /gene="pilM"
FT                   /locus_tag="CPS_0467"
FT   CDS_pept        469834..470913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="CPS_0467"
FT                   /product="type IV pilus biogenesis protein PilM"
FT                   /note="identified by similarity to OMNI:NTL03PA05045; match
FT                   to protein family HMM TIGR01175"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28245"
FT                   /db_xref="GOA:Q489N9"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q489N9"
FT                   /protein_id="AAZ28245.1"
FT                   /translation="MLDKLWKKKNSMMVGIDIGSHSAKAVLLGQGNEGFIIEDFAIEPM
FT                   PRGSVVDREIQDIEAVGAVIAKLRKKISAKATDAAAAVSGQTVITKLIYMDVALTEDEL
FT                   ASQIEIEADSLIPFPLDEVSLDFETLDVNESDPSKVNVLLSAARTESIEARVAALDAGD
FT                   FHAKVIDVESYAVGRAYDLCLTQLPDDAKDKVVAIVDIGSTVTLFSATDAGKHIYSRDQ
FT                   MFGGEQYTRSIVSYYNKSFEQAEEAKTSNDLPPNYTFEVLAPFHTVLMQQIRRAIQMFL
FT                   TTSGQNKVDYLLISGGTAALEGIESLLTEELGIHTVIANPFNDMSCGESIEQAELANVA
FT                   PQLMVATGLALRSFTPWHI"
FT   gene            470901..471467
FT                   /gene="pilN"
FT                   /locus_tag="CPS_0468"
FT   CDS_pept        470901..471467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="CPS_0468"
FT                   /product="type IV pilus biogenesis protein PilN"
FT                   /note="identified by similarity to OMNI:NTL03PA05044; match
FT                   to protein family HMM PF05137"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28815"
FT                   /db_xref="GOA:Q489N8"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q489N8"
FT                   /protein_id="AAZ28815.1"
FT                   /translation="MAHINLLPWRAAALKAQQKEYFTILAAVGLLTLALVLVINFYYQA
FT                   HIDGQNSKNQYLKNEIAQLDIQIDEIKTLNAKKLALQKRINVVEQLQRSRNVGTQVLDE
FT                   IAKIIPNGIYIIELEKQGNTLQLTGKSESNNHLANMIRAVELSDLFVDATPESITADDG
FT                   SPKLLSSFKMKVKIKGLDDAKKGSK"
FT   gene            471467..472063
FT                   /gene="pilO"
FT                   /locus_tag="CPS_0469"
FT   CDS_pept        471467..472063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="CPS_0469"
FT                   /product="type IV pilus biogenesis protein PilO"
FT                   /note="identified by similarity to OMNI:NTL03PA05043; match
FT                   to protein family HMM PF04350"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26877"
FT                   /db_xref="GOA:Q489N7"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q489N7"
FT                   /protein_id="AAZ26877.1"
FT                   /translation="MKFDASQFDNLELDNIGQWPAAAKLLLAVFLAVMVGFLGYMGLIS
FT                   DQMKELDRVSYEEKTLKESYRAKYHVAANLDLFRAQMVEAEDTFANQLRSLPNSHEIPG
FT                   LLDDITFVGTTSGLDFVKLEWQPEISKEIYIELPIDIEVIGPYHSFGQFVSKIAGLPRI
FT                   VTLHDFKISISQSDSEILNLKLQAKTYRYQEEAAK"
FT   gene            472060..472614
FT                   /gene="pilP"
FT                   /locus_tag="CPS_0470"
FT   CDS_pept        472060..472614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="CPS_0470"
FT                   /product="type IV pilus biogenesis protein PilP"
FT                   /note="identified by similarity to OMNI:NTL03PA05042; match
FT                   to protein family HMM PF04351"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27270"
FT                   /db_xref="GOA:Q489N6"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q489N6"
FT                   /protein_id="AAZ27270.1"
FT                   /translation="MIKVQQISTKIILSLTALTLVSGCFDDTSEIKTHMAQVQATTTNY
FT                   IDPMPEVNPFNHIAYSADDLRSPFVLPRPEAIQQKMQQMAGCLSPDTNRRKQPLEKYAL
FT                   SDLTMRGTLGDASMLWALLEASDLSLHRVALGNYLGLYNGRITQVSAKTVKIIELAPDG
FT                   SGCWVEREATLNIVQSEESNK"
FT   gene            472626..474746
FT                   /locus_tag="CPS_0471"
FT   CDS_pept        472626..474746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0471"
FT                   /product="type IV pilus biogenesis protein PilQ"
FT                   /note="identified by similarity to SP:P34750; match to
FT                   protein family HMM PF00263; match to protein family HMM
FT                   PF03958; match to protein family HMM PF07660; match to
FT                   protein family HMM TIGR02515"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25362"
FT                   /db_xref="GOA:Q489N5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q489N5"
FT                   /protein_id="AAZ25362.1"
FT                   /translation="MLFNKMKNYKGFTAVKELWLLNLFILSVFTLSFSVSAASNDVSIN
FT                   NNELIGISYNTIQSDQIVVVFSFTKNITSLPIVKTSMTPAFVEVTFDANTYGKDLTETL
FT                   INHAGIKGINLDAKTGKVVALISLEKLAVFDVSLNNEKEFSITFNYGESAEIVETLSPA
FT                   GDDFINSIESIDFRLNGDNEGQILVYLKDSMLAADVNDKLGKLNVEFHNTEIIDDLLYK
FT                   LDVTDFGTLVTSIETFKEGRNARLVIDVESGFIFTQKQEENLFILTVKKKPEKAPTYLG
FT                   DTDDFTGRSISLSFQDIPVRTVLQIIADYNEFNLIISDTVTGNITLRLDGVPWDQALSI
FT                   ILKVKGLDKRMQGNILMVAPSDELAAREAQSLQAKQQVEELATLYSEYLQINYAKAAEF
FT                   SELIKNEDTSILSDRGSVSVDERTNTLLIRDTAKSIEDIKRMITILDVPVRQVVIEARM
FT                   VTVKDNMNEELGIRWGVTNTDGEFATSGSIEGASSANGTRGVTTPGVGQVPTIGDGLNV
FT                   NLPVANAAGTIAFQVARLANGTILDLELSALEKENKGEVIASPRITTANQKEAYIEQGV
FT                   EIPYQEAASSGATATQFKKAVLSLTVTPHITPDDKIILDLVVTQDTISDITSGFAPAID
FT                   TQRIGTQVLVNNGETIVLGGIYQQAIISTVSKIPILGDIPYLGWLFRNSSQLNEKKELL
FT                   IFVTPRIVTEHF"
FT   gene            474987..475505
FT                   /gene="aroK"
FT                   /locus_tag="CPS_0472"
FT   CDS_pept        474987..475505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="CPS_0472"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by similarity to SP:P24167; match to
FT                   protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26032"
FT                   /db_xref="GOA:Q489N4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489N4"
FT                   /protein_id="AAZ26032.1"
FT                   /translation="MAEKRNIFLIGPMGAGKSTIGREIADRLHLEFFDSDQEIERRTGA
FT                   DIAWVFDLEGEEGFRKREETVIEDLSEKHGIVLATGGGSVISTNVRNHLSARGIVVYLE
FT                   TTIDKQVARTQRDRRRPLLQTSEEPRTVLENLAVERNPLYEDIADIIVQTDDQSAKVVA
FT                   HKIIERLDF"
FT   gene            475541..476605
FT                   /gene="aroB"
FT                   /locus_tag="CPS_0473"
FT   CDS_pept        475541..476605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="CPS_0473"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="identified by match to protein family HMM PF01761;
FT                   match to protein family HMM TIGR01357"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ23956"
FT                   /db_xref="GOA:Q489N3"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489N3"
FT                   /protein_id="AAZ23956.1"
FT                   /translation="MAILNLDLGERSYPIYIDSGLINKTDLLSSHIRAKRVCIVTNDIV
FT                   APLYLDSLKAKLTDFEVDEVILPDGEAEKNLANFEVIISHLLTLEHGRDTTLIALGGGV
FT                   IGDITGFAAACYQRGIDFIQIPTSLLSQVDSSVGGKTAVNHPLGKNMVGAFYQPKAVFI
FT                   DIDSLTTLPIREFNAGMAEVIKYGILGDKEFFLWLEDNISAIKAGEKQVLAQMIEKCCQ
FT                   CKADIVASDEKESGVRALLNLGHTFGHAIEAEQGYGKWLHGEAVATGMVLAAKLALAMN
FT                   LLEVSEFRRIEKLISAFDLPITAPKNMGFAEFIRHMRRDKKNIAGKLRFIIPTAIGQSE
FT                   IRDDVTQDTLQEIL"
FT   gene            476667..478076
FT                   /locus_tag="CPS_0474"
FT   CDS_pept        476667..478076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0474"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:27360923"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28198"
FT                   /db_xref="GOA:Q489N2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q489N2"
FT                   /protein_id="AAZ28198.1"
FT                   /translation="MSASANSHSTYQTTHRLTESESTLADGSVAISVTARIDYNLRFAK
FT                   QAVLVVGDNTEQYSQLASQFLVSLSNVNHSDTQDKHINVAFVAASSKLNDIQIRCRLIE
FT                   QLFVNTLFDPEKSLAVSVLGFAKQHGESISIVIDHAHALSLQVKYELCQLVTLAKKSKL
FT                   TINVVLFGLTEAAQQLAINKSLFKNKMAIIDAESGQVIGLDDKKMMITKSASPILLWQK
FT                   ISLVSAILLIGAALTWIYLLIAEDANNQAFNIKEQTVLESGTLQSLSSPNVNDISDNEN
FT                   TRQMQKKQKTALLEPSVHASESSDIVQATSEEINQALMTIQSVTPIKKIPAKAGDVLQA
FT                   LAIADNKIDAEVINIQSKETVNQNPAAEITNNYYQSKAKEYENGYVIQIAGFSDERLSD
FT                   RFLSLYPEENLHSYQKQLNGKEFTVITTKAFPNKTEAKSIIQSLPIQLIERKPWVKPIS
FT                   SVINEINTFKR"
FT   gene            478317..479138
FT                   /gene="dam"
FT                   /locus_tag="CPS_0475"
FT   CDS_pept        478317..479138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="CPS_0475"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by similarity to SP:P00475; match to
FT                   protein family HMM PF02086; match to protein family HMM
FT                   TIGR00571"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26836"
FT                   /db_xref="GOA:Q489N1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q489N1"
FT                   /protein_id="AAZ26836.1"
FT                   /translation="MQINMRSPLKWAGGKKRVVGEILKVLPVKGKKRLVEPFVGGGSVF
FT                   LNIDFDEYLLIDMNKDLISLFNIIKNQSTQFIADAQMYFAGDYNHPEKYYELRKQFNES
FT                   NDSYQRSVLFLYLNRHGYNGLCRYNKSGGYNVPFGRYKHPYFPKAELDFFSKKAQKATF
FT                   VQGDFEKAFSQLKSDDVIYCDPPYSPINRTSNFTAYAGNSFTDEDQIRLVACAEKAKQK
FT                   GVATIISNHHVDFTRELYKNADKREFFQVQRSISPKGQGRVKVKEVLALYK"
FT   gene            complement(479356..479532)
FT                   /locus_tag="CPS_0476"
FT   CDS_pept        complement(479356..479532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:PP2374"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26726"
FT                   /db_xref="GOA:Q489N0"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:Q489N0"
FT                   /protein_id="AAZ26726.1"
FT                   /translation="MKNTFKSVAAAFFGVQNESNRKRDFSEGKLSHFIIAGIIAVLIFI
FT                   GCLIAVVSLVMPS"
FT   gene            complement(479564..479881)
FT                   /locus_tag="CPS_0477"
FT   CDS_pept        complement(479564..479881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO0291"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25643"
FT                   /db_xref="GOA:Q489M9"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M9"
FT                   /protein_id="AAZ25643.1"
FT                   /translation="MKKTMSKRIMTNASFTKFKQLSFAFTLTIVLLFTLNKHTASQSIQ
FT                   AKLLSSCMLVESKLPMNHINHPCHITNMSNKSWISWLSGESKSTHLHFLDLVELIHYSF
FT                   H"
FT   gene            complement(479980..480669)
FT                   /locus_tag="CPS_0478"
FT   CDS_pept        complement(479980..480669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0478"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO0547; match to
FT                   protein family HMM TIGR02001"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25068"
FT                   /db_xref="GOA:Q489M8"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M8"
FT                   /protein_id="AAZ25068.1"
FT                   /translation="MKKTLVNIALTSALIAGSLVASSAFAVEGLSANVGATSNYLWRGV
FT                   TQTDDAAAISGGIDYAHESGFYAGTWASNVDFGDDASAELDFYLGFGGELGQGFGYDVG
FT                   YIYYAYPDSAQTDSTNEYDFGEVYGSLSYSYFSVSANYGVNNDDGAEWADSALYISADA
FT                   EIEVAEGLTLALHIGDYSFDDDYKSDDYSDYGVSLSKGGFTFAVSDTDMDNDDMKFTVS
FT                   YSIDIDL"
FT   gene            480988..481662
FT                   /gene="rpe"
FT                   /locus_tag="CPS_0479"
FT   CDS_pept        480988..481662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="CPS_0479"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="identified by match to protein family HMM PF00834;
FT                   match to protein family HMM TIGR01163"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28349"
FT                   /db_xref="GOA:Q489M7"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M7"
FT                   /protein_id="AAZ28349.1"
FT                   /translation="MSPFLIAPSILSANFARLGDDVAKVLAAGADVVHFDVMDNHFVPN
FT                   LTFGPMICKSLRDYGITAPIDVHLMVKNVDTLIPGFAEAGADIITFHPEASDHIDRSLQ
FT                   LIKDNGCKAGLVLNPATPLHCLDFVMDKLDVILLMSVNPGFGGQSFIPTTLDKLRLVKE
FT                   KIKQSGYDIRLQVDGGVKANNIAEIADAGADMFVAGSAIFSQDDYKVAIDEMRAELAKV
FT                   SQ"
FT   gene            481722..482729
FT                   /gene="trpS"
FT                   /locus_tag="CPS_0480"
FT   CDS_pept        481722..482729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="CPS_0480"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by similarity to SP:P00954; match to
FT                   protein family HMM PF00579; match to protein family HMM
FT                   TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27296"
FT                   /db_xref="GOA:Q489M6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M6"
FT                   /protein_id="AAZ27296.1"
FT                   /translation="MTSKPIVLSGCQPSGELTIGNYLGALKQWVNMQSTHECYYMLVDQ
FT                   HAITVRPKAADLRNATLDGLALYLACGVDPEQSTIFIQSHVPAHAQLSWVLNCYTQMGE
FT                   LNRMTQYKDKSQKSEANMNSGLFTYPVLMAADILLYGADRVPVGDDQKQHLELARDIAT
FT                   RFNNLYGDIFTVPDPFIPEHGARVMSLLEPTKKMSKSDTNPGNFIGLLEDPKKVAKKIK
FT                   RAVTDSDEQARIYYNLEEKPGVSNLLSLLSCATGKSVADLVPTYEDKMYGHLKGDVADA
FT                   VVALLEPIQTKFHQYRADTAFLEQVMHSGAEKASARANKVLASVYEAVGFIPRP"
FT   gene            complement(482833..483903)
FT                   /locus_tag="CPS_0481"
FT   CDS_pept        complement(482833..483903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0481"
FT                   /product="FHA domain protein"
FT                   /note="identified by similarity to OMNI:NTL01BL0696; match
FT                   to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25651"
FT                   /db_xref="GOA:Q489M5"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M5"
FT                   /protein_id="AAZ25651.1"
FT                   /translation="MEVGMEVTQRTEDYTAEIEPTKQIKNDDLSLEQGEIIIEEISRNH
FT                   KLLHRHKLKRNEVSIGRNYHNDIILTDPHICPQHLSLKYSQGIWHLNDNNSVNGTLLEN
FT                   NLDKRQDAHQQVINDGDVIILGKSQLRVLFSDHQVSNTIALSPFESLIDLIRHPIAVFI
FT                   SVALFMLIAGNISYLNQQVETNISQLFVSAFSMSLLFSLWPAGVALVSHLTKNEPRILA
FT                   QFGISFVFFILMWFSDLLEEVVAFNSASNSALGLLITLLPILLAFSLFWLNSYIGFHMS
FT                   AKRRIVVAISITALLFGGTYLLQYSKKREFNPHPNYNATIMAPVFLIAPSNSVDDFVKQ
FT                   SNALFEQASEAALEED"
FT   gene            complement(483894..485165)
FT                   /locus_tag="CPS_0482"
FT   CDS_pept        complement(483894..485165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0482"
FT                   /product="serine protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by similarity to SP:Q92743; match to
FT                   protein family HMM PF00089"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28853"
FT                   /db_xref="GOA:Q489M4"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M4"
FT                   /protein_id="AAZ28853.1"
FT                   /translation="MKAFFTLVIILLSSTTFASEQAEEIFAQLTPSLYQIKLIDKASGE
FT                   KSSIGSGFQISEDGIIATNYHVISSYARHPEKYRIEYLDHQGKMAEVELVSVDVINDLA
FT                   LVKRQVEGEMPYFLLSDQKPIKGEKLFALGNPHDLGMIVVPGTYNGLKKESFNERIHFT
FT                   GSINSGMSGGPVVNKSEKVVGINVATSGNQIGFLVPHDKLVKLFNDYNKEAPTDIKQQM
FT                   AEQLLANQNKLMTALLNNTWQSKELAGKAMIPIIEVPFIRCWGDSNADKTDALILAAIA
FT                   NCSLDENTYLSSHFFTGSVEIEFRYMQAKNLSDNKFYHLYQQQIARAGAGNRAGKNDVS
FT                   EYQCHNDLVTPSSTANTNKAINNKSIFCTRAYKDFPGLFDVLYLGASVDKNQQALVSHF
FT                   TIAGVSQENAMAFTGKFMEAVSWK"
FT   gene            485685..486596
FT                   /locus_tag="CPS_0483"
FT   CDS_pept        485685..486596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0483"
FT                   /product="putative beta-lactamase"
FT                   /note="identified by similarity to SP:P14489; match to
FT                   protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26227"
FT                   /db_xref="GOA:Q489M3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M3"
FT                   /protein_id="AAZ26227.1"
FT                   /translation="MKKVISIVSVLALSSFTHQAVASSELCLVSNNDCTFVLISEKKSE
FT                   VMTQVVSETTSEDVNTHHSAKVTQGSSYTEENEMLSVVNEERSKQRLSPFSTFKITNSL
FT                   IALDSKQIASAQQVLTFDKEKYPVKVWWPSVWKLPEYDLTTAFKFSMVPIFRQLATDIG
FT                   QDKMQSYVTKFNYGNHDISSGLDDFWLNGSMKISALEQVRFLQKMHRGQLGVSQHSIDT
FT                   LKEVMLVEKNANYLLYAKTGAGKANSNDKSSKAMLGWYVGFVENDKGVHYFAFNFTRGS
FT                   YAEMKAVRVKIARNHLKKAGVI"
FT   gene            486776..489025
FT                   /locus_tag="CPS_0484"
FT   CDS_pept        486776..489025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0484"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26015"
FT                   /db_xref="GOA:Q489M2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M2"
FT                   /protein_id="AAZ26015.1"
FT                   /translation="MNFTLKPIALAVNLTILGSSAMALPALALPFVANTAQGTIKDIEV
FT                   ITISNQRHNSLVDNQSYAQGKTTEADLANWLASVPGANINSNGPITGIAQYRGLFGDRV
FT                   ATSLDGHPIIGAGPNAMDTPLSYSTPLIVDSMTVYRGIAPVSAGMSTIGGAIDISMRKA
FT                   EVMNSENVQVSGDLQAGYRSNNSASTLSGVTNIATGDVAVLLYGNTQAGDSMESGDGTV
FT                   IEPTDFDKTQAGFDVRHATENNTVGLSYHYTKTTDSGTPALPMDIEYIESRRFNVDGDF
FT                   QLGQWQGEWSVGYLDADHGMTNFLMRAHDPMKKRRNTALADTTDFKFVLNREFSFGELS
FT                   FGVDGYLATHDSVITNPTNAMFEVVNFNNVQDDRFGFFTEWQNQYGQTTVQLGVRVKHA
FT                   ISNADEVSGNMAMNMADMNMDSGMGGMDSGMGDMDSGMGDMNSGMDDMNSAMMPSMGSL
FT                   LSDLEGDFNNADRKVSDTNVDVALSTQTQLSETLSLYVGVGMKSRAPSYQERYLWTPME
FT                   STGGLADGHTYIGDIDLESETAYQADLGLTWQSSDFMIAPHVFYQNIDNYIQGTQLDMD
FT                   DASAKMMASMMAQDDNPLKFSNVDAKLYGADVNWYYNLTDNFQLSGIASYVRGERRDID
FT                   DNLYRIAPLNGQVSVSYHNENVITNLTLVAVSAQDDVSATNTEQATSGYGLVNIDIEYF
FT                   VTADFTLRGGVDNLLDREYQNHLGGYNRVKEVGTPVMDRLPSEGLSAWVEATYSF"
FT   gene            489273..491381
FT                   /locus_tag="CPS_0485"
FT   CDS_pept        489273..491381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0485"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27575"
FT                   /db_xref="GOA:Q489M1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M1"
FT                   /protein_id="AAZ27575.1"
FT                   /translation="MQPYVFTPSLLALLIANTCYASSAETLPDGSAKSDLERITVTATR
FT                   KEALDTDLAMSVHGISEEELQMDNGQHVAESLNSISGVLIDQLSGGQGHKTSIRMPMNT
FT                   SGYYLFLQDNVPLQSAAFFNHNALWWSSFNSNVGRMEVLKGAGTALYGSGAVAATVNIL
FT                   TKPVVEQTETAMDVVLGQEQYGKVQISHSNKLSNTQGIRASASYVTNEGWRDHTASQRA
FT                   EINLRHEYELSANERLITSFTASDLEQEMAASLNDDQIENDRTNSGLSDEVLASDPLRK
FT                   TQYMRLTTQWDQMNEDSYYSVIPYLRHRTNDYTATWNKNMPRVQSTVNTVGLLALANFV
FT                   HTADNETTIGVDFEYTEGDQLSYQPLDFTTTGWGADTFVKGEKFYDDTTSYTSISPYLQ
FT                   HKRTLTKNLDLTLGVRYDYAKYEFTNHLGVYGDIGHGKISLEDRDDDFSHLSPKASLNY
FT                   HLSENTSTYFRYANSFRLPTAGSLYHLTTKDSEVAAPVDPETSDTYEIGYKGNFDNITF
FT                   DAALYFMDVDDGIVHAYNDQGQRYLTNATRVLHKGIELSTLWVINDELNLSVAYSKSKH
FT                   EFDEHDDYSGNEMRMAPDYIANVRLRYLPSYLEGFSSQVELQSVGEYWMDDANSTDPDT
FT                   GLERKDDGYSIVNLKARYQLNSQLSFNARILNLTDKVYAQGGEYRYGKNSWSPGAPRTA
FT                   YMGMSYQW"
FT   gene            491392..492639
FT                   /locus_tag="CPS_0486"
FT   CDS_pept        491392..492639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0486"
FT                   /product="BNR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25548"
FT                   /db_xref="GOA:Q489M0"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q489M0"
FT                   /protein_id="AAZ25548.1"
FT                   /translation="MRILMKNINNRLKLLILVTFILSTGISQQVLAEPMDHSQHQGQKS
FT                   VKQAKTICQKIAVTCGKTVTSAFAPNGDFWRIWSQQDNIYYQISPDNGQNFGIAKAVGI
FT                   AKEKISARNENRPKIAFDSKQGVYLSWASPREKKYTADIRYSYSSDYGKTFSTPITVND
FT                   DGLLTGHSFNEMVVNDEGDVSIVWLDGRLKQRKDAGNGSAIFIASGNMTKAKSQFVNQE
FT                   VVNGTCVCCRLAVDYNQQGKLAILWRHIYGDNIREFAITTLGEQSTPYQVSHDHWKING
FT                   CPHQGGALSIAQDNRYHMVWYNQGDKGKGIFYSYSNDAGKSLSLPLAVGEQAAQAAHPH
FT                   MSERKGVIDIVWTQFTGTEHQLWHQQSTDKGVTFGIARVLATSTKGSDRPFIVQGQNNS
FT                   FVSWHRFQQGHWLNQL"
FT   gene            492636..493166
FT                   /locus_tag="CPS_0487"
FT   CDS_pept        492636..493166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0487"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28212"
FT                   /db_xref="GOA:Q489L9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L9"
FT                   /protein_id="AAZ28212.1"
FT                   /translation="MKRLMWVKTLLFTNVIFLISALLMGTLFISGLVQAEPVGNSSIEF
FT                   SKIRFEQVTQERKGQKWLALLWSVDCPPCMKELALVQKLQQKQKNLAVVIINTDTEESS
FT                   EQKRADIIKHFKLMNLKNFHFTQGQEAQQRYQVDPQWFGELPRSYFIDEQGKFHGKSGL
FT                   IAEEFLTQWLLIL"
FT   gene            complement(493192..493500)
FT                   /locus_tag="CPS_0488"
FT   CDS_pept        complement(493192..493500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28380"
FT                   /db_xref="GOA:Q489L8"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L8"
FT                   /protein_id="AAZ28380.1"
FT                   /translation="MCSTPKPKQKIKGKTSTNVVSILSQMNAEKRKQFAERANEASERR
FT                   EIKKQKAILEQIQVDQNKAHAPLKKKTMTSKPWHYWLISASFSELFQTLFHKNHAMK"
FT   gene            493626..493946
FT                   /locus_tag="CPS_0489"
FT   CDS_pept        493626..493946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0489"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:29609247; match to
FT                   protein family HMM PF04237"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27721"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L7"
FT                   /protein_id="AAZ27721.1"
FT                   /translation="MTDSPDHTQAEHYLLNKPETTLEFPFGEEVKVFKVKNKMFATLAI
FT                   GKMGKGNGNSESSEKEDWWMNLKCDPDEAVMLRDIFPSIIPGYHMNKILSVIIPMMCLK
FT                   GS"
FT   gene            493953..495998
FT                   /locus_tag="CPS_0490"
FT   CDS_pept        493953..495998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0490"
FT                   /product="putative site-specific recombinase"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25515"
FT                   /db_xref="GOA:Q489L6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L6"
FT                   /protein_id="AAZ25515.1"
FT                   /translation="MYRKYAISYIRFSTAEQSLGDSYNRQFEEAERFCFENNIKIVKDY
