(data stored in SCRATCH3701 zone)

EMBL: CP000086

ID   CP000086; SV 1; circular; genomic DNA; STD; PRO; 3809201 BP.
XX
AC   CP000086;
XX
PR   Project:PRJNA10774;
XX
DT   18-DEC-2005 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Burkholderia thailandensis E264 chromosome I, complete sequence.
XX
KW   .
XX
OS   Burkholderia thailandensis E264
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3809201
RX   DOI; 10.1186/1471-2164-6-174.
RX   PUBMED; 16336651.
RA   Kim H.S., Schell M.A., Yu Y., Ulrich R.L., Sarria S.H., Nierman W.C.,
RA   DeShazer D.;
RT   "Bacterial genome adaptation to niches: divergence of the potential
RT   virulence genes in three Burkholderia species of different survival
RT   strategies";
RL   BMC Genomics 6:174-174(2005).
XX
RN   [2]
RP   1-3809201
RA   Fraser C.M., Casjens S., Huang W.M., Sutton G.G., Clayton R.A.,
RA   Lathigra R., White O., Ketchum K.A., Palmer N., Dodson R., Hickey E.K.,
RA   Gwinn M., Dougherty B., Fleischmann R.D., Richardson D., Peterson J.,
RA   Kerlavage A.R., Quackenbush J., Salzberg S., Hanson M., van-Vugt R.,
RA   Adams M.D., Gocayne J.D., Weidman J., Utterback T., Watthey L.,
RA   McDonald L., Artiach P., Bowman C., Garland S., Fujii C., Cotton M.D.,
RA   Horst K., Tomb J.-F., Roberts K., Hatch B., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (12-JUL-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 4852db61930abbc9dffc6091b31bbb47.
DR   BioSample; SAMN02604021.
DR   EnsemblGenomes-Gn; BTH_I0120.
DR   EnsemblGenomes-Gn; BTH_I0136.
DR   EnsemblGenomes-Gn; BTH_I0475.
DR   EnsemblGenomes-Gn; BTH_I0639.
DR   EnsemblGenomes-Gn; BTH_I0929.
DR   EnsemblGenomes-Gn; BTH_I1060.
DR   EnsemblGenomes-Gn; BTH_I1096.
DR   EnsemblGenomes-Gn; BTH_I1097.
DR   EnsemblGenomes-Gn; BTH_I1098.
DR   EnsemblGenomes-Gn; BTH_I1099.
DR   EnsemblGenomes-Gn; BTH_I1100.
DR   EnsemblGenomes-Gn; BTH_I1138.
DR   EnsemblGenomes-Gn; BTH_I1370.
DR   EnsemblGenomes-Gn; BTH_I1514.
DR   EnsemblGenomes-Gn; BTH_I1566.
DR   EnsemblGenomes-Gn; BTH_I1581.
DR   EnsemblGenomes-Gn; BTH_I1589.
DR   EnsemblGenomes-Gn; BTH_I1590.
DR   EnsemblGenomes-Gn; BTH_I1602.
DR   EnsemblGenomes-Gn; BTH_I1694.
DR   EnsemblGenomes-Gn; BTH_I1695.
DR   EnsemblGenomes-Gn; BTH_I1741.
DR   EnsemblGenomes-Gn; BTH_I1742.
DR   EnsemblGenomes-Gn; BTH_I1743.
DR   EnsemblGenomes-Gn; BTH_I1831.
DR   EnsemblGenomes-Gn; BTH_I1857.
DR   EnsemblGenomes-Gn; BTH_I1946.
DR   EnsemblGenomes-Gn; BTH_I1985.
DR   EnsemblGenomes-Gn; BTH_I1986.
DR   EnsemblGenomes-Gn; BTH_I1987.
DR   EnsemblGenomes-Gn; BTH_I1988.
DR   EnsemblGenomes-Gn; BTH_I1989.
DR   EnsemblGenomes-Gn; BTH_I2123.
DR   EnsemblGenomes-Gn; BTH_I2128.
DR   EnsemblGenomes-Gn; BTH_I2495.
DR   EnsemblGenomes-Gn; BTH_I2507.
DR   EnsemblGenomes-Gn; BTH_I2520.
DR   EnsemblGenomes-Gn; BTH_I2521.
DR   EnsemblGenomes-Gn; BTH_I2581.
DR   EnsemblGenomes-Gn; BTH_I2596.
DR   EnsemblGenomes-Gn; BTH_I2749.
DR   EnsemblGenomes-Gn; BTH_I2759.
DR   EnsemblGenomes-Gn; BTH_I2894.
DR   EnsemblGenomes-Gn; BTH_I2895.
DR   EnsemblGenomes-Gn; BTH_I2896.
DR   EnsemblGenomes-Gn; BTH_I2897.
DR   EnsemblGenomes-Gn; BTH_I2898.
DR   EnsemblGenomes-Gn; BTH_I2972.
DR   EnsemblGenomes-Gn; BTH_I3083.
DR   EnsemblGenomes-Gn; BTH_I3085.
DR   EnsemblGenomes-Gn; BTH_I3086.
DR   EnsemblGenomes-Gn; BTH_I3087.
DR   EnsemblGenomes-Gn; BTH_I3091.
DR   EnsemblGenomes-Gn; BTH_I3092.
DR   EnsemblGenomes-Gn; BTH_I3093.
DR   EnsemblGenomes-Gn; BTH_I3094.
DR   EnsemblGenomes-Gn; BTH_I3095.
DR   EnsemblGenomes-Gn; BTH_I3144.
DR   EnsemblGenomes-Gn; BTH_I3262.
DR   EnsemblGenomes-Gn; BTH_I3277.
DR   EnsemblGenomes-Gn; BTH_I3345.
DR   EnsemblGenomes-Gn; EBG00001057204.
DR   EnsemblGenomes-Gn; EBG00001057205.
DR   EnsemblGenomes-Gn; EBG00001057206.
DR   EnsemblGenomes-Gn; EBG00001057207.
DR   EnsemblGenomes-Gn; EBG00001057208.
DR   EnsemblGenomes-Gn; EBG00001057209.
DR   EnsemblGenomes-Gn; EBG00001057210.
DR   EnsemblGenomes-Gn; EBG00001057211.
DR   EnsemblGenomes-Gn; EBG00001057212.
DR   EnsemblGenomes-Gn; EBG00001057213.
DR   EnsemblGenomes-Gn; EBG00001057214.
DR   EnsemblGenomes-Gn; EBG00001057215.
DR   EnsemblGenomes-Gn; EBG00001057216.
DR   EnsemblGenomes-Gn; EBG00001057217.
DR   EnsemblGenomes-Gn; EBG00001057218.
DR   EnsemblGenomes-Gn; EBG00001057219.
DR   EnsemblGenomes-Gn; EBG00001057220.
DR   EnsemblGenomes-Gn; EBG00001057221.
DR   EnsemblGenomes-Gn; EBG00001057222.
DR   EnsemblGenomes-Gn; EBG00001057223.
DR   EnsemblGenomes-Gn; EBG00001057224.
DR   EnsemblGenomes-Gn; EBG00001057225.
DR   EnsemblGenomes-Gn; EBG00001057226.
DR   EnsemblGenomes-Gn; EBG00001057227.
DR   EnsemblGenomes-Gn; EBG00001057228.
DR   EnsemblGenomes-Gn; EBG00001057229.
DR   EnsemblGenomes-Gn; EBG00001057230.
DR   EnsemblGenomes-Gn; EBG00001057231.
DR   EnsemblGenomes-Gn; EBG00001057232.
DR   EnsemblGenomes-Gn; EBG00001057233.
DR   EnsemblGenomes-Gn; EBG00001057234.
DR   EnsemblGenomes-Gn; EBG00001057235.
DR   EnsemblGenomes-Gn; EBG00001057236.
DR   EnsemblGenomes-Gn; EBG00001057237.
DR   EnsemblGenomes-Gn; EBG00001057238.
DR   EnsemblGenomes-Gn; EBG00001057239.
DR   EnsemblGenomes-Gn; EBG00001057240.
DR   EnsemblGenomes-Gn; EBG00001057241.
DR   EnsemblGenomes-Gn; EBG00001057242.
DR   EnsemblGenomes-Gn; EBG00001057243.
DR   EnsemblGenomes-Gn; EBG00001057244.
DR   EnsemblGenomes-Gn; EBG00001057245.
DR   EnsemblGenomes-Gn; EBG00001057246.
DR   EnsemblGenomes-Gn; EBG00001057247.
DR   EnsemblGenomes-Gn; EBG00001057248.
DR   EnsemblGenomes-Gn; EBG00001057249.
DR   EnsemblGenomes-Gn; EBG00001057250.
DR   EnsemblGenomes-Gn; EBG00001057251.
DR   EnsemblGenomes-Gn; EBG00001057252.
DR   EnsemblGenomes-Gn; EBG00001057253.
DR   EnsemblGenomes-Gn; EBG00001057254.
DR   EnsemblGenomes-Gn; EBG00001057255.
DR   EnsemblGenomes-Gn; EBG00001057256.
DR   EnsemblGenomes-Gn; EBG00001057257.
DR   EnsemblGenomes-Gn; EBG00001057258.
DR   EnsemblGenomes-Gn; EBG00001057259.
DR   EnsemblGenomes-Gn; EBG00001057260.
DR   EnsemblGenomes-Gn; EBG00001057261.
DR   EnsemblGenomes-Gn; EBG00001057262.
DR   EnsemblGenomes-Gn; EBG00001057263.
DR   EnsemblGenomes-Gn; EBG00001057264.
DR   EnsemblGenomes-Gn; EBG00001057265.
DR   EnsemblGenomes-Gn; EBG00001057266.
DR   EnsemblGenomes-Gn; EBG00001057267.
DR   EnsemblGenomes-Gn; EBG00001057268.
DR   EnsemblGenomes-Gn; EBG00001057269.
DR   EnsemblGenomes-Gn; EBG00001057270.
DR   EnsemblGenomes-Gn; EBG00001057271.
DR   EnsemblGenomes-Gn; EBG00001057272.
DR   EnsemblGenomes-Gn; EBG00001057273.
DR   EnsemblGenomes-Gn; EBG00001057274.
DR   EnsemblGenomes-Gn; EBG00001057275.
DR   EnsemblGenomes-Gn; EBG00001057276.
DR   EnsemblGenomes-Gn; EBG00001057277.
DR   EnsemblGenomes-Gn; EBG00001057278.
DR   EnsemblGenomes-Gn; EBG00001057279.
DR   EnsemblGenomes-Gn; EBG00001057280.
DR   EnsemblGenomes-Gn; EBG00001057281.
DR   EnsemblGenomes-Gn; EBG00001057282.
DR   EnsemblGenomes-Gn; EBG00001057283.
DR   EnsemblGenomes-Tr; BTH_I0120-1.
DR   EnsemblGenomes-Tr; BTH_I0136-1.
DR   EnsemblGenomes-Tr; BTH_I0475-1.
DR   EnsemblGenomes-Tr; BTH_I0639-1.
DR   EnsemblGenomes-Tr; BTH_I0929-1.
DR   EnsemblGenomes-Tr; BTH_I1060-1.
DR   EnsemblGenomes-Tr; BTH_I1096-1.
DR   EnsemblGenomes-Tr; BTH_I1097-1.
DR   EnsemblGenomes-Tr; BTH_I1098-1.
DR   EnsemblGenomes-Tr; BTH_I1099-1.
DR   EnsemblGenomes-Tr; BTH_I1100-1.
DR   EnsemblGenomes-Tr; BTH_I1138-1.
DR   EnsemblGenomes-Tr; BTH_I1370-1.
DR   EnsemblGenomes-Tr; BTH_I1514-1.
DR   EnsemblGenomes-Tr; BTH_I1566-1.
DR   EnsemblGenomes-Tr; BTH_I1581-1.
DR   EnsemblGenomes-Tr; BTH_I1589-1.
DR   EnsemblGenomes-Tr; BTH_I1590-1.
DR   EnsemblGenomes-Tr; BTH_I1602-1.
DR   EnsemblGenomes-Tr; BTH_I1694-1.
DR   EnsemblGenomes-Tr; BTH_I1695-1.
DR   EnsemblGenomes-Tr; BTH_I1741-1.
DR   EnsemblGenomes-Tr; BTH_I1742-1.
DR   EnsemblGenomes-Tr; BTH_I1743-1.
DR   EnsemblGenomes-Tr; BTH_I1831-1.
DR   EnsemblGenomes-Tr; BTH_I1857-1.
DR   EnsemblGenomes-Tr; BTH_I1946-1.
DR   EnsemblGenomes-Tr; BTH_I1985-1.
DR   EnsemblGenomes-Tr; BTH_I1986-1.
DR   EnsemblGenomes-Tr; BTH_I1987-1.
DR   EnsemblGenomes-Tr; BTH_I1988-1.
DR   EnsemblGenomes-Tr; BTH_I1989-1.
DR   EnsemblGenomes-Tr; BTH_I2123-1.
DR   EnsemblGenomes-Tr; BTH_I2128-1.
DR   EnsemblGenomes-Tr; BTH_I2495-1.
DR   EnsemblGenomes-Tr; BTH_I2507-1.
DR   EnsemblGenomes-Tr; BTH_I2520-1.
DR   EnsemblGenomes-Tr; BTH_I2521-1.
DR   EnsemblGenomes-Tr; BTH_I2581-1.
DR   EnsemblGenomes-Tr; BTH_I2596-1.
DR   EnsemblGenomes-Tr; BTH_I2749-1.
DR   EnsemblGenomes-Tr; BTH_I2759-1.
DR   EnsemblGenomes-Tr; BTH_I2894-1.
DR   EnsemblGenomes-Tr; BTH_I2895-1.
DR   EnsemblGenomes-Tr; BTH_I2896-1.
DR   EnsemblGenomes-Tr; BTH_I2897-1.
DR   EnsemblGenomes-Tr; BTH_I2898-1.
DR   EnsemblGenomes-Tr; BTH_I2972-1.
DR   EnsemblGenomes-Tr; BTH_I3083-1.
DR   EnsemblGenomes-Tr; BTH_I3085-1.
DR   EnsemblGenomes-Tr; BTH_I3086-1.
DR   EnsemblGenomes-Tr; BTH_I3087-1.
DR   EnsemblGenomes-Tr; BTH_I3091-1.
DR   EnsemblGenomes-Tr; BTH_I3092-1.
DR   EnsemblGenomes-Tr; BTH_I3093-1.
DR   EnsemblGenomes-Tr; BTH_I3094-1.
DR   EnsemblGenomes-Tr; BTH_I3095-1.
DR   EnsemblGenomes-Tr; BTH_I3144-1.
DR   EnsemblGenomes-Tr; BTH_I3262-1.
DR   EnsemblGenomes-Tr; BTH_I3277-1.
DR   EnsemblGenomes-Tr; BTH_I3345-1.
DR   EnsemblGenomes-Tr; EBT00001658364.
DR   EnsemblGenomes-Tr; EBT00001658365.
DR   EnsemblGenomes-Tr; EBT00001658366.
DR   EnsemblGenomes-Tr; EBT00001658367.
DR   EnsemblGenomes-Tr; EBT00001658368.
DR   EnsemblGenomes-Tr; EBT00001658369.
DR   EnsemblGenomes-Tr; EBT00001658370.
DR   EnsemblGenomes-Tr; EBT00001658371.
DR   EnsemblGenomes-Tr; EBT00001658372.
DR   EnsemblGenomes-Tr; EBT00001658373.
DR   EnsemblGenomes-Tr; EBT00001658374.
DR   EnsemblGenomes-Tr; EBT00001658375.
DR   EnsemblGenomes-Tr; EBT00001658376.
DR   EnsemblGenomes-Tr; EBT00001658377.
DR   EnsemblGenomes-Tr; EBT00001658378.
DR   EnsemblGenomes-Tr; EBT00001658379.
DR   EnsemblGenomes-Tr; EBT00001658380.
DR   EnsemblGenomes-Tr; EBT00001658381.
DR   EnsemblGenomes-Tr; EBT00001658382.
DR   EnsemblGenomes-Tr; EBT00001658383.
DR   EnsemblGenomes-Tr; EBT00001658384.
DR   EnsemblGenomes-Tr; EBT00001658385.
DR   EnsemblGenomes-Tr; EBT00001658386.
DR   EnsemblGenomes-Tr; EBT00001658387.
DR   EnsemblGenomes-Tr; EBT00001658388.
DR   EnsemblGenomes-Tr; EBT00001658389.
DR   EnsemblGenomes-Tr; EBT00001658390.
DR   EnsemblGenomes-Tr; EBT00001658391.
DR   EnsemblGenomes-Tr; EBT00001658392.
DR   EnsemblGenomes-Tr; EBT00001658393.
DR   EnsemblGenomes-Tr; EBT00001658394.
DR   EnsemblGenomes-Tr; EBT00001658395.
DR   EnsemblGenomes-Tr; EBT00001658396.
DR   EnsemblGenomes-Tr; EBT00001658397.
DR   EnsemblGenomes-Tr; EBT00001658398.
DR   EnsemblGenomes-Tr; EBT00001658399.
DR   EnsemblGenomes-Tr; EBT00001658400.
DR   EnsemblGenomes-Tr; EBT00001658401.
DR   EnsemblGenomes-Tr; EBT00001658402.
DR   EnsemblGenomes-Tr; EBT00001658403.
DR   EnsemblGenomes-Tr; EBT00001658404.
DR   EnsemblGenomes-Tr; EBT00001658405.
DR   EnsemblGenomes-Tr; EBT00001658406.
DR   EnsemblGenomes-Tr; EBT00001658407.
DR   EnsemblGenomes-Tr; EBT00001658408.
DR   EnsemblGenomes-Tr; EBT00001658409.
DR   EnsemblGenomes-Tr; EBT00001658410.
DR   EnsemblGenomes-Tr; EBT00001658411.
DR   EnsemblGenomes-Tr; EBT00001658412.
DR   EnsemblGenomes-Tr; EBT00001658413.
DR   EnsemblGenomes-Tr; EBT00001658414.
DR   EnsemblGenomes-Tr; EBT00001658415.
DR   EnsemblGenomes-Tr; EBT00001658416.
DR   EnsemblGenomes-Tr; EBT00001658417.
DR   EnsemblGenomes-Tr; EBT00001658418.
DR   EnsemblGenomes-Tr; EBT00001658419.
DR   EnsemblGenomes-Tr; EBT00001658420.
DR   EnsemblGenomes-Tr; EBT00001658421.
DR   EnsemblGenomes-Tr; EBT00001658422.
DR   EnsemblGenomes-Tr; EBT00001658423.
DR   EnsemblGenomes-Tr; EBT00001658424.
DR   EnsemblGenomes-Tr; EBT00001658425.
DR   EnsemblGenomes-Tr; EBT00001658426.
DR   EnsemblGenomes-Tr; EBT00001658427.
DR   EnsemblGenomes-Tr; EBT00001658428.
DR   EnsemblGenomes-Tr; EBT00001658429.
DR   EnsemblGenomes-Tr; EBT00001658430.
DR   EnsemblGenomes-Tr; EBT00001658431.
DR   EnsemblGenomes-Tr; EBT00001658432.
DR   EnsemblGenomes-Tr; EBT00001658433.
DR   EnsemblGenomes-Tr; EBT00001658434.
DR   EnsemblGenomes-Tr; EBT00001658435.
DR   EnsemblGenomes-Tr; EBT00001658436.
DR   EnsemblGenomes-Tr; EBT00001658437.
DR   EnsemblGenomes-Tr; EBT00001658438.
DR   EnsemblGenomes-Tr; EBT00001658439.
DR   EnsemblGenomes-Tr; EBT00001658440.
DR   EnsemblGenomes-Tr; EBT00001658441.
DR   EnsemblGenomes-Tr; EBT00001658442.
DR   EnsemblGenomes-Tr; EBT00001658443.
DR   EuropePMC; PMC1343551; 16336651.
DR   EuropePMC; PMC1508146; 16725056.
DR   EuropePMC; PMC1847439; 17362501.
DR   EuropePMC; PMC2386483; 18439288.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC2612704; 19038032.
DR   EuropePMC; PMC3204160; 21793558.
DR   EuropePMC; PMC3515745; 23227305.
DR   EuropePMC; PMC3563489; 23294941.
DR   EuropePMC; PMC3966863; 24671187.
DR   EuropePMC; PMC3993349; 24464461.
DR   EuropePMC; PMC4029289; 24883196.
DR   EuropePMC; PMC5063335; 27736903.
DR   EuropePMC; PMC5547772; 28726626.
DR   EuropePMC; PMC6122001; 30006396.
DR   EuropePMC; PMC6350997; 30615607.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01730; Termite-leu.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000086.
DR   SILVA-SSU; CP000086.
DR   StrainInfo; 125454; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3809201
FT                   /organism="Burkholderia thailandensis E264"
FT                   /chromosome="I"
FT                   /strain="E264; ATCC 700388"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Burkholderia thailandensis"
FT                   /db_xref="taxon:271848"
FT   misc_feature    1..3809201
FT                   /note="Burkholderia thailandensis E264 is an environmental
FT                   isolate and the type strain of the species. It is available
FT                   from the American Type Culture Collection, Mananass, VA."