FT                   KDLGKSAYKSVNLAPESGLNYFLNALKRGEISNPKETHLLVESLDRLSRAQVTTSMHLF
FT                   LGILKQGISILTLADGKVYEQGCELSDIVTSVMMLAKAHQESVDKSYRIGKVWKRKKEA
FT                   ARADAKNKAGTDKKVTALTKMCPFWLKIVKENDRFVYEIKEIEVNTVKLIFDLATGDAI
FT                   DNEVELSISVENTKFSSIEIARILNNENIPIIKSGKRKRTDYWHASNINRIITNKAVYG
FT                   IYQPKLLVKKEYTHHDDFNESYPVEKPYFENDGEAIEEFFPVIISKDKFDRATHQREEK
FT                   FKGKRGKKGKRFSNLFNGLALCRKCQSSMVHSDKGTSKKGKRWVYLQCSNARIKGGCSA
FT                   TSINYSILEYNVLQFVQGTNFSELISNIQLPSVGEISQQQNIIDIVEANLNKISKQFHK
FT                   YMEFDDDNDPDFADEIKLKLIELRKEKRTLNSKWSNEKVKLGNMLTRTSSVNLDEMSFK
FT                   KLIKEIDISNQSKENDDVYFKRQKVNSLLTSLISHVYVDTLRLKALIFYKSNVIQLVDI
FT                   KDEIATGTIFSTVRLPSFKFSSKIESSYQDAFKDAFYDLVMMLIDGKMNMSATSLNESE
FT                   NEGLLNLEKNFSHVMSYPKILADSFKAGGNDFSVKFNEEQYWFEVS"
FT   gene            496127..496261
FT                   /locus_tag="CPS_0491"
FT   CDS_pept        496127..496261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0491"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25143"
FT                   /db_xref="GOA:Q489L5"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L5"
FT                   /protein_id="AAZ25143.1"
FT                   /translation="MMDWYAAIWGDYSDYHQSFKFIIKGLCTLMFIKESLTDHTNAVD"
FT   gene            496519..497004
FT                   /locus_tag="CPS_0492"
FT   CDS_pept        496519..497004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27323"
FT                   /db_xref="GOA:Q489L4"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L4"
FT                   /protein_id="AAZ27323.1"
FT                   /translation="MDGIDSRTIEILDNNYEQGELYNELIICSNALINTKHIFTSEDGW
FT                   HPLVIRKGKIPRVWLSIKHLVSVGSKKEQHYLDLIVDSKLKHPDLSLIASVHGFQIKLG
FT                   EDIIVESGNHKGNILEVYKLDFRPLGLNIHGDHSHLSIGNNNMSNNTSKNSNSMFGI"
FT   gene            497019..498617
FT                   /locus_tag="CPS_0493"
FT   CDS_pept        497019..498617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0493"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:28809629"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26602"
FT                   /db_xref="GOA:Q489L3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L3"
FT                   /protein_id="AAZ26602.1"
FT                   /translation="MSFELNGTNHKFISNECNDLDNKYTFLVGENGSGKTECLVQIINS
FT                   LNRYQLQHEQHEQHRDMLDKHLENRYKSSLVDFKIKSNLVFEKKDEKISISFEKTDAPR
FT                   EIIGFDGKKINLNQNSFRYIYNFKTSATVCNKADYDKESSIIAISESPYNKFPILQSDS
FT                   YFNYYNIGVNTEEKNEYLNHQSDDYVHPKVKQLTMSICGSLSEHHKTNFSHLFRMLGFS
FT                   EKIKFTLKIKDSFKYLNNNSKELAERVVSNRYRDTRFSSVGKNTEKEIESKKNQDKTEI
FT                   IKAIDGLHKLEPNLFTIESNQYHDSMNRELDFDIDFNSYTLMTGYVKTLIEYDVLFVSN
FT                   IYFYNLKFEKQSIDSSRLSSGQLCVLNLIFGISSKILNNSLILIDEPEISLHPHWQSNI
FT                   ISVIHNSFKNYTACHFIIATHSPHIISNVIKNNSSLVLMENSENNNLANDIINTEYGCQ
FT                   GWTVEEILHDIMGMSDTRTDEYHQRIKEFEVAIEQDNYLLAKASFTELDNLLHPNNHLR
FT                   KLLKLDLVSVKSEVE"
FT   gene            498614..499357
FT                   /locus_tag="CPS_0494"
FT   CDS_pept        498614..499357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28377"
FT                   /db_xref="GOA:Q489L2"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L2"
FT                   /protein_id="AAZ28377.1"
FT                   /translation="MIKLERETKPDYLSDEKVFELTESFKATKKSVWNHDHIKIPLLRS
FT                   SHSKCAYCECPLTSASNYMEVEHFEDKNHYPEKVVLWENLLPSCKKCNGAKGQHDVIGD
FT                   PIINPYVEDPKNHLSMRLYRFRAKSDKGQSTIEVTQLNSSDRSVFCRYEIGEKISEMID
FT                   LGFERWNEYLVRNNTRSKNKLVNLVQGLLNECQPTSSYSASTATNLLTDPKFIELMSLM
FT                   READIVSEELDDLILKASTLVLDYV"
FT   gene            complement(500193..500951)
FT                   /locus_tag="CPS_0495"
FT   CDS_pept        complement(500193..500951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0495"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27680"
FT                   /db_xref="GOA:Q489L1"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L1"
FT                   /protein_id="AAZ27680.1"
FT                   /translation="MKKLFGRKQDELGTNNKKKFHLERTNTHTIRDKEGNTIHYEEDVI
FT                   FKTVKNTQPHYFQTYTQHLDGLNTLTKQENNIIRRLADLADFESSIINLNSSIKKQIIK
FT                   TLEIELKTFDNILLILKKKQVLFHLDKSVFVLNPFYFGKGAWTDQLELRKAIKITKTND
FT                   QPYKFDYSNLVIAYKDTPKKTDKVSCVKTDVPISKEQNDNHSSKKINLTFLERLKFVFF
FT                   SSKKYPKLETPLDNKQVNESSPPDNDSKLH"
FT   gene            501285..502031
FT                   /locus_tag="CPS_0496"
FT   CDS_pept        501285..502031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25048"
FT                   /db_xref="GOA:Q489L0"
FT                   /db_xref="UniProtKB/TrEMBL:Q489L0"
FT                   /protein_id="AAZ25048.1"
FT                   /translation="MLKNWTVVTQPIKQKGVGLLKFLRYLVSDDHKNHKGKTTIKPIFG
FT                   NIERFYLKTVLNITKQELHTAKRKKGGRGFNSFAQSVCFSLPPNLPVEITLEQWKLISK
FT                   DIVIELINFLNVSAEEIKDHLFINLHDQDNPHLNMIIGKVINGETRIELQQKSIVRVLK
FT                   HAFNLSVLKRVGLDHCQYQPATKRKKRYKEHYYQQNKQIINTLSECHDNSSPSCQSSLT
FT                   RGTSSQLVPTEQSKSTNIKNNKRRYT"
FT   gene            502031..502576
FT                   /locus_tag="CPS_0497"
FT   CDS_pept        502031..502576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28333"
FT                   /db_xref="GOA:Q489K9"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K9"
FT                   /protein_id="AAZ28333.1"
FT                   /translation="MKNLKLIKDISEKLASENDYNLVKNNWILKEVDILVDIDPRFEDL
FT                   FEKAKCFKPSVLSDYINDSFKEELLFYSRDKKNPPQLQILRNVKDCCELPDFNLYHYLK
FT                   AGFSVKEALLHCYNHRYVKHKFIRWDKDITAGIEYLISENMVLCDCLKKHSNGNREKKN
FT                   RTGSTKMQTLKPKPNFLI"
FT   gene            502587..502949
FT                   /locus_tag="CPS_0498"
FT   CDS_pept        502587..502949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0498"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SF0469; match
FT                   to protein family HMM PF04237"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24904"
FT                   /db_xref="GOA:Q489K8"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K8"
FT                   /protein_id="AAZ24904.1"
FT                   /translation="MMEFENLKKYILSKPESTLEFPFGEDTSVFKVKNKMFALVGERNN
FT                   LMMMNLKCDPDEGAALRDIYPAITEGYHMDKKHWISIYFDSSVPENEVLRLIDNSYMLV
FT                   VSKMTKKDQESILIKI"
FT   gene            complement(503008..504321)
FT                   /locus_tag="CPS_0499"
FT   CDS_pept        complement(503008..504321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24264"
FT                   /db_xref="GOA:Q489K7"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K7"
FT                   /protein_id="AAZ24264.1"
FT                   /translation="MEILPKSAYFGNLEIFHVYEYYEGPKLFSAVNGVGTYYIAFWIGS
FT                   NDDGDEWLYAPVSDQRLIELEQSKIKLRDVFIYPNDLVFKVETYFNEDITSQVQQYSAS
FT                   QLTDEILPPSTFYIELTDNLSKSFQVEDGEDVTELYIKRFAGRLAPNLASISKVADAFS
FT                   SLYLEILKSLKIRNKSLTPLDARPGSFILRLKSPNIKECLPVIKTIFNILNEEQNPFPK
FT                   LLELNIDVSTIETLLEEVIDGKVKIQFGLAEKFEAELNISKEKALESLEQLKEQSSSLI
FT                   SSLLVPQANNLSKIFHAVELKSEGRFITPSLLNLTTERQVAYYLHAARTLGLLSKNNAI
FT                   NSVGYQFSTMSYAQKMNIVAIRFESSDCGWAWLKWSNKKSVDELDPSTATAFLIEKCPS
FT                   LSKNTAERRAKTLSMWQRELKPFRTMTSVSEQIIQPTD"
FT   gene            complement(504321..504704)
FT                   /locus_tag="CPS_0500"
FT   CDS_pept        complement(504321..504704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26274"
FT                   /db_xref="GOA:Q489K6"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K6"
FT                   /protein_id="AAZ26274.1"
FT                   /translation="MADWPEFYPENTPPSKAVATEGTSFRLVNEHPPTRGDFRSTYEEY
FT                   PNRKFNQSAIANACGTSQFRELKDIQKKRQLFPPLRNKKIAVGELVPTLGLTMKTFEPT
FT                   HHTVWYLKSAQPQIIFEVLKEEI"
FT   gene            complement(504750..505442)
FT                   /locus_tag="CPS_0501"
FT   CDS_pept        complement(504750..505442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0501"
FT                   /product="hemagglutinin associated protein"
FT                   /note="identified by similarity to PIR:S37734; match to
FT                   protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25972"
FT                   /db_xref="GOA:Q489K5"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K5"
FT                   /protein_id="AAZ25972.1"
FT                   /translation="MDSNFIISQSDAVDFLKSLPDESLDLVITDPPYESLEKHRKIGTT
FT                   TRLKHSKSSSNNWFEIFPNSRFEELFIEIYRTLKNNTHFYLLCDQETAFIVKPIAESCG
FT                   FKFWKPIVWDKMKIGMGYHYRARYEFILFFEKGKRKLNNLAIPDVLQVPRVYRGYPTEK
FT                   PVALMDILIEQSTEKGFLICDPFMGSGSVGVSALSLSRKFYGNDLSIDSLNHTIDRIKN
FT                   IEETPDTC"
FT   gene            complement(505614..506699)
FT                   /locus_tag="CPS_0502"
FT   CDS_pept        complement(505614..506699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01RC0850"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27219"
FT                   /db_xref="GOA:Q489K4"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K4"
FT                   /protein_id="AAZ27219.1"
FT                   /translation="MKNILKNIEHSSLFYIIELLTKVSIIFAIIGWFISYPERTRQNIL
FT                   NAYSTIYSAQEYKGNAGRKEALQTLANHETYIAHLSIKNAILKGLVLKNMQLFKMDFTL
FT                   SSFDDVDISNSEFTYSKFNSVIAQDHDVPRGMTSIGITAINTKFYRGEFNATELQGNFN
FT                   KAKFYNASFGSTKFRGSFKNTELNGTLFQLSDTYCSEIPKDSYCNDGTPTIDSSDFTDA
FT                   NMNGLKIWHLYSNNSDYSNAKFDKIDGRILNEGEEKENSIQFDGDKFINTEFKHARLTG
FT                   VTFNNSIFKGAKFYYISYMNVDFADSDMSNAEFYEANLTYTKISKTQLDSAYVCRVELP
FT                   DKSYLDRDCDYFKNKYGDVIY"
FT   gene            complement(506712..506807)
FT                   /locus_tag="CPS_0503"
FT   CDS_pept        complement(506712..506807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26443"
FT                   /db_xref="GOA:Q489K3"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K3"
FT                   /protein_id="AAZ26443.1"
FT                   /translation="MQMVILLIKIKQDVKYYTKKGSAIFFSFLGK"
FT   gene            506802..506903
FT                   /locus_tag="CPS_0504"
FT   CDS_pept        506802..506903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0504"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28355"
FT                   /db_xref="GOA:Q489K2"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K2"
FT                   /protein_id="AAZ28355.1"
FT                   /translation="MHSYLVLLSDDVLLPASKELIKLTPCEPAPMVL"
FT   gene            507044..507205
FT                   /locus_tag="CPS_0505"
FT   CDS_pept        507044..507205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:29896478"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28098"
FT                   /db_xref="GOA:Q489K1"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K1"
FT                   /protein_id="AAZ28098.1"
FT                   /translation="MGIIYLDIKRLWNTIILDGSIPQGEIERMIDNSFKLVVSQMTKKD
FT                   QQSILIHF"
FT   gene            complement(507211..508845)
FT                   /locus_tag="CPS_0506"
FT   CDS_pept        complement(507211..508845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0506"
FT                   /product="putative sucrose phosphorylase"
FT                   /note="identified by similarity to SP:P33910; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25551"
FT                   /db_xref="GOA:Q489K0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033746"
FT                   /db_xref="UniProtKB/TrEMBL:Q489K0"
FT                   /protein_id="AAZ25551.1"
FT                   /translation="MRLSSEVVVVKPFTNQWSEEDIILITYGDSIIKADQPPLQTLKHF
FT                   LDTTIENTINSVHILPFFPYSSDDGFAVIDYSSVNESLGTWQDIEDISKDYHLMSDLVI
FT                   NHCSSRSAWFDNFVKGEGQGSDYFFTALPDDNLTDVVRPRTSPLLKEVETGNGKKFVWC
FT                   TFSHDQVDFDFRNPEVLAAFTSIIRQYLDIGVKIFRLDAIAFLWKVTGTTCINLPETHE
FT                   VVRLLRTLIESAEPQAIIITETNIPNTQNLTYFGNANEAHGIYNFSLPPLLLNTLLTGN
FT                   CLYLKRWLMSMPPSQDGTLYFNFIASHDGIGLRPAEGLLSENELDTLVHTVENFGGKIS
FT                   WRTSDTGEQKAYEMNISLYDAMQGTVDGKDQWNFERFICAHAIMFALEGIPGIYIHSLL
FT                   GTQNDYQKLANTHHNRSINRRRWQENALEEALANKSLHHARVLSTLKSLLNTRIKQPAF
FT                   HPNATQFTLHLGLQLFGFWRQSQDRKQSIFCVSNVSDQPITLPLSELNLIITESWFELI
FT                   SKKEITELTQKILLTPYQTVWISNVIT"
FT   gene            complement(508992..510218)
FT                   /locus_tag="CPS_0507"
FT   CDS_pept        complement(508992..510218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01HS00220"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24938"
FT                   /db_xref="GOA:Q489J9"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J9"
FT                   /protein_id="AAZ24938.1"
FT                   /translation="MADFYQNGTVTTLHNLAQREPADMADELLTFSKTRSLGLMLPSLF
FT                   SELEGQALPDIINKVKEVKYLSEIVIGLDRADLEQYKHALSFFSQLPQHHRVLWNDGPR
FT                   LQAIDAKLQALGLAPKELGKGRNVWYCMGYILASGKAESIALHDCDILTYERDLLDRLL
FT                   YPVANPLFNYEFSKGFYARVADGKINGRVSRLLVTPLIKALKKTVGHCDYLEYMDSFLY
FT                   PLAGEFSFRRDVLNDIRIPSDWGLEIGVLSEMYRNYSPNRICQVDIASTYDHKHQDLSL
FT                   DNSAGGLSKMSIDISKAFIRKLATQGETFTAEKFRTLKATYYRIALDYVETYRNDAMMN
FT                   GLKLDIHNEEKAVEMFAENILTAGSTFLEHPMETPFIPSWNRVVSAIPDILSQLKEAVE
FT                   LDNEEFSKK"
FT   gene            complement(510211..511074)
FT                   /locus_tag="CPS_0508"
FT   CDS_pept        complement(510211..511074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0508"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="identified by match to protein family HMM TIGR01484;
FT                   match to protein family HMM TIGR01486"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26190"
FT                   /db_xref="GOA:Q489J8"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J8"
FT                   /protein_id="AAZ26190.1"
FT                   /translation="MRKLKTLIFSDLDGTLLDHFTYQSTAADKTLQQLESAEIPVILNT
FT                   SKTLAELEIIHHDLNLKTPFIIENGAAIYIPINTFKTQPAGTVVIDHYWVKPFSLPRQY
FT                   WINLLAKHTDEFSQYYQGFSALSASELCNITGLNLAETERAKQRQFAEPLHWLGDEPTK
FT                   KVFIDRLINLGVNVVQGGRFIHVGDFCDKGQALIWLTERYREHFDNVSIFTIALGDGEN
FT                   DITMLEAADIAVQVRSPVHDFPTLYRQYKTTQTQLYGPEGWAEAIQKLLANQLLSPSIN
FT                   SGVNHG"
FT   gene            complement(511071..511952)
FT                   /locus_tag="CPS_0509"
FT   CDS_pept        complement(511071..511952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0509"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:CC2910"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27016"
FT                   /db_xref="GOA:Q489J7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J7"
FT                   /protein_id="AAZ27016.1"
FT                   /translation="MVSTFIKQHNLPEEFKLAVNEYYIPLADQIFNRFTQNKEAYFVGI
FT                   NGCQGSGKSTLTDFIASYLTTQYQLNVVVMSLDDFYFSSEKRRTLAQGIHPLLATRGVP
FT                   GTHDVVELNHVLTQLKEKKTGFSIQKFNKATDNPYPEKQWPTIEKTADIIIVEGWCWGV
FT                   EPQTVEQLKAPINELECQYDKTGQWRDYVNQQLKIAYKPLYKKMDFWLALQAPSFDCVY
FT                   KWRLEQEQKLKDRNIGLVNSKIMSPAEILNFTQYFQRLSVQGCKTFSQSADAIFYLDYD
FT                   RKITKMSITESV"
FT   gene            complement(512255..512374)
FT                   /locus_tag="CPS_0510"
FT   CDS_pept        complement(512255..512374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25099"
FT                   /db_xref="GOA:Q489J6"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J6"
FT                   /protein_id="AAZ25099.1"
FT                   /translation="MPYKSEHSNLILLMISFSNSLFENLTMLKAFINRNDLLQ"
FT   gene            complement(512644..513333)
FT                   /locus_tag="CPS_0511"
FT   CDS_pept        complement(512644..513333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0511"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25881"
FT                   /db_xref="GOA:Q489J5"
FT                   /db_xref="InterPro:IPR022134"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J5"
FT                   /protein_id="AAZ25881.1"
FT                   /translation="MDCKNCQTKLQETAHFCLKCGQSTASLNRPFFVVAKDILHELLDI
FT                   DGRLGFTLRTMLSKPGQLTLEFNQGKRVKYTPPLRLYLAISILFFILLSSIYQVYDPNY
FT                   ALTDSMSSYYSKAMFVLFPVFALIVQLFFRQSFYIGNLVFSMHLHSIIYLMLMIIAPLE
FT                   ALEQSHLIFLLLQAPPTLYLIWYVFSAFKTVYQQSWWRILGKASAIYLIYMSILGIVFD
FT                   VVMKNIF"
FT   gene            complement(513572..514093)
FT                   /locus_tag="CPS_0512"
FT   CDS_pept        complement(513572..514093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0512"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:NTL01MM2874"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28343"
FT                   /db_xref="GOA:Q489J4"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J4"
FT                   /protein_id="AAZ28343.1"
FT                   /translation="MRILLFCLTLLLITGCTKNYANKTIEGKTFPSVTGQNLEQKMVSI
FT                   PNDFTSDFTLLLVGYKQNSQFDIDRWLIALDMTETNVDVYEIPSIQGLFPRMFSTMIDN
FT                   GMRKGIPKELWKGVITVYKDGESIQAFTGNEKPNNARAILLNKDGVILYFYDDGFSVAA
FT                   LNNLRSRLGS"
FT   gene            514677..515177
FT                   /locus_tag="CPS_0513"
FT   CDS_pept        514677..515177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:CT2083"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ23983"
FT                   /db_xref="GOA:Q489J3"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="InterPro:IPR039131"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J3"
FT                   /protein_id="AAZ23983.1"
FT                   /translation="MKKSTVLITFDNERSLDEWRVTNDSVMGGLSVANTQLDNKVFVFS
FT                   GNISIENYGGFTSIFKKLPTLPDDIESITIKVLGDGNRYQLRVRSQVAGYELAYKIDFD
FT                   TKKGEVEDHTFNLTDFKASFRGRIIENAPLLEAESISHVGFLIKANQRQHFSLSVQAIK
FT                   FMG"
FT   gene            515198..515413
FT                   /locus_tag="CPS_0514"
FT   CDS_pept        515198..515413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0514"
FT                   /product="tryptophan-rich conserved hypothetical protein"
FT                   /note="identified by similarity to GP:28809962; match to
FT                   protein family HMM TIGR02450"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27200"
FT                   /db_xref="GOA:Q489J2"
FT                   /db_xref="InterPro:IPR012663"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J2"
FT                   /protein_id="AAZ27200.1"
FT                   /translation="MNKVSPKALMHSKWTKMSVDNQEKHFVITKVIFDDKQRVIECVIE
FT                   AVISHNEYPINWRDLKNSLHWKIGWQ"
FT   gene            complement(515361..515534)
FT                   /locus_tag="CPS_0515"
FT   CDS_pept        complement(515361..515534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0515"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28040"
FT                   /db_xref="GOA:Q489J1"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J1"
FT                   /protein_id="AAZ28040.1"
FT                   /translation="MLKIRSLMEKQAFLIGKAKISRGDKFVDVIFNTLLRRLLYFIATL
FT                   FSNEDYFLNHAN"
FT   gene            complement(515464..516198)
FT                   /locus_tag="CPS_0516"
FT   CDS_pept        complement(515464..516198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0516"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25575"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q489J0"
FT                   /protein_id="AAZ25575.1"
FT                   /translation="MTNKATLIVGANSDIAKALALKIINSEYPQLIIVSRDITFYQQAL
FT                   FSQAILIETASYNDEDIGKVADTIKQIGARDISRVFICHGVLHSKSYQPEKRLEDFSAE
FT                   AFIKVINANTITPMLWLKHLTPLLASQHRCKIIIFTARVGSISDNKLGGWYSYRSSKAA
FT                   MNMLIKSAAVELARRAKNIKLISFHPGTTDTPLSKPFQANVPQGKLFTCEFVAKQLLTI
FT                   VEDTVIDGEASFLDWQGKDIPW"
FT   gene            complement(516188..516598)
FT                   /locus_tag="CPS_0517"
FT   CDS_pept        complement(516188..516598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0517"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO0771; match to
FT                   protein family HMM PF04134"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27586"
FT                   /db_xref="GOA:Q489I9"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I9"
FT                   /protein_id="AAZ27586.1"
FT                   /translation="MKDNILTIFYDGHCPLCTLEMQKLKHYDSKNLIVLEDLHQENFTM
FT                   LFPEIDNDKAMKILHGQYQGKTLLALDVTHRAWTLVGRGAFVVPLKLPIIKQLAHAGYL
FT                   LLAKYRHPISNCLYERFGIGINTCDKGTCYDK"
FT   gene            complement(516631..517089)
FT                   /locus_tag="CPS_0518"
FT   CDS_pept        complement(516631..517089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:EF0357"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26810"
FT                   /db_xref="GOA:Q489I8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I8"
FT                   /protein_id="AAZ26810.1"
FT                   /translation="MRPDNGSRHTLDNIICTKCYTINQVSAKFYNSAHQSSARYEKTQS
FT                   EFTQLGFSEHYLGNIKAPFVKESRLKYAVKLKEIMPVSLNDTLFIIGEITHIICDKVAI
FT                   KDDGYIDIEALETVTVSGLDSYHKSERLTRLSYAKPESFATDISLNGT"
FT   gene            517420..517593
FT                   /locus_tag="CPS_0519"
FT   CDS_pept        517420..517593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27331"
FT                   /db_xref="GOA:Q489I7"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I7"
FT                   /protein_id="AAZ27331.1"
FT                   /translation="MVGIITLKVVIEAALGVKIVDEKGRQVDSKCWVLIVLKSSENDFF
FT                   ITEILYLGIMTR"
FT   gene            complement(517662..518525)
FT                   /locus_tag="CPS_0520"
FT   CDS_pept        complement(517662..518525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:27352037"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28243"
FT                   /db_xref="GOA:Q489I6"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I6"
FT                   /protein_id="AAZ28243.1"
FT                   /translation="MANFYSTEVEIICVDQYAIAATIYTPQEALKGAILIGPATGIQRQ
FT                   FYASFAAFLAEKGYGVITFDNRGIGGSLIGNVSESDASLQCWGEKDMPAVLEQLKTTFP
FT                   NTKYHLIGHSAGGQLVGLMHNAKDFTSIFNFASSSGQLKNMNRTYAIKAHFFMNFFIPL
FT                   SNTLFGHTKSQWLGMGEPLPKVVAQQWREWCNSEGYVKASFGKTVHTHLYDDLSTPSMW
FT                   VNAADDEIAIDENVEDMLSVFTKINAETLTLSAGDYALDEIGHMKFFSRKSQVLWIHTL
FT                   NWLEKY"
FT   gene            complement(518656..519522)
FT                   /locus_tag="CPS_0521"
FT   CDS_pept        complement(518656..519522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0521"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:CC2910"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28804"
FT                   /db_xref="GOA:Q489I5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I5"
FT                   /protein_id="AAZ28804.1"
FT                   /translation="MLSDFIKQHKLPEEFRLTVEEHYKPLADRIVRLFNKKSNAYFVGI
FT                   NGCQGSGKSTLTDFIAEYLIAQYQLNVVVMSLDDFYLSSTKRNQLADDIHPLLSTRGVP
FT                   GTHDITALNRVLSQLSEHRTGFSIPKFNKAIDEPCPQSQWISVEKPVDIILLEGWCWGV
FT                   TSQTDEQLQTPINDLELQHDAEGEWRSYVNQQLKTGYEPLYKKMDFWLALQAPSFDCVY
FT                   QWRLEQEQKLQAKNIGLSHSKVMSPAEVLNFTHYFQRLTVHGSNTLSNSADAVFHLDNT
FT                   RHIIDIP"
FT   gene            519766..520026
FT                   /locus_tag="CPS_0522"
FT   CDS_pept        519766..520026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24041"
FT                   /db_xref="GOA:Q489I4"
FT                   /db_xref="InterPro:IPR021432"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I4"
FT                   /protein_id="AAZ24041.1"
FT                   /translation="MTNNILKYKDFLYIFNLIQTKGTKLGGEYEFLGIRAQHDFDGYTC
FT                   WLTYKDLTITLLFHSKFDVQFDKKETFNEFYKKVNSLIALN"
FT   gene            520083..520694
FT                   /locus_tag="CPS_0523"
FT   CDS_pept        520083..520694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0523"
FT                   /product="hydrolase, HAD-family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24565"
FT                   /db_xref="GOA:Q489I3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I3"
FT                   /protein_id="AAZ24565.1"
FT                   /translation="MLTHKLLGVIFDLDNTLVSSSLNFDNIRKALGCSKNIDLLNFVDS
FT                   LPKQQRIDAHQVLVDYEINDANSASKLAGTDELLALLSKLSIPCAIVTRNCKQAALIKL
FT                   NNNNIDVPILLTREDHKAKPAPDALLHLAQYWNTPPENLLYVGDYLYDLQAAQNANTMS
FT                   CLVTYAKALSYAGLADIVVDDLSELCDVIKQNMRVLLAIP"
FT   gene            520948..521718
FT                   /locus_tag="CPS_0524"
FT   CDS_pept        520948..521718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0524"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25423"
FT                   /db_xref="GOA:Q489I2"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022484"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I2"
FT                   /protein_id="AAZ25423.1"
FT                   /translation="MSEYSIAKHFNKYFKIRFADTKALRQAAFNIRYGVYSSELGWEPE
FT                   NELKIETDAYDDYAFHCLLEHRRTGTFAGCIRLVIPPVSQPNFQLPFEKNCLHSALPEI
FT                   IDSTTLKRGSFGEISRLAVLASFRRREKEKSKPFIINEINPETVYTEDERRNFPNIAMG
FT                   LYLAGLSLASLCNHVGLFVMMEPRLNRRLTRFGLPFEQAGEAMDYHGQRAMFYLEKEGF
FT                   SLNLTEELKDLYTIIHNDICQQISFIPYTNPAEK"
FT   gene            521663..522481
FT                   /locus_tag="CPS_0525"
FT   CDS_pept        521663..522481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26012"
FT                   /db_xref="GOA:Q489I1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022484"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I1"
FT                   /protein_id="AAZ26012.1"
FT                   /translation="MIFANKYHSYLIPIQRKNNGNLTMNHPFDFKIRFADTKSLRQVAF
FT                   KIRYGVYCTELGWEPENELEMETDVYDDYAFHCLLEHRRTGAFAGCIRLVIPPVNHPNF
FT                   QLPFEKNCLHSARPEIIDSTTLKRGSFGEISRLAVLASFRRRKKEDHTPFIINNIDPKN
FT                   FYSEDERRNFPNIAMGLYLAGLSLASMCNHVGLFVMMEPRLNRRLTRFGLPFKQAGDKT
FT                   DYHGRRAMFYLEKEGFSSHLTEELKDLYIIIHSDLCQQISLSPYTNLVDR"
FT   gene            522537..524189
FT                   /locus_tag="CPS_0526"
FT   CDS_pept        522537..524189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0526"
FT                   /product="FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26639"
FT                   /db_xref="GOA:Q489I0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016170"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q489I0"
FT                   /protein_id="AAZ26639.1"
FT                   /translation="MSDCISYIKTAIGNNATLITQADELIPYHRGTEGLEGKTNIIAVV
FT                   KAYDKKDVESLLLLANELANQPEFKFTIYPISTGLNWGYGTSQPPKLDIKVVILDLSGL
FT                   TQIEFDEDLGLVTVEPGVTQQLLSDFFISNGDNFMVPVTGAGPNASIVGNAIERGYGIT
FT                   PYTDHFGAVTAVQGYWANARHFCSAVNELDKSHNKTVDKTFKWGLGPYLDGLFTQSNLG
FT                   VVTQMSIRMARKPQKFISFIMQVPDDKALEIAIPLIRKILRDYEGIVGSINLMDKRRVL
FT                   SMFAENPNPGEHKVMSPTDIAKLSKAQQTPSWTIMGSIYGSNGVAKTVKKEIKRIFKAL
FT                   PCRQIFSDSPIFSIGNAVINTTPNFLFKLAPFLALIKEQLASFERGKEIMLGRPNNIAL
FT                   KLAYWRHKNAKRFPADNLSPGKDGCGVLWYAPLVTMKPNIMREYVDFIRATCPKFNIEP
FT                   LITFTNLKHDCVDSTIPILFDLSDPDAVKDAHNCLKELVLEGVKLGYIPYRLNIDQQQW
FT                   LLDANSPFWHTVNDIKSVVDPNNILSMGRYNPR"
FT   gene            complement(524311..525111)
FT                   /locus_tag="CPS_0527"
FT   CDS_pept        complement(524311..525111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28401"
FT                   /db_xref="GOA:Q489H9"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H9"
FT                   /protein_id="AAZ28401.1"
FT                   /translation="MKKLMIAGTIAGTMILSSFAASAAVVTAGGIQWDDTTTHAGGVAM
FT                   QSNFQQWFTNSATGMANGVDTIITDDAVLGAAGAELVGIGEFYSFADGRDPAGPPSFCV
FT                   TAGCELTYAFGGLIATGVNTFNSDNAWLNIYIDQSPDFDSNTATDTTLSSTAHEKFAEA
FT                   QNGTLWASYTFDFFDLDGTLLGGETEFTLSVVGGLAMGTLDYNNMPFGDLGNTATARFN
FT                   NDNSLYSFDGNGQHASFQVPEPTSLAIFGLGLLGLAGAARRKQA"
FT   gene            complement(525408..528161)
FT                   /locus_tag="CPS_0528"
FT   CDS_pept        complement(525408..528161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0528"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24949"
FT                   /db_xref="GOA:Q489H8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR014266"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H8"
FT                   /protein_id="AAZ24949.1"
FT                   /translation="MNDSTMKCIKLAAIVCIAIGLSACSEQKTTQEYILASKVYLQKLE
FT                   YGAAIVELKNAVRQTPKDAEARYYLAKAYSEQGSYVNAEKELDKAEQFGLEMNLLLPDL
FT                   VFIKSKLNKVEEVYALMENVESLNDEQYIVVLTYAGITALNNKELERAQDFIAQANTIS
FT                   ETSLYSKMGAAYLLHAEDNFSKGIEIIDTVLGESPDFTEALLLKGHLLFSSEQFIQANG
FT                   VYTKYRQLHPFANKVLFFEVNSLISAGEYEQADVKATELIKRFKNSPLAHQYKAQVEYQ
FT                   KKNYEDARSYAISAAQQGNEFIISKLIAGMSSYQLGDIEQAYGYLNQTEKYLPSSHPIK
FT                   RILASIKIKLGYTTEGIVQLSALEGLTTSDAGLFQSSSIELIKAGDFENAIKLLDKASI
FT                   IAPENASVAAQKGMLKLSQNDKTGIASLEHALNLDPNLKDVEFSLAIQYLDNGQEKKVR
FT                   SIAKKWIASQDNQASGYLLLGIIHSNNNLSSKAEENYQKALSIEPENYTALFYLADIAE
FT                   DADRILDAVDYYQKVVTILPEHKAAIQKLSRLQLKHNNTSNNVEFLSTLAAKHPKNITL
FT                   ALGLAQNLRLNNELKKAITLLESMSDWARSSQQYWAILGDNYLQAKSHTKAKECFKKVL
FT                   ALNPNNFVAHLRLIAISEVKRNYKQALTYTISSLERFEHNTRLLILKANFELLTGDLVS
FT                   AKKTLRYLQEQKVSHHLINKFVGELALADKDYPSAIDNFHELYQKSPTALNVMLLARAL
FT                   SFNGQKAEAAQTIESYLSRMIKDHKVRLLLAELYMQFDEAKAIKHLEIINQSEQNNAVV
FT                   LNNLAMLELKRARPEQALLYAEKAFELKSGIHQISDTYGAALVTVKNFDSAIIVLLNAI
FT                   NQGSEAETTYVNLTKAYLATGKTDKVKALLDSIKDRTFYSKVQAMR"
FT   gene            528547..528645
FT                   /locus_tag="CPS_0529"
FT   CDS_pept        528547..528645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24266"
FT                   /db_xref="GOA:Q489H7"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H7"
FT                   /protein_id="AAZ24266.1"
FT                   /translation="MLMLQRLIDYFLATQMKGKPRYDHLERRYKKK"
FT   gene            complement(529113..529328)
FT                   /locus_tag="CPS_0530"
FT   CDS_pept        complement(529113..529328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0530"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26379"
FT                   /db_xref="GOA:Q489H6"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H6"
FT                   /protein_id="AAZ26379.1"
FT                   /translation="MKPYTFAKTVSPLKIVARNILNLSSLILLVNTATYRHQISALLAK
FT                   ILGLPNTQCISGICYDNSTNTEHRRK"
FT   gene            complement(529237..530109)
FT                   /locus_tag="CPS_0531"
FT   CDS_pept        complement(529237..530109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0531"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25659"
FT                   /db_xref="GOA:Q489H5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H5"
FT                   /protein_id="AAZ25659.1"
FT                   /translation="MINLVWLKTFCSLVDIGHFTQTAEKLFMTQSGVSQHIKKLEQHLD
FT                   TFLLVREGKSFSLTDAGDKLYQQGQILLRSSEEIEASIKHDDPLIGTVKITTPGSVGLK
FT                   LYPQLLDIQQSHPTLVIDYMFAPNSSIEQDLIDRKVDIGLLTEQTKSSTLMSTPIAVEP
FT                   LVLVTSKQTQVINWQTLIALGFIGHPDAEHHTQQLLSENYHEFEHINQFERTGFSNQIS
FT                   LILEPVSRGLGFTVLPLHAVNAFHKQDDIAVHFLKHTVNETLYLCQNSLSFENSRTQYI
FT                   KSLIIDFIS"
FT   gene            530204..530704
FT                   /locus_tag="CPS_0532"
FT   CDS_pept        530204..530704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0532"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25860"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR019883"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H4"
FT                   /protein_id="AAZ25860.1"
FT                   /translation="MSKAYPRTFSHIGISVPSVEKAVKFYTEVLGWYLIMEPTEIEEDD
FT                   SPIGEMCTDVFGANWGKFKIAHMSTGDRIGVELFEFKNQENPENNFEYWKTGVFHFCVQ
FT                   DPNLEELVEKIVEAGGKKRMAEPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELTYAA
FT                   GAY"
FT   gene            complement(531016..531546)
FT                   /locus_tag="CPS_0533"
FT   CDS_pept        complement(531016..531546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0533"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25335"
FT                   /db_xref="GOA:Q489H3"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H3"
FT                   /protein_id="AAZ25335.1"
FT                   /translation="MEYALQEVKTQAKKLLKALKLDPSLVRAMQIPLKKIAISSPEALQ
FT                   LKHCLGLVSMELGFKDWHEAQQLLSGSKSQLMMINMGSFFYPKGCGGFINEWFADYSQA
FT                   RNTLVNSPTSKWLLPYKNQFIVVEKDYIEVFKLDKALLSSWAEIEHDMVASYNSVAWDK
FT                   ITCAVIRNRLKDY"
FT   gene            complement(531556..531798)
FT                   /locus_tag="CPS_0534"
FT   CDS_pept        complement(531556..531798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27497"
FT                   /db_xref="GOA:Q489H2"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H2"
FT                   /protein_id="AAZ27497.1"
FT                   /translation="MTFQENHRVCPEHPKTAKSTAKNKLTTFSKCTSTFSKLTFLILCF
FT                   VICDAYNLLSMNTFTASFELSSSNAFSFHTTIELK"
FT   gene            532046..534064
FT                   /locus_tag="CPS_0535"
FT   CDS_pept        532046..534064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0535"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28586"
FT                   /db_xref="GOA:Q489H1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H1"
FT                   /protein_id="AAZ28586.1"
FT                   /translation="MNWSLLRLLLALSSMVSALVFANNTSITNLVYSEKGLAGKQIMTK
FT                   VSDTQYHGSLDLRWNNRVFKVDEKIKLNEKGQVLSFESTGLSPFGAAIAESFKWQDGIA
FT                   SWESNKEDGRVKSTGERFYLPVNSAVVAENLMVQAMLKNIGNSIELLPSGTARLTELKT
FT                   VKLSAESGSEQVTLYAISGLGFTPDFSWYDSQGNFFAKDHSGFMKVIREGFTLDDFDKL
FT                   KVIQNSAEQEYLEGVSSKLSHSYTTLLIKNAQVVDVINSVVLKNTDVLFKNGKVSHVAK
FT                   NINVPENTPTIDGSGKTLIPGLWDMHGHLSKGDGLLNIAAGVTNVRDVGNSHDNIMTIE
FT                   RLFNTNQVIGNRVFRAGFFDQMSEFSAGLSVKSLAEAHEKIDWFADNGYIQIKLYSSID
FT                   PTWVESIAKHAHSRGLRLSGHIPAFMTAEQAVKAGYDEIQHINMLFLNFLAGTEVDTRQ
FT                   QLRFTLIGEKAGDVDINSKEFNDFIQLLADNQTVIDPTISTFRSLLLKERKKIDPEFLA
FT                   VAEHLPPNVLRQLKGAEMNVSDDLKDNYQAGADAMSALVKKLYDKGVPIVPGTDNIAGF
FT                   TLQRELELYADAGIPEMDVLKIASINSARLVGAAHYLGSITEGKSADVLLIDGDPLTDM
FT                   SVLRKTSLVIKDNHFYKPEELYKILGVKPFTPSSHLQ"
FT   gene            complement(534162..535865)
FT                   /locus_tag="CPS_0536"
FT   CDS_pept        complement(534162..535865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0536"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF00849"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26284"
FT                   /db_xref="GOA:Q489H0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q489H0"
FT                   /protein_id="AAZ26284.1"
FT                   /translation="MSNTSISTYLSSFVSDISHYSLPDSFPGKFTYPFCYKAHPLALAA
FT                   SEELQQKLEKFHPVESEQQGRMYGVLIVKDTQGSLGYLAALSGNANESNTDKSNIDNDA
FT                   SINFVPTIHQAYNQSEFEKQQQVEINGINKKINLLAANPEIDRLTVLLETETAKSDEEI
FT                   QSLQQQMRDNKKARKDQRTWLSTTVLPEDEHRDISIALSRASVTDKKALQALKLQHQTK
FT                   INLTSSNLQQLTNEIESLKNLRKKLSSTLQKHFFKQYQMLNSKGERKDLIKIFADTLLQ
FT                   KPPAGSGDCAAPKLLQYAFEHKLTPLCMAEFWWGKQPKSEIRKHKHFYPACQGKCLPIL
FT                   GHMLEGMEVDKNPLLINPAEGIDLEIVFQDEHVVVVNKPAGLLSVPGKSIKDSVYTRIK
FT                   TQFPQASGGLIVHRLDMATSGLLMLALNERAHKHLQQQFMNKEINKRYVATIEGKLEKT
FT                   SGEICLPLRGDFDDRPKQMVCHEHGKYAETHWQLIEEVDNTSKLFLYPITGRTHQLRMH
FT                   CAHPDGLNLPIIGDSLYGHSADRLHLHAQRLSFTHPITKELLTFEVAENF"
FT   gene            complement(536253..537218)
FT                   /locus_tag="CPS_0537"
FT   CDS_pept        complement(536253..537218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0537"
FT                   /product="siroheme synthase, N-terminal component"
FT                   /note="identified by match to protein family HMM TIGR01470"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24923"
FT                   /db_xref="GOA:Q489G9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/TrEMBL:Q489G9"
FT                   /protein_id="AAZ24923.1"
FT                   /translation="MKYFPVFLDGSKINAMVVGGGDVAARKIELLLKTTTNITIMAENV
FT                   TDGVERLINENKLNWLKHNYQAGLLTKITLVIAATDDTTVNEQVYHEAVEFNILANVVD
FT                   QPALCTYITPAIIDRSPMIIALSSSGSAPILIRMLREQIEKILPQGYGRLADFSLKFRD
FT                   HVKARIKGIRNRRTFWENTLRGSIGQALLDGKHQEAEQLLIVSLKEKIAPPQGEIIFIQ
FT                   TLEGNPDNLTLKAHRALQFADAVFYDDDVNIELIEYVRRDAEKYPQSVSSTLMLNYQHA
FT                   LELAQEGQQVIYLLSGNEELPSNAALISSGISTTIITNGS"
FT   gene            complement(537356..537847)
FT                   /locus_tag="CPS_0538"
FT   CDS_pept        complement(537356..537847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0538"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03737;
FT                   match to protein family HMM TIGR01935"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24045"
FT                   /db_xref="GOA:Q489G8"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q489G8"
FT                   /protein_id="AAZ24045.1"
FT                   /translation="MLDLLPDLFDQYPEQLSLANQAFTDYGKNTIFYGEIVTVSCFEDN
FT                   SKVKEILATDGSGKVLVVDGKGSMNRALLGDMIAENAVKNNWQAVVINGCIRDAGTIRT
FT                   LEIAVKAIGCNPIKTEKLGVGDTNIVVNFANVEFIPGWYVYGDENGLAVSKSKLSVTAG
FT                   "
FT   gene            537998..538192
FT                   /locus_tag="CPS_0539"
FT   CDS_pept        537998..538192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28410"
FT                   /db_xref="GOA:Q489G7"
FT                   /db_xref="UniProtKB/TrEMBL:Q489G7"
FT                   /protein_id="AAZ28410.1"
FT                   /translation="MSNLMKVVLFMPTLAVMDGKLASSLFIATICQLHRLFALTTETAT
FT                   TSSSKHQIPVEKIKCLGYN"
FT   gene            538174..539055
FT                   /gene="prmA"
FT                   /locus_tag="CPS_0540"
FT   CDS_pept        538174..539055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="CPS_0540"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P28637; match to
FT                   protein family HMM PF06325; match to protein family HMM
FT                   TIGR00406"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28787"
FT                   /db_xref="GOA:Q489G6"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489G6"
FT                   /protein_id="AAZ28787.1"
FT                   /translation="MPWIQLRLSANEDNAEKYSDWLSACGSQAVTFIDAKDTPIYEPLP
FT                   GDEVIYWSNTVVMGLFEASHDMDKVISYLQSIHPDKEQMRYKLEQLEDKDWEREWMDNF
FT                   HPMKFGERLWVCPSWRDVPDPEAVNVMLDPGLAFGTGTHPTTALCLTWLDGLDLQDKTV
FT                   VDFGCGSGILSLAALKLGAKKVIGIDIDPQALQASLANAERNNVSDRLELYLPKDQPEF
FT                   KADVVVANILAGPLRELAPVIIEYVGDKGLLALSGVLEEQAQTLQTIYGQWCDMEPVSV
FT                   QEEWVRLNGQRK"
FT   gene            complement(539224..541065)
FT                   /locus_tag="CPS_0541"
FT   CDS_pept        complement(539224..541065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0541"
FT                   /product="GGDEF domain protein"
FT                   /note="identified by similarity to OMNI:SO1480; match to
FT                   protein family HMM PF00990; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28234"
FT                   /db_xref="GOA:Q489G5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q489G5"
FT                   /protein_id="AAZ28234.1"
FT                   /translation="MQSLFLCVFISISVGLITTSPQAIAESFQYENDQTDVLKLKFSSE
FT                   YISEKLLIADRNRRENPVLYKKILAELAPLEKSFTRDQHSYYQFLQGYLAIYHGDYEQA
FT                   DKLLSEVLNSSADKLMKFRANYTLINVAAAKKDWSDGLRHIAVNKEMLPSITDKEHYQL
FT                   SILTAVIFYNQLQQFDLVLKNIAQVKRDNLPQEHNCFLEQFSLEAKLNLQLIKPGDKSI
FT                   DNGLDICQQAGNKISTNIIRVYRAKLYLKAQQPEKALAEILPYYDEINTTLFPMLIAGM
FT                   NNTLAKSNYLIGNIKSAEKYALAALRANKNNTIIKQSADSYKLLYQINKSQKNIALALS
FT                   YHEKYNALEVAHLEDEKSKHVAFQLAELKTFEHENQIILLNEQNTFLAAEQALSNIKVA
FT                   NIQLIITVMTLIIIMLIIWGARLWRSHKRVKALSEYDELTGIYNRRHFTQIAVSTLKYC
FT                   QSAEQDLSLIMFDLDNFKKINDNFGHICGDWALKETIRVCETIGRKNDIFSRLGGEEFC
FT                   ILLPSCNIEVAVLRAESCRAAIENTITEESGNDFSITASFGVTDVARSGYNLEKLLIDA
FT                   DFAAYESKHAGRNRVTVFEPQEDETGKSLGNSWSVAP"
FT   gene            complement(541142..541396)
FT                   /locus_tag="CPS_0542"
FT   CDS_pept        complement(541142..541396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0542"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27362"
FT                   /db_xref="GOA:Q489G4"
FT                   /db_xref="UniProtKB/TrEMBL:Q489G4"
FT                   /protein_id="AAZ27362.1"
FT                   /translation="MSKVIEVLMQMASNAEMSNTKSLAEMLSNASLTQAQEFAIQTKDM
FT                   DALKAATYNLPEIRCYPILLPDDKSEEVSTVINNTVVNF"
FT   gene            complement(541451..542272)
FT                   /locus_tag="CPS_0543"
FT   CDS_pept        complement(541451..542272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0543"
FT                   /product="putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26018"
FT                   /db_xref="GOA:Q489G3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q489G3"
FT                   /protein_id="AAZ26018.1"
FT                   /translation="MSGSLVCVGTGMTLGAHISPISQSHIEQADIVFSLMANGFAQKWL
FT                   EGMNTDVRCLQGFYQEGKNRNITYNEMVDAILNEVRNGKKVVAAFYGHPGVFACVAHRA
FT                   IKKAKLDDFPASMEPGISAEDCLYADLGIDPGKTGCMHYETSQFMFYKRNIDTSAHLIL
FT                   WQVALAGDKSLGKFSTGKAYRQVLVDLLLEHYPRDHEVILYQAKGIAIEPMREDKILLT
FT                   ELVDADLLMQTTLVIPPCSAMQANEELLAKLAKIDKQEERNKNRPALTLVL"
FT   gene            complement(542440..543045)
FT                   /locus_tag="CPS_0544"
FT   CDS_pept        complement(542440..543045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0544"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:29898619"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27985"
FT                   /db_xref="GOA:Q489G2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q489G2"
FT                   /protein_id="AAZ27985.1"
FT                   /translation="MHAFTTERLLIRPLISEDEHFYCYQYTDKKMMRIVGEPLTQEQAS
FT                   AAFHRALKANNLEQDTVRTWAIVDKAANDIIGTQALSWLATRQTTKPSSSPIEQVEIGI
FT                   MLATRANGKLLPEEAVSAIMEYGFKQLNIGRINAFYANKNRATQRILKKIGYIFEPCLQ
FT                   DNTTDNGYQYFEQHQWSGVIITQLFPEEIEIKEPTVND"
FT   gene            543040..543132
FT                   /locus_tag="CPS_0545"
FT   CDS_pept        543040..543132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26232"
FT                   /db_xref="GOA:Q489G1"
FT                   /db_xref="UniProtKB/TrEMBL:Q489G1"
FT                   /protein_id="AAZ26232.1"
FT                   /translation="MHKNSSIEYIPVTIEYAFSRVLDMFQLKAL"
FT   gene            complement(543186..544955)
FT                   /locus_tag="CPS_0546"
FT   CDS_pept        complement(543186..544955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0546"
FT                   /product="GGDEF domain protein"
FT                   /note="identified by similarity to SP:P38097; match to
FT                   protein family HMM PF00990; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26927"
FT                   /db_xref="GOA:Q489G0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q489G0"
FT                   /protein_id="AAZ26927.1"
FT                   /translation="MNKNILTFFIIISFFTTANASADFDAKLSLADSIRSSKPQEFSVI
FT                   IKGLNQEKSKLSTAQYQHLKYLNTYSLMFQGKLDEAIYLAKEIIISDANETLKFRAKIS
FT                   LMNIFANRQNWTEGLTNLSSLLKDLPSVKNEDFHQLALVAASMFYNQLGQYQLALSYAK
FT                   KIEARAGQNRNQCLAKGFIVEALSKSHQLSTNDPIIEQAIEVCRKNNEILMVSFINSHI
FT                   VRTYIYNEQFIKAIELLNATLQSTVNINFSRITAEYYSLLANAYWQTNELAKAQYFALK
FT                   TLESKNQLSSRKAKILANHLLYKIYKHQNNLELALSYFEVYSELGKEHLKGEKAKHFAF
FT                   QLAEHQNIEQESKIKLLNEKNSLLLSDQALSKAKVVNIQLMISILMVTLALLVLWGARL
FT                   LKAHKRVRELAEYDPLTGIYNRGHFTHVTNSALKYCKNAQQDLSVIMFDLDHFKKVNDS
FT                   FGHACGDWALKETIKVCQRIGRKNDIFARLGGEEFCLVLTCCTIDVAMLRAEACRAAIE
FT                   EIITEESGNDFSITASFGVTDIKRSGFTLDKLLADADMAAYASKNAGRNRVTLFEVPYT
FT                   AKANKLDDSWNYN"
FT   gene            complement(544966..545232)
FT                   /locus_tag="CPS_0547"
FT   CDS_pept        complement(544966..545232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25858"
FT                   /db_xref="GOA:Q489F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q489F9"
FT                   /protein_id="AAZ25858.1"
FT                   /translation="MSKVIKALEKMGQDSSLDNELAITLLLTSLKINTNQIESIINNDI
FT                   ASLKQELDICPDIKCFIIPAEDDDETNDEQESADESNNLAIGF"
FT   gene            complement(545636..546196)
FT                   /locus_tag="CPS_0548"
FT   CDS_pept        complement(545636..546196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0548"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24172"
FT                   /db_xref="GOA:Q489F8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q489F8"