FT   gene            complement(1..1248)
FT                   /locus_tag="BTH_I0001"
FT   CDS_pept        complement(1..1248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0001"
FT                   /product="uncharacterized enzyme subfamily, putative"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR02050"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37008"
FT                   /db_xref="GOA:Q2T2K3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T2K3"
FT                   /protein_id="ABC37008.1"
FT                   /translation="MLDRRAATDRAACRLSQPVGRRRAARRELTRAPDALHPVIRNHAM
FT                   ALETFVNSEPFTFGVELEIQIVNTHNYDLTKAASDLMRLIKDAKFPGNITPEITESMIE
FT                   LSTGICRTHDQALGELHAIRDTLVNAADQLNVGLCGGGTHAFQQWSERQIFDAPRFQYI
FT                   SELYGYLAKQFTVFGQHVHIGCPDADSALFLLHSMSRFIPHFIALSASSPYVQNVDTGF
FT                   HSARLNSVFAFPLSGRAPFVLTWSGFEEYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIE
FT                   VRVMDTPLSVDRAAAIACYIQTLARYLLIDRPLKLSEDDYLVYTFNRFEACRFGLEGTC
FT                   VNPQTGERRTIAEDILDTLDRIAPHAAALGSRAALDEIGALAKARVNDASWLRTIFKQE
FT                   KSLNETVRQQCLRWRE"
FT   gene            complement(1161..2375)
FT                   /locus_tag="BTH_I0002"
FT   CDS_pept        complement(1161..2375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0002"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39201"
FT                   /db_xref="GOA:Q2T2K2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2K2"
FT                   /protein_id="ABC39201.1"
FT                   /translation="MKSAFSFLPNWPLAPDAIFWAGFALFAAGLCGELCYRAWRLPRVT
FT                   GYAVIGLIAGAFGFGVIDASTDDTLRLLINVALGLLLFELGSRLDLRWIRRNPWLIASS
FT                   LAEATLTFVLVLAVLLLLKVPGMIALVLAAIAISTSPAMVIQLKTELRAEGQVSQRLIT
FT                   LSALNSVYAVVLTKLVTSWLHQEAYGNVFATILQPIYLLAGSFIVAYLFARACNYLFRH
FT                   VAATMRDEHSFVALFGLVVLAIAVAQVLKLSTMLTLLLAGIIVKNLEVRPQLWPEHFGT
FT                   AGWLLTVILFVLTLTSFEWQDVVAGGLVAGALIATRFFAKLVGVLAFAKPSGLGVKQGV
FT                   ALGFSLVPMSALAYLLVDDTYQLYPNFDPRLRAVIMCSIVVLQLIGPLVVYRSLSAVGE
FT                   RRDAS"
FT   gene            complement(3101..5074)
FT                   /locus_tag="BTH_I0003"
FT   CDS_pept        complement(3101..5074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0003"
FT                   /product="oxidoreductase, FAD-binding family protein"
FT                   /note="identified by match to protein family HMM PF05430"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38479"
FT                   /db_xref="GOA:Q2T2K1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T2K1"
FT                   /protein_id="ABC38479.1"
FT                   /translation="MFRMTDRIVPATLVFREDGTVVSPLYGDIYHSAAGALAQADHVFI
FT                   RGNDLPERWRHKRTFTIVETGFGTGCNFLATWAAWRADPSHCERLHFVSVEKHPFARDD
FT                   LRRAAAHIVAYTTIEPLVDALANAWPALTPGVHRLEFDEGRVTLTLAFGDALDVLPNLA
FT                   LRADAFYLDGFAPSKNADLWSPAIFKSLAKLADEHATFATYTSSGAVKRALDEAGFAYR
FT                   KVEGFAGKRAMLVGEFAPRWRVRRHEPPRALDVGTRDAIVIGAGLAGCAAVERLAARGW
FT                   HVTLIERRERIASEASGNPAGVFHPMIARDDNLAARLSRAGFLHALNRWRALEHAGHTF
FT                   ARSAHGLVQLATSADEFELMRESVDTLGVPSELARTLSRDDAQALLRTDIAHGGWLFPQ
FT                   GGSISPAALAAAQCAAAGDRLSRIAGVEVARLERGGDGRWLALDASGATIAQASVVIVA
FT                   NAADAARVAGLRHAPTQRVRGQLTLLPPGSAPAVPLPAIGDGYVVPLANGVTLTGATYE
FT                   PDDADTTLREAGHRENLERLERLLPAFSAHALDAHALAGRVGFRCVASDRLPLVGELGD
FT                   EAAAARDAAALTGARLRDVPRAAGLYGAFGYGSRGLVWAALGAELIAAQIEGEPWPLER
FT                   ELAEAIDPARFLIRALRRGRVA"
FT   gene            5354..5734
FT                   /locus_tag="BTH_I0004"
FT   CDS_pept        5354..5734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0004"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37488"
FT                   /db_xref="GOA:Q2T2K0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2K0"
FT                   /protein_id="ABC37488.1"
FT                   /translation="MRRAVATHYRRHGSRTYNRRVRAVRVNLTWKGTLMNKQELIDAVA
FT                   AQTGASKAQTGETLDTLLEVIKKAVSKGDSVQLIGFGSFGSGKRAARTGRNPKTGETIK
FT                   IPAAKTVKFTAGKAFKDAVNKR"
FT   gene            complement(5838..7397)
FT                   /locus_tag="BTH_I0005"
FT   CDS_pept        complement(5838..7397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0005"
FT                   /product="cobalamin synthesis protein/P47K family protein"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM PF07683"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37562"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J9"
FT                   /protein_id="ABC37562.1"
FT                   /translation="MQCRAGSPAIDRTACKHPRSFRYRITHHEIAAVLPPRAAVRLYLM
FT                   HNAAFPPPVRAGRSPVPPRFRGAAARFPLFSLVRTAMNQPLPVTVLSGFLGAGKTTLLN
FT                   HILANRAGLKVAVIVNDLAAANVDATFVRGATELSHVEEHFVEMSNGCICCTLRDDLLV
FT                   EIRRLAAENRFDAIVIESTGIAEPMPIAETFTFVDDDGSALEDVARLDTMVTVVDAFNF
FT                   LRDYARDDALAEHGLAATEEDDRTLVELLIEQIEFCDVLVINKADLVDADSLARLQRIL
FT                   ANLNPRARQIVSRFGDVPLAEVLNTGRFDFDAAANAPGWLASLEHRHDDDEEESDRGNG
FT                   HVHSEADEYGIGHFVYRARRPFHPQRLWALLHEEWKGVLRSKGFFWLATRNDIAGSLSQ
FT                   AGGVCRHGPAGHWWAAQDRAEWPEAGDELYDEIVADWRGDLADTSIGDRRQEFVLIGVG
FT                   LDAAAWRAKFDACLLTDAEYAQGKDAWANYADPFPAWDVDDHDHDHDDHDHGDDAEIVH
FT                   RH"
FT   gene            complement(7470..7919)
FT                   /locus_tag="BTH_I0006"
FT   CDS_pept        complement(7470..7919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0006"
FT                   /product="BapC protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36853"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J8"
FT                   /protein_id="ABC36853.1"
FT                   /translation="MFAAGAWFASAPARADCYDEAAKYQNVNPLILRAIAWQESHNRPE
FT                   ALNKNTNGSTDYGLMQINSIHLPTLSRYGITKDTLMEPCKSVYIAAWHLRRKMDKYGNT
FT                   WQAVGAYHSETPSLRDKYARKIADILVRWKLMPAPAAQGAQSAQR"
FT   gene            8351..10585
FT                   /locus_tag="BTH_I0007"
FT   CDS_pept        8351..10585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0007"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02517"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38265"
FT                   /db_xref="GOA:Q2T2J7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J7"
FT                   /protein_id="ABC38265.1"
FT                   /translation="MRRVATALVVAGIVAAQAAHAQVTLNFVNADIDQVAKAIGAATGK
FT                   TIIVDPRVKGQLNLVAERAVPEDQALKTLQSALRMQGFALVQDHGVLKVVPEADAKLQG
FT                   VPTYIGNTPQAHGDQVVTQVFELRNESANNLLPVLRPLISPNNTITAYPANNTIVVTDY
FT                   ADNVRRIARIIAGVDNAAGAQVAVVPLKNANAIDIAAQLTKLLDPGAIGNTDATLKVTV
FT                   QADPRTNALLLRASNTQRLAAAKKIAQQLDAPSGVPGNMHVVPLRNADAVKLAKTLRGM
FT                   LGKGGGESGSSASSNDANAFNQGGSQSGSNFSTGTSGTPPLPSGLSSGSSGGMGGTMGG
FT                   GGLGTAGLLGGDKDKSDENQPGGMIQADSATNSLIITASDPVYRNLRAVIDQLDARRAQ
FT                   VYIEALVVELNSTTNANLGIQWQVANNALYAGTNLPTGGVGGGNSIVDLTTRAATSAVG
FT                   AISTLTPGLNIGWLHNMFGIQGLGGLLQYFSGVSDANVLSTPNLVTLDNEEAKIVVGQN
FT                   VPIPTGSYSNLTSGNTNNAFNTYDRRDVGLTLHVKPQITEGGILKLQLYTEDSSVVNTT
FT                   VNNQSGPTFNKRSIQSTVLADNGEIIVLGGLMQDNYQVSNSKVPLLGDIPWIGQLFRSE
FT                   GKTRQKTNLMVFLRPVIITDRETAQAVTSNRYDYIQGVTGAYKSDNNIIRDKDDPVVPP
FT                   MPLGPSQGGSPAMNLFDIDKMRRQQLVAPAPASAPAAASDAGAASSGARP"
FT   gene            10582..12075
FT                   /locus_tag="BTH_I0008"
FT   CDS_pept        10582..12075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0008"
FT                   /product="general secretion pathway protein E"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36477"
FT                   /db_xref="GOA:Q2T2J6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J6"
FT                   /protein_id="ABC36477.1"
FT                   /translation="MTQALAQGAQDQPAASAPSPLAARLLPYGFAKAGQILIAHQHADT
FT                   LEVWISERTSSAALAEVARNFGAISLLRLPADELAQAINHAYARQDGSAAQIVGEVEGE
FT                   VDLSRLMQDIPEVEDLLESEDDAPIIRMINALLTQAAREQASDIHIEPFENASVVRFRV
FT                   DGTLRDVVRPKKALHGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLPT
FT                   GHGERAVLRLLEKDAQRLNLEALGMGRDTLVQFDKLISRPHGIVLVTGPTGSGKTTTLY
FT                   ASMSRLETATTNIMTVEDPIEYDLSGIGQTQVNERIGMTFARALRSILRQDPDIIMIGE
FT                   IRDLETAQIAVQASLTGHLVLATLHTNDAASAVTRLTDMGVEPYLLASSLLGVLAQRLV
FT                   RQLCPVCKEERHEDGRAVWHPVGCDKCGHSGYTGRRGVYELLVIDDSIRSLIHRNAADA
FT                   EILATGRANGMRTLRDDAERWLAAGATSLEEVLRVTGGA"
FT   gene            12080..13297
FT                   /gene="gspF"
FT                   /locus_tag="BTH_I0009"
FT   CDS_pept        12080..13297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="BTH_I0009"
FT                   /product="general secretion pathway protein F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   match to protein family HMM TIGR02120"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39403"
FT                   /db_xref="GOA:Q2T2F5"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F5"
FT                   /protein_id="ABC39403.1"
FT                   /translation="MPAFRFEAIDASGRAQKGVIEADSARNARGQLRTQGLTPLVVEPA
FT                   ASAQRGARSQRLALGRKLSQREQAILTRQLASLLVAGLPLDEALAVLTEQAERDYIREL
FT                   MAAIRAEVLGGHSLANALTQHPRDFPEIYRALVAAGEHTGKLGIVLSRLADYIEERNAL
FT                   KQKILLAFTYPAIVTVIALGIVTFLLSYVVPQVVNVFASTKQQLPLLTIVMMALSDFVR
FT                   HWWWAILIGIAAVVYLVKATLSRDGPRLAFDRWLLTAPLAGKLVRGYNTVRFASTLGIL
FT                   SAAGVPILRALQAAGETLSNRAMRGNIEDAIVRVREGSALSRALNNVKTFPPVLVHLIR
FT                   SGEATGDVTTMLDRAAEGESRELERRTMFLTSLLEPLLILAMGGIVLVIVLAVMLPIIE
FT                   LNNMVQ"
FT   gene            complement(13375..13785)
FT                   /locus_tag="BTH_I0010"
FT   CDS_pept        complement(13375..13785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0010"
FT                   /product="GspC"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38149"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F4"
FT                   /protein_id="ABC38149.1"
FT                   /translation="MNALSIRLLSLALFAVLCATATYWVVTLSAHQAPLPAAAARTPVR
FT                   TEDAAALFGGQLTRNPVQDIHLFGILALQRGAAAIVGIGGDAPRAVSLGSEIAQGAKLA
FT                   EVRDRSIVVERNGARSEIFLPTNTPSPAIYVR"
FT   gene            13943..14395
FT                   /gene="gspG"
FT                   /locus_tag="BTH_I0011"
FT   CDS_pept        13943..14395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="BTH_I0011"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01710; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36769"
FT                   /db_xref="GOA:Q2T2F3"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F3"
FT                   /protein_id="ABC36769.1"
FT                   /translation="MQTWITRRSQAARRQRGFTLIEIMVVVAILGILAALIVPKIMSRP
FT                   DEARRIAAKQDIGTIMQALKLYRLDNGRYPTQDQGLNALIQKPTTDPIPNNWKDGGYLE
FT                   RLPNDPWGNSYKYLNPGVHGEIDVFSYGADGKEGGESNDSDIGSWQ"
FT   gene            14439..15029
FT                   /locus_tag="BTH_I0012"
FT   CDS_pept        14439..15029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0012"
FT                   /product="general secretion pathway protein H"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01708; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36323"
FT                   /db_xref="GOA:Q2T2F2"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F2"
FT                   /protein_id="ABC36323.1"
FT                   /translation="MYARPGMNFVCGTRRHAGVFRGPATEARFGTSAAALSARPTGTAR
FT                   ARRARGFTLLEMLVVLVIAGILVSVASLTLRRNPRTDLREEAQRVALLFETAGDEAQVR
FT                   ARPIAWRTTDHGFRFDIRTSDGWRPLRDDVLRARDWDGGVTGAAIDYPGSDTHTDAVVF
FT                   GTESIDVPVRVTLYSAVGSATIVGTGNGRYEVR"
FT   gene            15032..15436
FT                   /locus_tag="BTH_I0013"
FT   CDS_pept        15032..15436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0013"
FT                   /product="general secretory pathway protein I"
FT                   /note="identified by match to protein family HMM PF02501;
FT                   match to protein family HMM PF07963; match to protein
FT                   family HMM TIGR01707; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38797"
FT                   /db_xref="GOA:Q2T2F1"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F1"
FT                   /protein_id="ABC38797.1"
FT                   /translation="MRPPALLRLPARSRGFTMIEVLVALAIIAIALAASIRAVGSMATS
FT                   ASDLHARLLAGWSADNALAQLRLAHAWPDIGTQTFDCSQGNVALTCTQRVRSTPNPVFR
FT                   RVEIAVSMNGRAGVLAQMVTVVANETSRPL"
FT   gene            15414..16142
FT                   /locus_tag="BTH_I0014"
FT   CDS_pept        15414..16142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0014"
FT                   /product="general secretory pathway protein J"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39394"
FT                   /db_xref="GOA:Q2T2F0"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F0"
FT                   /protein_id="ABC39394.1"
FT                   /translation="MKPAVRSERRAPGRKRTRQARRVFRRNARRGERGFTLIEMMIAIT
FT                   ILAVIAILSWRGLDQIIRGREKVAAAMEDERVFEQMFDQMRIDARRAATDDEAGQPAVR
FT                   VAGDTLQIVREFDAPGAAPRLQVVRYRISNGRVVRYASPPIADVNALRDALHGGDTEGW
FT                   SQVPLMRGVGMINARLYVPKVGWTTSMPDADNALEQNNNALKVPMLGNAPPPRAVTGLE
FT                   VSIGATSLRVPITRIFLVGE"
FT   gene            16144..17397
FT                   /gene="gspK"
FT                   /locus_tag="BTH_I0015"
FT   CDS_pept        16144..17397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="BTH_I0015"
FT                   /product="General secretion pathway protein K"
FT                   /note="identified by match to protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36847"
FT                   /db_xref="GOA:Q2T2E9"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E9"
FT                   /protein_id="ABC36847.1"
FT                   /translation="MRASALLVRLASLRRRRVPHDQHAPGAARSASARLPCAPRSSGSA
FT                   AADFRAGPLARRPRAPAHRERGVAIISALLVVALSAILVAGMLWRQQVQVRRIENQRLL
FT                   AQAQWIARGALDWTRMVLRSEGDTAPGITYLGGIWAVPIAKTKLSDFLGRIGAADAAEG
FT                   ADTYLSGSIEDAQAKFNLRDLVSSPAPGALQLNAAQVQTFQRLLATLGLDQQLAKIVAR
FT                   RVRAGLRQSATRFQAAQLPGVASGVPVPLPDGGTESGGNFTDEPGIAGGEGRGPAPLMM
FT                   TSVDSLLDVEGFTPEMVERLRPFVTVLPTVTPVNLNTAPAEVIAALVPGMSVSSAQALV
FT                   SRRETVFFRNVGDVTLALRGAGAPNVNLDSSQIDVTSSYFIVHGRIEHDRAVVDRTSLV
FT                   YRDPTTHTTRIVRIRDQL"
FT   gene            17464..18834
FT                   /locus_tag="BTH_I0016"
FT   CDS_pept        17464..18834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0016"
FT                   /product="General secretion pathway protein L (GspL)"
FT                   /note="identified by match to protein family HMM PF05134;
FT                   match to protein family HMM TIGR01709"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37556"
FT                   /db_xref="GOA:Q2T2E8"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E8"
FT                   /protein_id="ABC37556.1"
FT                   /translation="MPLQEWQWPELPFALVDKSGHTQRAGRAALALLPQAATTVLVVAA
FT                   RDLLMLEQALPPLKGPKLKQALPNIIEDQLIQDPQGCHIAVDPVALDGGRRVLAVIDRA
FT                   WFKFIVDAFAAAGHRHLRAVPVTRCLPPATRRDTAEAAVEAVAMHEAAAGAPGDGHAAA
FT                   EGASADTVALPEPIVAVALGLAATASAPSLAEESAALLPETAAAPRVELALARGALGEG
FT                   FAAPVSTAVPTLEALANGTPLELYELGEPGAEPQLASVRPLDDKRLLPGAAIWPFDALV
FT                   RRALDARFDLCQFEFEFAPWRFDHATFMRLRVPLALAAATLVVAVIGVNAHWWKLSRER
FT                   DALAAQITETLLTAFPKTTTVLDPAAQMTRQLDRLRIAAGELSPNDFLSLASRLARSLG
FT                   PLPPNGIASLDYHDRRLDVGFKPETKVDPDFAQRLARNGLAGEIDSSTGKWIIRSRS"
FT   gene            18831..19337
FT                   /locus_tag="BTH_I0017"
FT   CDS_pept        18831..19337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0017"
FT                   /product="general secretion pathway protein M"
FT                   /note="identified by match to protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38958"
FT                   /db_xref="GOA:Q2T2E7"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E7"
FT                   /protein_id="ABC38958.1"
FT                   /translation="MKTTEFNEALSQFWEARTAREKLLLGWGGAVLAVAIAYSVLWSPA
FT                   QEGRARIQRELPTMRHELAEMTAQANEARSLAGAAQGVAPTGVALKDALAASLSDHGLA
FT                   AAPPQVVGGGVQIQLKNASFPAWTQWLDDVRRQFKAQVVEAHVSALKEDGQVDLTAVLQ
FT                   PASVK"
FT   gene            19376..20167
FT                   /locus_tag="BTH_I0018"
FT   CDS_pept        19376..20167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0018"
FT                   /product="general secretory pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36482"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E6"
FT                   /protein_id="ABC36482.1"
FT                   /translation="MPMTWPMRIRRGAPWVVVGGLAILVTLVALLPAAWVTPQFARATG
FT                   GRVNLVDPEGSLWRGSATLLLAPGADRSASTLLPGRVEWRTRFWPLFAGRVRMRLRQTD
FT                   AMPDGVALDATLRGAVLSAGSMAVPASLLVGLGTPFNTLDLQGNVRLDWTDWRLFGADA
FT                   FGQLTVTITDMSSRVSRVKPLGSYRAVLEARGANSTLDLSTSKGPLMLSGQGSFGATGT
FT                   SFRGTASAAPEQRDNLAGLLNLLGHPIGGGAVSLIYGDAAR"
FT   gene            complement(20337..21956)
FT                   /locus_tag="BTH_I0019"
FT   CDS_pept        complement(20337..21956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0019"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family subfamily"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37082"
FT                   /db_xref="GOA:Q2T2G6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G6"
FT                   /protein_id="ABC37082.1"
FT                   /translation="MPQVPHPRARRALSAAVAAAAAVLLAGCAVGPDYHRPDAAIPAAY
FT                   KEAPPGWKVAQPADRADRGPWWSIYDDPQLNALVDKLNASNQTVAQYAAAYRQARALVA
FT                   QARASYFPTLGLTASESRASSALSSGTTTRTIGNTYNVGLDASWEPDLWGKVSRTVGAQ