FT                   /protein_id="AAZ24172.1"
FT                   /translation="MYSFTTERLMIRPLRAEDEVFYCQLYADSKVMENIGKTITKKQAR
FT                   QWFKRALKALSSPKKSVVTLAIVKKSTNNIIGIQALSWQNTTQILKPCSQKLVQAEIGI
FT                   MLTTKAQGQGFGKEAIKALMAYGFVYHSLDRINAFYAKKNLASERLFNSLHFIYDLSAQ
FT                   NCNSQNSYQYFNSPQLRKNIISK"
FT   gene            complement(546351..547676)
FT                   /locus_tag="CPS_0549"
FT   CDS_pept        complement(546351..547676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0549"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24813"
FT                   /db_xref="GOA:Q489F7"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR034164"
FT                   /db_xref="UniProtKB/TrEMBL:Q489F7"
FT                   /protein_id="AAZ24813.1"
FT                   /translation="MTTLLRIPITNVFGQGDYSVTLHLGSEKSPVNLLLDTGSSTLVVK
FT                   STTYQANLDKKLTPSTAVQEVNYGVGGWNGPVIFTSINIHEHCHKSDHPQSIAKSPSMN
FT                   LSNAPVALVHSDKQSKTFGDADGILGLAYHHLNKSFDFSDYFTEHKITPALSYPWPFSH
FT                   EVSEDLVSFKKLMWKYPEHDVTPYFTLLEEQQLSANKFAFYSKRSAIHVNKSHSNKINK
FT                   IPSDELAKDPLNKGLLILGGGEEQTDLYQGEFQSIKVEHDVYYNVDLKSVQVGTSQPVI
FT                   AEPLNQKHLKSYFTNAIIDTGAGGIVLTAEIYQQVINDLIAYNANFAQCLAPFKEMSAQ
FT                   LVGIDINELKLEQWPTVYFNFVSEPATANTEEKIVQLACTPETYWQINTPNYDKACFRL
FT                   LSQLPQWPNQSIIGLPLLNNYYVVFDRSKDKTGVVKFAQQKE"
FT   gene            547968..548984
FT                   /locus_tag="CPS_0550"
FT   CDS_pept        547968..548984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0550"
FT                   /product="NifR3/Smm1 family protein"
FT                   /note="identified by similarity to SP:Q08111; match to
FT                   protein family HMM PF01207; match to protein family HMM
FT                   TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27963"
FT                   /db_xref="GOA:Q489F6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q489F6"
FT                   /protein_id="AAZ27963.1"
FT                   /translation="MKIGTYQLNSQVMLAPMAGITDQPFRQLCCQLGAGLAVSEMLSSN
FT                   PKVWNTEKSKLRMLHGDAAGIRSVQIAGSCPDELAFAAKVNADNGAQIIDINMGCPAKK
FT                   VNKKLAGSALLREPAQVERIVQSVVNAVDIPVTLKIRTGWCEDTRNGIEIAKIAENSGI
FT                   ASLAVHGRTRNDFYKGNAEYDTIKAIKLAISIPVVANGDITSPEKALQVLDHTGADAIM
FT                   VGRGAQGRPWIFREINYFLATGNKMSAPELSEVRSIVLAHVMELHQFYGDFKGVMIARK
FT                   HVSWYVQNLVETLDGFSTAFTIDQGKAFRAIFNSLTSTDEQLVTLDKFFDDFTTGSY"
FT   gene            549047..549334
FT                   /gene="fis"
FT                   /locus_tag="CPS_0551"
FT   CDS_pept        549047..549334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="CPS_0551"
FT                   /product="DNA-binding protein Fis"
FT                   /note="identified by similarity to SP:P11028; match to
FT                   protein family HMM PF02954; match to protein family HMM
FT                   TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28311"
FT                   /db_xref="GOA:Q489F5"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q489F5"
FT                   /protein_id="AAZ28311.1"
FT                   /translation="MFEQNVSSPFITGDIQTQTKTSPLRSQAKIAISNYLSQLNGNDVD
FT                   DMYDLVLSEIEAPMLEEVMMYTRGNQTRAANLLGINRGTLRKKLKKYGMN"
FT   gene            549482..551083
FT                   /gene="purH"
FT                   /locus_tag="CPS_0552"
FT   CDS_pept        549482..551083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="CPS_0552"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /note="identified by similarity to SP:P15639; match to
FT                   protein family HMM PF01808; match to protein family HMM
FT                   PF02142; match to protein family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28762"
FT                   /db_xref="GOA:Q489F4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489F4"
FT                   /protein_id="AAZ28762.1"
FT                   /translation="MDTPRPIKRALLSVSDKAGIVEFAQRLSEKGVDLLSTGGTAKLLA
FT                   ENGIKVTEVSDYTGHPEIMDGRVKTLHPKVHGGILARRGIDEVVMDENGISAIDMVVVN
FT                   LYPFANAVSDENCSLENAIENIDIGGPTMVRAAAKNHKDVTIVVNASDYERVLTELDNN
FT                   NDSLTYKTRFDLAIAAYEHTASYDGMIANYFGKMLPAYGETESKASLENKVKFPRTFNS
FT                   QFIKTQDLRYGENSHQDAAFYKEENPEEASVSTATQLQGKALSYNNIADTDAALECVKE
FT                   FDEPACVIVKHANPCGVAIGDDILAAYEGAYKTDPTSAFGGIIAFNRELDADTAEAIVS
FT                   RQFVEVIIAPSVSDAAAQIVAAKPNLRLLECGQWDNKTTGFDFKRVNGGLLVQDTDQGR
FT                   VTSDDLTVVTKRQPTDEEMRDLQFCWKVAKFVKSNAIVYVKNSSTIGVGAGQMSRVYSA
FT                   KVAGIKAADENLEVKGSVMASDAFFPFRDGLDAAAEAGITAVIQPGGSMRDDEVIAAAD
FT                   EHNIAMVFTGMRHFRH"
FT   gene            551225..551320
FT                   /locus_tag="CPS_0553"
FT   CDS_pept        551225..551320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0553"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25716"
FT                   /db_xref="GOA:Q489F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q489F3"
FT                   /protein_id="AAZ25716.1"
FT                   /translation="MLIYLLTMKISMEIQSTLLVCFKSVINIAVN"
FT   gene            551595..552443
FT                   /locus_tag="CPS_0554"
FT   CDS_pept        551595..552443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01NSA0344"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24073"
FT                   /db_xref="GOA:Q489F2"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q489F2"
FT                   /protein_id="AAZ24073.1"
FT                   /translation="MTIKSNSLKSIAIAITLSCSALSLSAMAHDTHALENTASVKALEN
FT                   AVSGDHRTAKNKARDQYRHPIETLDFFGFTPNMTVVEITPGGGWYTEILAPALKGTGKL
FT                   YGAHYPDTGEDNYYSNSRKKLVKKLASDAVFSEVVLTDFTPRQESELAPQGTADLILTF
FT                   RNLHNWKDAGVEQVFKDAFNALKPGGVLGIVEHRLPVGVSPEKAKGYVSEVHTIKQAKA
FT                   AGFRFAGSSEVNANTKDLAIHPKGVWTLPPVLRLGETDRAKYLAIGESDRMTLKFVKPA
FT                   K"
FT   gene            552484..553779
FT                   /gene="purD"
FT                   /locus_tag="CPS_0555"
FT   CDS_pept        552484..553779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="CPS_0555"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by similarity to SP:P15640; match to
FT                   protein family HMM PF01071; match to protein family HMM
FT                   PF02842; match to protein family HMM PF02843; match to
FT                   protein family HMM PF02844; match to protein family HMM
FT                   TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26057"
FT                   /db_xref="GOA:Q489F1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q489F1"
FT                   /protein_id="AAZ26057.1"
FT                   /translation="MKILVIGGGGREHALAWKAAQSSQVTKVFVAPGNAGTATEAKLEN
FT                   VAIDVSDNAALVAFAQSEDVALTIVGPEQPLVDGVVDAFQAQGLAIFGPSAKAAQLEGS
FT                   KSFTKDFLARNKIPSGSYAKFTEVEPALAYVREQGAPIVVKADGLAAGKGVIVALTLTE
FT                   AEDAITDMLAGNAFGDAGHRVVIEEFLEGEEASFIVMVDGKNVLPMATSQDHKRALNGD
FT                   LGPNTGGMGAYSPAPVVTPEIHDRIMAEVIMPTVEGMANEDAPYSGFLYAGLMIAEDGT
FT                   PNVIEYNCRFGDPETQPIMMRLQSDLVELCLAATRGELDKVTIEFDSRAAVGVVLAAQS
FT                   YPADYPKGDVISGLDTNNNVLAKTFHAGTKLNEQGEVVTNGGRVLCATALGNTVTEAQQ
FT                   TAYELLHQISWQGVEFRTDIAYRAIEREQENS"
FT   gene            554664..556175
FT                   /gene="rrsF"
FT                   /locus_tag="CPS_0556"
FT   rRNA            554664..556175
FT                   /gene="rrsF"
FT                   /locus_tag="CPS_0556"
FT                   /product="16S ribosomal RNA"
FT   gene            556276..556351
FT                   /locus_tag="CPS_0557"
FT   tRNA            556276..556351
FT                   /locus_tag="CPS_0557"
FT                   /product="tRNA-Ala"
FT   gene            556447..556650
FT                   /locus_tag="CPS_0558"
FT   CDS_pept        556447..556650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0558"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28231"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A09"
FT                   /protein_id="AAZ28231.1"
FT                   /translation="MRANLNSLTIWKADINIGIYKVSTVSRCCLHDYKYQAVISFSYRE
FT                   CGNGDSASPQGCIIKFILLARA"
FT   gene            556788..559681
FT                   /gene="rrlF"
FT                   /locus_tag="CPS_0559"
FT   rRNA            556788..559681
FT                   /gene="rrlF"
FT                   /locus_tag="CPS_0559"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(559657..559818)
FT                   /locus_tag="CPS_0560"
FT   CDS_pept        complement(559657..559818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0560"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26520"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A08"
FT                   /protein_id="AAZ26520.1"
FT                   /translation="MSYKYRLVFLVQVTRKYVMFSYLSVYVSLYTNHFSITSQQNYLGV
FT                   VWLSLTGN"
FT   gene            559849..559967
FT                   /gene="rrfF"
FT                   /locus_tag="CPS_0561"
FT   rRNA            559849..559967
FT                   /gene="rrfF"
FT                   /locus_tag="CPS_0561"
FT                   /product="5S ribosomal RNA"
FT   gene            560506..562019
FT                   /gene="rrsG"
FT                   /locus_tag="CPS_0562"
FT   rRNA            560506..562019
FT                   /gene="rrsG"
FT                   /locus_tag="CPS_0562"
FT                   /product="16S ribosomal RNA"
FT   gene            562120..562195
FT                   /locus_tag="CPS_0563"
FT   tRNA            562120..562195
FT                   /locus_tag="CPS_0563"
FT                   /product="tRNA-Ala"
FT   gene            562288..562491
FT                   /locus_tag="CPS_0564"
FT   CDS_pept        562288..562491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0564"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24333"
FT                   /db_xref="UniProtKB/TrEMBL:Q48A09"
FT                   /protein_id="AAZ24333.1"
FT                   /translation="MRANLNSLTIWKADINIGIYKVSTVSRCCLHDYKYQAVISFSYRE
FT                   CGNGDSASPQGCIIKFILLARA"
FT   gene            562629..565522
FT                   /gene="rrlG"
FT                   /locus_tag="CPS_0565"
FT   rRNA            562629..565522
FT                   /gene="rrlG"
FT                   /locus_tag="CPS_0565"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(565515..565619)
FT                   /locus_tag="CPS_0566"
FT   CDS_pept        complement(565515..565619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0566"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24931"
FT                   /db_xref="UniProtKB/TrEMBL:Q489E7"
FT                   /protein_id="AAZ24931.1"
FT                   /translation="MVQVTRKYVMFSVSVFIQITSVSLFSKTTWVLYG"
FT   gene            565682..565800
FT                   /gene="rrfG"
FT                   /locus_tag="CPS_0567"
FT   rRNA            565682..565800
FT                   /gene="rrfG"
FT                   /locus_tag="CPS_0567"
FT                   /product="5S ribosomal RNA"
FT   gene            566052..566144
FT                   /locus_tag="CPS_0568"
FT   CDS_pept        566052..566144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26550"
FT                   /db_xref="GOA:Q489E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q489E6"
FT                   /protein_id="AAZ26550.1"
FT                   /translation="MPLPEYIRLLCHSASEVERCYADCCVTDVS"
FT   gene            complement(566530..568614)
FT                   /locus_tag="CPS_0569"
FT   CDS_pept        complement(566530..568614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0569"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28515"
FT                   /db_xref="GOA:Q489E5"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="UniProtKB/TrEMBL:Q489E5"
FT                   /protein_id="AAZ28515.1"
FT                   /translation="MKRCILLALALLPSITVTAEPEATMSFQGYSGLINTPTATLFEEG
FT                   KFFFQYGNQVETRTGAGYRNGDNYNFGVGLWKYVEVSGRLADYKHGSEDGLTDLSANIK
FT                   LGIPFIPKDWFSLAVGIQDVGGAANFYDAKYAVASKNIFEAVNLSLGIGTSVSTEDRLN
FT                   GFFAGIEWQPYNWVKLSAEYDAADTQFGLHLSSPKGWLYSGVQLTSDILVSSTNQALKD
FT                   DFYYGLGFTIPLGGEGNQSNNNNRMTASSHESSHLDDLDSGAASPSGTAERLRVKELLV
FT                   KEGFEAISIGETDGNTLYVELENHVYNRNQIDGLGVVLGVISKQVQHNYANFKLVLKER
FT                   QIPILVVKGSLAEYDAFLRDNQPLKLDISTDTFGSQRRDSTLDLNDANSIWFKPRFTFW
FT                   PGLVTRVGTEFGTFDASLALISHVEVPLWPGAAVTAQHTKQVAETKNFEDGEYFSDYKQ
FT                   KTGLKEYSFHQTFSLPYSIKNMSSVGRYRDTYDYLSNEVRWQSYGGSHKINLFTARYEN
FT                   QEPPEREHYNGCNILFPACWKEAEPLQRDVVIAKYLYYNAHFNASAEMQVGQFWQQDKG
FT                   VVVKLERMFGDVTLNLTYKDTKVDNEEANQFIGLGFSIPLTPRKDYNNKYFQVRGKPKW
FT                   RYSVNTLVGKDHNRLTPGTGDTSQRFYNLDSAFYNNNRLSSEYIYGNANRLREAYYHAR
FT                   "
FT   gene            complement(568730..569746)
FT                   /locus_tag="CPS_0570"
FT   CDS_pept        complement(568730..569746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0570"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27232"
FT                   /db_xref="GOA:Q489E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q489E4"
FT                   /protein_id="AAZ27232.1"
FT                   /translation="MKKIVRTTLAVSIALALTACNNDNNDPTPTTLDISGAAIKGSLAA
FT                   ATVNVYAASDAERATVLATAQTDANGDYSVQVVDASGAEIMGTFVVEVLADEDTTMICD
FT                   ATLCGDVARGESIPAAELVGLSLSTITYSDGTAISADVNSLTTMATETILSSAAIEGSA
FT                   IDLATISAADFLEVQNDTSEIIGAILGVDLSATNIFAIDIVDASVSADVSTEDSITATL
FT                   TLINASLTSLDVADGSTLSAAINDYVNAVETVTAALLVDPEVDLGTANSAALATINATQ
FT                   TQISDEVTMISAEITSDTGVEVPTEEVPMELDEDALGDTVGDIIDGTGGTGGTGGEG"
FT   gene            570057..570878
FT                   /locus_tag="CPS_0571"
FT   CDS_pept        570057..570878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0571"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24451"
FT                   /db_xref="GOA:Q489E3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q489E3"
FT                   /protein_id="AAZ24451.1"
FT                   /translation="MPSKNMEQRVNLEISNGIAYVSLNRPDKCNALDILMFHAIRKTIK
FT                   RLKADRSIRTVIVTGNGDDFCSGLDVKSVMSSTKGPLELLLKLLPWRANLAQYVSTGWR
FT                   EIPAPVIVVIKGRCWGGGLQIALGGDFRISTPDASISIMESRWGLIPDMGGTLALKELL
FT                   RLDKAKELAMTGEVITGLQALEYGLVTHVDDEPFERAIKLAEIISQQSPDSIAATKKLY
FT                   NRSWWSKPGFALLRESFYQIKILIGKNRAIKTYNQINQDKKAREFINRKNW"
FT   gene            571278..572549
FT                   /locus_tag="CPS_0572"
FT   CDS_pept        571278..572549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0572"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25811"
FT                   /db_xref="GOA:Q489E2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:Q489E2"
FT                   /protein_id="AAZ25811.1"
FT                   /translation="MIQGTSGQDEVIANPKKVALKKILLTLSLICALSYVTFPTLSQWY
FT                   SSIPTIDRKSINIETVILGDLIRDIVVSGKAVAANAPQLYSTEIGKITLLAKPGEAVAL
FT                   NQIVARLMSPELDALIKQQQSTLEQLSINANRGVLADKEAQLDLESNMNAAQSKLNVAK
FT                   REFQRAEISYGKQIISEVDWLKSQDAVADAKRLFEHAKKRVSFSVERLQFEKQHRDFLV
FT                   QKEKLILEELSRRHDELAIKAPVKGVVGNWLVAQKNTIAANTAIMTIVDLSEYEAELSV
FT                   PEFYADDLGIGLEVSMKISGVSVRGEIIAISPEVKGNQVTVRAKIKNSQNIQLRQNQRI
FT                   NARIEFEKKENVLMVKRGAFMGSLGGKFIFKLSEDNYADKTAITTGTSSVEYIEITSGI
FT                   DVGQQVITSDYVDFNKAEQIYLGG"
FT   gene            572646..573407
FT                   /locus_tag="CPS_0573"
FT   CDS_pept        572646..573407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0573"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27977"
FT                   /db_xref="GOA:Q489E1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q489E1"
FT                   /protein_id="AAZ27977.1"
FT                   /translation="MLNMNNISRIYQSDTIQTHALRDFSLNVKAGEFVAVTGPSGSGKS
FT                   TFLNVAGLLDSFDRGQYELDGVSVQGLKDDELSRLRNEKIGFIFQNYNLIPDYSIFDNV
FT                   DMPLRYRGFSASERKRRVEQALEKVGLASRFKYLPSQLSGGQQQRVAIARALAGEPKIL
FT                   LADEPTGNLDSLMARQVMEILHDLNKGGATIIMVTHDPDQAREVNRNVQVIDGQLADFK
FT                   IYAPLDRATETKGKTISAAVSASVAEEMENA"
FT   gene            573400..574698
FT                   /locus_tag="CPS_0574"
FT   CDS_pept        573400..574698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0574"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25050"
FT                   /db_xref="GOA:Q489E0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q489E0"
FT                   /protein_id="AAZ25050.1"
FT                   /translation="MRSDSLFVYNLTLAMQSFKRAPTLYFLIILTLSIGVGVLCANLAL
FT                   VNSMASDPIPEKSAHLFHINMNTWPDDQPPDEPMHILRYRDAMAIAESNLTKGSAIFYA
FT                   SGVYARDAESNSMKRFDSDVRATTPGFFELTNAPFAYGAAFEKSRGMEIVIGDELNQKI
FT                   FAGKNSVGKTLELDGELLTIVGVLKPWVLRPLFYHPTERRAFNLTDDIFAPLETAIDLG
FT                   WSIHARSSSAVDYTGIEETRDKDVYYLQAWVELENVNQKPALQSYLDNYSQQLKDAGEH
FT                   PLAIKNELHNVNEWLKVNKVVDQKVLAFTLASVLFLSVCIFNASSLLLSRFHAAKFEVG
FT                   LRRAIGASNRHMLVQGLTESVLLGLFTGAVALVLSWLFLKLSVQFLPRLANIAVLEPKL
FT                   LVLGMLLALVTSIASALYPLYRANRYSISAELK"
FT   gene            574720..575934
FT                   /locus_tag="CPS_0575"
FT   CDS_pept        574720..575934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0575"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28431"
FT                   /db_xref="GOA:Q489D9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D9"
FT                   /protein_id="AAZ28431.1"
FT                   /translation="MNIKALLKSLLLRKFTTGLLILQLAITLGLLINSVILAVDTNNKL
FT                   AQDTGLDIDNTLIVSLHPTSGEYRNLDYYRSIVSQDLHQLNQLSGVESVSLMNQLPINT
FT                   RGMLGNVYDLDDPEIVRRDLYLQDSKIFLTNEELSNTLALALLEGRFLTKDDQLDFGSD
FT                   ENGNVLITESLKKALYGEGSALGQETNNGRIVGVVKDIMLDPTLPIDKQYGVFGNRVME
FT                   FIFTGRYYLLRVIPGQVEAVRNKVSDTILAVQAERDIYRIMTMAEHMKRFYSHDKGLAE
FT                   LFLLLCGLMIFVTAISSYAYSQFHISRQKKYIGIRRALGARKKDILLYVLTENWLVYSI
FT                   GCALGLVMAFGFNILLSQYISLSKPDIMLFILASVVIFIAGTIATLIPAIKTSNIPPVI
FT                   ATRTV"
FT   gene            576233..577540
FT                   /locus_tag="CPS_0576"
FT   CDS_pept        576233..577540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0576"
FT                   /product="sigma-54 dependent DNA-binding response
FT                   regulator, Fis family"
FT                   /note="identified by similarity to SP:Q06065; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00158; match to protein family HMM PF02954; match to
FT                   protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26462"
FT                   /db_xref="GOA:Q489D8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D8"
FT                   /protein_id="AAZ26462.1"
FT                   /translation="MPQILIVDDNPDILEALELLLSLHGYAVLTAENEKQALLAVSHQR
FT                   VDLVIQDMNFAQGITSGKEGKSLFTALKALNSDLPIILITAWTQLETAISLVKSGATDY
FT                   LQKPWDDVKLLDLVAKYSLNSKINQDKNNQSVSNQKPADDFIYKSQEMQTLISQASKVA
FT                   GANVNVLITGANGAGKEKLADYIHQQSPRYNSAFIKVNMGALPHDLMEAELFGAEKGAF
FT                   TGANQARIGRFEAADGGTLFLDEIANLTLAGQMKLLRVLQTGEFERLGANATLKVDVRV
FT                   LSATNADLRLAVQQGTFREDLYYRLNVIELNLPDLAYRKADIVPLAQYFIGNDCSLSDE
FT                   AAQTLTDYTWPGNVRELENACKRALVFANSSTLTASDFQLASSQKEAALGEKGNIEQVL
FT                   IKHKGVIKHTALELGLSRQALYRRIEKYQIDVGSLC"
FT   gene            577551..578852
FT                   /locus_tag="CPS_0577"
FT   CDS_pept        577551..578852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0577"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by similarity to SP:Q04850; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26411"
FT                   /db_xref="GOA:Q489D7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D7"
FT                   /protein_id="AAZ26411.1"
FT                   /translation="MLIVQLILINIAFIVSFSLLLPSSPWLFSISSILLITLAAMRYQH
FT                   YHRQTHQILQTLLHGLRNLQDGDFSITLADKKTNKSQSQSEVLALFNQVTDKLRQEKQS
FT                   LYQRELLLDKVVNASDVVTVLVNHRDTIIFANRAAEYFFNQKSMLGMSWTTLLDEKLPE
FT                   LIPHNDKDNAIIQLLLAETKTEHSWHLSRHHLKLHGSRHQLTLLKPITKAMHQQELQTW
FT                   KKVIRVINHELNNSIAPISSMCHSGNILAERLNEPQLIRVFATISKRINKLAEFIQSYS
FT                   QLARLSQPKKQEFDLIKTLKQLQELYLFTLSCQGNSLMFTGDESQIEQLLINLLKNAQQ
FT                   ACPDKVNAEKSCVVSVSSQQDKLVITVRDFGTGMPVEVLQKAFLPYYSTKADGSGIGLS
FT                   ICREISDGHQGQITLNNHPKGGLQVDVYLPHNVN"
FT   gene            579384..580511
FT                   /locus_tag="CPS_0578"
FT   CDS_pept        579384..580511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0578"
FT                   /product="polysaccharide biosynthesis/export protein"
FT                   /note="identified by similarity to SP:Q46629; match to
FT                   protein family HMM PF02563"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27017"
FT                   /db_xref="GOA:Q489D6"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR040716"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D6"
FT                   /protein_id="AAZ27017.1"
FT                   /translation="MLISSKKVIVSLALLLLSGCNIIPGSHMEGVDVEPETSTLEQDLS
FT                   NINISVIDSSLISRLKDSQQTYSQAKKYTPVVTDTYDYVLGVGDVLSIGVWDHPELTIP
FT                   AAVQRTAEFDGFRIQADGTITYAYAANVPAAGKTIRELHNVLVAKLSEVIEKPQLDLKV
FT                   VGFKSQRTYVTGEVKRPGVFAISEIPLTLIDALNLAGGLSERADWRTVSFTRDNQVQTI
FT                   KLDDFYTKGDISQNRLLKHGDIIHVNRTDNQKVFVLGDVSKAGSIEINRYGLSLAEALS
FT                   DVGGLNERTANANGVFVLRKRPDNEEGIIADVYQLYAQNVVALVLADQFKLQPRDIVYV
FT                   TTAPIARWNRLISQLVPTVQALESISTIKTQGNFF"
FT   gene            580511..580975
FT                   /locus_tag="CPS_0579"
FT   CDS_pept        580511..580975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0579"
FT                   /product="phosphotyrosine protein phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="identified by similarity to SP:P75880; match to
FT                   protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25765"
FT                   /db_xref="GOA:Q489D5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D5"
FT                   /protein_id="AAZ25765.1"
FT                   /translation="MGMFNSILVVCAGNICRSPTGEYLLKDKLKDKSADNSVENQIKVS
FT                   SAGLTALVGKGAEATATKIALSNNIDMSPHKGRQLNSKLIAENDLILVMEERHLSDLLG
FT                   QYPEARGKTFLLGKWIDDTEIPDPYRQSHEAFEHVYQLIDRACSAWEKYL"
FT   gene            581041..583320
FT                   /locus_tag="CPS_0580"
FT   CDS_pept        581041..583320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0580"
FT                   /product="tyrosine-protein kinase"
FT                   /EC_number="2.7.10.1"
FT                   /note="identified by similarity to SP:P38134; match to
FT                   protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27542"
FT                   /db_xref="GOA:Q489D4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D4"
FT                   /protein_id="AAZ27542.1"
FT                   /translation="MSIDENIVKPTVRNQQGNNTSNNAPANEIDLMALFGALIDRKIFI
FT                   VSITTLFAVIGIAIAIFSTPIYKATAMIQVEESGGSVPGLDDMAGMFESSSKSITEIEL
FT                   LKSRSVIGEAVDTLKLDIVAVPKLFPVIGGRSFRKFNPIKEGDLAAASFGATSYAWGGE
FT                   QIEVFRFDVPQYGIDKEYIIQASDNQSFKLLSEDGKVILHGKVGEELSNDRFSITLKTL
FT                   VARAGTEFIVTRKDRLNTIVDLQTAIGASEKGKDSGIVNLSFQHETPEYAEGVLNKTAE
FT                   IYVLRNVDRNSAEAKKSLDFLEVQLPEIKKQLESSEALFNDYQRDQQSVNITLETQGVL
FT                   EQIVELDTKLQELDLKRLAMSRMFKRNHPNYQGIVEQIEAVQKQRDGLAGKISNLPEMQ
FT                   QKLLRLTRDVEVGNEIYMMLLGKVQELDIVRAGTVGNVRIIDVAEVNTIKPVKPKKALI
FT                   VVMATLVGGMLAIAIVLVQKALHKGVEDPSEIEAIGMPVYASVPFSMHQDKLTGLTKAL
FT                   TKGRKRKANQSHNDKSNVLAVDNPADLSIEALRSLRTSLHFAMMEAKNNVIAISGPSPG
FT                   VGKSFISANLGAVLAQSGQKVLVIDADMRKGYLQKQFGIVWENGLSDYLSGQQTLEQVT
FT                   KATNVEGLSVITRGQVPPNPSELLMHSNFSDLITEIKAKYDIILIDTPPILAVTDPAIV
FT                   GGHAGTMLLVTRFGQNAIKEIDYARQRFEQNGIDVKGVVFNGVVKKASNAYGYYGYYNY
FT                   EYKSDK"
FT   gene            583458..583583
FT                   /locus_tag="CPS_0581"
FT   CDS_pept        583458..583583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0581"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24052"
FT                   /db_xref="GOA:Q489D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D3"
FT                   /protein_id="AAZ24052.1"
FT                   /translation="MYNEVKKAMTSPLKHLQTGVFCLYYSGLISAVGLGEKLNEY"
FT   gene            583573..584793
FT                   /locus_tag="CPS_0582"
FT   CDS_pept        583573..584793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0582"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="identified by similarity to SP:P37746; match to
FT                   protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25838"
FT                   /db_xref="GOA:Q489D2"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D2"
FT                   /protein_id="AAZ25838.1"
FT                   /translation="MNIDIKRLVDNFCSLAVLKIFNLLLPLVTLPYLLKTLELNNYGVI
FT                   VLALSLIMYFQTITEYGFNLSATREIAKNRSSAARLEFIYSKVVWCKLLLLIISLLVLV
FT                   VVVFFTPKLFESKTTFLLTGLILIGHSMFPEWFFRGMEQMRYITLLDLCIKLLFTIGVF
FT                   VFINNEGDGWLYPLLLGSAYITVSILSHLLIYYKFNVSLKLVKFMVIYRTLKNTFPLFI
FT                   NQFFPNLYNNTTTFLVGMMLGNHAVGLFGAIKQVASLLNVFNSVITAVIFPYLNRNKDK
FT                   FNLYCKYYLLLLFTVSLLFIFVGQYVFLLLEINDEIVNKVFLILIIGIFNIGIYSVFAT
FT                   NYLIIHKKDKLVMKITVITSLIGFSLSYPFIHLFGLTGAALTVCTSQFLLGTISFVFYK
FT                   KNNERNI"
FT   gene            584777..586312
FT                   /locus_tag="CPS_0583"
FT   CDS_pept        584777..586312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0583"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24796"
FT                   /db_xref="GOA:Q489D1"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D1"
FT                   /protein_id="AAZ24796.1"
FT                   /translation="MKEIFSIGRNLTARDKCMNGNYNKNYIGNGSHLGTIYPLFSKESP
FT                   SDFFFNMEDIINFRTKNNLNIELDKVALVEKACLPYLLGNRTLITDVERAPWMHSYSNQ
FT                   RWINESLPYHGKSKPNKETFVCDLKTSLSNEAIGYIGKANTVGILLSGGMDSRVVAGVV
FT                   RDLQKNNRSISVVGITWGNANSRDVIYSQRICQQFGWEFVHFPITAETLHKNIQLSAKM
FT                   GAEVSALHFHAMSDVADLKGVDVILAGSYGDSVGRAEFSGKHVTKLSSVLPSRINNLGL
FT                   IKDELFQSALESIRNDAQLPAFHNAGDNNLRKYEIEQECHYMRRMLQSCMHVVAEKIPF
FT                   YQMFTAPSVFGLMWGLEPNIRNNDWYVELLNILPGQLLQIPWARTGILYHLPEGTADEF
FT                   DKSYHQYGLWLKTELKDEMLNAMNSKSIRELGIFNEYSLDALVSSWGIAKGASNNRLDE
FT                   VVSWIASLNTFINNNQSLNLAEEIPYKYSDYYNTAKGSCYGMLYSLARNYLRK"
FT   gene            586577..586687
FT                   /locus_tag="CPS_0584"
FT   CDS_pept        586577..586687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24113"
FT                   /db_xref="GOA:Q489D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q489D0"
FT                   /protein_id="AAZ24113.1"
FT                   /translation="MVWGPASLSCETLEVEPLVYIFQLANFILLDIGDKR"
FT   gene            586684..587835
FT                   /locus_tag="CPS_0585"
FT   CDS_pept        586684..587835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0585"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26806"
FT                   /db_xref="GOA:Q489C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C9"
FT                   /protein_id="AAZ26806.1"
FT                   /translation="MNIVKLNSVIFFLIGLGVTLRSFYIYSISLAPLPLISIFLVFFLC
FT                   YLNRQRLRTAKLDSNIVLFIAFFIMYICFSISLNFYYRNANINVNSIFGVFLNLSFFFS
FT                   IYLLKDVFVECKKGLNYLIIFHLCFFFFQFFMFHVFGDKIDYLLSITGEAQRFNGFANV
FT                   EGSGTSMFRPVGLFTEPGNYSIHILTLLWLAYLADEINPIVEKCALASVVLSFSLTGMA
FT                   GVLVYIVLKLNKKIELKYMIISILSLIAFAYIFNELIINYLSERVGNISNDNSTNVRVM
FT                   AFEAITSFSITMQLFGVGLGHDYVQIHLPTIPYVLVTFGIVGSIIIFLLFITLAHSNNV
FT                   TIKTYLFFLFISFQFYTLMHPLFWYFWVGVFIFSSHAKRKACC"
FT   gene            588046..589188
FT                   /locus_tag="CPS_0586"
FT   CDS_pept        588046..589188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0586"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by similarity to GP:3413449; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28574"
FT                   /db_xref="GOA:Q489C8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C8"
FT                   /protein_id="AAZ28574.1"
FT                   /translation="MDLEKMSTIIFINNLGLGGAERVVSRLFQNRDINDIATLWVFNDN
FT                   FFYDCTAKKKVILSKKYKLLTYINALIKLLKLDDTKLVQAHLNLPILLSTCAKLFGAKF
FT                   NLKTVHCFAYSSFYNRRGFLGKSHKFIFSKLLKKADFHTFKSREMVDDFVETFGWRPER
FT                   YSVIYNPYDIENITRLSNEVVNQCDLKNNKLNVAIVGRLNISKRSFDVIELALGTSDIA
FT                   HYHFFGDGPLKEDLLKEVKNRKINNVTVHGMIKNPFKYVRKMGVYLSLSESEGFPNALI
FT                   ESMICNAIPIHSDCKTGPKEILCDNYKDYSSIKSEFSVQKRGVLFPVGDMLGASKAILY
FT                   VFENYVELREGFNSESREFIDSLAFDKISQEYYLTLNKHS"
FT   gene            589530..590984
FT                   /locus_tag="CPS_0587"
FT   CDS_pept        589530..590984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0587"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26171"
FT                   /db_xref="GOA:Q489C7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C7"
FT                   /protein_id="AAZ26171.1"
FT                   /translation="MEFYGPITGEKFAFLLFRDNGEVIEFNHWSQVKEYKSELKISKSS
FT                   IQIFLRNGCVYPPYTIYSNVLMLPIGTKLTIDIKNDIFKWENNFCFLDRHSKQDSKPST
FT                   SKLKTLIANSFAHLKKEVKPIYMMQSAGKDSTAMLLGLHEQGIQNVHCVTYEANFRDTE
FT                   SDAAKKIAESLGFEHTILFPNYEAEFDALLEYQENAVSITGDFSMLPYIAANKSVFKSD
FT                   SLVIDGLGNDLYMGYVSNKLERSIMKCSLGNFSYLEPSKFTSNEVINYAISSIFMKPYE
FT                   RLFPGTRLSSSEIENFTDNKFIDDDAIYFSKQYNNLDKDDFRAAIRARFCDSTMFQMKA
FT                   ELTTNSFGNEVYFPFSNKELVDYYFNLPIEERYDKANSCNKTLLRSMLNEYVEVDDFFK
FT                   VKSGFRYNMPEFITINKEKIKKEIIECDLLEQDYSNRFFAKHLDVQKVNYTSACKAYIL
FT                   LVFASWRNRNKLAVVDGHVADKFDWY"
FT   gene            590986..592119
FT                   /locus_tag="CPS_0588"
FT   CDS_pept        590986..592119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0588"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28407"
FT                   /db_xref="GOA:Q489C6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C6"
FT                   /protein_id="AAZ28407.1"
FT                   /translation="MKKLLFIVNVDWFFISHRLPIAIDALKKGYTVTIACHFTSHKQEL
FT                   IDMGFNVLEIPFSRSGAGILSELNTLKCIRKVINDVNPSLIHAVTIKPVLYTGLVLKSI
FT                   NRNIPFVAAISGLGYVFTASTLRAKLTRFIASAFYKVALSQKYKMVIFQNTSDENILTK
FT                   VAKLESSDKFLIKGSGADLSVYNFSPENLDNRTSIVMACRLLREKGVYVYVDAAKLVKE
FT                   HFPEAEFLLVGTPDLENPNTVKQVEIDQWVSDGTIKYLGHRNDIPSIFANSNIVCLPSF
FT                   YGEGVPKVLIEAAACGRAIVTTDNPGCKDAIINEVTGIAVPVRDAQSLALAIIKLLDDP
FT                   ALRISMGKKGRSFAEQEFDVRAVVTKHLDIYNELLQK"
FT   gene            592116..593081
FT                   /locus_tag="CPS_0589"
FT   CDS_pept        592116..593081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0589"
FT                   /product="sugar epimerase family protein"
FT                   /note="identified by similarity to SP:Q56623; match to
FT                   protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28046"
FT                   /db_xref="GOA:Q489C5"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C5"
FT                   /protein_id="AAZ28046.1"
FT                   /translation="MKIAITGATGFLGKPLTKELSERFCDDSIAPILRNLSQEFNNVNC
FT                   IVVGDIGPMTDWSNKLEDIGCVIHCAARVHVMNEKNEDPLDAFREVNVRGTLVFAKAAA
FT                   KSGVKRFIFVSSIKVNGESTTSKKPYKNSDEPSPKDPYGISKSEAEAGLKLIADETGME
FT                   VVIIRPPLVYGPGVKANFAAMLKFASTGIPLPFGCISHNKRSMVYVENLISLIVECIDN
FT                   PNAANNTFLVSDDNDLSTKEFVNGLSAGLGKSGLMLPVPNALFSIAGKVLGKSAVIDRL
FT                   CGSLQVDINHTKDTLSWQPPYSVVEGFAATARYFKDQRSN"
FT   gene            593142..593708
FT                   /locus_tag="CPS_0590"
FT   CDS_pept        593142..593708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0590"
FT                   /product="putative polysaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /note="identified by similarity to GP:1929427; match to
FT                   protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27516"
FT                   /db_xref="GOA:Q489C4"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C4"
FT                   /protein_id="AAZ27516.1"
FT                   /translation="MTLLLIRILDFIFSFFGLLFACPFLIILTIIGYFDTGSPIFIQER
FT                   VGRNKKPFNLIKFRTMTVGTASVASHLASSASITNFGSFLRKTKLDELPQLWNVLKGEM
FT                   SLVGPRPNLFNQTELVLERESRGVYNVRPGVTGLSQVNEIDMSTPILLAKTDEQMILTL
FT                   TISYYFKYILQTVTGSGSGDRVTKD"
FT   gene            593724..594890
FT                   /gene="ugd"
FT                   /locus_tag="CPS_0591"
FT   CDS_pept        593724..594890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="CPS_0591"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="identified by similarity to SP:P76373; match to
FT                   protein family HMM PF00984; match to protein family HMM
FT                   PF03720; match to protein family HMM PF03721"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26971"
FT                   /db_xref="GOA:Q489C3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C3"
FT                   /protein_id="AAZ26971.1"
FT                   /translation="MKIAIAGTGYVGLSNAMLLAQHNEVIAVDIIAEKIELLNSGKSPI
FT                   EDTEISDFLANRELNFTATLDKEAAYAGADYVIIATPTDYDPETNYFNTASVESVIKDV
FT                   MAINPSACMVIKSTVPVGYTARIREELGCEGLIFSPEFLREGKALHDNLYPSRVIVGED
FT                   SDRARKFAGLLTEGAWKENIDVLFIRSTEAEAVKLFSNTYLAMRVSYFNELDTYAEVHD
FT                   LDSRHIIEGVSLDPRIGNHYNNPSFGYGGYCLPKDTKQLRANYKDVPNNIISAIVDANS
FT                   TRKDFVADSIIARSPKVVGIYRLIMKAGSDNFRASSIQGIMKRIKAKGIDVVIYEPVME
FT                   EDEFYHSKVIKSLSEFKAMSNVIVSNRMVDELIDVVDKVYTRDLFGSD"
FT   gene            595062..596066
FT                   /locus_tag="CPS_0592"
FT   CDS_pept        595062..596066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0592"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="identified by similarity to GP:3093975; match to
FT                   protein family HMM PF01370; match to protein family HMM
FT                   PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25731"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C2"
FT                   /protein_id="AAZ25731.1"
FT                   /translation="MKYLVTGAAGFIGSAVVERLCAAGHDVVGIDNINDYYDIALKQAR
FT                   LARIEHASFSFIKMDIADRNVMAELFTAQQFDKVVHLAAQAGVRYSIENPMAYADSNLI
FT                   GHLNVLEGCRNNQVKHLIYASSSSVYGLNNKVPFSTKDTVDHPVSLYAATKKSNELMAH
FT                   SYSHLYNIPTTGLRFFTVYGSWGRPDMAPYIFTKKILNGDTIDINNNGDMWRDFTHVDD
FT                   IVEGVIRIADVIPERDAEWKVESGSPATSSAPYSVYNIGHGSPISLMDFVKAIEDELGI
FT                   EAKKNFREMQPGDVYQTYADTQDLFKATNYVPKISVKEGVAELVVWFKDFYKI"
FT   gene            596131..597018
FT                   /gene="galU1"
FT                   /locus_tag="CPS_0593"
FT   CDS_pept        596131..597018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU1"
FT                   /locus_tag="CPS_0593"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by similarity to SP:P25520; match to
FT                   protein family HMM PF00483; match to protein family HMM
FT                   TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25212"
FT                   /db_xref="GOA:Q489C1"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C1"
FT                   /protein_id="AAZ25212.1"
FT                   /translation="MKAVIPVAGLGTRMLPATKAIPKEMLPIVDKPMIQYIVNECVAAG
FT                   IREIVLVTHSSKNAIENHFDKSFELETTLESRVKRQLLDEIQAICPKGVTILHVRQGEA
FT                   KGLGHAVLKARPIIGDSPFVVVLPDVILDEASADLKTENLSAMLTRYHEVGHSQIMVEP
FT                   VPMDMVSNYGVADCNGDELTAGESKAMTAVVEKPPVDEAPSNLAVVGRYVLSEKIWDML
FT                   EFTPPGAGDEIQLTDAIASLMKIETVEAFHMTGKSHDCGSKLGYMKANVEYGLRHAELG
FT                   DDFKAYLQETVKNS"
FT   gene            597300..599240
FT                   /locus_tag="CPS_0594"
FT   CDS_pept        597300..599240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0594"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF02719;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24654"
FT                   /db_xref="GOA:Q489C0"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q489C0"
FT                   /protein_id="AAZ24654.1"
FT                   /translation="MSLIQSVLSLPRAYKRAISLLIDSIFLFCAFWLALFMRLDSFSPL
FT                   FDQGYWLVFSCSLPLSLLVFVKLGLYRAVLRYMNMQAVWAIALGSIFSAMFVIGFSFLY
FT                   TAGIPRTVPFIFISLCLILIGGSRVSVRAVISHQRWHKKASVLIYGAGSSGRQLATALS
FT                   QGPEYHAVAFIDDYKALQGQIIQGIPVYSPEEISHVVERKTVQKILLAIPSASRARRKQ
FT                   VLAKIDCLGIQVLTIPGMADIVEGKAKLEEFKDVGVEDLLGRDSVEPKPELMNADIADK
FT                   VVMVTGAGGSIGSELCRQIIRLKPTKLVLFELSEFGLYTIDKELNEYKQQHDLAVEVLP
FT                   LLGSVQRVNRIETVMKSFAVQTVYHAAAYKHVPLVEHNVVEGVRNNVFGTYYAARAAIN
FT                   ANVETFVLISTDKAVRPTNIMGTTKRMAELVLQALAKTQHSTRFCMVRFGNVLGSSGSV
FT                   VPLFRKQIKNGGPVTLTHPDITRYFMTIPEASQLVIQAGAMGKGGDVFVLDMGDAVKIY
FT                   DLASNIIHLSGFSVKSAELPDGDIEIKCTGLRPGEKLYEELLIGDNVSGTSHERIMTAQ
FT                   EVMLDWDELEALISRLDDACHAFDHELIREILLKAPTGFNPTDGICDLVWQQKSTLQQY
FT                   TADIIELKVAT"
FT   gene            complement(599413..599895)
FT                   /locus_tag="CPS_0595"
FT   CDS_pept        complement(599413..599895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0595"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO2622"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26480"
FT                   /db_xref="GOA:Q489B9"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B9"
FT                   /protein_id="AAZ26480.1"
FT                   /translation="MKSLLLTSLTLFTFFFSNLANADYDRNKAVPVEQVLFGTVISARN
FT                   VSQEELIQDKNSGWKTFGGALIGGAIGNQFGGGSGRDIATVLGAVIGGKMANNRSQDKT
FT                   VVIHLVELMIEVDCAEQQCQQYMVIQDYDSQMVFHHQDAVRMVYLANGNVRIDKQF"
FT   gene            complement(599965..600567)
FT                   /locus_tag="CPS_0596"
FT   CDS_pept        complement(599965..600567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0596"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:SO1060"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27416"
FT                   /db_xref="GOA:Q489B8"
FT                   /db_xref="InterPro:IPR014094"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B8"
FT                   /protein_id="AAZ27416.1"
FT                   /translation="MKKLIMITSVALTLTLVAGCTNKSVVRYGDATEVETTDISFGSTD
FT                   LQKVAGDMTDSLLVSPVVGTLTANTRPIMFVESIKNKTSEHIDTESITDSISTKLLRSG
FT                   KFRFVDMGRVAAARKQLDYQQSSGMVDPNKAMQFGKQVGAQYMLYGNLASIVKSNKDQS
FT                   DVYYKFTLRLMDLESGLVEWADETEIRKTKGKEFVSW"
FT   gene            complement(600735..601208)
FT                   /locus_tag="CPS_0597"
FT   CDS_pept        complement(600735..601208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0597"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:VC1895"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25997"
FT                   /db_xref="GOA:Q489B7"
FT                   /db_xref="InterPro:IPR010824"
FT                   /db_xref="InterPro:IPR038483"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B7"
FT                   /protein_id="AAZ25997.1"
FT                   /translation="MKKVKMMTSTTTRRSALLIAALTATLLISGCKNVPPVTSGMGSDQ
FT                   IAPGQKFSKHLQVHNPELGKKLHISDIRSRTNNELLEINLSLTSTYEKTLKLQYQFTWF
FT                   DKDGFVIEAGKAPWKPLDLHGMQTETVPGLAPTNQVASFSLYVRDVPEKFFKF"
FT   gene            complement(601284..602735)
FT                   /locus_tag="CPS_0598"
FT   CDS_pept        complement(601284..602735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0598"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF04141;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26725"
FT                   /db_xref="GOA:Q489B6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B6"
FT                   /protein_id="AAZ26725.1"
FT                   /translation="MLNIPSKISIILLLSLALSACAGTSFSDLFSNYNKQMQGAKNAQQ
FT                   QGNFEQAVSLLPERSESNGSYGLSLLEKARLEFLANNHTQSQQDFALVYRQVQQAEQAA
FT                   KIQLSRGIENIQAVVSNDNATRYDIHYYEQSMLHCYQALNYLNQNDLSGALVEIRRANL
FT                   VQQKALQANQQALFDSQEEMSKKGVSSESLASKYPSMSTAIGKVKNGFQNAYTFYLSGV
FT                   LYEAAGQANDAYIDYKKALEIYPHNVTVQKDVWRLATKLGMTNDIQLFGNRFSSDITRG
FT                   NHQTVDNRKSLTKSGQLVVLVEQGIIPSKQEVSIHLPIFTSHNDMRFYSLALPSYQNRL
FT                   RQYSGLSLNYQGNTYQSQEIVRLQSLAAKQLQDEMPAIVTRQVVRLVAKEELRQQMSRK
FT                   GGDVGNILAGLYNIASEKADTRSWSTLPDSIHILRLDLAPGQQEVELNINGSSRTITVE
FT                   INEDRQTLVKLTSIGSYTNYQSINL"
FT   gene            602899..603234
FT                   /locus_tag="CPS_0599"
FT   CDS_pept        602899..603234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0599"
FT                   /product="copper-binding protein, plastocyanin/azurin
FT                   family"
FT                   /note="identified by similarity to SP:P22365; match to
FT                   protein family HMM PF00127"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25073"
FT                   /db_xref="GOA:Q489B5"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR002386"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B5"
FT                   /protein_id="AAZ25073.1"
FT                   /translation="MIDKRVWLFMTMSLFIGTSQVQAKDVIVEIYKKQFIPSEVTIEAG
FT                   DRVIWKNIEKRQYHNVWFKGSGEEEPDYFFPDESYQRQFDQLGTFAYECGPHPKMKGKV
FT                   IVKKSQQ"
FT   gene            603497..603943
FT                   /gene="norC"
FT                   /locus_tag="CPS_0600"
FT   CDS_pept        603497..603943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="CPS_0600"
FT                   /product="nitric-oxide reductase, C subunit"
FT                   /EC_number="1.7.2.5"
FT                   /note="identified by similarity to SP:Q52527; match to
FT                   protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25319"
FT                   /db_xref="GOA:Q489B4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B4"
FT                   /protein_id="AAZ25319.1"
FT                   /translation="MSESFTKGMARNIYYGGSIFFFLIFLALTFHTVKEMPKRDNRENI
FT                   TEAVERGKHLWEKNNCIGCHTLIGEGAYFAPELMNVYDRRGGGNEVAFKAFLNGWMNAQ
FT                   PLNIPGRRQMPNFHLNDQEIDDLAEFLIWTSKLDANNWPPNIEG"
FT   gene            603947..605338
FT                   /gene="norB"
FT                   /locus_tag="CPS_0601"
FT   CDS_pept        603947..605338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="CPS_0601"
FT                   /product="nitric-oxide reductase, B subunit"
FT                   /EC_number="1.7.2.5"
FT                   /note="identified by similarity to SP:P98008; match to
FT                   protein family HMM PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28679"
FT                   /db_xref="GOA:Q489B3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B3"
FT                   /protein_id="AAZ28679.1"
FT                   /translation="MNTLKYQSQAVAKPYFIFAMILFVGQILFGLIMGLQYVVGDFLGG
FT                   IIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEEAETELYSPKLAIILFWVFAAAGVLT
FT                   ILGYLLVPYSTLADITFNELWPTMGREFLEQPTITKFGIVIVCLGFLFNLGMTILKGRK
FT                   TAINMVMMTGLIGLAVFFLFAFYNPTNLALDKYFWWFVVHLWVEGVWELIMGAILAYVL
FT                   IKVTGVDREVIEKWLYVIIAMALISGILGTGHHFYWLMTPEYWQWVGSIFSALEPLPFF
FT                   AMVLYAFNMVNRRRREHPNKAATLWALGTAVMAFLGAGVWGFLHTLSFVNYYTHGSQIT
FT                   AAHGHMAFYGAYAMIVMTIISYAMPKLRGIGEANCNKAQVVEMWGFWLMTVAMVFITLF
FT                   LTGAGILQVWLQRLPESGEALSFMATQDKLAIFYWLREISGVIFLLGLISYITSFFITE
FT                   KKAQA"
FT   gene            complement(605424..605534)
FT                   /locus_tag="CPS_0602"
FT   CDS_pept        complement(605424..605534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0602"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24294"
FT                   /db_xref="GOA:Q489B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B2"
FT                   /protein_id="AAZ24294.1"
FT                   /translation="MHRKNKSGQGARLSNSWLLGLRATPPWSILTSTSGQ"
FT   gene            605760..607271
FT                   /locus_tag="CPS_0603"
FT   CDS_pept        605760..607271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0603"
FT                   /product="serine carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF00450"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27834"
FT                   /db_xref="GOA:Q489B1"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B1"
FT                   /protein_id="AAZ27834.1"
FT                   /translation="MVMLSLSSSPVLAAQESEQRQNKHERKLAIDEKNITKHSTKVNGQ
FT                   KFKYTATTGTQPVWDEEGNPIASLFYTYYQRSDVKDSAKRPLVISFNGGPGSASVWMHV
FT                   AYTGPRVLNVDDEGYPLQPYGVKTNPYSILDVADIVFVNPVNTGYSRVLAGKDGEMPSK
FT                   EQQKKMFFGVNADINYLAEWLNTFVTRNNRWRSPKYLIGESYGTTRVAGLAKELQERQW
FT                   MYVNGVILVSPTDIGIKRDGPVKAANRLPYFTAAAWYHKALTPALQQKPLAELLAEVET
FT                   FTLSEYLPALAKGGFITAQEKQVIAEQVANYAGLSVTAVINNNLDIDNSFFWKELLRDR
FT                   KQTIGRLDSRYLGIDKKVAGSSPDYNAELSSWLHSFTPAINYYLREELNYKTDIKYNMF
FT                   GNVRPWDRTGNKTGEGLRSAMAQNPYLQVMIQSGYFDGATNYFDAKYTMWQLDPSGLMK