FT                   KAGEAAAAADLANARLSAQATLAQTYFQLRAADATQKLLDDTVASYQKSLQLTQNQYAQ
FT                   GVAARSDVIQAQTQLQSAQAAAIDNGIARAQYEHAIATLVGEPASTFSLPPMPLTAEPP
FT                   AMPIDVPSAILERRPDVAAAERRAAAANEQIGVAIAAFFPTLTLSASGGFQSSVWSQLF
FT                   TLPARFWSVGPQLAATLFDAGLRAAQTEAARATYDQDVAAYRAAVLSAFQDVEDNLASQ
FT                   RILEQEIAVQRQAVESARHALDITLNQYKAGTVAYLNVLTAQTTAFSAQQKLSTISGQR
FT                   MVSSVGLVKALGGGWDVSQIARETGSMQAPAAPQPASGPAAAVAPAATPAAAVGPAARS
FT                   AAVVATASANASAVRPAATPTQ"
FT   gene            complement(22170..22481)
FT                   /locus_tag="BTH_I0020"
FT   CDS_pept        complement(22170..22481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36493"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G5"
FT                   /protein_id="ABC36493.1"
FT                   /translation="MPGARPEDFPMPFLKHAAGALRRNLSDTARHTLSGPHRGWKIALY
FT                   AALLIVPGGSLAALGFAWFDQRRHRAARDGGGRAAPARESSAPQLCLAAAHGESVRCS"
FT   gene            22608..23153
FT                   /locus_tag="BTH_I0021"
FT   CDS_pept        22608..23153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0021"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36772"
FT                   /db_xref="GOA:Q2T2G4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G4"
FT                   /protein_id="ABC36772.1"
FT                   /translation="MHCCGSRNRPDSLTMSGLYDPEHIELESSLGYYLTKARQALVERL
FT                   DRALGPLELTAQQISVILLLARGYARTPFELSRKLSYDSGSMTRMLDRLEKKGFVARAR
FT                   SELDRRVIELALTERGAQAAQALPALIATELNAQLEGFSAGELALLTDLLRRFIANAPG
FT                   AADSACAASIAEPPPGKR"
FT   gene            23301..24863
FT                   /locus_tag="BTH_I0022"
FT   CDS_pept        23301..24863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0022"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39555"
FT                   /db_xref="GOA:Q2T2G3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G3"
FT                   /protein_id="ABC39555.1"
FT                   /translation="MAATAPASASLSAEPAPLSGGTLALLTVGLALGTFMEVLDTSIAN
FT                   VAVPTISGSLGVATSEGTWVISSYSVASAIAVPLTGWLARRVGEVRLFTLSVLAFTIAS
FT                   ALCGLAENFESLIAFRLLQGLVSGPMVPLSQTILMRSYPPAKRGLALGLWAMTVIVAPI
FT                   FGPVMGGWITDNYTWPWIFYINLPIGMFSAACAFFLLRGRETKTTKQRIDAIGLALLVI
FT                   GVSCLQMMLDLGKDRDWFNSTFITSLALIAVVSLAFMLVWEATEKEPVVDLSLFKDRNF
FT                   ALGAMIISFGFMAFFGSVVIFPLWLQTVMGYTAGLAGLATAPVGFLALVLSPLIGRNMH
FT                   RLDLRMVASFAFVVFAGVSIWNSTFTLDVPFNHVILPRLVQGIGVACFFVPMTTITLSS
FT                   ISDERLASASGLSNFLRTLSGAIGTAVSSTFWENDAIYHHARLAESVDVYAQSTIDFQG
FT                   ALARLGIVGDVSTAQINQIVTQQGFMMATNDFFHISALAFVALAALVWVTKPKKGAGPA
FT                   MGH"
FT   gene            complement(25087..26010)
FT                   /locus_tag="BTH_I0023"
FT   CDS_pept        complement(25087..26010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0023"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38591"
FT                   /db_xref="GOA:Q2T2G2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G2"
FT                   /protein_id="ABC38591.1"
FT                   /translation="MELRALRYFVEVVRQQSFTVAAEQMHVTQPTISKMVKALEDEIGS
FT                   PLLLRDGRQMVLTDAGRIVYQRGQDVLAAQAQLQAELNDLGTLGRGELTVGIPPLGGSL
FT                   FTPAIAAFKARYPRIELKLFEQGARKIEEALVAGELELGGVLEPVDPAVFDVLPMVRAP
FT                   LWLVAPHGSRWDADATVPLADLANEPFVFYAESLALHDAVLDACRKVGFTPQIVSRSGH
FT                   WDFMAALVHAGVGIALLPEPYCRRLDAAQFTCRPIVEPEITWAIAIGWLKKGYLSHAAR
FT                   AWLDVARETEPIDPGDDLAFGSLRAR"
FT   gene            26150..26599
FT                   /locus_tag="BTH_I0024"
FT   CDS_pept        26150..26599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0024"
FT                   /product="LrgA family protein"
FT                   /note="identified by match to protein family HMM PF03788"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36966"
FT                   /db_xref="GOA:Q2T2G1"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G1"
FT                   /protein_id="ABC36966.1"
FT                   /translation="MTRISATATAATARAGRTARIALQTAALGALWAAIDWTVRALGVP
FT                   VPSGVVGLAVLLALLLSGRVAPGWVKDGANWLLADMLLFFIPATVAAVQYGGLFKADGW
FT                   RLALVVVAGTTFVMLSVAIAVDIAAGFERRLAVTRVRAGRRRARA"
FT   gene            26668..27390
FT                   /locus_tag="BTH_I0025"
FT   CDS_pept        26668..27390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0025"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF04172"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37859"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G0"
FT                   /protein_id="ABC37859.1"
FT                   /translation="MTTPDLSFLTAPSSAAISAGCFALTIALYFASKRLYAYRKTLFFS
FT                   PLVLVPAVLVAFVALTGIPYAVYFRDTRWLMWLLGPATIAFAVPIYEYRELMKRHWFSL
FT                   AVGVVVGIAVAICGSLLLSKLLHLSPELQRSLVTRSVSTPFALAVSDRIHAPRDLTALF
FT                   VIATGICGMLVGEFVLALVPLRSRLARGALFGAAAHAVGTAKAREIGSEEGVVSSLTMM
FT                   IAGVAMVLIAPLLTLLPI"
FT   gene            27944..28486
FT                   /locus_tag="BTH_I0026"
FT   CDS_pept        27944..28486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0026"
FT                   /product="flagellar protein FliL"
FT                   /note="identified by match to protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38392"
FT                   /db_xref="GOA:Q2T2F9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F9"
FT                   /protein_id="ABC38392.1"
FT                   /translation="MPNNAGYLESSRRHAMATTANPTVDKPASSGKLKRIVLFLLIGIV
FT                   AAAAAAGGTYFVLLKEGARGSAPSAPPPLAVPAFFPLEPLTVNLQSDDGVQHYLRVGLS
FT                   LKLTDPKAQEYLTQHMPELRSRILLALSNKHPEQLATLEGKRALADELKTLIEQPTQPG
FT                   NQSARVDDVLFTEFVVQ"
FT   gene            28509..29507
FT                   /gene="fliM"
FT                   /locus_tag="BTH_I0027"
FT   CDS_pept        28509..29507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="BTH_I0027"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM PF02154; match to protein
FT                   family HMM TIGR01397"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38173"
FT                   /db_xref="GOA:Q2T2F8"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F8"
FT                   /protein_id="ABC38173.1"
FT                   /translation="MGHEEFMSQEEVDALLKGVTGEDDSADEPAESSGIRPYNIATQER
FT                   IVRGRMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNL
FT                   VHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFE
FT                   HYAVAWKSVRPLQFEFVRSEMHTQFANVATPNEIVIVTQFSIEFGPTGGTLHICMPYSM
FT                   IEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELVADLAEVPTTFEKILNLRAGD
FT                   VLPLDIADSITAKVDGVPVMECGYGIFNGQYALRVQKMISASDTMKEGGYD"
FT   gene            29566..29997
FT                   /locus_tag="BTH_I0028"
FT   CDS_pept        29566..29997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0028"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02480"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39059"
FT                   /db_xref="GOA:Q2T2F7"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F7"
FT                   /protein_id="ABC39059.1"
FT                   /translation="MSAAAADGAAPAAPQEEMAMDDWAAALAEQNQQPIETGATGAGVF
FT                   RPLSKAAASSTHNDIDMILDIPVKMTVELGRTKIAIRNLLQLAQGSVVELDGLAGEPMD
FT                   VLVNGCLIAQGEVVVVNDKFGIRLTDIITPSERIRKLNR"
FT   gene            29994..30668
FT                   /locus_tag="BTH_I0029"
FT   CDS_pept        29994..30668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0029"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF04347"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36371"
FT                   /db_xref="GOA:Q2T2F6"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2F6"
FT                   /protein_id="ABC36371.1"
FT                   /translation="MTPRIAPSVSPSVSLRRSAARALAAAPRRMRRAPASLAALAIGAA
FT                   ALPASAADMDAVNHAASLASGVVVGSAAPSLGVGAVVQTLVGLAVVIGLVFGCAWLARR
FT                   FGFQPQRRGGALKVVASVAVGGKESATVVEIGDTWLVLGVAPGNVRLLHTLPAGSAGVI
FT                   GAPVAPGVAPAGGGLPRAPGAPGGTARSGPFPEGASFGARFRDAMLGEAAKRFKRDGGK
FT                   DR"
FT   gene            30670..31500
FT                   /gene="fliP"
FT                   /locus_tag="BTH_I0030"
FT   CDS_pept        30670..31500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="BTH_I0030"
FT                   /product="flagellar biosynthetic protein"
FT                   /note="identified by match to protein family HMM PF00813;
FT                   match to protein family HMM TIGR01103"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37932"
FT                   /db_xref="GOA:Q2T2N8"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2N8"
FT                   /protein_id="ABC37932.1"
FT                   /translation="MPRLRFVAPRADAAARAHSDSRSMKTAFLRGAARWLPAILIGLAP
FT                   ALACAQAAGLPAFNSAPGPNGGTTYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIVLS
FT                   LLRQAIGTASTPPNQVLVGLALFLTLFVMSPVLDKAYTDAYKPFSEGTLQMDQAVQRGT
FT                   APFKTFMLKQTRETDLALFAKISKAAPMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIF
FT                   IPFLIIDMVVASVLMSMGMMMVSPATVSLPFKLMLFVLVDGWQLLIGSLAQSFT"
FT   gene            31526..31798
FT                   /gene="fliQ"
FT                   /locus_tag="BTH_I0031"
FT   CDS_pept        31526..31798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="BTH_I0031"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="identified by match to protein family HMM PF01313;
FT                   match to protein family HMM TIGR01402"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38828"
FT                   /db_xref="GOA:Q2T2N7"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2N7"
FT                   /protein_id="ABC38828.1"
FT                   /translation="MTPENVMTLAHQAMYIGLLLAAPLLLVALAVGLVVSLFQAATQIN
FT                   EATLSFIPKLLAVAATMVIAGPWMLSTMLDYLREILLRVATLGAG"
FT   gene            31911..32693
FT                   /gene="fliR"
FT                   /locus_tag="BTH_I0032"
FT   CDS_pept        31911..32693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="BTH_I0032"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="identified by match to protein family HMM PF01311;
FT                   match to protein family HMM TIGR01400"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39170"
FT                   /db_xref="GOA:Q2T2N6"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2N6"
FT                   /protein_id="ABC39170.1"
FT                   /translation="MFSVTYAQLNGWLTAFLWPFVRMLALVALAPVTGHRATPVRVKIG
FT                   LAGFMALVVAPTLPPMPAATVFSAQGVWIIVNQFLIGAALGFTMQIVFAAVEAAGDIIG
FT                   LSMGLGFATFFDPHSSGATPVMGRFLNAVAILAFLAFDGHLQVFAVLVDSFRLVPISAD
FT                   LLRAAGWQTLVAFGSAIFEMGLLLALPVVAALLIANLALGILNRAAPQIGIFQVGFPVT
FT                   MLVGLLLVQLMAPNLIPFVGRLFDTGVDFVGRVAAGMR"
FT   gene            complement(32827..33321)
FT                   /locus_tag="BTH_I0033"
FT   CDS_pept        complement(32827..33321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0033"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36945"
FT                   /db_xref="GOA:Q2T2N5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2N5"
FT                   /protein_id="ABC36945.1"
FT                   /translation="MHAFERPELHCANSSPLEVKRVGNLDIAEVARRSGVPASALRYYE
FT                   EKGLIASTGRRGLRRTFDARVLERLALIALGRAAGFSLDEITSMFDAQGRPSIDRATLA
FT                   AKADELDGTIRKLISMRDGLRHAAACTAPSHMECPKFQRILRAASDARRAKKAPPSLPR
FT                   G"
FT   gene            33316..34233
FT                   /locus_tag="BTH_I0034"
FT   CDS_pept        33316..34233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0034"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38388"
FT                   /db_xref="GOA:Q2T2N4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2N4"
FT                   /protein_id="ABC38388.1"
FT                   /translation="MHWRMAMNVTDRNDDVDNTDSGQAAHWNGRAGRAWVDAQQVLDRM
FT                   FEPFAQRLVEAARAGGGRHVLDVGCGAGATTLAAARMLGERGRCVGVDVSRPLIAAARG
FT                   RAERERVPARFVRADAQTHAFVPASFDTIISRFGVMFFENAVDAFANLLRAATSDASLA
FT                   FVAWRGAAENPFMTTAERAAAPLLPNLPARQPDAPGQFFFGDRRRIETVLAQSGWCGVD
FT                   VRPIDVECTLPERELIGHFSRLGPVGQMFADLDEPTRARLVDTVRAAFDPYVRGDDVRF
FT                   TAACWLVNARSPVKWSARKEAVGV"
FT   gene            34432..35445
FT                   /locus_tag="BTH_I0035"
FT   CDS_pept        34432..35445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37297"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2N3"
FT                   /protein_id="ABC37297.1"
FT                   /translation="MRTTLRALSLAAVAAGLSFGFAAQPAFADDGGKITIMVGGITKLI
FT                   YLPARLTQELGYFKAEGLDVELQSQPAGVDAENELLAGAVQGVVGFYDHTIDLQSKGKD
FT                   VKAIAVLGQVPGEVEMVSTKAAGAIKSMADVKGKTLGVTGLGSSTSFLTQYLAQQHGIS
FT                   ASQYTMLPVGADASFIAAVKQGRIDAGMTTEPTVSVLEKNGDAKALVDLRTLDGTRAAL
FT                   GGTYPAASLYVQSAWADTHKAQATKLAHAFARTMQFIHTHSAEEIAAKMPADYQKDKAL
FT                   YVRALKASLPMYTPDGKMPADGPATVLKVLSAFNPSVKGKHIDLSKTYTNDFVNAK"
FT   gene            35552..36349
FT                   /locus_tag="BTH_I0036"
FT   CDS_pept        35552..36349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0036"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38452"
FT                   /db_xref="GOA:Q2T2H7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H7"
FT                   /protein_id="ABC38452.1"
FT                   /translation="MNQHVPAHAPAIEFRNVSCRFISPDGRATVALHDFTMSVARGEFV
FT                   AVVGPTGCGKSTTLNLITGLLKPVSGEVRVMGKPVDGIDPRIGFVFQADAVFPWRTVID
FT                   NVAAGPLFRGRSKESAYAQAEEWIRRVGLAKFAKHYPHQLSGGMRKRVALAQTFINQPE
FT                   ILLMDEPFSALDMQTRTLMQDELLQLWSANKGSVVFVTHDLEEAIALADRVFVLTSRPA
FT                   TLKRVYEIDLPRPRVTSEVRYEHRFIEISKDIWHDLREEVQIG"
FT   gene            36449..37228
FT                   /locus_tag="BTH_I0037"
FT   CDS_pept        36449..37228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0037"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38772"
FT                   /db_xref="GOA:Q2T2H6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H6"
FT                   /protein_id="ABC38772.1"
FT                   /translation="MRRRRQLIVGLRIAVLVVALGGWEIAARFKWIDPFFFSMPSLIAA
FT                   QIQDWFVNGTSQGPLLLQVWVTLEETIAGFLIGSVAGIFCGIVLGRNKLLADVFGLYIQ
FT                   IANSIPRVVLGSIFVIALGLGMASKIALAVVMVFFVVFGNAFQGVREADRYLIANAQIL
FT                   GASRRQITTSVVIPSALSWILASLHVSFGFALVGAVVGEFLGSKQGIGLLISTAQGAFN
FT                   ASGVFAAMIVLAVVALAADFLLTRLEKRLLKWRPAAF"
FT   gene            37305..38684
FT                   /locus_tag="BTH_I0038"
FT   CDS_pept        37305..38684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0038"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36668"
FT                   /db_xref="GOA:Q2T2H5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H5"
FT                   /protein_id="ABC36668.1"
FT                   /translation="MSHSLRGRLLWWLLLPLAVFVAIAGAMSYDTARKTADLVQDGALV
FT                   ASARAIAEDVNWENGALVANVPPAALELFESPARDQVYYMVRTGGGRLLAGNPDLGGPG
FT                   APAAPGAQPVLFDTALNGLAIRAVAYTRELYNAGDTETVTVVVGKTQTSRQMMIAAIWH
FT                   PQLWRLALMLALAMALVYLGLTFELRPLMKLKDDVADRGPMELEPIRTERLHFELRPIV
FT                   DAINQCIARLNLHAATQRRFIADAAHQLRTPIAVIDTQIQCARQREDGDAALAALLASM
FT                   QRSSRRMADVTDKLLLLAHAEAASPARLAARVDVAAVVSGVLEEAIVLAERRRIDLGAE
FT                   LDDDLQVAGSESLLSALLMNLVDNAVRYTHEGGCVTVSARRDGEAVVLDVVDDGPGIPA
FT                   EARPHVFKRFYRVAKDEEGTGLGLAIVEEIAQSHGGTVTLGTGPGNRGVRMTVRLPAYR
FT                   N"
FT   gene            38695..39372
FT                   /locus_tag="BTH_I0039"
FT   CDS_pept        38695..39372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0039"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37046"
FT                   /db_xref="GOA:Q2T2H4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H4"
FT                   /protein_id="ABC37046.1"
FT                   /translation="MKLLLVEDNAELAHWIVDLLRGEGFGVDSAPDGESADTVLKAQRY
FT                   DALLLDMRLPGMSGKELLARLRRRGDNVPVLMLTAHGSVDDKVDCFSAGADDYVVKPFE
FT                   SRELVARIRALIRRQCGVGATQLACGDLVYLFATREFQCGSVPLALRRREHAILETLML
FT                   QQGKTVSKARLMDSVYGLDDEPSADAIDIYIHRLRKHLSGSLAQIITLRGLGYILRTKD
FT                   AAE"
FT   gene            39693..40820
FT                   /locus_tag="BTH_I0040"
FT   CDS_pept        39693..40820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0040"
FT                   /product="porin"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37471"
FT                   /db_xref="GOA:Q2T2H3"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H3"
FT                   /protein_id="ABC37471.1"
FT                   /translation="MKRQYLALSIATAACAAPQAHAQSSVQLYGLIDLSFPTYQSHANA
FT                   KGDHVIGMGLGGEPWFSGSRWGLKGAEDIGGGTKVIFRLESEYTVADGNMEDPGQIFDR
FT                   DAWVGVENDTFGKLTAGFQNTIARDAGAIYGDPYGSAKLTTEEGGWTNANNFKQMIFYA
FT                   AGATGTRYNNGLAWKKLFGNGIFASAGYAFSNSTSFGQNSTYQVALGYNGGPFNVSGFF
FT                   SHVNHAGYANKSFSVGGNYTFDIFRVNAGYFRYLGDQGALGQRQDNAWTVSFKVAPKGA
FT                   LDYELGYQQMRVHNAAYNSDGNVPNANIGDFSLTSGVGNGFKETLYGSVFYHLSKRTEL
FT                   YLAGDYMRLHGGYTVASTHGATNQLELTTGIRTRF"
FT   gene            41277..43325
FT                   /locus_tag="BTH_I0041"
FT   CDS_pept        41277..43325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0041"
FT                   /product="type III DNA modification methyltransferase"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36522"
FT                   /db_xref="GOA:Q2T2H2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H2"
FT                   /protein_id="ABC36522.1"
FT                   /translation="MQLMGRMMQKLDAASPEAQSADLVSANVERLRALFPDVVTEGPDG
FT                   ASVNLDALAAMVGASAAAVADADEKYGLNWHGKRRARRLALTPSTGTLRPCPRESVGWA
FT                   STRNLMIEGENLEVLKLLQKSYAGRAKLVYIDPPYNTGKDFVYSDNFTDSLRHYLELTG
FT                   QTTDGKRISSHTDASGRFHTDWLNMIYPRLKLARDLLADDGVIAVHIDEHEQHALVLVM
FT                   REIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAQLLFERAPLKRPKRNAQR
FT                   MLDAARGAIAGAATIADANAAYRAWVKSQTTLSGGEAMYDRISADGRVYRLVSMAWPNK
FT                   KKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMQALIDKGLVEFGADETTQPQRIYFL
FT                   DENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGS
FT                   GTTGHAVMALNAADGGNRRYVLVQLPEPLDAGSKDQKAAADFCAAQRVPLNLAELTKER
FT                   LRRAAARVAAEHPGTRADLGFRVFRLDSTNVSEWDPRGDDIQQSLFAAVEHIKPNRSEE
FT                   DLLYELMLKLGLDLCAPIDARTIAGKAVYVIDGAIVACFDAHIDRASTDALGEGIVELI
FT                   AEAAAAGAAHARDVTCVFRDSGFADDVAKVNLSAILEQHGVKRIRSL"
FT   gene            43366..46395
FT                   /locus_tag="BTH_I0042"
FT   CDS_pept        43366..46395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0042"
FT                   /product="type III restriction-modification system, res
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39023"
FT                   /db_xref="GOA:Q2T2H1"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H1"
FT                   /protein_id="ABC39023.1"
FT                   /translation="MQLHFESDLDYQLEAIEAVCGLFRGQEACRAEFSVTAQAARRRAS
FT                   PQISLGMAESGLGVGNRLTLDAHTFAENLARVQVRNGLPPSGAPRSNDFTVEMETGTGK
FT                   TYVYLRTIFELHRRFDFTKFVIVVPSVAIKEGVYKTLQITERHFRRLYAGVPFDYFVYD
FT                   SAKLGEVRSFASKSTVQIMIVTVAAINKKDVNTLYKDSEQTGGEKPIDLIRAAHPIVIV
FT                   DEPQSVDGGLDGRGKEALDAMHPLCTLRYSATHADKYQMLYRLDAIDAYERKLVKQVEI
FT                   ASATVEDAHNKPFMRVMSIGSRRGAIAARVELDVATAAGDVERQTVSVSDGDDLERIAR
FT                   RAVYANFRIGEIHAARGAEYLVLRYPGGDAFLSIGDTYGDVDTLAIQREMIRRTIREHL
FT                   DKELRLTPLGVKVLSLFFVDAVDKYRKYDRHGQPFKGDYARLFEEEYRRAAKLPEYRAL
FT                   FAGVDCAIAAEAVHDGYFSIDRKGGWTDTSDKSAGSRENAERAYGLIMKDKERLLSFDT
FT                   PLKFIFSHSALKEGWDNPNVFQICTLRDIRSERERRQTIGRGLRLAVNQRGERVRGFDV
FT                   NTLTVIAGESYEQFAENLQKEIEADTGIRFGIVETHQFAALPVPAGDGSVQPLGVERST
FT                   ALWTYLRDAGYLDARGRVQDTLRAALKLRALPVPDEFGSQRALIVDMLRKLAGRLDVRN
FT                   ADERRHIALRPDAHGKAVYLGDEFRALWERIQYRTTYRVNFDNARLIERCVAALKAAPA
FT                   VARARLQWRKAEIAIDAAGVEAIETEAAGAIAIDEGEIDLPDLLTELQDRTQLTRRTIA
FT                   TVLIESGRLDEFPRNPQRFIALVAAALERCKRDALVDGIEYKLLGKEHVHALSLFEDEP
FT                   LTGYLSSMRRGAAKSIHEDVPCETPAERVFVESLERDDAVRLYAKLPGWFKIPTPLGSY
FT                   SPDWAVLIAEGDGPRLYFVVESKSGIADSDLHAHERRRIQCGAAHFRALEAASVNPARY
FT                   VRARCADDLPTAPANARDAA"
FT   gene            46764..47864
FT                   /locus_tag="BTH_I0043"
FT   CDS_pept        46764..47864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0043"
FT                   /product="outer membrane porin OpcP"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38279"
FT                   /db_xref="GOA:Q2T2H0"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H0"
FT                   /protein_id="ABC38279.1"
FT                   /translation="MKKFAVAAAGLAVATGAHASDGSVTLFGLVDAGVSYVSNEGGRHN
FT                   VYFDDGIAVPNLWGLRGTEDLGGGAKAIFELTSQYALGNGAALPTPGSMFSRTALVGLW
FT                   SERLGSVTLGQQYDFMTDSLTFGSFDGAFRYGGLYNFRQGPFSKLGIPDNPTGSFDFDR
FT                   MAGSSRVPNAVKYTSANLNGLVFGLMYGFGNQAGGGLSANSTVSAGLKYEAGSFALGAA
FT                   YVEVKYPQMNNGHDGLRNWGLGARYALSAFDLNLLYTNTRNTLTGAAIDVIQAGARYVG
FT                   APWTIGANYEYMKGNAQLDRNYAHQVTAAVQYALSKRTSAYVETVYQYAGGSAGAHAWI
FT                   NGVMGPDAQSSSRSQFLARIGMLTRF"
FT   gene            48240..49199
FT                   /locus_tag="BTH_I0044"
FT   CDS_pept        48240..49199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0044"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37613"
FT                   /db_xref="GOA:Q2T2G9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G9"
FT                   /protein_id="ABC37613.1"
FT                   /translation="MVNGRFFTTAGESPAFRGHAWGRVVTQYFGGLDACCDSDDVFDAQ
FT                   LSQYEIGPMRVFTIAAPAHRIVRPVAALHDHGSDFFKLILQLSGVSEIEQRGKVFRLRT
FT                   GDWSLYDPRVPYSIANLTRVEQLAIQIPRRQLGGFAVPDLHTSDVREFELKGLFSLLSS
FT                   FLMSLSEQLPSLPGTTGAALSETILGLIVSTLTAQRDAQGAHVALPAVLRMRVKQYIRG
FT                   HLADADLSIDRIARELRCSKRYLHRIFEEEGVTIDRYIWSSRLERCKDALDNARAAKPA
FT                   ISEIAFSWGFSSSAHFCRSFKQRYGMTPREFVRRRTSA"
FT   gene            complement(49318..50049)
FT                   /locus_tag="BTH_I0045"
FT   CDS_pept        complement(49318..50049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0045"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37364"
FT                   /db_xref="GOA:Q2T2G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G8"
FT                   /protein_id="ABC37364.1"
FT                   /translation="MRLEVKDLVVHRANKPVLHGVSLAVAPGRVTALVGANGAGKSTLV
FT                   MSIAGTLPATSGAVLLDGAPLGALRPEAVRRRGIAVVPEGHRVLGDLSVRDNLRAAGAF
FT                   LSARRLNDAIDRALAIFPELEAKLDARGNDLSGGQKQMVCVSQALIGEPHTLLIDELSL
FT                   GLAPAVTKRLAQTVARIANDGVAVLLIEQFTTIALALATNAYVLERGRVAFAGTAQMLR
FT                   ERPEILHGSYLASKGGGANAA"
FT   gene            complement(50104..50826)
FT                   /locus_tag="BTH_I0046"
FT   CDS_pept        complement(50104..50826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0046"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39462"
FT                   /db_xref="GOA:Q2T2G7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2G7"
FT                   /protein_id="ABC39462.1"
FT                   /translation="MIEISNLTVQFGGTRVLDALDAKLAAPICGLIGPNGAGKTTLLNV
FT                   LSGFLRPRAGSVALDGRALLALSVAERVRAGVRRTFQTEQIVEDLSVHDNVLALAEHVM
FT                   PAFAAREDTRRALELVGLADVAHMRGAALNLYQRRMLELGKALVGAPRLLLLDEPGAGL
FT                   NETEAARLADVIVRIPECVGAQVLLIDHDVDLIDAVCEATLVLDFGKRLALGPTRAVLD
FT                   DPLVRSAYLGQAFDEHAA"
FT   gene            complement(50823..51872)
FT                   /locus_tag="BTH_I0047"
FT   CDS_pept        complement(50823..51872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0047"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein, putative"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38432"
FT                   /db_xref="GOA:Q2T2I8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I8"
FT                   /protein_id="ABC38432.1"
FT                   /translation="MKTPLAFAAPPRDAAARATPSGARLPLVATLGTLAAIALVVPAVA
FT                   DAYWIKTLTSALTVSIAAAGVALLYRQLGLVCLSQHALLGVGGWIALRLAHLGAPFELC
FT                   VIAGAAGGSAVGMIAGLPALRLRGLYLALVTLMMAGGFQVVVSAIGFPDGGGGFTGHLS
FT                   FGARQMMARPLAGQSDAAYFRYVAAWAALAFALIELHRRSKAGRSWALIRRGEMPALAA
FT                   GVNVVFYQTWAFGLAGLLAGLSGGLLAGSVGQLDGRAFAASESVLLFALSVVGGVYHWF
FT                   GALITGLLLRAVPALLTDFGVNGYLAMIFFGAALLHALITAPAGIAGQLAALASRIARA
FT                   FRARDGGAR"
FT   gene            complement(51869..52663)
FT                   /locus_tag="BTH_I0048"
FT   CDS_pept        complement(51869..52663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0048"
FT                   /product="Branched-chain amino acid transport system /
FT                   permease component, putative"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37901"
FT                   /db_xref="GOA:Q2T2I7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I7"
FT                   /protein_id="ABC37901.1"
FT                   /translation="MLYRASGVLNFAFGATGALGAYVAAACLDAGYPQALAWGAAIAAS
FT                   TAASLVYGLALAPRLAARDRVVRSIATLGFALVLLGFCEWYWGDTPRRLVLPTDSEALD
FT                   FGDVRFTYTRIVGLALAFAMMAAIGVVLARTRLGLQMRALSNDRHLSGLLGIRVLRVDV
FT                   AAWAISGVFAGITGLLLGNLVRLQAAVLTFLVIPAFAAAIVGRLASLPATVAAGVAIGL
FT                   AEALAITVPGFAPYRSATPFLIALVAMLFIGSQSSGHAANES"
FT   gene            complement(52752..54011)
FT                   /locus_tag="BTH_I0049"
FT   CDS_pept        complement(52752..54011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0049"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37248"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I6"
FT                   /protein_id="ABC37248.1"
FT                   /translation="MKPLSPNMKRTLAGACIGAAGFLAQHAAFAQSCGLANGKPATGAP
FT                   IPIGAIVGKTGPDDFSSSTRAAAAYFKCVNANGGINGRPVQYLVEDDQWNPETASQVAS
FT                   KLVRDRKVLALAGNASFVECGANAKFYEQENVIAIAGVGVPRECYFARNYVPLNMGPRL
FT                   SMTQAALYAKQQYKATRMVCIAPNIPSLGAWSCEGPVLWGKRNGVSVDTIVMDPDSADP
FT                   TSVVLQAASKNPQAILLGLPKGLMVPILSAAEQQNLGRRIHFVSAASGYDLGVPKAIGP
FT                   YWKGNFDVNLEFQPLDAPTPDNQNWLAVMNKYGEKKDPRDTFSQAGYLAARLVTDTLLK
FT                   LPANQLDRAHVTAALREVKDFRSDILCGPFYVGAGERHNANNAGRMAQSTGAGWKTVST
FT                   CQAVDDPQLVDIRAAEKKMH"
FT   gene            complement(54208..55713)
FT                   /locus_tag="BTH_I0050"
FT   CDS_pept        complement(54208..55713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0050"
FT                   /product="phenylacetaldehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37755"
FT                   /db_xref="GOA:Q2T2I5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I5"
FT                   /protein_id="ABC37755.1"
FT                   /translation="MNLAALSTQHQRQSGFLARRQFGNWIDGAAAEPRSGRYLPVVDPA
FT                   TEMTIAEVAASDARDVDAAVAAARRAFDSGDWPRMRPASREKLLHQLADRIERYADELA
FT                   ALETLETGKLVGLARAIDVLGGAEYVRYMAGWATKLEGSTLDTSIAVPAGTEYFAYTRR
FT                   EAVGVVGAIVPWNFPLAIALWKVATALACGCTVVLKPSEETPLTALRLGELAQEAGLPD
FT                   GVLNVVTGTGADTGAALVAHPGVDKITFTGSVGVGKAIGHAAVDRMARFTLELGGKSPL
FT                   IVFDDADPDVAARGAAQGIFFNQGQVCTAGSRVYVHKSLFERVVAGIAAAAESMKIGSG
FT                   FDPNTQIGPLVSKRHFERVLGHIDAAKEEGATLVTGGTRALDGGYFVKPTVFVDAAPSM
FT                   RIVREEVFGPVVTVTPFDTVDDAVRLANDSDFGLAASVWSQNLSRVHRVVPRLKAGIVW
FT                   VNTHNMLDNNLPFGGVKQSGYGRELGRAALEQFTELKSVCIAH"
FT   gene            complement(55768..56187)
FT                   /locus_tag="BTH_I0051"
FT   CDS_pept        complement(55768..56187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38070"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="PDB:3EC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I4"
FT                   /protein_id="ABC38070.1"
FT                   /translation="MRNPSEDHMMRTPYQIVADHYAASDRHDPAAMMADIAPAIEWTEM
FT                   AGFPCAGTYRSADEIVRNVFRRLGEEWDGYTFKLDALHDAGDTVIGVGRYSGTYRRTGK
FT                   SFECRVAHVWRVDAGKIVHFEQFTDTLLVAQAMQP"
FT   gene            complement(56171..56962)
FT                   /locus_tag="BTH_I0052"
FT   CDS_pept        complement(56171..56962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38231"
FT                   /db_xref="InterPro:IPR024724"
FT                   /db_xref="InterPro:IPR035348"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I3"
FT                   /protein_id="ABC38231.1"
FT                   /translation="MNDKPQDWKNYEDFAAGIDTNRLPATGALAGRALTFELPSGAFAA
FT                   HFVDGHTLAWRRGDAGDTDWYEAIEVAPDTFFVDVTFISRPAEALTLVFNTATRRVLGI
FT                   LSRIRSREEAGAAPRVAQEFLVGTLASGDAGEGASGAVPAETRDLIGTRTLNVYSPNHT
FT                   YEHTYLSSTRYCWQCLVGEQRGHGDVDLATTYKFADDLYVFTFREFLIPVASVFVFNFA
FT                   AGRSTGKFLGETGDGAIANRPAGSFIRKLSQAVYPADAQPV"
FT   gene            complement(57002..57799)
FT                   /locus_tag="BTH_I0053"
FT   CDS_pept        complement(57002..57799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0053"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37316"
FT                   /db_xref="GOA:Q2T2I2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I2"
FT                   /protein_id="ABC37316.1"
FT                   /translation="MHTFNGKVALITGGGTGIGAAVARKFVEAGGRVVLLGRRREPLDA
FT                   VAKPLGAAAIAVAGDAADAHDVRRALDDARAAFGSVDVLVANAGGHGVGSALDTDDASW
FT                   AQSTRVNLDTAFVCARELLPELIERRGSIVILSSLAGHFAGPNVVGYVTTKHALIGLTR
FT                   SLARDYGRCGVRVNAVCPGWVRTAMADEQMDALRDAHGLATREDAYRLVTRDVPLGRPA
FT                   EPDEVADTVLYLASPHASMITGTSLLVDGGASAVDLPTIEFAR"
FT   gene            complement(57884..59554)
FT                   /locus_tag="BTH_I0054"
FT   CDS_pept        complement(57884..59554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0054"
FT                   /product="GMC oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36820"
FT                   /db_xref="GOA:Q2T2I1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I1"
FT                   /protein_id="ABC36820.1"
FT                   /translation="MSAATPKGSTEFDYIVIGGGSAGCVATHRLVNAGHRVLLLEAGPP
FT                   DNSFFVHTPATFVRVIGTKRTWVYETEPQAHAAGRRMYVPQGRTLGGGSSVNAMVYIRG
FT                   TPADYDGWRDAGCDGWGWDDVLPFFRRAERNHRLAGPLHGADGPLHVSDARFRHPLSDA
FT                   FVQGAQEFGLPYNDDFNGASQAGVGFYQTTTFEGRRGSTAATYLAAVKRDPLLTIETDA
FT                   FVTRIVFENGAAVGVRYRARGGEERLVRARAEIVLCAGALASPKLLMLSGIGPADQLRQ
FT                   HGIAVVHDSPEVGLNFQDHLEVSLYGRARAPISLAGQDRGLNALRHGIQYTLFHTGLLT
FT                   SNVVESGGFVDTANGGRPDVQFHVLPVLVGDVGREPLEGHGISINPCFLRPKSRGTVRL
FT                   RNADPLAPILFDGNFLSHPDDFATLVRGLSLAREIMRMPSMSKAIAGEMLPTDGGRVDL
FT                   DAYVRSHAKTVYHPSGTCRMGGDPGSVVDSQLRVRGVGGLRICDASVMPSLVSGNTNAP
FT                   TIMIAERCAEFMLSPALAPNARAGASAPRAAPLDAGHAR"
FT   gene            59895..60236
FT                   /locus_tag="BTH_I0055"
FT   CDS_pept        59895..60236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0055"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37972"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I0"
FT                   /protein_id="ABC37972.1"
FT                   /translation="MKTQLKKGALDMCVLAVLARRDSYAYELVSTLAETMEISEGTIYP
FT                   LMRRLQAEAWVTTYLVESTSGPPRKYYSITDAGRASLRQMENEWRSFVDEVNGVLALHR
FT                   TQADGEERQ"
FT   gene            60233..61411
FT                   /locus_tag="BTH_I0056"
FT   CDS_pept        60233..61411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38556"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H9"
FT                   /protein_id="ABC38556.1"
FT                   /translation="MKQDAFIQRLRQALGSLPKRDVDEIVADYREYIGDALSAGRAEED
FT                   VIAALGDPEKLARELKAQANFRQWEERRSFGNLMRVVGSIAGLGLLHLILLVPFLLYML
FT                   VLTTGYVFFGALTVAGLVTLVAFGSHYVFGTPVPGVLPFGGGAAQVGVAGAADGKGAAA
FT                   GKDAQGGKDAKNSKSASAAAADALNDAKELRVDGERYVLDLHDGSRVSIVTRKGVIDAR
FT                   KQDGKLSVDATGDGARALLATGSDGTFNIARADVIALDLKSASGDQMTVANTGASMPGV
FT                   NVPGIAGGNVQMTPDGRGGMNLSVTNGENAVSIVGGRITVDNGKQHVSVAAPTGFALGG
FT                   IAFGYGLAMLPIGIVGLLVCIWLTRVTWRALVRYVRRRIDAVSAKLERERGS"
FT   gene            complement(62099..63088)
FT                   /locus_tag="BTH_I0057"
FT   CDS_pept        complement(62099..63088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0057"
FT                   /product="fatty acid desaturase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37430"
FT                   /db_xref="GOA:Q2T2H8"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2H8"
FT                   /protein_id="ABC37430.1"
FT                   /translation="MTDRIRIRDLFTRDEIRALTARSNWRGAWAVGSTWAVIALAFAGL
FT                   AYARAHFPAWGFALALAAGMTIIAGRQLCLGILQHDAAHGTLFRTRWANDVLVDWLCAR
FT                   PIWNELHKYRPYHLTHHATTSSSADPDLSLVAGLPTTRASLARKCLRDLSGVTGVKFLI
FT                   GRALMDAGVLKWSLTNDIQRLPQTGRRWRDYPVAFLRTAAGMLITNAILFGALWASGHP
FT                   WLYGVWVLAYVTPFPLFIRIRSMAEHACRETSDDPLRNTRTTHAGWLARATVAPIRVNY
FT                   HVEHHLMASVPYFRLPKMHRMLRERGCVARPPSYWQVLKTVSGKTAAA"
FT   gene            complement(63118..63954)
FT                   /locus_tag="BTH_I0058"
FT   CDS_pept        complement(63118..63954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36507"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J5"
FT                   /protein_id="ABC36507.1"
FT                   /translation="MTQPTAKHLILDLLVAKDGEPLQVREAIIACRLFGLTENSVRVAL
FT                   ARLAAESLVEGAERGSYRLGPSAVELSEELTAWRTVESRLRRWSGAYLMVSCISLGRVD
FT                   RTALARRERALEMLGFREWDKSLYVRPDNIAGNVDSVRRRLTNLGVEPAAAVFVAMGFD
FT                   AAQEARIRALWDGDALSDTYRTLGAQLEDWLARAPELDLDVAAREAFLLGGKAIRQVVF
FT                   DPLLPEPFVDVAARAVFIECARRYVGAGHRIWRALLDSEHPSAPGAARAAVAGHLH"
FT   gene            complement(64266..65480)
FT                   /locus_tag="BTH_I0059"
FT   CDS_pept        complement(64266..65480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0059"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38721"
FT                   /db_xref="GOA:Q2T2J4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J4"
FT                   /protein_id="ABC38721.1"
FT                   /translation="MASPVWESRGAPASAPAASCLRYLSKSGTICVDPKRHFLDMKKPP
FT                   RGAGRPGVAILLPPRLLGGYVFLTQEMLLLAGTMKARSLDVVNSRLFDIAMLSHDGRPV
FT                   PTIGGVDVPATAALRDTDAHEVVIVPAQFMPDEQIGAVERVFIDWLKRRYAAGALVVGL
FT                   NAAPLIAKAGLLDGRGATGLPSERTLFARHFPAVRYTPSKPLVVDGRLITVSGINPAVD
FT                   ACAYVIDYCFGAGVSQRLLRVALTQSLPSYEHMAVWAAQYKRHGDAPVLAVQDGVERAL
FT                   AHPPTLAELAARAAMSERTLSRRFAAATGLTLRRYVAALRVELAAFLLRTSRMTLDHIA
FT                   DECGFASASALSHAFLAGQGCSPVQYRNRHRPDARRDAAQNGSAGGTAAISGTGGASAG
FT                   EQAGK"
FT   gene            65479..66615
FT                   /locus_tag="BTH_I0060"
FT   CDS_pept        65479..66615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0060"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38891"
FT                   /db_xref="GOA:Q2T2J3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J3"
FT                   /protein_id="ABC38891.1"
FT                   /translation="MIPRTIFAEEHEQFRESVRRFIESEVMPYHERWEEQGYVDRGVWT
FT                   KAAEAGYHCASMPEAYGGAGADIRYSIVLFEEIARAGASGLGFGLHSEIVAPYILHYGD
FT                   DALKARYLPKLASAEMIGAIAMTEPGAGSDLQGVRTSAVRDGDHYVLNGSKIFITNGWH
FT                   ADVVIVVARTTPEGGSKGTSLFVVDTGMAGFSKGKRLKKVGMKAQDTSELFFDGVRVPA
FT                   GNLLGEENRGFVYLMQELPWERLQIAISAIASAEAALAWTLDYTRDRRAFGRAVIDFQT
FT                   SRHALAELKSEIQIGRVFVDKCIELQLAGKLDAATASMAKYWTTELQFKVIDRCVQLHG
FT                   GYGYMWEYPIARAWADSRVQQIYGGTNEIMKELIARTL"
FT   gene            66869..68371