FT                   DRLSFKGYESGHMMYLRHEDLRDANQDIREFIKKSLPAKGQAAKY"
FT   gene            607691..608842
FT                   /locus_tag="CPS_0604"
FT   CDS_pept        607691..608842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28039"
FT                   /db_xref="GOA:Q489B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q489B0"
FT                   /protein_id="AAZ28039.1"
FT                   /translation="MLKKALVLLQDYLNHLGFKAQIHFELEGCYKIPDHINDIDLTAVN
FT                   HSLSMLDIDGEVVNEYWKNQWEYVSLFNGQSPLKEADNLVRAIHHLPIIFAQHGITETL
FT                   IQPVVWSGDQGKLALGSRDIFTTDTRAVHIPNAIQINVSVINEQGVNIISHDGFGEYLQ
FT                   QCFLQTSKACSLLYLPEEEAFERLKLKSYYGLAEELCSPCDISGGHQGSIALYKELGKH
FT                   NQQMGEETLLFDQHNKILVTEQNWQKTARIEHRLGASSTSYNPHVNVLFSLMNVVDALE
FT                   VYLQESCLSDLSSSIPAIELPKSLYNQYQKAAGGAKDSLGAIELFTRCPWFSERINKVQ
FT                   QFMISINNDSHQPAYLGDLIKQQILAKYQAKKIALPINFNYTL"
FT   gene            608853..611096
FT                   /locus_tag="CPS_0605"
FT   CDS_pept        608853..611096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0605"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO4465; match to
FT                   protein family HMM PF03781"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26514"
FT                   /db_xref="GOA:Q489A9"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR027625"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q489A9"
FT                   /protein_id="AAZ26514.1"
FT                   /translation="MDTYKDNEVNEPKSPTLTGDSINGKRAELKRYFKATWQRYDSLFS
FT                   LVNNDEAYYQRPEPLRHPLIFYFGHTACFYINKLILGKYIDERINPRIEAICAVGVDEM
FT                   SWDDLNSEHYDWPAVDEVRVYRQQVFNVVDHIIDTMSLVLPIKQNSLAWIILMGCEHER
FT                   IHIETSSVIMRMLPLASLTPNECWPTCLQTDSPPNNVLMPVKGSVIDFGKPTSDDSFGW
FT                   DNEYGCATLALDDFHAAKYLVSNEEFLSFVESGGYQNNFLWTQEGQKWLAYSEATMPRF
FT                   WLNKSGEYWQRNLLNEMPLPLDWPVEVNYLEAKAFCNWKNSLGDKVLTIEGKQGHYRLP
FT                   SEAEWLSLREQVEGDLLSWHKAPGNINSEYFASSCPINLFSQGDFYDIVGNVWQWTESA
FT                   IDGFNGFSVHPLYDDFSTPTFDGKHNLIKGGSWISTGNEAMQNSRYAFRRHFFQHAGFR
FT                   YVVSKNENVPNLADNHYETDTKVCQQLHNHFEQLNSLSASLYNKEQQARKDLNLAINEP
FT                   HLANNYLEKLADTIIRVVDKYNVKPMSKCLDLGCNVGGLSFILAKYYASIDAVDFSARY
FT                   IQYGVKLQQGESIRYVMHREGELIDFHEFSLPTQLQEESKKIHFSQGDIGNLKNIFTGY
FT                   DVIVAQNVLEKSYDPALFLAHVHQRLNAQGILVIISDYQFTEEVTDKTKWLGGQKINGE
FT                   NLTGFEALTALLSKKFTLVIEQEVTQIIKTNTRHFEVVQPQLTIWQLREDNRY"
FT   gene            611378..613195
FT                   /gene="typA"
FT                   /locus_tag="CPS_0606"
FT   CDS_pept        611378..613195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="CPS_0606"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by similarity to SP:P32132; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF00679; match to protein family HMM PF03144; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27350"
FT                   /db_xref="GOA:Q489A8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q489A8"
FT                   /protein_id="AAZ27350.1"
FT                   /translation="MLDKLRNVAIIAHVDHGKTTLVDKLLEQSGTLDTRGGLEERTMDS
FT                   NDIEKERGITILAKNTAVNWNGYRVNIVDTPGHADFGGEVERVMSMVDSVLLIVDAQEG
FT                   PMPQTRFVTKKAFAQGLKPILVINKVDKPGSRPDWVMDQVFELFDNLGATDEQLDFKVV
FT                   YASAINGWASLEEGVTGTDMTPLFDTIIKEVPQPIADPEGAFQMQISQLDYNSYLGVIG
FT                   VGRITRGSVKPNQQVTIQLANGGVHNAKVGKVFGYLGLERLDIAEGFAGDIIAITGLGE
FT                   LKISDTVCCPTEVEGLPALSVDEPTINMTFQVNTSPFCGKEGKYVTSRNIKDRLDKELI
FT                   HNVALRVEQLEDADKFKVSGRGELHLGILIENMRREGFELAVSRPEVIIREIDGQLQEP
FT                   YETVTIDVEEQHQGPIMEKMGVRKAELTDMAPDGTGRIRMDFIMPSRGLIGFQTEFMTL
FT                   TSGSGLIYHTFFEYGPHKGGEIGQRKNGVMIGNATGKALTNAIFNLQSRGRMLIGHGVD
FT                   IYEGQVIGIHSRDNDLTVNALKGKQLTNVRSSGTDEAQTLTPPIVMSLEQALEFIDNDE
FT                   LVEVTPESIRIRKKFLKENDRKREGRGVK"
FT   gene            613524..613706
FT                   /locus_tag="CPS_0607"
FT   CDS_pept        613524..613706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0607"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25545"
FT                   /db_xref="GOA:Q489A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q489A7"
FT                   /protein_id="AAZ25545.1"
FT                   /translation="MTPAQLKELQELSHIFSQGKASPQQMQQLSALLAQINCYGEENRA
FT                   EESEQVNFIDTPHFG"
FT   gene            complement(613761..613985)
FT                   /locus_tag="CPS_0608"
FT   CDS_pept        complement(613761..613985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0608"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO4402"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25183"
FT                   /db_xref="GOA:Q489A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q489A6"
FT                   /protein_id="AAZ25183.1"
FT                   /translation="MASQGSAGNVISAICNVFFPGLGQLVQGRLMAALIFAIVCVGGYA
FT                   LWWMVIPAIIAGVFHVWSIIDAATYKDYG"
FT   gene            614083..614994
FT                   /gene="rbn"
FT                   /locus_tag="CPS_0609"
FT   CDS_pept        614083..614994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="CPS_0609"
FT                   /product="ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to SP:P32146; match to
FT                   protein family HMM PF03631; match to protein family HMM
FT                   TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27652"
FT                   /db_xref="GOA:Q489A5"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489A5"
FT                   /protein_id="AAZ27652.1"
FT                   /translation="MLTNMSLFNEKKLISFWHDNKELLFYFTRRVRREQIQVVAGYLSY
FT                   VCLMSLVPLIVVMLSVMTAFPLFAELQQSIEQFVYQNFVPAAGDVVQQYLTGFVANASK
FT                   MSAVAISFLFLAALLLISSIDNTFNKIWRVTDKRRTITSFAMYWMVLTLGPILVGASIA
FT                   LSSYLVSIVAVDEYDVLGLSDMFLRMLPLLSSIIAFIILYIAVPNKAVPFRFALSGAIV
FT                   AGVLFELAKKAFALYITAFPSYQVIYGALATIPIIFLWVYVSWIIVLTGALITVSLQEY
FT                   EILKEKKVKESDRAQVKDEEIS"
FT   gene            614991..615428
FT                   /gene="dtd"
FT                   /locus_tag="CPS_0610"
FT   CDS_pept        614991..615428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="CPS_0610"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to SP:P32147; match to
FT                   protein family HMM PF02580; match to protein family HMM
FT                   TIGR00256"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28346"
FT                   /db_xref="GOA:Q489A4"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489A4"
FT                   /protein_id="AAZ28346.1"
FT                   /translation="MIALIQRVSQASVTVNGEIIGEIEKGLLVFLAIEPLDNEQKAKRL
FT                   AERVAGYRVFNDENDKMNLNVKQAEGNILVVSQFTLAADTSSGMRPSFTTAAKPEFSNH
FT                   LYQFFVTQLRDKGFDVPTGEFAADMKVALINDGPVTFTLTI"
FT   gene            615689..616057
FT                   /gene="rplN"
FT                   /locus_tag="CPS_0611"
FT   CDS_pept        615689..616057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="CPS_0611"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by similarity to SP:P02411; match to
FT                   protein family HMM PF00238; match to protein family HMM
FT                   TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27981"
FT                   /db_xref="GOA:Q489A3"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489A3"
FT                   /protein_id="AAZ27981.1"
FT                   /translation="MIQMQSQLNVADNSGAKRVQCIKVLGGSHRRYARIGDIIKVAVKE
FT                   ASPRGKVKKGDVHTAVVVRTKKGVRRTDGSAIRFDENAAVMLNANLQPIGTRIFGPVTR
FT                   ELRNEKFMKIVSLAPEVL"
FT   gene            616070..616384
FT                   /gene="rplX"
FT                   /locus_tag="CPS_0612"
FT   CDS_pept        616070..616384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="CPS_0612"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by similarity to SP:P02425; match to
FT                   protein family HMM PF00467; match to protein family HMM
FT                   TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28576"
FT                   /db_xref="GOA:Q489A2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489A2"
FT                   /protein_id="AAZ28576.1"
FT                   /translation="MASKIRRDDEVIILAGKDKGKTGKVTKVLVEDGKVFVEGINLIKK
FT                   HTKPVPQLQQPGGIVEKEAPLQVSNVAIVNSATGKADRVGFRIEDGKKVRFFKSNNELI
FT                   "
FT   gene            616397..616942
FT                   /gene="rplE"
FT                   /locus_tag="CPS_0613"
FT   CDS_pept        616397..616942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="CPS_0613"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by similarity to SP:P02389; match to
FT                   protein family HMM PF00281; match to protein family HMM
FT                   PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26957"
FT                   /db_xref="GOA:Q489A1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489A1"
FT                   /protein_id="AAZ26957.1"
FT                   /translation="MAKLHDLYKDTVVAELQKQFGYKSVMQVPRIEKITLNMGVGEAIS
FT                   DKKVLEHATNDLTAISGQKPITTVARKSVAGFKIREGYPIGTKVTLRGERMWEFLERLI
FT                   SISIPRIRDFRGLNPKSFDGRGNYSMGVREQIIFPEIEYDKIDKIRGLDITITTSAKDN
FT                   EEGLALLSAFDFPFKKKV"
FT   gene            616947..617252
FT                   /gene="rpsN"
FT                   /locus_tag="CPS_0614"
FT   CDS_pept        616947..617252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="CPS_0614"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by similarity to SP:P02370; match to
FT                   protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27560"
FT                   /db_xref="GOA:Q489A0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q489A0"
FT                   /protein_id="AAZ27560.1"
FT                   /translation="MAKTSMKAREAKRTKLVAQYAEKRAALKAIISGTDSSDEERWDAV
FT                   LKLQSLPRDSSSSRQRNRCNITGRPHGFLRKFGLSRIKLRETMMRGEVPGLKKASW"
FT   gene            617272..617661
FT                   /gene="rpsH"
FT                   /locus_tag="CPS_0615"
FT   CDS_pept        617272..617661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="CPS_0615"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by similarity to SP:P02361; match to
FT                   protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28152"
FT                   /db_xref="GOA:Q488Z9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Z9"
FT                   /protein_id="AAZ28152.1"
FT                   /translation="MMTDPIADMFTRIRNGQSAAKVAVQMPSSKVKVAIATLLKEEGYI
FT                   SEFSVSGEVKPELAVTLKYFEGKEVIEKIKRVSRPGLRIYKSCDELPKVLAGMGIAIIS
FT                   TSKGLMTDRAARSAGIGGEVLGFVE"
FT   gene            617672..618205
FT                   /gene="rplF"
FT                   /locus_tag="CPS_0616"
FT   CDS_pept        617672..618205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="CPS_0616"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by similarity to SP:P02390; match to
FT                   protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28521"
FT                   /db_xref="GOA:Q488Z8"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Z8"
FT                   /protein_id="AAZ28521.1"
FT                   /translation="MSRVAKAPVVVPAGVTITLSGQDITVKGPIGELSRTIHSDVVVSQ
FT                   EENNIITNIVADVKGAWAQAGTTRALINNMVEGVSKGFEKKLVLQGVGYRAKAAGKSLD
FT                   LSLGFSHPIKHAIPEGITCETPSQTEVTLKGCDKHLVGQTAANIRAYRKPEPYKGKGVR
FT                   YVDEYVRRKEAKKK"
FT   gene            618215..618568
FT                   /gene="rplR"
FT                   /locus_tag="CPS_0617"
FT   CDS_pept        618215..618568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="CPS_0617"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by similarity to SP:P02419; match to
FT                   protein family HMM PF00861; match to protein family HMM
FT                   TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26308"
FT                   /db_xref="GOA:Q488Z7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Z7"
FT                   /protein_id="AAZ26308.1"
FT                   /translation="MDKRSSRLRRAKRARAKISELGANRLVIFRTPRHIYAQLIAPTGS
FT                   EVIASASTLDKEVSAQIEKTGNVAAATAVGKAIAERAVAKGITKIAFDRSGFLYHGRVK
FT                   ALAEAAREAGLQF"
FT   gene            618578..619087
FT                   /gene="rpsE"
FT                   /locus_tag="CPS_0618"
FT   CDS_pept        618578..619087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="CPS_0618"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by similarity to SP:P02356; match to
FT                   protein family HMM PF00333; match to protein family HMM
FT                   PF03719; match to protein family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24388"
FT                   /db_xref="GOA:Q488Z6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Z6"
FT                   /protein_id="AAZ24388.1"
FT                   /translation="MANHNQENSQQSDMAEKLIAVNRVSKVVKGGRIFSFTALTVVGDG
FT                   NGRVGFGYGKAREVPAAIQKAMEKAHRNIVTIDLKGTTLQHVITGKHSGSKVFMKPASE
FT                   GTGIIAGGAMRAVLEVAGVQNVLSKAYGSTNPINVVRATVSALVNMHSPEGMAAKRGKR
FT                   VDEILG"
FT   gene            619088..619273
FT                   /gene="rpmD"
FT                   /locus_tag="CPS_0619"
FT   CDS_pept        619088..619273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="CPS_0619"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by similarity to SP:P02430; match to
FT                   protein family HMM PF00327; match to protein family HMM
FT                   TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25628"
FT                   /db_xref="GOA:Q488Z5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Z5"
FT                   /protein_id="AAZ25628.1"
FT                   /translation="MRMSKTVKVTQLKSSIGRLPKHRATLKGLGLRRINHTVELEDTPS
FT                   VRGMINKVYYMVKVED"
FT   gene            619276..619710
FT                   /gene="rplO"
FT                   /locus_tag="CPS_0620"
FT   CDS_pept        619276..619710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="CPS_0620"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26195"
FT                   /db_xref="GOA:Q488Z4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Z4"
FT                   /protein_id="AAZ26195.1"
FT                   /translation="MHLNTLSPAPGSHKARKRCGRGIGSGIGKTGGRGHKGQKSRSGGS
FT                   VRPGFEGGQMPLKQRLPKFGFTSRKSLVRAEVRLHELNLITGDVVDIHALKDAGLITRN
FT                   IVAVKVMLSGEITRPITLRGIAVTKGAQAAIEAAGGKVEE"
FT   gene            619717..621054
FT                   /gene="secY"
FT                   /locus_tag="CPS_0621"
FT   CDS_pept        619717..621054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="CPS_0621"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by similarity to SP:P03844; match to
FT                   protein family HMM PF00344; match to protein family HMM
FT                   TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27193"
FT                   /db_xref="GOA:Q488Z3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q488Z3"
FT                   /protein_id="AAZ27193.1"
FT                   /translation="MATPGTATSQGSKGAGGLSELKQRLWFVFVALVVLRLGSFVPIPG
FT                   IDAAVLAQFFEQQKGTIVEMFNMFSGGALERASVLALGIMPYISASIIMQLLTVVHPAM
FT                   AELKKEGEAGRRKISQYTRYGTLVLATVQSIAIARSLPEMMQGLVINAGFSFYFTAVIS
FT                   LITGTMFLMWLGEQITERGIGNGISIIIFAGIVAGMPSAVGQTAEMARQGELHLLVLLL
FT                   IGVVVFAVTFLVVFVERGQRRIVVNYAKRQQGRKVFAAQSTHLPLKVNMAGVIPPIFAS
FT                   SLILFPGTLASWFGQGDGPVADFLQGVSGAMSPGQPLYVMMLAAAIIFFCFFYTALVFN
FT                   PRETADNLKKSGAFIPGIRPGEQTSKYIDKVMTRLTLCGAAYITFVCLVPQFMIMAWDV
FT                   QFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYDNVLKKANLKGYGR"
FT   gene            621085..621198
FT                   /gene="rpmJ"
FT                   /locus_tag="CPS_0622"
FT   CDS_pept        621085..621198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="CPS_0622"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27117"
FT                   /db_xref="GOA:Q488Z2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Z2"
FT                   /protein_id="AAZ27117.1"
FT                   /translation="MKVRASVKKICRNCKVVKRKGVIRVLCVEPKHKQRQG"
FT   gene            621350..621706
FT                   /gene="rpsM"
FT                   /locus_tag="CPS_0623"
FT   CDS_pept        621350..621706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="CPS_0623"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by similarity to SP:P02369; match to
FT                   protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24238"
FT                   /db_xref="GOA:Q488Z1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Z1"
FT                   /protein_id="AAZ24238.1"
FT                   /translation="MARIAGINIPDRKHAVIAITAIYGIGATRAKAICAATGIAESTKI
FT                   SELDEAKIDLLRAEVDKFTVEGDLRREVSMNIKRLMDLGCYRGIRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            621720..622109
FT                   /gene="rpsK"
FT                   /locus_tag="CPS_0624"
FT   CDS_pept        621720..622109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="CPS_0624"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by similarity to SP:P02366; match to
FT                   protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24770"
FT                   /db_xref="GOA:Q488Z0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Z0"
FT                   /protein_id="AAZ24770.1"
FT                   /translation="MAKTPVRTRKRVKKQVADGMAHIHASFNNTIVTLTDRQGNALSWA
FT                   TAGGSGFRGSRKSTPFAAQVAADRAGAVAKEFGLKNIEVFVKGPGPGRESAIRALNAAG
FT                   FKITNITDVTPIPHNGCRPPKKRRV"
FT   gene            622142..622762
FT                   /gene="rpsD"
FT                   /locus_tag="CPS_0625"
FT   CDS_pept        622142..622762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="CPS_0625"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by similarity to SP:P02354; match to
FT                   protein family HMM PF00163; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24190"
FT                   /db_xref="GOA:Q488Y9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Y9"
FT                   /protein_id="AAZ24190.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIETIPGQHGARR
FT                   GRLSDYGVQLREKQKVRRIFGVLEKQFSNYYKEAARQKGNTGENLLQLLETRLDNVVYR
FT                   MGYASTRAEARQLVSHKAIVVNGVVVNIPSFTVKAEDTVSVREKSKTQARIIAALELAD
FT                   QREKPLWVEVDTKKLEGVFKRVPDRADLSAEINEQLIVELYSK"
FT   gene            622788..623777
FT                   /gene="rpoA"
FT                   /locus_tag="CPS_0626"
FT   CDS_pept        622788..623777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="CPS_0626"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P00574; match to
FT                   protein family HMM PF01000; match to protein family HMM
FT                   PF01193; match to protein family HMM PF03118; match to
FT                   protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25824"
FT                   /db_xref="GOA:Q488Y8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Y8"
FT                   /protein_id="AAZ25824.1"
FT                   /translation="MQGSVTEFLRPRLVGIETVSPRRAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDIIEILLNLKGLAVILEGKNEAVLTVTK
FT                   SGEGPVTAADIQHDGDVTIANPDHVICTLTGEGSISMRIKVEMGRGYVPASARRDAEEE
FT                   DRAIGRLLVDASFSPVVRIAYDVDSARVEQRTDLDKLVLDMETNGTLDPEEAIRRASTI
FT                   LAEQLDAFVELRDIKEVEQVEEKPLFDPILLRPVDDLELTVRSANCLKAEAIQYIGDLV
FT                   QRAEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPESIVDND"
FT   gene            623821..624225
FT                   /gene="rplQ"
FT                   /locus_tag="CPS_0627"
FT   CDS_pept        623821..624225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="CPS_0627"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by similarity to SP:P02416; match to
FT                   protein family HMM PF01196; match to protein family HMM
FT                   TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25202"
FT                   /db_xref="GOA:Q488Y7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Y7"
FT                   /protein_id="AAZ25202.1"
FT                   /translation="MRHRQSGRQLNRNSSHRQAMFRNMASSLVKHGVIKTTVAKAKELR
FT                   RVLEPLITLAKTDSVANRRLAFARTQDKEVVGILFNELGARYQERPGGYTRILKCGFRT
FT                   GDKAPMAYIELVDRPVVEDAPEVVEESAEA"
FT   gene            624421..625320
FT                   /gene="prkB"
FT                   /locus_tag="CPS_0628"
FT   CDS_pept        624421..625320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkB"
FT                   /locus_tag="CPS_0628"
FT                   /product="phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="identified by similarity to SP:P37307; match to
FT                   protein family HMM PF00485"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27371"
FT                   /db_xref="GOA:Q488Y6"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q488Y6"
FT                   /protein_id="AAZ27371.1"
FT                   /translation="MSSRNPIIAVTGSSGAGTSTTTASFEHIFRTLGISSVNVEGDSFH
FT                   RFSRQEMDMEKRKAKEARKNISYFGDLANDFSALEKQFRDYSETGRGQIRRYLHTFDEA
FT                   VPYNQMPGTFTPWEEFGEGTDLLYYEGLHGGVVTKDNDVAKHVDLLIGMVPIVNLEWIQ
FT                   KIIRDTNKRGHSREAVTASIVRSMEDYISFITPQFSRTHINFQRVPTVDTSNPFSAKAI
FT                   PSLDESFVVIRFREVKNVDFQYYLRMIDGSFMSRINTLVVPGGKMGLAMELILTPLIRD
FT                   LMDRKNQANKQLDWMSDL"
FT   gene            complement(625655..627535)
FT                   /locus_tag="CPS_0629"
FT   CDS_pept        complement(625655..627535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0629"
FT                   /product="GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26907"
FT                   /db_xref="GOA:Q488Y5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q488Y5"
FT                   /protein_id="AAZ26907.1"
FT                   /translation="MFIKQCLVTFLIIASYISSIFFCLSVNANENKRADVIIALFKTNK
FT                   PASPEQADSLLQELKSTIASNDFLRQKEYIRAKCWNQKAETNEQIISAISYANEQLDIF
FT                   SQYTPSKITIDLTLCKTSYQRLLGQVETTLKDLTTAINQAYTIEAQLLVAHGHSQRGTL
FT                   HSYQGNYSASLEDLLTAQNHYESLKLTYWANINLGELATSYRRFGDARTALKYQLQLEE
FT                   IYIKEGKIFEANGINIQIASSLEQLNKLDEANTRYQVSQQFLLNKQPVIAADMSINIAN
FT                   NLITLGQYDKALTILQQAESTITPEFNAPYSFLQLYLANAQLKLNNYPASLHALQNAEA
FT                   AFLIDKNQRGLSKVHLLRSNIHEANKSWKSAYFALRNHLHVHLAQDKSVLTKLNAELQT
FT                   RFDTDRIKHENTLLVQHAKDKEIQLNMLQRNKSMQFIIITLVGIILILVSIFAYKQMHH
FT                   KHQFKKLAFTDELTKIANRRETYFQAEKCLTYSKKNQTPFSLIFFDADYFKLVNDELGH