FT                   /locus_tag="BTH_I0061"
FT   CDS_pept        66869..68371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0061"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38278"
FT                   /db_xref="GOA:Q2T2J2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J2"
FT                   /protein_id="ABC38278.1"
FT                   /translation="MPSRVRDRNRPRRSKIAPGERAARLAADERFGKRRLAGGREEKTR
FT                   GQHAGTRRSAHPSGGTGGTRRAPGRPAGRRGRPDRRPPHPAVPTGHLHQPKERFMEAYI
FT                   FDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTSAVDDVVLGCVEPVGEQG
FT                   ACIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSDMAIGGGVESMSRV
FT                   PMGASGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAATQA
FT                   GWFARSIVPVRDANGLTILDRDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRYP
FT                   ELERIEHVHHAGNSSGIVDGAAAVLIGSLEAGKRAGLAPRARVRSFASVGSEPSMMLTG
FT                   PAYAAEKALKRAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPL
FT                   GATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI"
FT   gene            68384..70507
FT                   /locus_tag="BTH_I0062"
FT   CDS_pept        68384..70507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0062"
FT                   /product="fatty oxidation complex, alpha subunit"
FT                   /EC_number="5.1.2.3"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM PF00725; match to protein
FT                   family HMM PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37159"
FT                   /db_xref="GOA:Q2T2J1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J1"
FT                   /protein_id="ABC37159.1"
FT                   /translation="MIDYTLDDDGIAALSWNLPGRSQNVLNGESCAAFFAAASRALQDA
FT                   AVKGILVTSAKPDFIAGGDLEWLQASDDAETLFARTCELHRALRALETGGKPVAIAMPG
FT                   SALGGGLEIALAGHYRVAADNPKARFGLPEVTLGLLPGGGGTQRLPRLVGIQASLPLLL
FT                   EGKRLKAADALAAGILHAVVPAGEEIAAARAWLLDASRRTATQPWDVKGFRIPGGALTH
FT                   PSVQQVFMAANALARQKTYGNYPAVASILSCVYEGLLTDLDTGLKTEARYFVKAVLSPQ
FT                   AKAMIRTLFFGMNEANKLAARPAGVPTQRYRKIGVLGAGMMGAGIAYVSAKAGLDVVLI
FT                   DTSEEAAARGKDYSRKLVDKQVQRGRLTREKADALLAKIVPTTDYARLDGAELVIEAVF
FT                   EDRAIKADVTRRSETVLAPDALFASNTSTLPITGLAQASARPANFIGLHFFSPVDKMPL
FT                   VEVIVGRDTSEATLARALDYVKTIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVA
FT                   PALIENAGLLAGMPVGPLALTDEVSSELIHKITKQTRADLGDAYVARPGEDVAARMVEL
FT                   GRLGRKAGLGYYDYPANGGKKALWPGLAQAFPVAAEQPDVAALIERLVTVQAVETARCL
FT                   EERVLTTARDADVGAILGWGFPAFRGGPVSYIHGVGVDAFVATCDRLAARYGARFAAPG
FT                   LLREMAAQGRSFY"
FT   gene            complement(70662..70850)
FT                   /locus_tag="BTH_I0063"
FT   CDS_pept        complement(70662..70850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36489"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2J0"
FT                   /protein_id="ABC36489.1"
FT                   /translation="MPAPVRFDAFGSARCRVAPRGRDDRGPAMSGSVTSPVPLRHGMTQ
FT                   RGAMRRVVTQRMRHGTT"
FT   gene            70850..71983
FT                   /locus_tag="BTH_I0064"
FT   CDS_pept        70850..71983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0064"
FT                   /product="alpha-methylacyl-CoA racemase"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36414"
FT                   /db_xref="GOA:Q2T2I9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2I9"
FT                   /protein_id="ABC36414.1"
FT                   /translation="MGPLHGIRIVEIAGIGPAPFCGMLLADMGADVILVERTAGRAGDP
FT                   LDLGRRAIFNRGKRSLALDLKQPEAVDAVLRLVEHADALIEGMRPGVMERLGLGPDACF
FT                   ARNPKLVYGRMTGWGQDGPLAHAAGHDINYIGLSGALWYAGQPGDAPFAPPTLVGDLGG
FT                   GALYLAMGVLAGIVDARLRGKGQVVDAAIVDGSANLMNLLLSIHAAGFMPMARGQGLLD
FT                   GPHWYGSYRCACGGYVSVGALEPPFYALLVDKLGLADDDDFRNPYDASRWPRLRERLAE
FT                   IFASRPRAHWVELMEGTDVCFAPVLSPAEAKSHPHLAARGVYAERDGVLQAAPAPRFSG
FT                   SPNAQPGAVPKRGADSAAILREAGFAPDEIAALVAKA"
FT   gene            complement(72059..72883)
FT                   /locus_tag="BTH_I0065"
FT   CDS_pept        complement(72059..72883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38719"
FT                   /db_xref="GOA:Q2T2L0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2L0"
FT                   /protein_id="ABC38719.1"
FT                   /translation="MARRVASARPNRAAAMAIAWRRQPSAGSRTHPCGKLAGDERAAFP
FT                   SAASSRSDTLHVTIDAIRLQSEVRPHRRRPPTLYPNHEDHSMRIIRAWLALTFVASIAC
FT                   LLFAAPAAHAAPAGKTLTFDGVAFFQRDAAGNRLEYTPKGEDDLSTWQTMITLVRYPEA
FT                   TTPDGLASITDSVLRLYKQNGALILKVDAVPAAHGKPAEYFISVAFPTRDFIEAVFTRV
FT                   ALVDGAGAAAIYSHREYGRAVGNEVSAWIEKNGPAKERALKQWNPLPTVGGK"
FT   gene            complement(72952..73413)
FT                   /locus_tag="BTH_I0066"
FT   CDS_pept        complement(72952..73413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39359"
FT                   /db_xref="GOA:Q2T2K9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2K9"
FT                   /protein_id="ABC39359.1"
FT                   /translation="MNRLIRCATALIGSSSFVCACAQTYDGTAAPIDTSNCRAIAGQAD
FT                   IDGTMQQVVGRACLQSDGTWRLVQNPDGSVLWYPLAAYPYPDLWYWGAPFVIGAGTTFI
FT                   FVDRFHHFHRFHHFHPMTPGHIGPPAGGGFHRGPPHGGGMSGWGGKTRH"
FT   gene            73696..73812
FT                   /locus_tag="BTH_I0067"
FT   CDS_pept        73696..73812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37270"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2K8"
FT                   /protein_id="ABC37270.1"
FT                   /translation="MFFAFAFVPAIGLCAHRVRMSLPSRGASAVTAYAWRTP"
FT   gene            73967..74407
FT                   /locus_tag="BTH_I0068"
FT   CDS_pept        73967..74407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38716"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2K7"
FT                   /protein_id="ABC38716.1"
FT                   /translation="MPYVSTHYSNNAGAPVGRWTCAPTSKLAPFDKAPTGSVTSGVDLC
FT                   GQCVSYVKRVCPTLPLTGQWRKGAPVKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTK
FT                   DGGILVYDQFVTPPTPQPVQQRRLRWGAHGRSNNGDNFYVVE"
FT   gene            74394..74789
FT                   /locus_tag="BTH_I0069"
FT   CDS_pept        74394..74789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0069"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37798"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2K6"
FT                   /protein_id="ABC37798.1"
FT                   /translation="MSWSKAACALAAASFFGCAGASGTADATGATGAAGAARAGTAVCP
FT                   VRAQSPLQYVDVFDGAPSDLATLIPDDAGERKGHWELGYVYDAGRYVTIRCKYADGQTK
FT                   DVRLAERVNRCDYRIDGKKTLKVTCRK"
FT   gene            complement(75029..75781)
FT                   /locus_tag="BTH_I0070"
FT   CDS_pept        complement(75029..75781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0070"
FT                   /product="transmembrane regulator PrtR"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37636"
FT                   /db_xref="GOA:Q2T2K5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2K5"
FT                   /protein_id="ABC37636.1"
FT                   /translation="MNIPPDEQDLHAYVDGRLDADARVAVERWLALHPARAEQVRRWRQ
FT                   DAQQLRAALDSAAMPAATATLDPAALRARRAERARARLAVAASFVLCVALGAMGGWQAH
FT                   GWSSAPAAPMSDAVAAYKLMVVDRSARVDVVQKQPGELQAWVAREIGAPVRLPDLSGAG
FT                   FAPVGGRLFATERGAAAMVLYEDAAGRTLSFYIRPPESANRLLAAGERADGALLARYGS
FT                   VRGFNYAVVGRADSVGEAAVARALDAQI"
FT   gene            complement(75778..76293)
FT                   /locus_tag="BTH_I0071"
FT   CDS_pept        complement(75778..76293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0071"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36632"
FT                   /db_xref="GOA:Q2T2K4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2K4"
FT                   /protein_id="ABC36632.1"
FT                   /translation="MPSADLDDPLRELLPRLRRFALWLTRDVHSADDLVQSTLERALSR
FT                   WSTRRDASALRSWLFTILYRQFVDTTRRAKRYAWLLGRIKDDDEPQWPSAEDHALARSM
FT                   LDAFGRLSTEQRSLLLLVAVEGFSYQEVAELLDIPIGTVMSRLSRARQALRALGDGEIS
FT                   APSLRLMK"
FT   gene            76454..77539
FT                   /locus_tag="BTH_I0072"
FT   CDS_pept        76454..77539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0072"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="identified by match to protein family HMM PF00199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38021"
FT                   /db_xref="GOA:Q2T2L6"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2L6"
FT                   /protein_id="ABC38021.1"
FT                   /translation="MEHPSTPPGAGPARGLWRWALIGGAVTAVAATFGYVGGWLAPHRL
FT                   TPQRLVDALQRNSGLHPGYRRNHAKGVCVTGYFEGNGAASAYSTAPFFAAVRTPVVGRF
FT                   AMPGGNPYAPDSSVPIRSLALRLSAPDGEQWRTGMNSMPVFPVATPRAFYEQTVAGRPD
FT                   PRTGKPDPAKLKAFFDAHPETAAFRAWAKTAKPSASYVTETYYSLNAFYLVDAAGRRQA
FT                   VRWRVAPERTAEAGEVAKAGDPNVLQEDLTRRIGSGPQRWHLLLTLAEPGDPVDDATRV
FT                   WPANRTTIDAGTLVLDRVEAQDSGPCRDVNYDPTILPDGIRVSGDPLLAARSAAYADSY
FT                   LRRTSEEAGIPGAAHPLSEKR"
FT   gene            77536..78063
FT                   /locus_tag="BTH_I0073"
FT   CDS_pept        77536..78063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0073"
FT                   /product="cytochrome b561, putative"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37923"
FT                   /db_xref="GOA:Q2T2L5"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2L5"
FT                   /protein_id="ABC37923.1"
FT                   /translation="MMKTTFNPLARLLHWVMAAMIVSMLFVGAGMVATVSGRHAVLVAI
FT                   HKPLGVAVLVLACVRVVVRLSSRPPALPSDLPGWQKFAAHGSHLVLYALMIAMPLVGWA
FT                   MLSAGGYPVTLGGGVQLPPIVPADAVWFAWLRHAHRWLAYLFFATFLAHFAAALYHGLI
FT                   RRDGVLRAMVGR"
FT   gene            complement(79206..79715)
FT                   /locus_tag="BTH_I0074"
FT   CDS_pept        complement(79206..79715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0074"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37750"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2L4"
FT                   /protein_id="ABC37750.1"
FT                   /translation="MPRKRKEEVTIEPGKGLNLDPELIKQLVPGTLDRAASEDHQGARP
FT                   LPVGRGRAQTDLAGAAQRRCQVDRLPARLEECHDSVRTALPGTIQHWSLNLNPPHTRNS
FT                   GYPRCALLKGSNRSLFYFPEIPIAGHHFSALYKSKLRICRSMNFVIKFSHLNVPRPRQA
FT                   LHASIS"
FT   gene            80897..82462
FT                   /locus_tag="BTH_I0075"
FT   CDS_pept        80897..82462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0075"
FT                   /product="recombinase"
FT                   /note="identified by match to protein family HMM PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37203"
FT                   /db_xref="GOA:Q2T2L3"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2L3"
FT                   /protein_id="ABC37203.1"
FT                   /translation="MSFNSAGAPSVASSLAGRAAEYVRMSTEHQQYSTENQRDRIRDYA
FT                   TRRGFDIVRTYADEGKSGLRIDGRQALQNLISDVTNGKADFCIILVYDVSRWGRFQDAD
FT                   ESAYYEYICRRAGIQVAYCAEQFENDGSPVSTIVKGVKRAMAGEYSRELSAKVFAGQCR
FT                   LIEMGFRQGGPAGYGLRRVLVDEHGLMKAELHRGEHKSLQTDRVVLMPGPESEVRIVNL
FT                   IYNWFIDESLDEYEIAARLNGMNVRTDLGREWTRATVREVLTNEKYIGNNVYNRVSFKL
FT                   KKMRVMNTPDMWIRKEGAFQAIVPSETFYTAQGIMRARARHYSNEELIERLRNLYRARG
FT                   FLSGVVIDETDGMPSTSVYVYRFGSLIRAYQTVGFTPGRDYRYIETNRFLRKLHPEIVA
FT                   QTEKKIADLGGTMIRDTATDLLTVNDEFTVCIVLARCQAHGNGRNHWKVRFDTSLLPDI
FT                   TVAVRLDQANASTLDYYLLPRLDFGQPRIHLADQNPIEFESYRFDTLDYLYGMAERARL
FT                   RRVA"
FT   gene            82492..83133
FT                   /locus_tag="BTH_I0076"
FT   CDS_pept        82492..83133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0076"
FT                   /product="stage 0 sporulation protein J, putative"
FT                   /note="identified by match to protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38099"
FT                   /db_xref="GOA:Q2T2L2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2L2"
FT                   /protein_id="ABC38099.1"
FT                   /translation="MIPVSQIEVINPRERNGRVFNEIVDNIKAIGLKKPILVTPRVTTG
FT                   GIEKYLLVCGEGRLKAFRTLGEATIPALVVHVSDEDAYVMSLTENIARRQCRPIERLAG
FT                   IRQLQEQGYPPKVIAEKTGLTSTYVHGILTLLHQGEERLVVAVEKGLVPLNAALMIVGA
FT                   GDDDAEIQAALQEAYESGKLRGKQLMTARRIIERRKALGSKRVAGTVSTV"
FT   gene            complement(83375..83782)
FT                   /locus_tag="BTH_I0077"
FT   CDS_pept        complement(83375..83782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0077"
FT                   /product="L0013 protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38799"
FT                   /db_xref="GOA:Q2SZK0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2SZK0"
FT                   /protein_id="ABC38799.1"
FT                   /translation="MSTEAPKRTSRKGIPNHPVEFRRKLAKLACEPGVSVARLAMEHGV
FT                   NTNLLFKWRRALRAGEYDSVGFLPVTLEAPAPQIERPTATVAPTPVIGAAAMGAIEINV
FT                   GNTRVRIEGSPNEGTLRLVLRMLRNTPESAA"
FT   gene            84413..85573
FT                   /locus_tag="BTH_I0078"
FT   CDS_pept        84413..85573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37539"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M4"
FT                   /protein_id="ABC37539.1"
FT                   /translation="MKTIWKILGLAAAASISLAGCGGGDGGGSAQTGTLHVAMTDAPSC
FT                   GFDHIYVTVSKVRVNMSAQAGDNDAGWTDVALATPEKVDLLSLTNGVLADLGQNALPAG
FT                   QYQQVRLVLAQNQGNTLANSVVPTGGTEQPLATPSATQSGYKIITPFTVQPNTLVDLVL
FT                   DFNACKSIVQRGNGAYALKPVVTATPTVVSGAIDGYVAPTEAGATVYAEQNGHVIKGTL
FT                   ADSAGHFVLTPLVQSSTNGNYDIVIAQNNVATGIVRSVPVVVNTTTSVSTSSVPITLPA
FT                   STMNMVSGTATASADAILRALQMVNSLPYEIASANANLDTGAYALTLPTAAPIVGTYSG
FT                   ALPVAMSAVPTAAGQYTIEADAANGATQQQPANITAGSVSNVNFGF"
FT   gene            85638..85793
FT                   /locus_tag="BTH_I0079"
FT   CDS_pept        85638..85793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0079"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36857"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M3"
FT                   /protein_id="ABC36857.1"
FT                   /translation="MKKIIIALAVSAGVLSGCAVYVPDQPGVIMAPQGGPGNGFCPPGQ
FT                   AKKGNC"
FT   gene            complement(86137..86319)
FT                   /locus_tag="BTH_I0080"
FT   CDS_pept        complement(86137..86319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37360"
FT                   /db_xref="GOA:Q2T2M2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M2"
FT                   /protein_id="ABC37360.1"
FT                   /translation="MEAIVIEQVILGVFLVLPLLIVAVLYSDELWQEHRLQHPRDEHTP
FT                   HIDWRHPWRILRRGH"
FT   gene            86443..87027
FT                   /gene="speG"
FT                   /locus_tag="BTH_I0081"
FT   CDS_pept        86443..87027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="BTH_I0081"
FT                   /product="spermidine n(1)-acetyltransferase"
FT                   /EC_number="2.3.1.57"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38475"
FT                   /db_xref="GOA:Q2T2M1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M1"
FT                   /protein_id="ABC38475.1"
FT                   /translation="MTQGPSHTMQTQKEQHMLALRPLERQDLRFVHELNNDAKIMRYWF
FT                   EEPYETFTELSQLYDQHVHDQRERRFVVFDPDGELVGLVELIELDYIHRRGEFQIIIAP
FT                   NRQGRGYATRATRLAVEYAFKVLNLRKLYLIVDKSNAAAIRVYEKCGFTHEAELIEEFF
FT                   GNGQYHNALRMCIFQRDYFAAHQGAELHGRE"
FT   gene            87513..87860
FT                   /locus_tag="BTH_I0082"
FT   CDS_pept        87513..87860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39174"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M0"
FT                   /protein_id="ABC39174.1"
FT                   /translation="MMKRTGLFLVLTSGIVAFSVAQAAGDASLKPQQEIQLTKDAWGCL
FT                   SKDNLDSVLNHERDGKSQAKQQYFDDYRCLSVPEGQRFRVVSVDQGDVQFVSAENSDQQ
FT                   GLWTDARFIKQ"
FT   gene            87880..88635
FT                   /locus_tag="BTH_I0083"
FT   CDS_pept        87880..88635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0083"
FT                   /product="YaeQ protein family"
FT                   /note="identified by match to protein family HMM PF07152"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36283"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2L9"
FT                   /protein_id="ABC36283.1"
FT                   /translation="MRPASRPSQRTGAADSSGPACVGPSCVYGCRSWPLPAAISSDVAL
FT                   AARIRYHHAPNRINGPRGLRCRMALKSTIYKAELQIADMDRHYYADHSLTVARHPSETD
FT                   ERMMVRIAAFALFAHERLEFCKGLSDIDEPDLWQKDLTGAIEAWIDVGQPDERRIAKAS
FT                   GRADRVNVIAYGGRTSDIWWQGVRGKVERLRNVQVTSLAEGVAAALGGIAERTMRLQCT
FT                   IQDGGAWLSSETHDPVAIEWTTLKAREDA"
FT   gene            complement(88763..89179)
FT                   /locus_tag="BTH_I0084"
FT   CDS_pept        complement(88763..89179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0084"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37840"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2L8"
FT                   /protein_id="ABC37840.1"
FT                   /translation="MKFHIHEIDHVVLRAADLAAMTRFYCDVLGCHVEKEQRELGLVQL
FT                   RAGRSLIDLLAAGAPIDRADSGAPGKGRNMDHLCLRIEPFDAAALHAHLAEHGARPGDE
FT                   ARRYGADGYGPSIYLFDPEGNMVELKGPPEAIAP"
FT   gene            89582..90676
FT                   /locus_tag="BTH_I0085"
FT   CDS_pept        89582..90676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0085"
FT                   /product="ADA regulatory protein"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01035; match to protein
FT                   family HMM PF02805; match to protein family HMM PF02870;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38715"
FT                   /db_xref="GOA:Q2T2L7"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2L7"
FT                   /protein_id="ABC38715.1"
FT                   /translation="MKQPAYPTDDARWAALVARDADADGAFCYAVKTTGVFCRPSCASR
FT                   LPRRENVSFFADTDAARAAGYRPCKRCRPEGLPRELEIVNRACVVLDAHRQDRFTLAQL
FT                   SDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQGGAAVTRAAVDAGFNSPSR
FT                   LYESVPRELGMSPSAFRRKGAGLTIDYATADTRLGVVLVAATSKGICKIAFGDAATPLV
FT                   DELRTAFANAQIVESPARIAPFIAQVDAYLNGTRRRFELPLDLAATEFQQRVWDALRRI
FT                   PYGETRSYTQIAETLGAPRSVRAVASACASNPVALAIPCHRVVQKGGSLAGYRWGLPRK
FT                   AALLDAEAQRAARESVEPAVDDAA"
FT   gene            90583..91614
FT                   /locus_tag="BTH_I0086"
FT   CDS_pept        90583..91614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0086"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /note="identified by match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39352"
FT                   /db_xref="GOA:Q2T2N2"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2N2"
FT                   /protein_id="ABC39352.1"
FT                   /translation="MGLAAQGGAPRCRSAARGARIRRARRGRRRLSAAVESAVVPSGSV
FT                   VFELPFKPPYDWPRVLRFFAGRAIPGVEAVEGGAYRRTVDYRGAVGALTVRKHPRKRCL
FT                   VATVEGDAARHADAAFAARLATMFDLHADPAAIGAHLARDAWLAPLVDAAPGLRVPGAW
FT                   SSFELIVRAIVGQQVSVKAATTIVGRLVERAGERLVGHAPGATGWRFPEPAALAACDLS
FT                   RIGMPGKRAAALQGVARAVAAGDVPLDAYATDPAGVRAALLALPGIGPWTVEYVAMRAW
FT                   RDADAWPATDLVLMQAIVARDPALDRPASQRLRADAWRPWRAYAAMHLWNEIADRAGSA
FT                   RGG"
FT   gene            91752..93398
FT                   /gene="gshA-1"
FT                   /locus_tag="BTH_I0087"
FT   CDS_pept        91752..93398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA-1"
FT                   /locus_tag="BTH_I0087"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04262;
FT                   match to protein family HMM TIGR01434"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37829"
FT                   /db_xref="GOA:Q2T2N1"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2N1"
FT                   /protein_id="ABC37829.1"
FT                   /translation="MPRIAEPALASMPNNMTSRQTDLLQQRLAVLSTSPTREQLPDGLR
FT                   GIEKESLRVTRDGMIAFTPHPRALGSALTHPSLTTDYSEALVELITPAERDAATTLERL
FT                   DELHRFVYASIGDEMLWTDSMPGLLPADDEIPIADYGTSNIGRLKTVYRRGLAYRYGRT
FT                   MQCIAGIHYNYSLSEEVWRRLHAEEGSTASIVDYQSERYLALIRNFRRTSWLLMYLFGA
FT                   SPALDLGFLRGRAHKLDTFDAATLYRPHATSLRMSDLGYSNTTAQAALQADYNTLSGYL
FT                   DALSKAVSEPYPPYEAIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHAL
FT                   ASRGVQYIEVRCLDIDPFEPTGIALDTARFLDAYLLVCALDESAPLTCDAYRESNANFG
FT                   RVTMEGRKPGLELARNGAAVPMRTWADEIFAQIEAAGRVLDDIRGGDAHARAIAAQRAK
FT                   LDDPELTSSARVLRAMRENGQSFLEFARAQSAAHAAYFRGRPLDEAATRDAQALAERSL
FT                   AEQAELEGKNAGSFDAFVAAYRAYTLNRFSV"
FT   gene            complement(93414..94865)
FT                   /locus_tag="BTH_I0088"
FT   CDS_pept        complement(93414..94865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0088"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="identified by match to protein family HMM PF00140;
FT                   match to protein family HMM PF04539; match to protein
FT                   family HMM PF04542; match to protein family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38558"
FT                   /db_xref="GOA:Q2T2N0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2N0"
FT                   /protein_id="ABC38558.1"
FT                   /translation="MKVSEREVRYEQGIDRLLELACARDDTEYAELADEFASAPSDTHA
FT                   HAHDLGEPEFLDRHASDESAGTGSFGDKPTRAAHADADWHDGDVVDAQSSEPSDATPDD
FT                   TAVSTDPLALFVRRMHAVPLLTHAQEIALATEIEAGREQVLQALAETLDLLELASLPDD
FT                   PALGRARAALQRARARGDEGARAFARARKAAYAALAAHGWPSAEIDAMRRAMRRLPTPP
FT                   EQGDAGALPAFADGEARISAATARMAEANLRLVLSIARKYASRGLDLADLLQEGNLGLL
FT                   RAIEKFEYRRGFKFSTYATWWIRQAISRAIADRARTIRVPVHVGDEARRVRKVADRIER
FT                   RSGARASLAELSEATGLSAERLRAVLMLPREPRSLNAPLGDDDQAEFGDIVEDASTPSL
FT                   FDALAQGQMCDVVTSLLKTMSAQEADILRRRFGIGGDEPWSYEQIAAQAGVSREQIRRI
FT                   EKRALQTLRITADACNARDFLDAQP"
FT   gene            complement(95108..95533)
FT                   /locus_tag="BTH_I0089"
FT   CDS_pept        complement(95108..95533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38048"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M9"
FT                   /protein_id="ABC38048.1"
FT                   /translation="MLADVPLVEYVVQDMTVREFASRALRAFCLWPQLLLEDPLDYGAL
FT                   ALPVRRHLFTGNDAGWKAYASTLRDAAPGFDTARWYTAEPHEAELELAGERDVEAGDGP
FT                   IERNDEDDDDGRLRERAAASVESAAPDAAPIRRESYE"
FT   gene            complement(96449..97024)
FT                   /locus_tag="BTH_I0090"
FT   CDS_pept        complement(96449..97024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37018"
FT                   /db_xref="GOA:Q2T2M8"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M8"
FT                   /protein_id="ABC37018.1"
FT                   /translation="MKIERYSKGLTVISLTAALWSLGMPSAPAAPASAPDASAQTPCGR
FT                   GYGYGMGPGMMGGGYRRGMMGGYGMGPGMMRGYGPGMMMGFGGWPGDLDLTTEQRAKIN
FT                   RIQDETRKTHWALMGNMMDQQAKLRDLYDAPKHDSAAIDETSKAIGSLRQKMIDSSVDA
FT                   HKKMEAVLTSKQLDKLRAYEKQANDMGW"
FT   gene            97240..97533
FT                   /locus_tag="BTH_I0091"
FT   CDS_pept        97240..97533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0091"
FT                   /product="phage portal protein, PBSX family"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36589"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M7"
FT                   /protein_id="ABC36589.1"
FT                   /translation="MARRRTMVSGTLRLEPALAKYVRRKADFSGFVYVNGWQDRHAFEP
FT                   GSVFQLVRSDGHQSGGVRPARVQARCAELNDWRGEEVVVFDDYEIPPTPVAA"
FT   gene            98003..98578
FT                   /locus_tag="BTH_I0092"
FT   CDS_pept        98003..98578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0092"
FT                   /product="Fels-2 prophage protein"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37442"
FT                   /db_xref="GOA:Q2T2M6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M6"
FT                   /protein_id="ABC37442.1"
FT                   /translation="MQESELTYLVPQQIRGLLTALAEGRNIHVLLISKVCLATGARWGE
FT                   AEGLRRTQIKGGQIQFVKTKSSKARSVPITDVLERELIAHFGNYGDSDTGRLFEASSSA
FT                   FREAVERAGVVLPDGQLTHVLRHTFASHFMMNGGNILALQRALGHHSLTMTMRYAHLSP
FT                   EHLAETRRLNPIACLENDGAAVAAMTDK"
FT   gene            98679..99695
FT                   /locus_tag="BTH_I0093"
FT   CDS_pept        98679..99695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37629"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2M5"
FT                   /protein_id="ABC37629.1"
FT                   /translation="MRYAFWNNKGGTGKTSLAFQSICRFAELNPHARILAIDVCPQANL
FT                   SELMLGGLTNQGSARLMQRQGQVPRCSIGGYFQLRLPAPYTRPAFTASDFITTPNQYNP
FT                   LIPGNIDLVCGDPLLELQANAVNTLANAQIPGTNTWIAVIDWISDFLESAEGYDYVFFD
FT                   ANPSFSIYTQIALSATNRVILPVMADDSSRRAIQNAFSLIYGLRLPSPIYATYNFATKL
FT                   REAERPLPQVHLIPKNRLTQYMGPASAFYAVLAAIDQDVAGLLVQRPDLFTFADVADGV
FT                   VDVRDFQTTGVVSYAKGAPFSQLRTGRLDIGGHRVRVDADMRQNCIDAIDGLVDRIE"
FT   gene            100027..101376
FT                   /locus_tag="BTH_I0094"
FT   CDS_pept        100027..101376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0094"
FT                   /product="Phage integrase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38326"
FT                   /db_xref="GOA:Q2T2E5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E5"
FT                   /protein_id="ABC38326.1"
FT                   /translation="MVSKQNFTAARVDAFQCEPGKQQTIYWDAKTPGFGLRVTAAGARA
FT                   FIFESRLFGKTVRLTIGDVRAWDLGRARTEAARLKTLIDDGKDPREVRAEQQAEHEARR
FT                   AEARRQDALFGVVWDEYTESRKAFWGERHYRDHLQHADEGGQPKKRGKGVTQPGPLAAL
FT                   RPLKLSELTSERIADWLTAESRERPTMSALSFRLLRGFIRWADDTSAYKGIVPIDAYKA
FT                   RDVRDVVPRVKAKDGDSLQREQLGVWFREVRKIANPVQSAYLQGLLLTGARREEWAGLR
FT                   WEDIDFRWRSVVLDDKVEGTGGRTIPLTPYLATLLMNLKRLNETPPDRRQLARLAERRE
FT                   TWVPSEWVFASKTSEDGKIAEPRIAHNKALAAAELPHVTLHGLRRSFGTLSEWVEVPVG
FT                   VVAQIQGHKPSAIAEKHYRRRPLDLLRMWHDKVESWMLEQAGVQFQVDPA"
FT   gene            101445..102239
FT                   /locus_tag="BTH_I0095"
FT   CDS_pept        101445..102239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0095"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38905"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E4"
FT                   /protein_id="ABC38905.1"
FT                   /translation="MATIDRRRLSQRSDGVMTNDQTPQERIAAGRQLYAVLKDHLERRA
FT                   WTPVEGALLLSGIQPPAGCTQIPIGGTGLDGREFASAANDRFHSAVRIMDLWQVRCDDD
FT                   EENGEITPTELTPYEFIAWCQEMSIETDWMRLFFEVADGSSRSDRPDLIPAAVAEYAAR
FT                   AAETIGAIQAALTGGPSGSAPAAAPLPAEGEPAARRGPIPIPENREHVSTDELAAILAV
FT                   DAQSIRKRYSQTGSYHGVRPTKLPSRRLLWPVEAIKALLRRV"
FT   gene            complement(102222..104012)
FT                   /locus_tag="BTH_I0096"
FT   CDS_pept        complement(102222..104012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0096"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39248"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E3"
FT                   /protein_id="ABC39248.1"
FT                   /translation="MAEQRYAPHHIADLITVRNVVTQMKEMAAMSRYRPPFTLVQRPVP
FT                   RIQLGAHASPILALLGLREPARQIKARAGEVHEFHPYFEAFLEVAEIGLRYEDATGEMR
FT                   TLEYDEFDGASFSNHPKVALYCATLNDFFVRLGKRLDKKSRAAAKAFERTPSDNRQHAM
FT                   RYAAQLIDRAPRTRIVHVTIRRHLDLYGNPVSQDEIRACRQMLSDYLDEPSPKRSHLGH
FT                   CSFLRRFSDVGYCLDAFVFLSDSFLKPAADIARDLTEWWEAFAPKSTACVTRVLPPDKL
FT                   VKETLDRMTLVTEPDFYVRPARLSGAPKKLRHFWCTQFPVNLRAARRRGKAGSYRPTAD
FT                   QSHTVDPLLEALREEEIEDNGVQKELRWRQAREKEQARRSASHKKGARTRAKNRKTAEQ
FT                   ERAWQSARFEACKSRIMYDDEIIDVEAAEVIDVAQALRRHSRRRTVLPSASATPRHADN
FT                   LAPCSPAAGITPNAPEMAAASSDRGVAAGSLTEPRIFDEQPGVITPAPGLGETEGATAA
FT                   TSGPATNAGPKTRRRTSEKQERDKHGRLRTIQVEVRRASPLTRSSTAMKKAPNNAEANT
FT                   PSTESGFDASSPHTTSDPTE"
FT   gene            107166..109325
FT                   /locus_tag="BTH_I0097"
FT   CDS_pept        107166..109325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37854"
FT                   /db_xref="GOA:Q2T2E2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E2"
FT                   /protein_id="ABC37854.1"
FT                   /translation="MTTVNFTRGANGKPVATQALQESLSRIGGVSGECFFGYPLIATPE
FT                   GKYFLDGTLVSPEKGIVLFDLVEGTDVGDYAARQDDLANKIEAKLKLHKELVKGRKLIP
FT                   GLQVITFAPAVEGVERLAVEGYPIANEKGLAHILGEFAWGETASDELYRLTLSAVESLS
FT                   SIRKSRSKREVTKHDSRGAKLKRLEDSIATLDHRQNRAVIETIDGVQRMRGLAGSGKTI
FT                   VLALKAAYLHTQHPEWRIAVTFNTRSLKGQFKRLINNFCIEQSGEEPDWTKLRVLNAWG
FT                   APGGDERDGMYYEFCRATGQEFSDFGAASTRFGGADKAFDGVCQAALSGLTSEVPLYDA
FT                   VLVDEAQDFAPSFLRLCYSMLRQPKRLVYAYDELQNLSGTSLPSPEEIFGVGADGLPLV
FT                   SLGEDPSRDVILQKCYRNSGPVLVSAHALGFGIYRDAPAGTETGIVQMFDQPALWEEIG
FT                   YSVQQGSLGKGQHVTLARTNESSPEFLSSHSPIDDLVVFQPFHDEAAQNAWLVDEIQRN
FT                   ITQDELRHDDIIVIHPDPISARNRLGPIRRMLFERGIQSHLAGVDTLADVFFKAETPSV
FT                   TFTGIYRAKGNEAGMVYVVNAQSCDTTGPGLANLRNRIFTAITRSKAWVRVLGYGPGMA
FT                   QLQREFARLRQQNFRLDFTYPTDGVLSQLRIAYRDLSPHEKRRLEKGKGRAAELAASFA
FT                   RGEILPEDLDPETKEELLRWLGGKA"
FT   gene            109304..109996
FT                   /locus_tag="BTH_I0098"
FT   CDS_pept        109304..109996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38626"
FT                   /db_xref="InterPro:IPR018742"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E1"
FT                   /protein_id="ABC38626.1"
FT                   /translation="MAWRKSMTTPRMPRTVKDDLTAILGTLIERGIVDDQNFPVLRQLS
FT                   GTHWEVSFDGAEHVSLAMGGIDYQDVHKELSEKRSYNARLIDGGILQMMYRFEGENLIK
FT                   HRLAYYPSPALRSFREDPDAYLRDELFLEIVSRHIVAFPLRFDFDMEAATDVAHPCSHL
FT                   TLGDVEGCRIPVSGGLTPRWFTEFVLRNFYQTARHDFLNGLPEHRFEFDSTITGNERRL
FT                   IHVMVPAH"
FT   gene            complement(110138..111244)
FT                   /locus_tag="BTH_I0099"
FT   CDS_pept        complement(110138..111244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36654"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2E0"
FT                   /protein_id="ABC36654.1"
FT                   /translation="MSWAELHAQSEVLASEAFIALRQGNASSAEALYAKAAELEEAALY
FT                   VIESGKPRTLGITAVSAVSLWFKARVYRQAEQLACLMLGNKALPEFAADNLRLLIQAIW
FT                   TEQSKLQAGVAFLPGQVMVSVKGGEVVTGGAPLDLIVDKVQTVQSIFYRTIEFLKNMPH
FT                   RSRGGPQRSIQDACRPWLFQAPPGSYQFSVAIQEPAQKDFFDESIRPDEVALHFLALLK
FT                   ASSLDEREALEKLIPDREYRSTFLKLIRNLAPTGKSFERLEIKAAGESGGVVLAPENRV
FT                   LINQSLREQTPPVSSRGEATTVVGTLRAVHLDKDWLDLNMSGKSIHIDGVKDSIDDIIG
FT                   PMMNKQVVVHVLKLPKGKLKFVDIELEE"
FT   gene            112209..113489
FT                   /locus_tag="BTH_I0100"
FT   CDS_pept        112209..113489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D9"
FT                   /protein_id="ABC36909.1"
FT                   /translation="MTGGALSSIGWIDFSSTDRERVAGVLALLSEAGTLDELGIGQLRD
FT                   AFADSLFPGFSTVQTRAKYFATVPQIFDDYWALPPRERRRRSLEAYLKESEDYVAERLV
FT                   HNHEADHRELREPFPNGIIGKERVGKGGASRRPSSAYWTGLRKFGLVGTELSIAEFCRS
FT                   ASEQQPVESLLRDGAEVDSQEDDDLMKRRRLVATIPRRSGDWREDIRITLTRPEAELLY
FT                   NKIRYAGALKDSIPAQLINTDLFNEGTLLGAENFEALSSALQELPQVSESCRTAARNAA
FT                   RFSKAFLGAHLRFNYLIAEKLEQTKRAGELSQEFAAWRAAAADEGLFNATAVDEWLSPS
FT                   VALQVGLKANTRRFIRRWHEAMTAYNTPIERLDTLVREQAEANKGNRSLLKRSLPADTG
FT                   WVGIYTLQYRWPQASQILTDIREGLAC"
FT   gene            113483..115360
FT                   /locus_tag="BTH_I0101"
FT   CDS_pept        113483..115360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38876"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D8"
FT                   /protein_id="ABC38876.1"
FT                   /translation="MLNPASSRCDYGQLLRPPALEETDGIAYELDAAIATTYTLDLNAL
FT                   LVLPVSLVLGNTLEGDLGGEKIALLEAVDRLSGKLKVFYQCGNIHVPPEFNRLFGLLEP
FT                   MLVPIVPSGQDDERSAAFSSFHPKLWLLRYVRTGRHASGTPDPKRRYRLLVMSRNLTFD
FT                   RSWDLTVSLDGEPSAESARSDDRLASFVESLEPHAPGFGPLKSMIRDLRRMLWQPPQPF
FT                   RDPRMLPGGGAHIATPDDRFGSPLNFGDAKDDLLVVSPFLDASEKKALDWLGNDVKGKR
FT                   TLLSRSDSLDALGSEALAGWDCYALNDRIVDGEEQREEENARSQNLHAKLIVSRSGQTA
FT                   HWHLGSANATIAALGESLWATPRNTEFMLRLSGADAKVGIDVLLGQWIGDDGNHFAVPH
FT                   TFSPLDVSDQESDRQKLRLLMHRLVASNWKLDARADETGRYRLLLSTNFALSSVPDGLQ
FT                   VNVGLLSRLGVWKPLLGSVEWTDLALTQLSALVPLQVCGPDGEVKESLIIQARLLLPPG
FT                   VNRMDAVVRELVDTPDKFLNYVRMLLDPSPDKRRLLRSDRHGNEVTDLFGFDGNDALFE
FT                   QLMGAAARNPDHLGRVGQLVKRLDKLNVVVPQAFSDLWRHFAPLAKDRR"
FT   gene            115321..118776
FT                   /locus_tag="BTH_I0102"
FT   CDS_pept        115321..118776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0102"
FT                   /product="DEAD/DEAH box helicase:Helicase, C-terminal"
FT                   /note="identified by match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37912"
FT                   /db_xref="GOA:Q2T2D7"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D7"
FT                   /protein_id="ABC37912.1"
FT                   /translation="MAPLCAPCEGSPMSRIQELIAASLAKLTDFQRATVNAVMQRFDDA
FT                   QQNRILVADEVGLGKTVVARGVIARMLLRHLKIHGDEPARPLRVTYICSNQSLADENRR
FT                   KLAIFTEKDAETYVQAPTFWRLAELGVARDHGAHGKLIEVCTLTPATSFGVKRRGKGNA
FT                   KERYIIFRALAEHPRLCGSNLAGLENFFRQDVGASWRPEDDGWPRAGGIVPSVRDAFHA
FT                   SLSRAAPLTREEMAELDEANVPHGDWFELLLGGAAVYSRDNKACPYAFSRILTELRLRF
FT                   MHACAGNLEADLFILDEFQRFKELLGRNDDSEDGIIAHKVFQETREDGGKVLLLSATPY
FT                   KALTHIDDEEDAHSEQLKYLLRFIVNGEGGPWHKYAQAREVLLAEILRLRDPVVRPLDL
FT                   DEQPKKDVEAALRPYICRTERASIGSGVENVTHASHLACTTTFSRAEIDAFVAFDKVGQ
FT                   VLHDVQPSIHHLPLMDFYKSAPWPLSFLGDYKLRAHIESNKDVPEVKAALSRANTAWIP
FT                   RDDLDNYAVRLGTHAPHAKLREVTNAVFERGAEMLLWVPPSRPYYNQEGPFAANAQFTK
FT                   TLLFSSLLLAPRALSGLISYEAERRLLRAAGDSAKYFEERSTSDIVRFDNLKTLAPWGL
FT                   VYPSRTLCNLASVRDQAFGQSSGALVVEMKRRLAGDIQRLRRFAGSGPRHADLWYALAP
FT                   LLLDWTDNTGEDATRNIPSPRDACRQWLVDFRRDPGQSTDASGRRGVIDVMCERLEDRT
FT                   LDLGPMPDDLATFLAKLAIAGPAVGLLTSLERIWGKGSTGLARLAGVGAIDFIQVFNNP
FT                   EGRRILKASRRDRQIPFWMAALDYCIAGNLQAMFDEYLHLLHSNGLSAIDAMARLNETA
FT                   RLRGGSVTAQVRRANGTAVRFRCHYAVSISNQRSTDQQAVERIGNVRDAFNSPFWPFML
FT                   NSTSIGQEGLDFHWYCSRVVHWNLPPNPIDLEQREGRVNRYKSLVVRRRVAEYCAGTSV
FT                   NSDGGDVWAAWFEYAKSARKHVGDSRASDLVPYWHMPSGQACIERFVPFLPMSREATRL
FT                   DELLRILSLYRLAFGQPRQQELLENLLHREFDAAEIAEIKRKLMIDLAPLNYLRQAPDS
FT                   IEISNDDSAIVVTKPLPASKDDTDAPFDINRPSSHNEQPPGAEM"
FT   gene            120056..120805
FT                   /locus_tag="BTH_I0103"
FT   CDS_pept        120056..120805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37113"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D6"
FT                   /protein_id="ABC37113.1"
FT                   /translation="MSTGELERDGKADVWNKVLRSALALPGARIDRTSYLKRELEKRVA
FT                   PELVELAIASSPARAGISSSEVEKIASSSIAWHRTGVTGTSIAAGLPGGWWMAGTIPAD
FT                   LTQFFWHVVVITQKLAYLHGWPDLYADGEELDDETLHIFTIFIGVMFGAAGAGALLTKL
FT                   SENVAKEVATRLPRMPLTKWGLYTLAKQIAKWIGVKLTKQTFARIASKAVPVLGGLASG
FT                   AITWISFSQMSSRLLSHLSGLHPHTWR"
FT   gene            complement(121039..122211)
FT                   /locus_tag="BTH_I0104"