FT                   NIGDQVLICLANIASNVIRKGDVVGRVGGEEFIILLPDTDIDTALSIANRLLTNIEQYE
FT                   WSIISNDLTQTVSAGVVSYQGENDLSELLFKADKALYEAKAAGRNHIKTF"
FT   gene            complement(627757..628515)
FT                   /gene="speD"
FT                   /locus_tag="CPS_0630"
FT   CDS_pept        complement(627757..628515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="CPS_0630"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /EC_number="4.1.1.50"
FT                   /note="identified by similarity to SP:P09159; match to
FT                   protein family HMM PF02675"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27847"
FT                   /db_xref="GOA:Q488Y4"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/TrEMBL:Q488Y4"
FT                   /protein_id="AAZ27847.1"
FT                   /translation="MNTDNKIPLYGFNNLTKSLSFSLYRVYYLPSIQSVESYNTYINRT
FT                   YNSALLEVLLTKVCHAIGGNVLNIASQDYTPQGASVTLMISEEAKPESLVAHLDKSHLC
FT                   IHTYPEETAQSGIAIFRADIELSTCGIISPLKVLDYVIEAFSADVIDIDYRIRGMTRDQ
FT                   YGKKHFNDHEISQISEHLTTDTLAKYQVKDSVMTTHNLFHCKLARQSIELRQHIFNLDS
FT                   NLGEHQLSAQDEIQIKTQLAIELDELFIGK"
FT   gene            complement(628528..628932)
FT                   /locus_tag="CPS_0631"
FT   CDS_pept        complement(628528..628932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0631"
FT                   /product="OsmC family protein"
FT                   /note="identified by similarity to OMNI:NTL01ST3363; match
FT                   to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27967"
FT                   /db_xref="GOA:Q488Y3"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q488Y3"
FT                   /protein_id="AAZ27967.1"
FT                   /translation="MEAQVKWLGEELFMGTSESGHTMVLDANGGNLAPSPMEAVLISLG
FT                   GCSSVDVVSILQKARQSIIGCHVDISGTRVDSVPALFEKIHLHFVITGADVAAKHVERA
FT                   VNLSADKYCSVALMLNAKVDITHDFEIVAS"
FT   gene            complement(629147..629491)
FT                   /locus_tag="CPS_0632"
FT   CDS_pept        complement(629147..629491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0632"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO2891"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27370"
FT                   /db_xref="GOA:Q488Y2"
FT                   /db_xref="InterPro:IPR020979"
FT                   /db_xref="UniProtKB/TrEMBL:Q488Y2"
FT                   /protein_id="AAZ27370.1"
FT                   /translation="MVTDTDGYIQIIEYLTEHLSLFENSTAPAQASETVMSAIEVELCD
FT                   QIISVCSQNQDLTFNQRNAIIREVDAIVYDLEEILSGVINNPVNAAQQAFIKEFAGLIK
FT                   NLFDTVIHKE"
FT   gene            complement(629665..630855)
FT                   /gene="astE"
FT                   /locus_tag="CPS_0633"
FT   CDS_pept        complement(629665..630855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astE"
FT                   /locus_tag="CPS_0633"
FT                   /product="succinylglutamate desuccinylase"
FT                   /note="identified by similarity to SP:P76215; match to
FT                   protein family HMM PF04952"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28059"
FT                   /db_xref="GOA:Q488Y1"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016681"
FT                   /db_xref="UniProtKB/TrEMBL:Q488Y1"
FT                   /protein_id="AAZ28059.1"
FT                   /translation="MQNNNTLTAANLTDITSDNFTQAYRHFVEQGDFIALTRQFEQGFV
FT                   QTGADNQLSFKVKQAKVSLLDTGVLLIEPENVEPELIKEKSATPSKSIVISSGIHGNET
FT                   APIEIVQQLISDIIAQKIQVKHRTLLIMGNPVSMNIAKRFQTENLNRLFCGKYQDIDPC
FT                   FEKYRAEKLEGYVSDFFNAGTATNATDNTSGNTRESQVTNSSKMTNYHYDLHTAIRNSK
FT                   YEKFAIYPYQAGKPWDKEQLSFMASCGVNTILFGHGPSGTFSYFSSANFSAHAFTIELG
FT                   KVRPFGENNMANFQAMTNNLSALISDEAIPLKSFDNNDFNLFEALGDITKVSDKFELYV
FT                   ADEASNFTDYPVGTLLSTDMNQEYRTTLLGESIVFPNANVGNGQRAVLMVVPTTLQ"
FT   gene            complement(630856..632334)
FT                   /gene="astD"
FT                   /locus_tag="CPS_0634"
FT   CDS_pept        complement(630856..632334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astD"
FT                   /locus_tag="CPS_0634"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by similarity to SP:P76217; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28301"
FT                   /db_xref="GOA:Q488Y0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q488Y0"
FT                   /protein_id="AAZ28301.1"
FT                   /translation="MSHANPVQFINGQWQAGLGHDVSSSNPARNEVIWQGKTASKDQVN
FT                   DAVLSARQAFESWANISLEARVAVVTKFAELLAENKDALATTIALETGKPKWETTGEAG
FT                   AMVAKVAISLKAYNERTGTVENPMPGAKAFIRHKPHGVVAIFGPYNFPGHLPNGHIVPA
FT                   LIAGNTIVFKPSELTPRVAQEMLKLWEQAGLPNGVINLVQGEVETGKALASHKLIDGLF
FT                   FTGSSNTGHILHEQFAGQPGKILALEMGGNNPLVVKDVSDIDAVVHDIVQSAFVTTGQR
FT                   CTCARRLFIEANEQGDAILARLIEVTKNLTIGYYDDEAQPFMGSMISEKAALSLVDAQA
FT                   KLLALGAKSVLDLKHLEVGTGFVSPGIIDVSDIIADIPDEEYFGPLVKLYRYNDFDKAI
FT                   DEANNTGFGLSAGLLSDSEASYNHFFTRIRAGIVNWNKPITGASSAAPFGGIGASGNHR
FT                   ASAFYAADYCAYPIASVEAEKVSLPETLTPGMKF"
FT   gene            complement(632460..633476)
FT                   /gene="astA"
FT                   /locus_tag="CPS_0635"
FT   CDS_pept        complement(632460..633476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astA"
FT                   /locus_tag="CPS_0635"
FT                   /product="arginine N-succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /note="identified by similarity to SP:P76218; match to
FT                   protein family HMM PF04958"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24234"
FT                   /db_xref="GOA:Q488X9"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X9"
FT                   /protein_id="AAZ24234.1"
FT                   /translation="MIIVRPIKTSDLKALYQIAIDSGHGFTSLPVNEQLLQQRISLAEE
FT                   SFSKEVSQAGKEGYLFVMEDTETGDVVGTSGIEAAVGLDDAFYHYHLGKVVHSSRELNI
FT                   YNTVETLSLCNDYTGASEICTLFLSNSHRKNNNGRFLSRFRFLFIAEHKERFSDTIIAE
FT                   MRGVSDNEGRSPFWNWLEEHFFSMDFPTADYLTGIGKKEFIAELMPKYPIYVNLLSKEA
FT                   QDVIDKVHPQTVPALRLLEAEGFARRGYVDIFDAGPTVESNVNNIRSVNQSKRCQVIID
FT                   EVQSTDNYIICNSKVEDFRATQAPLSLRDTANQVVISQAVADALMVSAGDWVRIISN"
FT   gene            complement(633570..634781)
FT                   /gene="argD"
FT                   /locus_tag="CPS_0636"
FT   CDS_pept        complement(633570..634781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="CPS_0636"
FT                   /product="acetylornithine/succinyldiaminopimelate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.17"
FT                   /note="identified by similarity to SP:P18335; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00707"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25133"
FT                   /db_xref="GOA:Q488X8"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X8"
FT                   /protein_id="AAZ25133.1"
FT                   /translation="MSEHFSVERGLFDDVMVPNYAPSAVIPVRGQGSRVWDQQDKEYID
FT                   FAGGIAVSALGHCHPALVGALKEQGEKIWHLSNVQTNEPALRLAKKLVDSTFAEKVYFC
FT                   NSGAESNEAALKLARRWALDVHGADKSQIIAFKQGFHGRTFFTVTVGGQAAYSDGFGPK
FT                   PGDIDHAEYNNLDSLKALISDKTCAVMIEPLQGEGGIVSPTDEFIKGVRALCDQHNALL
FT                   IFDEVQTGVGRLGELYAYMDLGVTPDILTSAKGLGGGFPIGAMLTTTEIAKHLKIGTHG
FT                   STYGGNPLACAVSEAVLDTVNTTEVLAGIKAKAKLYVDGLNAINAKYNVFSEIRGKGLL
FT                   IGAVLTEKYQGQAKTFLNAAMDEGVMVLVAGASIIRFAPSLVIPDEDIALGLARFEKAI
FT                   VSLV"
FT   gene            complement(635450..636490)
FT                   /locus_tag="CPS_0637"
FT   CDS_pept        complement(635450..636490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0637"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO0615"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25683"
FT                   /db_xref="GOA:Q488X7"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X7"
FT                   /protein_id="AAZ25683.1"
FT                   /translation="MVDHQGSEQENRRRELLSVEVQAQQEKIIAEHGEEHFRKQTKQNF
FT                   FSRLRTQINSDFDNKEHLYHYVLGIEDACPAILDILSARAASVNQIKDLAASLSWLTID
FT                   LISLVNKPQYRKRADVQVTDAKLALSYIGLDNLKLVMPTFTLKHWLPTSTAPYGLMKRK
FT                   LWNDSLSIALASRVLAKEQGLDEFTAFTTGMLSNIGRLAVTRCYLTKFSEMHKKEVREA
FT                   FEKKDKRLHNVLSKIETSEELLLEQLIMRSSQLSADLIEKMHFKRLAITEPIFDLAYAD
FT                   NIEKMHPIAQLVAKAKAYVAFRALAKEELIDSDESKKLLSTVNLTPAEITLLKKSDIDH
FT                   IKLNFN"
FT   gene            complement(636703..637302)
FT                   /gene="pabA"
FT                   /locus_tag="CPS_0638"
FT   CDS_pept        complement(636703..637302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="CPS_0638"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by similarity to PIR:A01122; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24848"
FT                   /db_xref="GOA:Q488X6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X6"
FT                   /protein_id="AAZ24848.1"
FT                   /translation="MLLMIDNYDSFTFNLVHYFQALGQEVVVYRNNEISLKEIEQLTPQ
FT                   YIVISPGPCDPDSAGISLDVVKEFAGKIPLLGVCLGHQCIAQHFGASVVKAKKVMHGKT
FT                   SKISHNQQGLFAELNHPLQVTRYHSLIVDKQSLPAELTMTAWSQNEQGEVDEIMALEHK
FT                   TLPISSVQFHPESILTEQGQCLLANFIKQFKNYPIS"
FT   gene            complement(637472..638674)
FT                   /locus_tag="CPS_0639"
FT   CDS_pept        complement(637472..638674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0639"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:CC0608"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26130"
FT                   /db_xref="GOA:Q488X5"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X5"
FT                   /protein_id="AAZ26130.1"
FT                   /translation="MKTVVNKFTLTLISAAILAAPTAFAGETEHGNSITEALSESTVKV
FT                   NLRARYEGVDQDGIDKKAAALTLKSRITIDTGSYSNFSLGLEVDKVDALVDDYNSTQNG
FT                   NTEYPVVVDPQSTDVNQAFIKYANNGFSAVVGRQRVLHNNQRFVGGVGWRQNEQTYDGV
FT                   RAQYKADAFLADYSYIQNINDIKGGNVKGDFHLVNAKYNINKSHKLAGFAYLLDYDAVA
FT                   NYKNSSSTVGALYNGKFGKFLVNASLATQSDNGDNPMSYSAMYINAEAGYNFGQVTVLG
FT                   GYELLGSDDGKVAFNTPLATKHKFNGWADKFLGTPKEGLQDIYLTAKGKVSGVKWAATY
FT                   HDFSSDEGSIDFGNELDLVATYQINKNYGVLVKAANYSEGDSGIAPTDTNKLWVQMTAK
FT                   F"
FT   gene            639049..639276
FT                   /locus_tag="CPS_0640"
FT   CDS_pept        639049..639276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0640"
FT                   /product="putative glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25909"
FT                   /db_xref="GOA:Q488X4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X4"
FT                   /protein_id="AAZ25909.1"
FT                   /translation="MKRVVLYTMEKCPHCQTAKRYLEQQGIAFRLCNIKTAKGQKEFSA
FT                   TGFRGVPVLKVGDQLLNGFSVQAFTELYKN"
FT   gene            639577..639915
FT                   /locus_tag="CPS_0641"
FT   CDS_pept        639577..639915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0641"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="identified by similarity to SP:P05826; match to
FT                   protein family HMM PF00543"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26621"
FT                   /db_xref="GOA:Q488X3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X3"
FT                   /protein_id="AAZ26621.1"
FT                   /translation="MKIISAIIKPFKLDDVREAISEVGVEGITVSEVKGFGRQKGHTEL
FT                   YRGAEYQVDFLPKVKIEIAVNEELVERLVEAITKSAYTGKIGDGKIFVYNLEQAIRIRT
FT                   GEQDSEAL"
FT   gene            639928..641208
FT                   /locus_tag="CPS_0642"
FT   CDS_pept        639928..641208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0642"
FT                   /product="putative ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26981"
FT                   /db_xref="GOA:Q488X2"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR019879"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X2"
FT                   /protein_id="AAZ26981.1"
FT                   /translation="MEQNIFQLQYALDTFYFLICGALVMWMAAGFSMLEAGLVRAKNTT
FT                   EILTKNVALYAIACIMYLVVGYDIMYGGGVFLNGIALDGASDAEALVGAVLAESAEAGF
FT                   DGGAVYSNASDFFFQVVFVATAMSIVSGAVAERMKLWAFLAFTVVLTGFIYPMEGSWTW
FT                   NGDAVFGLYTLGDLGFSDFAGSGIVHMAGASAALAGVLLLGARKGKYSKDGKVNAIPGA
FT                   NLPMATLGTFILWMGWFGFNGGSVLKLADINSANSVAMVFLNTNAAAAAGAISALIFAK
FT                   ILFKKADLTMTLNGALAGLVAITAEPSTPSPLQATIFGAIAGVIVVMSILALDKVKIDD
FT                   PVGAISVHGVVGFFGLMIVPITNSSSSFSGQLIGAATIFVWVFVTSFIVWFALKKVIGI
FT                   RVSAEEEYEGVDISDCGMEAYPEFTRG"
FT   gene            complement(641366..642238)
FT                   /gene="ppiA1"
FT                   /locus_tag="CPS_0643"
FT   CDS_pept        complement(641366..642238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiA1"
FT                   /locus_tag="CPS_0643"
FT                   /product="peptidyl-prolyl cis-trans isomerase A"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P20752; match to
FT                   protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27483"
FT                   /db_xref="GOA:Q488X1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X1"
FT                   /protein_id="AAZ27483.1"
FT                   /translation="MFTQITKKNTRKIFALVGIATATLGIANTATATIVAIKTSLSPDS
FT                   IEINLFDKTTPETVKNFLNYIDNGHYTNSVVHRVSPGFVVQAGGFEFSGTWPLTPLEPN
FT                   APVVNEPVYSNVKGTIAMAKKGNDVNSATNQWFFNLKDNNDTSDANNLDRQNGGFTVFG
FT                   QVIKGFDIIEKISLIQNLCTNGALQGIPMIIESNKTCTDMVVPGPENFVVIEQVTIIDS
FT                   SGVTDDGLNPLLSKYPDSDGDGVKDIDDAFPSDPNKSVPDVEDSGGSMTWFTIAMLGLL
FT                   ATRKRFIES"
FT   gene            642533..642928
FT                   /locus_tag="CPS_0644"
FT   CDS_pept        642533..642928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:28807037"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28445"
FT                   /db_xref="GOA:Q488X0"
FT                   /db_xref="UniProtKB/TrEMBL:Q488X0"
FT                   /protein_id="AAZ28445.1"
FT                   /translation="MRKLLLVSIFMLLSSLSSFAQADMKLGVALDMDLSLVAQIDRYNI
FT                   VLGDRGFAVDYLIKTGQFDNKTPLSWYFAGGGWTEWDDGFGVRAPVGISWYFAKGWDLY
FT                   GQVQPVANFDDGFKFSVDGAVGVRFSF"
FT   gene            643090..643944
FT                   /locus_tag="CPS_0645"
FT   CDS_pept        643090..643944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0645"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01AA00564"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24160"
FT                   /db_xref="GOA:Q488W9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W9"
FT                   /protein_id="AAZ24160.1"
FT                   /translation="MRWRYFIILQAIILLIAAGLVYKHQDKAKLIKTPPIELAKWYKPD
FT                   NKRQVWLHNMFKLRREMQAVEFYAQQQDAEHLQVWTEQLTEHYLKIADMVPAWQKKLSI
FT                   NTMEELKFASEQQDFTSVLVQHKTLQKSCDSCHDDYQAITALTYRTPDFSNIQITPELS
FT                   FVEHMDMLTRQVNQIKISAQDGNKSLALSSLADLNDEMATLGETCVDCHKKDRKPYPSE
FT                   MMKKTLSSLKTSIESGTAKQQGRDLGTLAVLACARCHGTHRIAYGAKKHLVKEVSFSNL
FT                   IKH"
FT   gene            644004..644111
FT                   /locus_tag="CPS_0646"
FT   CDS_pept        644004..644111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0646"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24802"
FT                   /db_xref="GOA:Q488W8"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W8"
FT                   /protein_id="AAZ24802.1"
FT                   /translation="MGECVHYYLPLVSLRFFINANLIKIKPEEQLLLLY"
FT   gene            644205..644426
FT                   /gene="feoA"
FT                   /locus_tag="CPS_0647"
FT   CDS_pept        644205..644426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="CPS_0647"
FT                   /product="ferrous iron transport protein A"
FT                   /note="identified by match to protein family HMM PF04023"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25199"
FT                   /db_xref="GOA:Q488W7"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W7"
FT                   /protein_id="AAZ25199.1"
FT                   /translation="MTLAELPLNKPAKISALPKDEAIAAQLIEQGFTLRSHVSLAHKAP
FT                   FNGPMAFRLHNTKISIQRDIAKQIGVNF"
FT   gene            644477..646660
FT                   /gene="feoB"
FT                   /locus_tag="CPS_0648"
FT   CDS_pept        644477..646660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="CPS_0648"
FT                   /product="ferrous iron transport protein B"
FT                   /note="identified by match to protein family HMM PF02421;
FT                   match to protein family HMM PF07670; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00437"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24116"
FT                   /db_xref="GOA:Q488W6"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W6"
FT                   /protein_id="AAZ24116.1"
FT                   /translation="MKQSKHFALVGFANSGKSTLFNLLLSDSESNKKQSKQNVGNWSGV
FT                   TVAAKKTSITLNNNAAYLSDLPGLSSLERHAEQGKDLTISQSFLQGNDIDFLVNVVDIN
FT                   QLSRQLYLTSQLLELGVPMIVVLNKIDRQKHLDIDISQLAAELGCPIVAISAQRDDALK
FT                   KVQQALGQLNGDLSAVHQKIIDNAHTESKDKPEPNVKVMHARYDYITDMLARVSSVEAT
FT                   NAAFANPTSSNKPFSEKIDSLVLHPITGIPVFLGVMYLLFMFAINVGSAFIDFFDIISG
FT                   TLFVEYPLHFLAPLDLPQWILTIVEGLGSGMQTVATFIPIIACLFIGLSLLESSGYLAR
FT                   AAFVVDSLMQKIGLPGKAFVPLIVGFGCTVPAVMSARILDSERERITTVMMSPFMSCGA
FT                   RLPVYALFAAAFFPDNGQNLVFLLYLVGIAAAIFTGFLLKKTVLSGTTSLNIMELPQYE
FT                   MPRIGALSKRVWQRTSSFVTGAGKTIVIVVCLLNFFNSIGIDGKFGSQDSENSVLSQGA
FT                   KVVMPLLAPMGVQEDNWQAGVGIITGIFAKEVLVATFNNLYSPHASEGEGAPSLVQSWQ
FT                   DATDSIKENLFGISPDDPLGISVGDISDLNIAAQEQGVELTTYQRMQLAFVSQLGAFSY
FT                   LLFILLYTPCVAAMGAIKNEVGSRWAGFAGIWSFVFAYLVSTLCYQIGNFLASPLSSSI
FT                   TIALALLTFVLIYFWLKHKGKKVLTIPVRVSYS"
FT   gene            647258..648301
FT                   /gene="pfkA"
FT                   /locus_tag="CPS_0649"
FT   CDS_pept        647258..648301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="CPS_0649"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by similarity to SP:O34529; match to
FT                   protein family HMM PF00365"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24359"
FT                   /db_xref="GOA:Q488W5"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W5"
FT                   /protein_id="AAZ24359.1"
FT                   /translation="MNNKKTTSIKRIALLTSGGDAPGMNAAIRSVVLAAHHYHIEVIGF
FT                   YHGYNGLVCEEHIAMAEPLTLLKVNSIIHLGGTILKSARCQLMHEAKGLQLAADTLNDK
FT                   NIDALVVIGGDGSFSGLLALQAYWSGQMIGIPGTIDNDLDGTDYTIGFATAVNTGIEAI
FT                   DKIRDTADAFERIFIVELMGRHCGHITFNVGIACAAEQVLSFENFNANEQSSKLQQLAT
FT                   EITTAKKNRHSSYIIVIAENLWPGGAVELARQLHLQADIECTPCILGHIQRGGSPIAKD
FT                   RILATKMGVAAVQALIDGESNIMVAEQNNAMNFITLDEAIKHKKVVSKQLIDAQQNILA
FT                   LTAQTQC"
FT   gene            complement(648387..649877)
FT                   /locus_tag="CPS_0650"
FT   CDS_pept        complement(648387..649877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0650"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by similarity to SP:P35164; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26658"
FT                   /db_xref="GOA:Q488W4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W4"
FT                   /protein_id="AAZ26658.1"
FT                   /translation="MKTSLYQRLALTLCATFMVMASLLVAWSNSLVQQSKYQAEQKLHV
FT                   NLAEHLAHDNPLLQDGVYDKAALENLFHTLMLLGPSFEFYFLDTQGNILTYSADPAKIK
FT                   RKSVSLIPLKKLIDKPQQVPVFGDDPRDINNKKIFSASPVYQGELLQGYLYIIIGGEIY
FT                   DSIFSQVQSDKDLQKYGAFVVAGLFLFLLVLLAVFRYFTRPVRELATQMQALKAVKFDQ
FT                   TKVELKQWGSESSQNIDSNEVHFLGATFNDMVVQINQQFSLLTENDRIRRELLAHLSHD
FT                   LRTPLATMQGYIEILAIKGDNLSSIEKQDYLATVQRNVSQLKRLIDQIFELAHLENGQV
FT                   TVNLETFPIGELLHDILAKFTLKAAEKNIALTLQPQPCQFIVYSDIAKLERIMTNLLEN
FT                   AIRHTDNGGDIVMTVTQLSTQVKVSVTDNGSGISKEDIAYIFDARYRASNAIEDSTQHA
FT                   GLGLAISQKLSQVINSELMVKSELGNGSSFSLSLPMLP"
FT   gene            complement(649884..650666)
FT                   /locus_tag="CPS_0651"
FT   CDS_pept        complement(649884..650666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0651"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by similarity to SP:P13792; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28571"
FT                   /db_xref="GOA:Q488W3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W3"
FT                   /protein_id="AAZ28571.1"
FT                   /translation="MKDNILIIEDEIDIAKLIKVHLSELDLNCDICTQGNEALQQALTK
FT                   DYQLILLDVMLPGISGLDICRQVRQEKPLQSIIMLTSKTSEIDRILGLELGADDYMTKP
FT                   FSVRELQARVRSQLRRVHAITAKNASEINSLVHEEKPVQESAQLDKTSTSIGQLLVDHR
FT                   FHQVTYKNKAINLTVTEFELIDFFCQHPDQVFSRAQLLDGVWGYHHNGYEHTVNSHINR
FT                   LRSKLEEDCTEPKIIQTVWGVGYKLNSAGVMPSTVCKD"
FT   gene            complement(650711..651442)
FT                   /locus_tag="CPS_0652"
FT   CDS_pept        complement(650711..651442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0652"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:28809920"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24917"
FT                   /db_xref="GOA:Q488W2"
FT                   /db_xref="InterPro:IPR038678"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W2"
FT                   /protein_id="AAZ24917.1"
FT                   /translation="MLTFNTQKKSTNKLAKPLLIASLLTLGLSACNDNDNDAPPPVETP
FT                   MEYSYSLTLTNLTYAQPLSPVAVSLHGDAKMWQVGQAASVALEKLAEGGDNADFIALEN
FT                   NLATATAEGPTLPGTSVTVNISTMDRAATYLTVATMLVNTNDAFSGLTGVDISTLTLNQ
FT                   EKSWRLNVYDSGTEQNNEAAGTIPGPADGGVGYDSTRDDIDLVGYHSGVVSKDDGLPSS
FT                   VLTQAHRFDNPAVKLTITRTK"
FT   gene            complement(651452..652171)
FT                   /locus_tag="CPS_0653"
FT   CDS_pept        complement(651452..652171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0653"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:28809921"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25364"
FT                   /db_xref="GOA:Q488W1"
FT                   /db_xref="InterPro:IPR009465"
FT                   /db_xref="InterPro:IPR038678"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W1"
FT                   /protein_id="AAZ25364.1"
FT                   /translation="MKVIKKSPITSTLSVLALALASSTTMAQELSITVTNLTQGLYFTP
FT                   VITAAHTSENHIFMSGTMASDELQAMAEGGSISGLSSILTNADANLNENPAGGLLAPAM
FT                   SASFDLSNDSANTHLSLAAMVLPSNDGFVGLDSWKIPEEAGTYTVFLNAYDAGTEANDE