FT   CDS_pept        complement(121039..122211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38204"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D5"
FT                   /protein_id="ABC38204.1"
FT                   /translation="MHRHAPLLFDPPSKPMKRTHVPGRGAALVAVAIAAVLLAGCKGEV
FT                   LDYRNAQMVNGKVYDGSANEPFSGKLTNVPDRSLLIEQAGLQLAGKLASIALVDSLPAS
FT                   ERNAQSFLGRSGAEILLSGAVCDVQIEGGVPDGSAVCKAPQSDLVRIETSFKHGALNGP
FT                   LKLSGGQNEGPLLEATFNNGQLDGTEKVYSWTDHKLIHTFPWNNGVASGTEEAFDPNTG
FT                   AVVKRATFVDGKYEGEVVHYAPDGKQVTLRATYVNGKLNGPYKEWDAGGSLIADKTYSS
FT                   GVEVGADGSDVGACVNEWDDAYRVVPGRPAFPPAELQLQWKISCRAGKHPSASDSGLPG
FT                   AAVSGEKPAPDSCVEAWTAAYRHENGVDAIVTADQLGEWQSRCKAAKRPS"
FT   gene            complement(122049..122153)
FT                   /locus_tag="BTH_I0105"
FT   CDS_pept        complement(122049..122153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D4"
FT                   /protein_id="ABC36866.1"
FT                   /translation="MFQAGARRSSLSRLRLFFSPAVKAKYSTIAMLRW"
FT   gene            complement(122382..124172)
FT                   /locus_tag="BTH_I0106"
FT   CDS_pept        complement(122382..124172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39395"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D3"
FT                   /protein_id="ABC39395.1"
FT                   /translation="MNNDRPNRGIRIALGASLGSLTLLAACGGGGGGSSTGTTSTPTGT
FT                   SLLSGKAIDGYLSGATVCFDNGAGACDTSLPSTTTDASGNYTLNVSGSVTGKQIDVIVT
FT                   PSTTDLSNPTTPFTSTFTLSAIVTGNTQNVTPLTTMVVSQMNAGRTQDQATQAVQALVG
FT                   SSVDPNADYLSNGDSSTASVAASMVSHLTALAGQGAISWSQVQATMNAYAAKGNVNGVQ
FT                   QSDVDAQLTNPKFSTAVDAASALANPLHTVDGDLTQFIVGSSVSVALSPVRENYTLNGS
FT                   TLSVTQEIQSDGSWSSASPVGSYDAGFSGSWISLDGGVGAYEMKADGSWTSWLTAAQLH
FT                   PSYSLSAAGANLVGIDPNTGDTVTVSYRKTDVSGQPLSSALQIDYRNPIRGAMTGSFSS
FT                   GTTAYLATTTYANDRLLLVNQGLGQPWVNGADANSSTIVNGSVLYSLGDPNTTYTSVQQ
FT                   AVGTQTDIGGGCLLLSIQSGGIAQVIESGKSGCNYSNEPISFPLTGSWSPYSRNANVIT
FT                   ISLPKSIGAPTVPIDDAIKNTINAGGSLVVGLMKGKLMGGFMLPASASATVAQFPSSVT
FT                   DTIATSMRAAAAKLGITQNP"
FT   gene            124305..124691
FT                   /locus_tag="BTH_I0107"
FT   CDS_pept        124305..124691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0107"
FT                   /product="possible transcriptional regulator, XRE family"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37291"
FT                   /db_xref="GOA:Q2T2D2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D2"
FT                   /protein_id="ABC37291.1"
FT                   /translation="MIVEFIASRISRRAGILHDMTVKRSPSPPGRPAPISIALGKRIKQ
FT                   CRHEAEKSQETLAFEAHIDRTYISSIERGIANPSVETLANICYSLNITLAELFAPLDGV
FT                   SLKPTGERRANAATPPEIKRSRLR"
FT   gene            complement(125713..126765)
FT                   /locus_tag="BTH_I0108"
FT   CDS_pept        complement(125713..126765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37584"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D1"
FT                   /protein_id="ABC37584.1"
FT                   /translation="MTTQRWAFSLAVTATGTAVTLSILSGWQRGGTLPERLVWVAIGVV
FT                   LVVTAHLLPALARSSNLRVQFVAAALWLGCMGASVYGHTTFFLFAQVHAGERRAASVAS
FT                   PSMPSGRSLTAIMTERAIVATQAAAANTQRCTRDCPSLRVRRASLAARLDALDAEAGDI
FT                   RRREALDDRVTAQRDALLADPVTSRLAASLGTTVSRVDLLSGLMFAAVLEGVACLLWVL
FT                   TFGSSQLPGPTPVVSKAAPAAVMPAASVTAVTASKVAAEEESHADATVTFERPSHGHGG
FT                   TTHTRAPRDDPLTRSSDAGSSEDDLARLVEDIAAGHVRPTVADIRRHLGCSQARATTLR
FT                   RQLAAHHTAA"
FT   gene            complement(126762..127679)
FT                   /locus_tag="BTH_I0109"
FT   CDS_pept        complement(126762..127679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37827"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2D0"
FT                   /protein_id="ABC37827.1"
FT                   /translation="MLKGLSITPPVVGRISIGRIVERAGKRLPEKDDQFTLTTQVQSRG
FT                   EWMLHPLNESLRKASPGKLRAIPVRVLFNDPDLNLRADYSLFDRDTGRPVCVGDGQTCK
FT                   RATDNGVETLTCASPDGCAFGQHGGCKPYARLNVLIGDEDEMGSFIFRTTSFNSIRTLA
FT                   ARLHYFAAVSGNLLACLPLELKLRGKSTTQSYRAPIYYVDLSVRAGSTLEEALTHAREL
FT                   DARRKSAGFDQTALDAAARLGFANGAFEDSPEERAAVAEEFYPPPEPAKPNGEPPASAG
FT                   GANEKPTLRERLERQTVLLGGAAA"
FT   gene            complement(127713..128789)
FT                   /locus_tag="BTH_I0110"
FT   CDS_pept        complement(127713..128789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0110"
FT                   /product="gp47"
FT                   /note="Bacteriophage A118; similar to lin0084"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36597"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C9"
FT                   /protein_id="ABC36597.1"
FT                   /translation="MSHVSPVFSHPRPGQVRLSGRIVLRGTMSAVQPDGPDTRRPALKL
FT                   VKTQELSRDDWLAVRRTGIGGSDAAAAAGLNPYMSTLELWMDKTGRAEGLAGPDPNDTT
FT                   SPTYWGTLLEPIVAASYTKQTGNRVRRINAVLRHPTIPFMLANIDREVVGCREVQLLEC
FT                   KTAGEYGARLWRAGVPEYVELQVQHQLAVTGKQAAHVAVLLCGQALEVYRIERDDALIG
FT                   RLVELEARFWRYVESDTPPPADGSESADRALRHLYPGNGGTVDFTDDRQLSSVFADLVA
FT                   VRAQIETHQAIEAQLKQAIQQAMGEATRAVFETGAVSFKRSRDSSTVDLARLLADHPEL
FT                   EQQYAGSKPGTRRFLISA"
FT   gene            complement(128786..129754)
FT                   /locus_tag="BTH_I0111"
FT   CDS_pept        complement(128786..129754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38953"
FT                   /db_xref="InterPro:IPR017686"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C8"
FT                   /protein_id="ABC38953.1"
FT                   /translation="MHLVQTMAYAGAEPWHGLGNKLAPNQPIELWAERAGMNWRIEEAE
FT                   VRFVAAGNRSLGSIHAFPEQKVLYRSDTKAPLSVVSARYQVVQPSEILEFYRDLTEVGG
FT                   FQLETAGVLKEGRKLWALARTGQSATLKGKDEVNGYLLLATACDGTLATTAQFTSVRVV
FT                   CNNTLQIALGDSASAVKVAHRSQFDAQAVKRQLGIAISSWDAFLARTKALAERKVSDSA
FT                   VETFLRRVLTYSTPNVADHDGLAVNERAIKAVGQLYAGRGKGADLASASGTAWGLVNAV
FT                   TEYVDHHRRARSDDHRRDAAWFGQGATIKQRAWDEALKLVV"
FT   gene            130914..131828
FT                   /locus_tag="BTH_I0112"
FT   CDS_pept        130914..131828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36329"
FT                   /db_xref="InterPro:IPR016634"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C7"
FT                   /protein_id="ABC36329.1"
FT                   /translation="MSIEQLADLTQPQRDRLAFVELRVRFIGEIRRQDLVSRFGIQSAA
FT                   ASRDLALYKELVPGNIDYDSKGKSYVLGPDFRPLFEFPPERVLSWLTQGFGDGEPMQLK
FT                   AWVASESPSRLARPDLTVLASVTRAIHQGCPLAVEYHSISSGKANRQIVPFALIDDGQR
FT                   WLVRAFDRESQQFRDFVITRIRNPQVLKGENPAPHEASDQDIQWTRILELDLVPHPNRP
FT                   HPEISEMDYSMERGVWKMKLRAAMAGYILCKLRVDCSPTHKLNGSEHRLWLRNHLALYG
FT                   VRSAVLAPGYESPEPVGQEQDGD"
FT   gene            131918..136120
FT                   /locus_tag="BTH_I0113"
FT   CDS_pept        131918..136120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0113"
FT                   /product="Protein kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38589"
FT                   /db_xref="GOA:Q2T2C6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C6"
FT                   /protein_id="ABC38589.1"
FT                   /translation="MSGRWKAISPSQFPWEQDALDFVQRALPNREPFRAYSNFEFVADD
FT                   GSINEVDLLVISRYSIFLVEIKSRPGEVGGDSHTWIWRDGGREYFDDNPLLLTNRKAKK
FT                   LASLLRKQLTLQKRRTPYIQSLVFLSDPAQRCKLTGPARENVQLRADIVGKLFDETAPV
FT                   TSAQPIDRDLATSINRALEIVGIRPPQQSRRVGDYQLEQVLAETDFHQDWLAKHVSLNN
FT                   LWRRVRLYTAKRTLSAAQRAVLVDAARREFQLLEGIRHPGILRALDFIDSEHGPALIFE
FT                   YEEGLQRLDHFIRAQGDQLDLWQRLKLVRAIAEALDAAHRYRLYHRGLSPHTIMVRTVG
FT                   TNSFDVTLFDWQIATRQLQEAESETTGTLHVEMLSDRVAQEIYLAPEARNAPRPDAIKL
FT                   DVFSLGAISYFVLAGEPPAVSGDELVIKCEQGPGLTLSAMVNGCLAEIEDLIQFATWPS
FT                   PDDRFSSTNEFLSALDKAEEALEDALTAPASPLASPLDANTGNELNGFEVLRRLGKGGT
FT                   SLALEVRRKSAGQPRQGVFKIALEPEYNNRLKQEAETLVRLQPHQNIVQCFERFEIAGL
FT                   ATLFLSSAGEETLGERLRQEGRLGLDLLQRFGEELISVVEYLEREGVPHRDIKPDNIGI
FT                   RPGAGKRLTLTLFDFSLAGVPATDLNAGTRVYMDPFLRKRGMWDGYAERYSCALTLHEM
FT                   ATGTLPEWGDGSADPVTLKSEIVLDSERFDASIRKQALDFFSRALARDHRKRFDNAEQM
FT                   LRQWRRVFENVSRPVTTHTTQLPQSQLPLGEESPAGGITPGTPLESLELDSRHLELLDR
FT                   IGRDELATAGDLADLPRNRLYRHRGIALAVARELHQIADRLRHQFSGGAAKDDEPADTT
FT                   VAKLSVDAAAALLIPKKGDESQLEVLEKWLGLSAQPGTSLLQEDVLQSMVERMSRQPEI
FT                   THLRDDVALVLAGLGGIATVGEIAAALLARRGSVQTGAARRSEAEAVTRAVITVERTKQ
FT                   AARWQLVKRAANVRPLVEPPQVDDLVVATLASSGAAGLFPSAPEVRASYAVALGEAADR
FT                   LAQQDPLPSSQQVADTLARIPPPAGDLGLSSERLIRLAAACAQQAALSSRLEFYPVQLS
FT                   AARAVKLATNSLLGLRQFDLQTIGRRIFARYPEAAPLPGPTELEQLLEDAGLEVKWDGA
FT                   KCAFVTHYSAGIISSTTQIGRFGTNNRPRTATAPDVQAAQQIDERIKHALSSGKLLTLS
FT                   VDPKGLAIAQHELAQRFGLKVIDFDDLVLTQFEAQAKEWDIDWNTLLAADAAPAGSVDS
FT                   HNFATVLGEVWPKVEAQLLQDDQPGLLVNLGLAARWQKMPLFAKLADACMFGKRPPLIA
FT                   LLASPLTPDNRPVLDGEAVPVTINTTDYGRIPRAWLENAHRKHDITASTTSTKSKLI"
FT   gene            136117..139812
FT                   /locus_tag="BTH_I0114"
FT   CDS_pept        136117..139812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37758"
FT                   /db_xref="GOA:Q2T2C5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C5"
FT                   /protein_id="ABC37758.1"
FT                   /translation="MIDRAKLLADLKLQVRALEADLRQRFVSNASEYKSRLTAEWQAAR
FT                   DAGRTSEDVAIWAEAQFTQSAVAWVLACVFVRFCEDNDLLDAPLISGTDGRGQSAVSRQ
FT                   EAFYLQSPTASDNDYLREVFAVAGRLPGLSDVLKVQSSLLLAPVSADMGKQLVRFFRAT
FT                   NADSGSLVHDFADPEWNTRFLGDLYQDLSEAARERYALLQTPEFVESFILDRTLTPALD
FT                   VYTLEEVDLIDPTCGSGHFLLGAFERLAPRWLRKRPENVNLALQEALGRIAGIDLNPYA
FT                   VAIARFRLLIAALKMASVKKLRLAPDFHLHVETGDSLLHGFDQRDYAGAQVSLALDTPQ
FT                   ENLAAVADHLYRHAFAAEDLTATNRILARKYAAVVGNPPYIAVKDRAVSALYRERFSSC
FT                   HGKYALVAPFCERFWALAKPLDNAQRAGYVGLIVGNAFMKREFGKKLVEEFFPSVDLTH
FT                   VIDTAGAYIPGHGTPTVILAGRNRLPASPVIRAAMGIEGEPSKPDDPSQGIVWRAIVDQ
FT                   IDQRDSESKWISVSDIDRSTLAKHPWSMGGGGASSLKEAIEDSAEKILADFADSIGITS
FT                   FTLEDNAYIHDSQTFRRQGVEVQLLRDMVVGDEVRDWFNDCESTALFPYDANYSPIRLA
FT                   AFRKAFAFLWPYRTCLSNSKMFGGQTKVEAGLNWFEYGRLTAGKLVTPLSITFAFVATH
FT                   NHFVLDRGGKIFNRSSPVIKLPAGTGEDEHLGLVGLLNSSTACFWLKQMFHNKGSTVDQ
FT                   HGARQRTSAFEDFYEYTGTGVGKFPVPNVRPVQIARQISDLAIECSRHLPAALIARGAI
FT                   SRKELDASRAESARIRSKMIAWQEELDWKTYSLFDVTDEELCFDKDPPEVKLGERAFEI
FT                   ALAQDCTAGIAATTWFDRHRSQPITSVPTHWPSDYRALVEKRIAAIRKSRDLALIERPE
FT                   CKRRWVSDEWDALEKAALEQWLLNRLEAADLWPHDALPAPKLRSVRELVDALSGDEEFR
FT                   RALDLYAGSGSDAHVTVVALVQQASVPFLDALRYSESGLRKRAVWRNTWLMQRREDALD
FT                   AEVARQLTDEPIEAIKEEQAKRKAAEVGVVPVPPKYKQVDYREGVYWKLRGALDVPKER
FT                   FVCFPGLERSNDAGSPMLLWAGYDAKARALALTGYLYEMLQREGADVARLTPALAGLDE
FT                   LLPWVHQWHPEADDDLGMSTGDYLQGLLDAQLAQHGLTLSALRAWQPEAPVRRKRGKRG
FT                   QHVAQA"
FT   gene            139845..143528
FT                   /locus_tag="BTH_I0115"
FT   CDS_pept        139845..143528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0115"
FT                   /product="pglY"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37511"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C4"
FT                   /protein_id="ABC37511.1"
FT                   /translation="MPKLREIFDLPEQVHQGDFVLRLTDGLSAPAETVRDYIATPQLVK
FT                   CFDQALGVVKGAIDSRMSKGAYLHGSFGSGKSHFMAILSLVLRGDAAARGKPELAPVVS
FT                   KHNGWTQGKKFLVVPFHMINAETLESALFSGYAELTARLHPDAPSPGFYQSEGMLNDAQ
FT                   KLRTQMGDEVFFRTLNGAAGAASGGGWGRVTQTWAAARFEAALKVPPGSPERFKLVGAL
FT                   TRAFYGSVSHLSASQREMYTSLDEGLSAMSHHAKDLGYDGIILFLDEFILWLASRAADV
FT                   AWIAREGQKVAKLVESSNADRPTPIISFMARQRDLRELVGEHMPGAEQLSFADTLQYWE
FT                   ARFDKVNLEDRNLPEIAKKRLLRTRGPAEDALLKGAINKLLGSQPEVLQTLLTRDGDQQ
FT                   MLQDLYPFTPALIQTLIAVSSMLQRERTALKLMQQMLVDKADALEIGDVIPVGDLFDVI
FT                   ADGDEPFTHGIKLFFEQAKQLWRRRLLPILETQHGVAWEDIESGKADFKKAAALQNDAR
FT                   LLKTLVLAALVPEVEALKNLTPTKLAALNHGTIRTPVPGSEGITVLTKLKRWAGQAGEI
FT                   KIADDSPNPIVSVEVAKVDTDAILANAMVFDTQGNRQAEVRQLITDGLGLADAGSSLLP
FT                   PEMEISWRGSRRAAEILFGNVREQSFDTLKGREGTWRILVDFPFDHQPEHGPQDDVAKI
FT                   NGFLNEGRVGRSMVWLPSFLSPNTQDQLGRLVVINFVLRGNNLDQYASQLSQTDREQAR
FT                   VLLTNQRDQLRQFIRNCLYTAYGLNSVAQEALDPAQTVDEHYFSLDPSLVLRPPVAANF
FT                   KDAFEKLAEQALDYEFPAHPHFDAEPRPIAVKRLADLMVLAAQKPAHRVELEASLRDDA
FT                   KRIAPRLDLAEVGEAALQLRDDWSQHFARQIAQQAGREPTVTDLRRWLDLPDRRGLRED
FT                   LQDLVILTWLAKSNRSLYRFGQPFKGEIGNVPNECEVREQPLPTVVEWDKATKLAGEML
FT                   DPAMSTLYRSAPGLVEFSRAARKRVADTAAHLLNYLRVVDQLMTLVQTDVVATGEPALR
FT                   KLGATRLRDWFAAMESCSSEIDLVNMVSRLDFSAEEIAEAKAVLGGVQTLARVEAKHYL
FT                   VNSVRSIAGGSSEFAPRANQILESLAHAVLRYEYVDGLQVAVVQFERDAGTLMADVANR
FT                   ATPPSPQPQPASEPGMKAPQKIEYTRLTKTDALKTLADARMLLEELGEISVDIQIVIRE
FT                   QE"
FT   gene            143525..145741
FT                   /locus_tag="BTH_I0116"
FT   CDS_pept        143525..145741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0116"
FT                   /product="bacteriophage phiC31 resistance protein pglZ,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37150"
FT                   /db_xref="GOA:Q2T2C3"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C3"
FT                   /protein_id="ABC37150.1"
FT                   /translation="MKVPAHQISFQAKQAHEADPLARFILLRLPLDAFDGTAVDVNAAS
FT                   WPVSTCSSPLAVRDAMRRYAASTTPVVLLFAGDESELGSDVLARCTKRRAITHDLWQTV
FT                   LALFRAAHIDPRLARHRWLAELLVRYMPAEGYAPVRSLVLDQDRAWKELFKVVLGFESY
FT                   PPTELDLLRWAGDAQRREQIKTLEDPARQETVQCLRETLGDLVDFIFAAIDTGSADELV
FT                   AIAMLCEALEDKAIGSESNRAKVAARLEVLFDGLTISSHTIHQLAGAADAWFDRASEVA
FT                   KQQQVARYESLVTQLKAEPLAAQARYGITALREKTKAFAAALNDINLPEAISRFGRLMA
FT                   HRGPVLSSHSELRCKMALRLVSWLRKTVSTFPSSLNALSERYRNEIGWVDWAQTVLLEG
FT                   DDSPDLANAYGLLREKTRIQRDLFDQRFAESLAADKPDGTTLIAIEDALDKCVAPVVVA
FT                   GRCLLIVVDGMSVPVFLELHHSLKEHGWVQFERSEGACSTLLTMLPSTTEASRTSLLCG
FT                   IACAGSASTERAAFSAYPALVAPSVAGKPPAIFHKRDLLDASGVALSDDLRTALSDTRQ
FT                   RVVAVVINAVDDHLMKSDQLRLRWDIAQFKGLDALLAEARSSERAVVFTSDHGHVLDQD
FT                   TVMLGASPNARWREPSLESYPGEIALTGNRVKAASGMDEVVLAWNSKLRYATKRNGYHG
FT                   GCAPAEALVPIATYRYGAKAFDGWSIRDEVAPDWWQVDRGGFRE"
FT   gene            complement(146034..147248)
FT                   /locus_tag="BTH_I0117"
FT   CDS_pept        complement(146034..147248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0117"
FT                   /product="gp31"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38427"
FT                   /db_xref="InterPro:IPR021815"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C2"
FT                   /protein_id="ABC38427.1"
FT                   /translation="MTDEEIAAWAKDPRRADTLPFGLFEPAYRKGITGAALVVRGVLYF
FT                   RNGYTPTVRKALVQCFEQYAAMVDEYHHALEVAAGQKPSKEGPLRWFYTEGKQPMAYEK
FT                   APAFERLATSTPGDASLVATMTSADHKLATGFYEFSVFALGEWKATHNRGLDTLVFTVP
FT                   RAFLEQRPGKFQALFVAMCEALPIVHGHAGYGVNLPPMELNANEASEYFYARRYGPGID
FT                   VGDPMGYSTVMLEGAIKTVDWIVALDANLVRAAGGADSLTLPPDWYVRQALRDGGLIVQ
FT                   AGVAPQASVSAGPGKPPLPPPAYVLLDAALRPIIAEKMDILQSGTLDSTAPMLNTTIAT
FT                   EAWLKRFDVPPDQMTEQWRELHKTPTVDSSKAAVAANLLRLRKAMGLPEPVSSNGFGYD
FT                   GGSPR"
FT   gene            complement(147259..148008)
FT                   /locus_tag="BTH_I0118"
FT   CDS_pept        complement(147259..148008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0118"
FT                   /product="gp30"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39021"
FT                   /db_xref="GOA:Q2T2C1"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C1"
FT                   /protein_id="ABC39021.1"
FT                   /translation="MSGYGSGYSTGGTASGEGRTTQVGLQSGLSPKDRAILCDTVCNCK
FT                   RIGVASVDGKIQRQRCVMQRLNYQDMVSQVTTGQRTVYRPEVAYDMRPDVPTPIMSSQD
FT                   PLQPHPFIPNWLNKYWPGGYAEYKKLAGQGLIRRPDVIVVNDPDQPPVQSNIKMCAEMK
FT                   FPPDDFSREQRADYIRIAGGPNKFERIGPAECKCGEEKEDTETSKSSQSKASKQSDLEG
FT                   LFGGGSSPLMGGGPPPLPPMPPLPVFP"
FT   gene            complement(148005..148532)
FT                   /locus_tag="BTH_I0119"
FT   CDS_pept        complement(148005..148532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0119"
FT                   /product="gp29"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37615"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2C0"
FT                   /protein_id="ABC37615.1"
FT                   /translation="MGFAFIREGDTTSHGGRVLACSPENKSDGIPLALLGDKVSCPKCG
FT                   GIYPIVGVKNLGVTFDGRPVASEGDTTACGATLIASQNNTTAEPTSGPGGAVGRGKSVV
FT                   SDTNAQTPHRGRFQVLDDVTRQPVAGHPYTIKSSDGRTVQGKTDANGFTEWLEGDEGSS
FT                   LMFSHPGRESAE"
FT   gene            complement(148883..148958)
FT                   /locus_tag="BTH_I0120"
FT   tRNA            complement(148883..148958)
FT                   /locus_tag="BTH_I0120"
FT                   /product="tRNA-Lys"
FT   gene            149151..149555
FT                   /locus_tag="BTH_I0121"
FT   CDS_pept        149151..149555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0121"
FT                   /product="uncharacterized domain 1, putative"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39538"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2B9"
FT                   /protein_id="ABC39538.1"
FT                   /translation="MDENTVRDLLDRLLAPWVRSLSLTPVSVSEESVTLRLPFSGELRH