FT                   LRGSGAPGEAGMPVPPPLDPLLGMNGTGVTDMESNDKVHIHRGSLGDSDMSAGMSDINN
FT                   SVQRWLNPVAKLTITVK"
FT   gene            complement(652520..653371)
FT                   /locus_tag="CPS_0654"
FT   CDS_pept        complement(652520..653371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0654"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26757"
FT                   /db_xref="GOA:Q488W0"
FT                   /db_xref="UniProtKB/TrEMBL:Q488W0"
FT                   /protein_id="AAZ26757.1"
FT                   /translation="MKFWCFFVFVFMLSACGEGGGSSDNKISSQHSEIIYLKSHSINDL
FT                   IKLADGTLWSIVGLSLGDGTHSAGEVDVIIYDNPNDFGEPNQGVKGQYYVFINNSAASF
FT                   YIDPIQTPTILQQGNIELAPLSVGSVMLLDDNSIWRVNGIDYSDINTGGIFDYTLYNVR
FT                   SNFPDLTSQTAEKLGEFSAWYLYNEYAPFGYYLKPLTKAKIIWQGLHTFYSEGENDSIL
FT                   LSDGSLWVITGALAPATTASGEYSITLIHNVSSLDEPIFGEKSETVMYIQGHETAFYVK
FT                   KI"
FT   gene            complement(653522..654607)
FT                   /locus_tag="CPS_0655"
FT   CDS_pept        complement(653522..654607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0655"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:SO0364"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28238"
FT                   /db_xref="GOA:Q488V9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V9"
FT                   /protein_id="AAZ28238.1"
FT                   /translation="MDNRSASLHSDIDTVLNNYDYDFAEVEIAVLGNGHINNTYKLTTP
FT                   EVEFVLQQINHDVFPKTAELSSNAQKINLHLQRQKNIGNYPLSIPQQILSKTGETYSKV
FT                   GTNYWRLMEFISNSYTLEEVESPEQAALVANAFAEFSCTLSDFPVEELAVIIEDFHDIS
FT                   FRMRQLNEAVENDLQDRLSSCQTLVNFCLDQQDFINHVIDISKKLPLHVTHNDTKINNL
FT                   LFTEGDTPCAVIDLDTCMPGLLMHDFGDMVRTCCSNLAEDDTNIDAMIIKLDIFSALIQ
FT                   SYQNAFGTKMSALEKDSLIVGTKSVPFSLGTRFLTDYLNGDSYFQVSREKHNLDRAFNQ
FT                   IQLFILLCEAEPELIKLAMQA"
FT   gene            complement(654948..656054)
FT                   /locus_tag="CPS_0656"
FT   CDS_pept        complement(654948..656054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0656"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28419"
FT                   /db_xref="GOA:Q488V8"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V8"
FT                   /protein_id="AAZ28419.1"
FT                   /translation="MTSPVTVEELAIKNGQCIGVLTLNSEKTLNALTLEMIDLMSAQLQ
FT                   QWQTNDKIAAVFIQGAGEKAFCAGGDVQALYKSSIEQPGGPCEYAETFFEREYRLDYLL
FT                   HNYPKPTIAWGHGIVMGGGLGVFAGCSYRIATERTRIAMPEVTIALFPDVGGSYFLNTM
FT                   PGYCGRFLALTSSSINAADGLYAGIANYAITHTSKQAVIDELTSLECPAFEINNNLDNI
FT                   FNHYQSQCIADIPAGNLATNQTLINDLCRSDNVEKIAANFSSLKTDDKWLQRAKNGLAS
FT                   GSPLAIKWIFHQLELCKGLGLKTVFEKEVLLATTIIRHTEFAEGVRALLIDKDQSPDWQ
FT                   YKQLSEVTNEVIAPFFEAPWQQNPLADL"
FT   gene            complement(656054..656830)
FT                   /locus_tag="CPS_0657"
FT   CDS_pept        complement(656054..656830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0657"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24063"
FT                   /db_xref="GOA:Q488V7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V7"
FT                   /protein_id="AAZ24063.1"
FT                   /translation="MSDLLKVEKRGHVAIVTFNNPPANTWTPESLNYLKQLIGVLNEDK
FT                   DNYSLILTSDSEKFFSAGADLNQFNHDDKGLSFDFSAAFGGAFEALSNYQGVSIAAITG
FT                   FAMGGGLEVALSCDVRICEEQAQMALPEAAVGLLPCGLGSQQLSWLIGEGWAKRMILLG
FT                   ERIKAPQAEKIGLVSEVVPTGTSLSRALALAEKAESQSPTSVAYCKSLIMEARNGDINS
FT                   AYTKERELFVKLWDTEDQKEGVSAFIEKRKPQWKNN"
FT   gene            complement(656886..658052)
FT                   /locus_tag="CPS_0658"
FT   CDS_pept        complement(656886..658052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0658"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by similarity to SP:P45867; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770; match to protein family HMM PF02771; match to
FT                   protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25240"
FT                   /db_xref="GOA:Q488V6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V6"
FT                   /protein_id="AAZ25240.1"
FT                   /translation="MNFLLNEDQLAFQDAARSFAAGEMKPFASEWDEKKIFPKAMFKKA
FT                   GELGFMGMYCPEDVGGMNLPRLDTSIILEELAVGCTSTAAFISIHNMASWMISTWGTES
FT                   TKQQWCDDLVMGQKLASYCLTEPGAGSDAGSLRTTAKKDGDYYLLNGSKMFISGAGETD
FT                   VLVVMARTGSQEEGAKGISAFAVPADLAGVSYGKNEDKMGWNSQPTRAISFENAKLPAD
FT                   CLLGAEGEGFKIAMKGLDGGRINIASCSIGAAQACIDLSQAYMQERKQFGKPLAAFQAL
FT                   QFKLADMVTELVAARQMIRLAASKIDINDPDKSTYCAMAKRFATDVGFNVCNDALQLHG
FT                   GYGYIKEYPIERYMRDARVHQILEGTNEIMRVITARRILEEGATNIIR"
FT   gene            658291..659163
FT                   /locus_tag="CPS_0659"
FT   CDS_pept        658291..659163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0659"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311; match to protein
FT                   family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25031"
FT                   /db_xref="GOA:Q488V5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V5"
FT                   /protein_id="AAZ25031.1"
FT                   /translation="MSKPSRWPLTADGIRFITPHVLVKRLQNHALAKGLFVTAMGYYPT
FT                   ASGHAMERKGHPDHILIYCTAGSGFLTMAGKTTEINSGDIFYLPAGSQHSYQASKELPW
FT                   TLYWLHFDGTLANDFCQHINIVERKFTIGVQPRVIRVFDGISHLRHSSHNLAEFIQGGH
FT                   QVQALLSYIALLVQQRKPSAINTFDTENLRAMMQEHIHSKLDLDSLAEAAKLSKYHFSK
FT                   KFKQVTGESPISYFINMKMQRACYLLDSTPRSVKHVASELGYHDTYYFSRLFKKNIGMA
FT                   PAIYRKAKL"
FT   gene            complement(659322..660899)
FT                   /locus_tag="CPS_0660"
FT   CDS_pept        complement(659322..660899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0660"
FT                   /product="sulfatase family protein"
FT                   /note="identified by similarity to SP:P25549; match to
FT                   protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25577"
FT                   /db_xref="GOA:Q488V4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V4"
FT                   /protein_id="AAZ25577.1"
FT                   /translation="MDKFLPMKSYLTMNFTKIITTCLLVTSGMASGTTDTERPNILAIW
FT                   GDDIGQSNISAYTHGMMGYKTTNIDRIAKEGVLFTDYYGENSCTAGRAAFITGQYPVRT
FT                   GLTKVGLPGSDKGLRAEDVTIAELLKDRGYVTGQFGKNHLGDKDEFLPTNHGFDEFLGN
FT                   LYHLNAEEEPEHPDYPKDQAYKKRFGPRGVIHSFADGKIEDSGPLTKKRMETIDDEFLA
FT                   ATTKFIDKAHKNNKPFFVWFNATRMHIWTHLKEESKGLSKRGGIYGDGMMEHDYQVGVL
FT                   LDQLDRLAIADNTIVLYTTDNGAEVFSWPDGGTIPFKGEKNTTWEGGFRVPAMVRWPGK
FT                   ITAGDAKIEMVSHMDWAPTLLAAAGVTDIKEKLKQGTTVNGKKYKVHLDGYNLLPYLTG
FT                   ATDEAPRPSYLYFTDGGDLSAVRFGDMKLQYSIQECEGLNVWICPLTPLRAPLLTNLRQ
FT                   DPYERARDESGSYERWYVDHIFEFSRGITMTAQQMKTFVEFPPRQKPASWSVDAMVKKI
FT                   MGMSVPQY"
FT   gene            complement(660899..662461)
FT                   /locus_tag="CPS_0661"
FT   CDS_pept        complement(660899..662461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0661"
FT                   /product="AMP-binding enzyme family protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25025"
FT                   /db_xref="GOA:Q488V3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V3"
FT                   /protein_id="AAZ25025.1"
FT                   /translation="MYFYQALQRNATIFSNNIGTSFGDRERTWKEVEQRVAKLAGALVE
FT                   HGVGQENHVAILAMNSDQYFEYYNAIPWIGGVVVPLNIRWSIKENIYSLENSQSSVLFV
FT                   DDAFLEMGKELAKQCEKIQVIIYMGDGETPAGMLNYEQLIEHADAIAPVENDYSKLAGI
FT                   FYTGGTTGFPKGVMLSHTNLWSSSIVVTAEMGLNVAGERYLHAAPMFHLADVGVSYAMV
FT                   IGGLSQVFVPYFEATSVIEAIEHKQVNHVLLVPTMVTMMLATPALDNANFSSLKHIIYG
FT                   ASPMPEGTLIAAMEKMSSVKFIQAYGQSELSPVISILPAEYHVLEGPNAGKLRSAGRPA
FT                   YCVSVEMRDENGKVLPTGKVGEIAASGPNSMLGYWNNTEQTAATLIDGWVLTGDAGYMD
FT                   EDGFIFLVDRLKDMIVTGGENVFSAEVENALSHHPAIQESVVLGIPSEQWGESVHAILR
FT                   LNEGQEITDEEIFSHCREYIAGYKVPQSIEIRVEAFPITGAGKIMKNELREPYWINETR
FT                   AIN"
FT   gene            complement(662686..663705)
FT                   /locus_tag="CPS_0662"
FT   CDS_pept        complement(662686..663705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0662"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24489"
FT                   /db_xref="GOA:Q488V2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V2"
FT                   /protein_id="AAZ24489.1"
FT                   /translation="MNQNDISAATGELFATNIFVRDFCFLGESIGLAREEFAKRIGLSL
FT                   KSIEDPQVVISKHYIIKGYTIILEYSDDEFLGAGTAKLPRGSVDLMVKSACTEQTLAQA
FT                   LKAIEQVIRISQSPVNSSTIIEGSLVRWRFIPKVKDPRFSLLISALCTCMGHKVLSTLI
FT                   KKEIPLKYSHFMEDKPKNISDYQFLFACPIKFNQQHCELAFDIKWLKQPVKCNYQEVKS
FT                   YLDIPLSLITYSFQTLGFIRQIKDLLSACPYARFPNQLELAEQLGVSVRTMQRKLDAEN
FT                   SNYMQIKDDIRQRKAIFYLEHTDKRLDEIAERCGFSEMASFTRAFIRWTGCSPSKYKN"
FT   gene            663968..664408
FT                   /locus_tag="CPS_0663"
FT   CDS_pept        663968..664408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0663"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GP:29608559"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27737"
FT                   /db_xref="GOA:Q488V1"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V1"
FT                   /protein_id="AAZ27737.1"
FT                   /translation="MLNTSDIGKVFPSVTAVVEKGRLRFFAKAIGENNPIYTDEAAAKD
FT                   AGYESLPMPPTFFFSLKMDVPNPFENYEKVGASLAKILHANQAFVYHQSVVAGDSLTFE
FT                   SHIADIYDKKAGALEFLVEKTKVSNQRGQHVADMTTTLVVRN"
FT   gene            664446..664859
FT                   /locus_tag="CPS_0664"
FT   CDS_pept        664446..664859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0664"
FT                   /product="MaoC domain protein"
FT                   /note="identified by similarity to OMNI:NTL02LI3606; match
FT                   to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27186"
FT                   /db_xref="GOA:Q488V0"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q488V0"
FT                   /protein_id="AAZ27186.1"
FT                   /translation="MIGFDEVQVGDELPVLQTKVISRTTLALFAGASGDHNPMHIDIDF
FT                   AKKAGMNDVFAHGMLSAAYLGRLLTGWVAQTAIKKIDVRFTAITQLFAEITCSAIVKEK
FT                   FERDGSKLVLLLIDAKDQNGDIKISGSAEIALN"
FT   gene            664915..665742
FT                   /locus_tag="CPS_0665"
FT   CDS_pept        664915..665742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0665"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /note="identified by similarity to SP:P51831; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26686"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U9"
FT                   /protein_id="AAZ26686.1"
FT                   /translation="MSKNLQNKVALITGSGRGIGKALALKLASEGAKIVINDLDEAPAQ
FT                   ETVSEIKAAGGEAISFVGSVTAKGFAENYIAAAIEAFGTPDILVNNAGYTWDSLLHKAE
FT                   DEQFDAMYDIHLKAPFQLNRAFTKAVTPAAKNEAEAGIEVFRKIINISSIAGEYGNIGQ
FT                   VNYSSMKSALNGMTKTLSKELGRLKINVNCVAFGVVETRLTQITDVKKTIVVDGNEVGV
FT                   GIPEKVSAGFARMIPLGRSGTAEEAANGIYLFCTPESNYISGQTVVVGGGLRM"
FT   gene            665753..666913
FT                   /locus_tag="CPS_0666"
FT   CDS_pept        665753..666913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0666"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by similarity to SP:P45857; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770; match to protein family HMM PF02771; match to
FT                   protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25611"
FT                   /db_xref="GOA:Q488U8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U8"
FT                   /protein_id="AAZ25611.1"
FT                   /translation="MVPFYCTWIDEDLRIFSESVNKFIDKEIAPYYEKWEDDAWMPREI
FT                   WNKLGQAGLLCVDMPEEYGGFGVDFKFAALINDIFYRRGVGAIAGGGIAVHAGIVGHYI
FT                   LNMGTEAQKQKYLPKMACGECVGAIGMTEPGAGSDLKALKTSAKKVDGGYVINGSKTFI
FT                   SNGQHCDIVVLACKTDPNAGAKGVSLFIVDADTKGFVKGQKLKKLGIHCQDTSELFFDD
FT                   MFVPDDALLGPLNTGFIAMMKELPRERLLLAVGGQAAAEGMLEITIDYVKERNAFGKRI
FT                   ADFQNTRFKLAELATGVRVQKAFVDQCVMLLAENKLDAVTASMAKLHVTELQGKVADEC
FT                   LQFFGGYGYMTEYRIAREFVDARVQRIYGGTSEIMKEIIGRELIKD"
FT   gene            667020..669401
FT                   /locus_tag="CPS_0667"
FT   CDS_pept        667020..669401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0667"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25234"
FT                   /db_xref="GOA:Q488U7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U7"
FT                   /protein_id="AAZ25234.1"
FT                   /translation="MNILPIAKSIIAMSVASALLVNNVAAEELNESTVDTKDVEVIEVR
FT                   GGQRVKTLREVPASVSVISGESLSQMKINKLDDLSQSLPNVSISENAVQDTISIRGVNS
FT                   DLQAGGEQSVGIFLDGVYHGRGVQSRFSFMDVDAIEVLRGPQGSLFGKNTVGGVISILP
FT                   AQPKDYFEAKLTAAYEFEYEKVDYSGYVTGALNESGSLTGRFAFKGSNSEEGWVENEAN
FT                   GETMPTKEDSALRGILNWQVNDDFKVNLRAENGTFETKGAPYEILYLEDSQPITGLARM
FT                   FGAEANIDGKTNISNGNYPGLGFNGEETPYFMDANFSEYALKSYYKIDQGTISATIAQS
FT                   NLDFVRSQDADFGPLPVIQFSESEDYQQNSVELRFVSEDNDDFEYLFGVFWQNSDLLVD
FT                   AVADFATAPGTPVAGAFPIPIEHAVTSRFNELEQETDSLALFGQVTFGLTESLKLELSG
FT                   RYSKEEKTGRQTVEVYGGTGDGSKSGLPLTNPTELFIWSQAIMEAFPHSVPVSREENLF
FT                   SPSASLTWLASDSASFYVSVSKGFKGGGFNAIAMSPDLDEIEYENEEAISSEIGGKFEF
FT                   FDGTVLLNTAIFNVAYDNMQTTLFTGGTTFVVENAAKATSRGLEAELRWLINDEFTLDA
FT                   NLGYIDFEFDDYKNAGCTAQQVIDSGLTGSACAAAGLNDLSGKTNQDVPEITLSLSLQH
FT                   EFAINEYVVTSRIDSNYVDDFFATADLDPITVQEAYIVWNAAVSIASSDGLWKTDLIFK
FT                   NITDESYFYYANDVPLFAGSQFASFSQPSTVTLQFSYLFE"
FT   gene            669469..670635
FT                   /locus_tag="CPS_0668"
FT   CDS_pept        669469..670635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0668"
FT                   /product="CAIB/BAIF family protein"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25682"
FT                   /db_xref="GOA:Q488U6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U6"
FT                   /protein_id="AAZ25682.1"
FT                   /translation="MSALANVKILDFSTLLPGPFGTLVLADLGAQILRVEAPGRTDLAR
FT                   IIGELDGDASYAHRYLNRSKKSIGLDLKKPEAIEIVKQLIAEYDVVVEQFRPGVMDKLG
FT                   LGYQALTAINPKLIYCSLTGYGQTGPYKDRGGHDNNYLAIAGTQDYSRRINTAPVPAGI
FT                   QIADVAGGSMHLVAGLLAAVIQRLETGIGQQIDISITDAAFSLNVFAASNYLGAAVATG
FT                   PEQELLNGQQFYDYYQTKDDRYLSVGGLEPQFKKTLCEAIGQPALVELALSPKLAHQQA
FT                   FKAQLTDIFKSQDFAYWKTLFRSIDACVEPVLTMDEACQHEQINSREMIVEVDGIKQVG
FT                   CAIKMSASPAKYQFKGCSLGEHNQILQQEFGFSEQQINQLKADGIFGK"
FT   gene            670653..671822
FT                   /locus_tag="CPS_0669"
FT   CDS_pept        670653..671822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0669"
FT                   /product="thiolase"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25010"
FT                   /db_xref="GOA:Q488U5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U5"
FT                   /protein_id="AAZ25010.1"
FT                   /translation="MSQVIVAGVGMTKFCKPGQQEPYRVMAATAIKIALADAGIDATKI
FT                   QQAFGAYIYGDSTCAQHAFYDVIQSGIPVVNVNNNCSSGSTALFLARQAVLSGEIECAL
FT                   AFGFEEMQPGALGSGWDDRESPFDRAKPVLEKFNAPDGPLALQAFGAAGRHYMDLYGAE
FT                   ADIFAKVSAKSRSHAVHNPYSMFTKPLTYQDVLNDKVIYDGYMTRLMACPPTCGAAATI
FT                   VCSEAFAARNGITNGVKILAQAMATDTEKSWQDPIYAAGKGMTEIAAQKVYNMAGISPE
FT                   DIDVIELHDCFTTNEVISYEGLGLCPEGGAAEFIDKGDNTYGGKFVIGPSGGLMSKGHP
FT                   IGATGLAQCTELTWHLRGQAGARQVEGARLALQHNVGLGGAVVVTLYGK"
FT   gene            672068..673672
FT                   /locus_tag="CPS_0670"
FT   CDS_pept        672068..673672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0670"
FT                   /product="oxidoreductase, GMC family"
FT                   /note="identified by similarity to SP:Q00593; match to
FT                   protein family HMM PF00732; match to protein family HMM
FT                   PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ28564"
FT                   /db_xref="GOA:Q488U4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U4"
FT                   /protein_id="AAZ28564.1"
FT                   /translation="MYNYIIVGAGSAGCVLAARLTENPNITVCLLEAGGPDKSVFIHAP
FT                   AGVAAMLPTKINNWAFETIPQKGLNGRKGYQPRGKTLGGCSSTNAMLYVRGNKWDYDNW
FT                   SALGNKGWSYEEVLPYFKKSEGNEYFSDQYHNQDGPLGVSNATAASNTNEMFIASCQEQ
FT                   GLKQNDDYNGAEQEGCFMYQRTVKNGERCSAAKAFLTPHLNRPNLTVITHALTEKVLFE
FT                   GKKAVGIRYKKDKKSVDIHCDKEVILSGGAFGSPQVLMLSGVGPKEHLSDKNISLVHHL
FT                   PGVGQNLQDHIDYIQTYRVASSDETFGLSLQGGTSMLKWMFEWKNKRSGKITSTLAESG
FT                   AFFSTQDNVVAPDAQLVFVPGIVDDHARKVNFGHGYSCHITVLRPDSTGEVKLNSSNPE
FT                   DSLAIDPKFFDNDKDLDLIKRGAKKMRAILESSPFDGIRQKLLFPLEKGNEHALEQDIR
FT                   NRSDTQYHPACTCKMGTEYDAMAVVDEQLKVHGLNGIRVVDASIMPKLVSGNTNAPTIM
FT                   IGEKAADMILADYEDSQ"
FT   gene            673669..674169
FT                   /locus_tag="CPS_0671"
FT   CDS_pept        673669..674169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0671"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01RS2043"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ27846"
FT                   /db_xref="GOA:Q488U3"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U3"
FT                   /protein_id="AAZ27846.1"
FT                   /translation="MSDVISESALKSAKTEKNQKIYWDELKEGEQFSYGHYQVSEHENI
FT                   DFAKRYDPMEFHVDPEKAKLSPIGALCASGIHTLGIMQRLTFDNIYTNWHIVAGRELRK
FT                   CQFRLPVFVDDCLTVNMTIAKLSVDTRSDRGNAELTFDVKNAKGKTVLEVEGEIVLQRF
FT                   PSI"
FT   gene            674232..674330
FT                   /locus_tag="CPS_0672"
FT   CDS_pept        674232..674330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0672"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ26072"
FT                   /db_xref="GOA:Q488U2"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U2"
FT                   /protein_id="AAZ26072.1"
FT                   /translation="MLTLIDSYISKLDEYSSSSALGIGFKSQFILA"
FT   gene            674360..675085
FT                   /locus_tag="CPS_0673"
FT   CDS_pept        674360..675085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0673"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ25368"
FT                   /db_xref="GOA:Q488U1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U1"
FT                   /protein_id="AAZ25368.1"
FT                   /translation="MNNLVLTEEHQGVLTITLNRSMKKNAINAAMYKSLCEHLTYANES
FT                   AHIHCLLIQGDENCFTAGNDFAESGNEEELSAFVFIEQLATFSKPIVAAVAGPAVGIGT
FT                   TLLLQCDMIIAANNSKFILPFAHLGICLEAGASLLLPLKVGLNRAFELAVLGAPFTAEQ
FT                   AYQYGIVNQVCQPNEVIAKALNVAQTIAKLPADSVQTSRRLMRQSTDKLMLDVINSEKS
FT                   EVTRLLKTEYCQSMLTKFS"
FT   gene            complement(675188..677554)
FT                   /locus_tag="CPS_0674"
FT   CDS_pept        complement(675188..677554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0674"
FT                   /product="sensory box/GGDEF/EAL domain protein"
FT                   /note="identified by similarity to OMNI:SO1500; match to
FT                   protein family HMM PF00563; match to protein family HMM
FT                   PF00990; match to protein family HMM TIGR00229; match to
FT                   protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24656"
FT                   /db_xref="GOA:Q488U0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q488U0"
FT                   /protein_id="AAZ24656.1"
FT                   /translation="MFSYMDTSSFIALLYNAALLISLGVIYDALKLESIKNKKLRDLIS
FT                   GLLVGMLGLAVMNTSWEMAPGMFFDTRWVLISLCGLFFGLVPTLIAGAMMVSLRLHIGG
FT                   AGILVGSLCVIIPGSIGCLFAIILKRKNLKLDWFKLYSFGMLIQITVLGCMLLMPEHLR
FT                   YKVIGAVIQPVIVVFPVCTMLVGLILRRQRDRRKSEYDLTESQKLLNREQSLMRGLIGS
FT                   LPDLISFKDVQGRYLGCNHAFEQFVGLTEQELKGKMDQELKGNFKPSDIAGLDEQEIIA
FT                   SGKVYSQDEWVVYPDGSKVLHETIKKTFDGFDGTRYGLMSVSRDITERKNHEDQIQRLA
FT                   FYDSLTQLPNRRMLQDRLQLLVTTSARDERFNALFFIDLDHFKTLNDTQGHNMGDQLLI
FT                   AVAARIQDSVRDEDIVARLGGDEFVALISNLGEDEATAGHVAEKVAEKIRLSICQPYKL
FT                   SIKENVDANNEMIFHCTPSIGISLFKSNLTSPDEILKQADVAMYQAKAAGRNAIRFFDP
FT                   AMQIALEENAAMLAELHQAIDNGELELFYQIQIDETKGIQGAEVLLRWFHPIRGMVSPL
FT                   DFIPMAEESGLIIPIGRWVLESACHQLKVWENIPNRENWQISVNVSALQFQQENFVEIV
FT                   QEIILSNNINPHGLKLELTESMVLDNVDIIIEKMHQLNQLGIDFSMDDFGTGYSSLSCL
FT                   KRLPLKQLKIDQSFVRDITTDPDDAAIVQTIINLSNSLKYDVIAEGVETQEQRQFLFNN
FT                   GCSQYQGYLFSRPVPIAEFEELVSSMSVNFAAALD"
FT   gene            complement(677701..679344)
FT                   /locus_tag="CPS_0675"
FT   CDS_pept        complement(677701..679344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0675"
FT                   /product="AMP-binding protein"
FT                   /note="identified by similarity to OMNI:SO0355; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24008"
FT                   /db_xref="GOA:Q488T9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q488T9"
FT                   /protein_id="AAZ24008.1"
FT                   /translation="MEYLTPLQNLKNNISRHPNKIFLHQPVNRQWQEFSWADVDHQARC
FT                   IAAALKSQGFESGAKIGILSKNCAQWVITDLAIMMAGMISVPIYPTAEQTNISHIIKHA
FT                   DLSAIFIGKLDNPEEVQSAINDDLLSIAFPYPTPATTVQFSDWLTEFEPLLNVHQNTIN
FT                   EIATIVYTSGSTGRPKGVVLSYKNMASVAQNLVELFKLSNNFRSISYLPLAHIVERSNG
FT                   YVALYAGFEVFFVESLDTFIDDLQYAQPTGFISVPRLWTIFQGNVLNKISQNTIAVLLN
FT                   IPLLKHLFAKKIRNALGLNNAQWFVSGTAPIALSLLHWYEKLNMPISEGWGMTETSGAS
FT                   CLNYPFTKRGLGTIGKPLPCVEMTLSAEGEILIRGDAVFTEYYLAPQATEASFSNGWFH
FT                   TGDCAVVNGQGEYTIIGRIKDKFKTSKGKYVAPVPIESLLCTNLDIEQVCLIGSGMKQP
FT                   VALIVLTAMKNKRDIELVNRLKNTLSNVNAELESHQKIDYLLVCDEAWSVENHLLTPSM
FT                   KIKRNIIEKKYDALTTKEFSDLVIYEEDMF"
FT   gene            679408..679524
FT                   /locus_tag="CPS_0676"
FT   CDS_pept        679408..679524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPS_0676"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPS_0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ24380"
FT                   /db_xref="GOA:Q488T8"
FT                   /db_xref="UniProtKB/TrEMBL:Q488T8"
FT                   /protein_id="AAZ24380.1"
FT                   /translation="MKTMRGNRWMLKQMLMVFINLNYNGLSEARGAARLPTS"
FT   gene            679566..680174
FT                   /locus_tag="CPS_0677"
FT