FT                   SGGVICGQVFMAAADTAMVVAISAALGEFRPMTTVALNTHFMRPVRKGDVLVTARVLRM
FT                   GRNLVFGEIELFDEDGKMAVHATSTYALVS"
FT   gene            149594..150463
FT                   /locus_tag="BTH_I0122"
FT   CDS_pept        149594..150463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0122"
FT                   /product="patatin-like phospholipase"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39098"
FT                   /db_xref="GOA:Q2T2B8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2B8"
FT                   /protein_id="ABC39098.1"
FT                   /translation="MFDQVVFAGGGNRCWWQAGFWDVVRPALDLRPRVIAGISAGAATA
FT                   CMLYTRDSRWVMRYYEEALRHNRRNVHWGNLLRAEPVFPHYRIYRQALLDIYGEPFAKL
FT                   TGAPDIRIGVSHVPRWLGARSAVAAGLVAYNIEKYVRKTLHPTLGRSLGFRPEFVRAQD
FT                   CARVDELADLVLQSSCTPPFTPVLRRNGRPVLDGGMVDNVPVGALDASPGLVLVMVTRR
FT                   YPRPQTFVVDHGGQRRLYVQPSSKVPISSWDYTSPHQMRHAYDLGRRDGERFLSAAPQC
FT                   LDDGGAAR"
FT   gene            complement(150585..151601)
FT                   /locus_tag="BTH_I0123"
FT   CDS_pept        complement(150585..151601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0123"
FT                   /product="glyoxylate reductase"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36791"
FT                   /db_xref="GOA:Q2T2B7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2B7"
FT                   /protein_id="ABC36791.1"
FT                   /translation="MKIAILDDYQDAVRKLNCFEMLADHEVKIFNNTVRGLGQLASRLA
FT                   EVEALVLIRERTHITSQLLGKLPHLRMISQTGRVSTHIDLDACTERGIAVLEGAGSPIA
FT                   PAELTWALIMAAQRRIPQYVANLKQGAWQQSGLKTSAMPPNFGLGQVLRGQTLGIWGYG
FT                   KIGRLVAGYGKAFGMNVLVWGREHSLEAARADGHATAESREAFFEQADVLSLHLRLHDD
FT                   TRGIVKLDDLLRMKPTSLLVNTSRAELLEENALVSALARNRPGMVAIDVYESEPILQGY
FT                   SLLRMENVICTPHIGYVERESYELYFGAAFKNILAFDAGDLSSVANPEALNQGRVRR"
FT   gene            152039..153094
FT                   /locus_tag="BTH_I0124"
FT   CDS_pept        152039..153094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0124"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37258"
FT                   /db_xref="GOA:Q2T2B6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2B6"
FT                   /protein_id="ABC37258.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASAMDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRIVAPVVFGL
FT                   HNLAPVLQTYTQRFPKVIPDLTLVDRQVDLVEEGFDVGIVITRQMRSASIVTRRLTTGC
FT                   MVVCATPSYLEKHGTPTHPEQLVEHPCLSLPSEYWGDERVFTGPDGEVRVRPSNVVVAN
FT                   NTEMLRQFAMLGMGVAILPSYLIGSDIARGKLVRLLSDYRLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEHFSQSPDTMLGEQWATQGVAGQPLDALPADALAERSSADPALSPRLPRA
FT                   PRARAVVPSPL"
FT   gene            complement(153323..155998)
FT                   /locus_tag="BTH_I0125"
FT   CDS_pept        complement(153323..155998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0125"
FT                   /product="DNA topoisomerase III"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38051"
FT                   /db_xref="GOA:Q2T2B5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2B5"
FT                   /protein_id="ABC38051.1"
FT                   /translation="MCYKAVVKGPASGSPGPSIHTVMSKALIIAEKPSVANDIARALGG
FT                   FTKHDEYYESDEYVLSSAVGHLLEIAAPEEYEVKRGKWSFAHLPVIPPHFDLNPIAKSE
FT                   SRLKVLTKLIKRKDVDRLINACDAGREGELIFRLIAQHAKAKQPVQRLWLQSMTPAAIR
FT                   DGFAHLRTDVDMQPLADAARCRSEADWLVGINGTRAMTAFNSKGGGFFLTTVGRVQTPT
FT                   LSIVVEREEKIRRFVPRDYWEVRAEFVCAGGFYEGRWFDPKFKKDEFDPEKRDSRLWSL
FT                   PAAETIVAACRDQLGTVTEESKPSTQLSPLLYDLTSLQREANSRFGFSAKNTLGLAQAL
FT                   YEKHKVLTYPRTDARALPEDYLGTVKSTLEMLKESNNYLPHAKQVLDKNWVKPNKRIFD
FT                   NSKISDHFAIIPTLQAPKSLSEPEQKLYDLVVKRFLAVFFPAAEFKVTTRITEVAGHHF
FT                   KTEGKVLVEPGWLQVYGRDAEGADANLVPVQKDEKVKTDKIAAHGLTTKPPARYSEATL
FT                   LSAMEGAGKLVEDDELREAMAAKGLGTPATRAAIIEGLLGEKYLLREGRELIPTAKAFQ
FT                   LMTLLRGLGVKELTAPELTGEWEYKLSQMERGNLQRDAFMQEIARMTQTIVKRAKEYDS
FT                   DTIPGDYATLETPCPNCGGQVKENYRRFACTKCDFSISKIPGSRQFEIAEVEELLQKKE
FT                   IGPLSGFRSKMGRPFSAILKLTFDDETKNYKLEFDFGQEQGGEEGEAPDFSAQEPVGAC
FT                   PKCKGRVFEHGMSYVCEHAVANPKTCDFRSGKVILQQEITREQMAKLLENGRTDLLPNF
FT                   KSSRTGRNFKAYLVKQADGKIGFEFEKKEPKPAAAKKTASKSTAAAADAAADSDDKAEK
FT                   KTAPARKTAARKTPARKTGS"
FT   gene            complement(156142..156513)
FT                   /locus_tag="BTH_I0126"
FT   CDS_pept        complement(156142..156513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36487"
FT                   /db_xref="GOA:Q2T2B4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2B4"
FT                   /protein_id="ABC36487.1"
FT                   /translation="MPALNLDTDEDRIAERLRNPGTLLVACLCAEWCGTCREYRAAFDR
FT                   LADAHPGACFAWIDVETHADRLDDLDVENFPTLLVEDASSVRFFGTVLPHAAIVERMLA
FT                   DLTALPGAPHAPKLRNLFD"
FT   gene            complement(156574..157875)
FT                   /locus_tag="BTH_I0127"
FT   CDS_pept        complement(156574..157875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0127"
FT                   /product="DNA processing protein DprA, putative"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37328"
FT                   /db_xref="GOA:Q2T2B3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2B3"
FT                   /protein_id="ABC37328.1"
FT                   /translation="MTGQSPWACARGIRSISDDENFITALRSPQAALLEDFVMSPRSLT
FT                   RDELAGWLRLAAASGVPAAACAALLGAFASPEALFAASHAELAALVGDAAARAVLAPPA
FT                   DDFAQRVDATLAWLDEPGNALVTRHDPAYPERLAELYDPPPLLYIKGRVALLHARAVAI
FT                   VGSRGATPQGLADATRFARELSDAGLAIVSGLARGIDGAAHRGGLDGANATVAVIGTGA
FT                   NLVYPACHHALAHEIAERGALVSEWPLGTPARSAHFPQRNRLIAALSGGVLIVEAALRS
FT                   GSLITARLANEMGRDVFAIPGSIHAPLSQGCHALIRDGAKLVETAADVLDEFGLEPARP
FT                   AGPARDAPAAAADADLDDDARRLLDAIGYGPVPPELLAQRTSLSGGTLHRLLLQLELAG
FT                   RIATLPGGRYTRIDGAQAEPAQARGTSAVLNSGA"
FT   gene            157957..158496
FT                   /gene="def-1"
FT                   /locus_tag="BTH_I0128"
FT   CDS_pept        157957..158496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def-1"
FT                   /locus_tag="BTH_I0128"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36838"
FT                   /db_xref="GOA:Q2T2B2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2B2"
FT                   /protein_id="ABC36838.1"
FT                   /translation="MRAGRSSLNTEIMALLNILHYPDKRLHKVAKPVDKVDDRIRRLVA
FT                   DMAETMYAAPGIGLAATQVDVHERVIVIDVSEDKNELRVFINPEIVWTSDGKQVYEEGC
FT                   LSVPGVYDEVERPDRVRVRALDEQGEPFELDCEGLLAVCIQHEMDHLMGRVFVQYLSPL
FT                   KQTRIKTKMKKLERAM"
FT   gene            158528..159514
FT                   /gene="fmt"
FT                   /locus_tag="BTH_I0129"
FT   CDS_pept        158528..159514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BTH_I0129"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36524"
FT                   /db_xref="GOA:Q2T2B1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T2B1"
FT                   /protein_id="ABC36524.1"
FT                   /translation="MTHSLRVIFAGTPEFAAAALAAIHEAGFPVPLVLTQPDRPAGRGM
FT                   KLQASAVKRYALEHGITVAQPPSLRRAGKHPAEAAAALDLLHATPHDVMVVAAYGLLLP
FT                   QEVLDLPRYGCINIHASLLPRWRGAAPIHRAIEAGDAETGVTLMQMDAGLDTGAMLHDA
FT                   RVAIAPDDTTATLHDKLAAAGATLIVDALVELERAGALAATPQPDDGITYAEKIGKHEA
FT                   ALDWRKPATVLARQVRAFDPFPGGAGTLDGVTLKLWAADAMPARGDAAPGTIVDAGADG
FT                   VVIACGEGALRVTQLQKPGGKRLPAREFLAGAPLAVGQRFSPPDTAA"
FT   gene            159635..160270
FT                   /locus_tag="BTH_I0130"
FT   CDS_pept        159635..160270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0130"
FT                   /product="LysE family protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37157"
FT                   /db_xref="GOA:Q2T2B0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2B0"
FT                   /protein_id="ABC37157.1"
FT                   /translation="MFGIIHLGLFVAAVFLLNITPGPDTAYIVGRSVAQGRGAGLMSAL
FT                   GISAGCCVHVLACAFGLTAVLAASAAAFTVIKIVGAAYLVYLGVRLIFAKPEPAAEQPA
FT                   RRGADKSLRQLFTQGFLTNVLNPKVVLFFVSFFPQFVSADSSHKVLAFLTLGAVFLAMS
FT                   TVWSCTVAWVAGTVTQRFAGKPGVKKWLDRGVGSAFVGLGVKLATSTR"
FT   gene            160379..161236
FT                   /locus_tag="BTH_I0131"
FT   CDS_pept        160379..161236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0131"
FT                   /product="heat shock protein HtpX, putative"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38153"
FT                   /db_xref="GOA:Q2T2A9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T2A9"
FT                   /protein_id="ABC38153.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLIALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDETTAPQFYRMVRELATRANLPMPRVYLIDESQPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTISATMAGAISALANFAMF
FT                   FGGRDENGRPANPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASA
FT                   LDKIHRYASGIPFQTAEEHPATAQMMIMNPLSGGGLQNLFSTHPATEERIARLMEMART
FT                   GRFD"
FT   gene            161334..163049
FT                   /locus_tag="BTH_I0132"
FT   CDS_pept        161334..163049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0132"
FT                   /product="sun protein"
FT                   /note="identified by match to protein family HMM PF01189;
FT                   match to protein family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37679"
FT                   /db_xref="GOA:Q2T2A8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2A8"
FT                   /protein_id="ABC37679.1"
FT                   /translation="MHRAAGFGVLGGWPFARSRLQNAAWGRLRTVSILRPKHRSTEAPK
FT                   HRPYRTRRHIARPATRGPNPRRATICRLPADRPRAGHQGTSYHCPARARASGTADPMTQ
FT                   TRPSRSRASGAPARAPRQSALHLVPDSLGFALDGAAQAVDAVTRGAALPAALAAVHATL
FT                   PANARAASRGAIQDIAYRAMRRRGTADWLIAQLVAKAPPAHVHALLVCAFALLVDDDEH
FT                   AAYAPFTVVDQAVTAIGARRECSFAKGLVNAVLRRFLRERAVWLERLQSDRRARWNYEP
FT                   WWIDAVERAWPDAWPRILASGDAPGPLTLRVNARRMTADAYLDVLRAERIDAEKVGRHA
FT                   IRLASALPVERIPGFADGIVSVQDAGAQLAAEWLGARDGMRVLDACAAPGGKTGHILEL
FT                   AHAEVVALESDPARAPRIGENLARLSLAADVRVGDAGDPSQWHDGRAFDRVLADVPCSA
FT                   SGIVRRHPDIRWLRRAADIPALVAEQRRILSALWPLVKPGGELLYATCSIFPEEGELQA
FT                   RWFGDACQDAVRLDAPGQLLPQGATGGAPAAGGSDEPGRHVDHDGFFYARFQKR"
FT   gene            163046..163636
FT                   /locus_tag="BTH_I0133"
FT   CDS_pept        163046..163636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38570"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2A7"
FT                   /protein_id="ABC38570.1"
FT                   /translation="MTIKRFFPLRLAAVLWVALTLCLAAVPSARADTIAVQRASLQSDG
FT                   SGWSLDARFDFELNSSLEDAVNKGVPLYFTTDFELSRARWYWFDEQPVSVSQTIRLSFQ
FT                   PLTREYRVSTGGLQLGFPSLKEALAVVKHVTSWHVIDKGQVRSGETYTASVRMQLDTAL
FT                   MPKPFQVDAVNNRDWNLVSDWKRFTFTVAERAK"
FT   gene            163683..166046
FT                   /locus_tag="BTH_I0134"
FT   CDS_pept        163683..166046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0134"
FT                   /product="nitrogen regulation protein NtrY, putative"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38295"
FT                   /db_xref="GOA:Q2T2A6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2A6"
FT                   /protein_id="ABC38295.1"
FT                   /translation="MIVSTVAITALLLLVLLAAASANTEFFDRYYSWLYSANIIVALVF
FT                   MLVVLGLVGMIVARLRKGKFGTRLLAKLAVFFTLVGVVPGGIIYIVSYQFVSRSIESWF
FT                   DVNVETALTAGLNLGRGMLDTSLADLQTKARLMSEQLASADTNTNGTTLTLLRLRDQFG
FT                   VQDATIVEPDRGTGASPDVHIVAQASGNFAALIPDDMPTPLMLSQAREHGAFAAIEGEV
FT                   DGDPRARGSKGALRLRVVQRIPDSSTSLLQPAERFLQLTQPVSPTLARNADAVQRAYRE
FT                   YQEKALGRSGLRKMYIGTLTLALFLATFIAMMIALALGNQLARPLFLLAQGTKEVAEGD
FT                   YTPKREIKTRDELGFLTQSFNAMTRQLSEARLAVEKNRVALEHSKTYLESILANLTAGV
FT                   FVLDRQFRLTTANRGAERIFRQPFNSLIGTTLDQIGVVAEFGAMVRKAFADREAAGQGS
FT                   GEDRGHWQQQFAVEVPGEADPLTLLVRGTRLVSTAAAPGQPDDPQTSGYVVVFDDISDV
FT                   ISAQRSVAWGEVARRLAHEIKNPLTPIQLSAERLQMKLSDKLSQPDADVLKRGATTIVN
FT                   QVAAMKRMVDDFRDYARTPPAVLVNLQLNDLVSEVLTLYGVGEGKSTIVVEQAPLPVIR
FT                   GDATQLRQVIHNLLQNAQDSVADVEHPRVLLETKTVEYGDPDANGKTRVAVRLTVSDNG
FT                   PGFPARILTRAFEPYVTTKAKGTGLGLATVKKIVDEHGARIDLRNRMRGDVVEGAQVSI
FT                   LFLQLADDAAGAGGGTNGGTAPAKTRATVQTKAA"
FT   gene            166047..166733
FT                   /locus_tag="BTH_I0135"
FT   CDS_pept        166047..166733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0135"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36766"
FT                   /db_xref="GOA:Q2T2A5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2A5"
FT                   /protein_id="ABC36766.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVDVAENAQAARDYRLRHA
FT                   PDLVLLDIWMPDTDGVTLLKEWASQGQLTMPVIMMSGHATIDTAVEATKIGALDFLEKP
FT                   ITLQKLLKSVEHGLARGAAPLPASAATKPAAGASSVASAAALPMLGDDPAAALAGQTTA
FT                   AIPFDIPLREARDAFERAYFEYHLARENGSMTRVAEKTGLERTHLYRKLKQLGVELGKK
FT                   PAEGAA"
FT   gene            166794..166869
FT                   /locus_tag="BTH_I0136"
FT   tRNA            166794..166869
FT                   /locus_tag="BTH_I0136"
FT                   /product="tRNA-Phe"
FT   gene            167194..167928
FT                   /locus_tag="BTH_I0137"
FT   CDS_pept        167194..167928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0137"
FT                   /product="exsB protein"
FT                   /note="identified by match to protein family HMM PF06508;
FT                   match to protein family HMM TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37485"
FT                   /db_xref="GOA:Q2T2A4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T2A4"
FT                   /protein_id="ABC37485.1"
FT                   /translation="MIRTDAKDGALVLFSGGQDSATCVAWALERYQTVETLGFDYGQRH
FT                   RVELECREGVRDALKRRFPQWSHKLGDDHMIDLSVLGAISDTAMTRAIEIETASNGLPN
FT                   TFVPGRNLLFMTIGAAIAYRRGLRALVGGMCETDFSGYPDCRDDTMKALQVALNLGMDT
FT                   RFVLETPLMWLDKADTWRLAEQLGGKPLVELIRVETHTCYVGERSELHDWGFGCGECPA
FT                   CKLRKRGFEAYLRGESVTQAPV"
FT   gene            168026..168658
FT                   /locus_tag="BTH_I0138"
FT   CDS_pept        168026..168658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38183"
FT                   /db_xref="GOA:Q2T2A3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2A3"
FT                   /protein_id="ABC38183.1"
FT                   /translation="MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWTGREADRGDAV
FT                   CRFCDTDFVGTDGENGGKFKDAASLAAKIASLWPPGEAHRFVVCTGGEPMLQLDQPLVD
FT                   ALHAAGFTIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYA
FT                   KLDFEHFLVQPMDGPSRELNTKLAIDWCKRHPQWRLSMQTHKYLNIP"
FT   gene            168678..169130
FT                   /locus_tag="BTH_I0139"
FT   CDS_pept        168678..169130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0139"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01242"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39315"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2A2"
FT                   /protein_id="ABC39315.1"
FT                   /translation="MLITRKLEFDAGHRIPDHRSQCRNLHGHRYVLEITLRGDLVETEG
FT                   APDRGMVMDFADVKGLAMEHLVSKWDHAFLVYARDEIVRSFLEKMADHKTVVLDRIPTV
FT                   ENLAAIAFDILANVYDAHYGVNLRLERVRLYETPNCWADVERDPRV"
FT   gene            169476..170261
FT                   /locus_tag="BTH_I0140"
FT   CDS_pept        169476..170261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0140"
FT                   /product="HpcH/HpaI aldolase family protein"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36946"
FT                   /db_xref="GOA:Q2T2A1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2A1"
FT                   /protein_id="ABC36946.1"
FT                   /translation="MSTLTNSLKARLRDGGEPLLGLWLTLASAAATEALAHAGFDWLCI
FT                   DMEHAPNDSRDVASQLRALAAAHLPSEPVVRVPAREPWLVKRALDAGARTLMFPGIETA
FT                   DEAAHAVRLTRFQAPDAPDGLRGVAGIVRAAAYGMRRDYVHTANAQIATIVQIESARGI
FT                   DEAERIAATPGVDCVFVGPADLSASLGHLGDTKHPDVAAALERVLAAGRRAGVPVGIFA
FT                   ADTAGARQSIDAGFRVVALSADVVWLLRATRQALQEVRG"
FT   gene            170258..171025
FT                   /locus_tag="BTH_I0141"
FT   CDS_pept        170258..171025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39279"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T2A0"
FT                   /protein_id="ABC39279.1"
FT                   /translation="MNGKRRGAPFSVRARHALRGAAAGALVSAAFGAVAGGAFAQASGA
FT                   PGRSNPGRETESAVADYNAGSLRAALVQFHDAAARGNRLAAFDYAMMLINGEGVTANVP
FT                   EGLRWLRRAADAGMSQAQYVYGRMLDDGEFVARDPAVAHVWFLKAARQGHVQAELALAN
FT                   QFLDGRGTPRDNRQAFAWYKRAADAGEPVSQYVTASFYERGGDGVTRNLDIARAYYAAA
FT                   AAQGDDAAALKYRELTAVSKAGAGGGAAPKPSN"
FT   gene            complement(171143..172291)
FT                   /gene="rodA"
FT                   /locus_tag="BTH_I0142"
FT   CDS_pept        complement(171143..172291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="BTH_I0142"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36548"
FT                   /db_xref="GOA:Q2T299"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T299"
FT                   /protein_id="ABC36548.1"
FT                   /translation="MQFDKRASLDKIKQMFAGFDRPLALIVFLLLCVGIVTLYSASIDM
FT                   PGRVEDQLRNIMLTFVLMWVIANIPPQTLMRFAVPLYSFGVALLVAVALFGMTKKGAKR
FT                   WLNVGVVIQPSEILKIATPLMLAWYYQRRESSLRWYDFVVAFGILMVPVGLIAKQPDLG
FT                   TAVLVFAAGLFVIYLAGLSYKLIVPVLIAGVLAVGSIAVFEERICQPDVVWPLMHDYQK
FT                   HRVCTLLDPTSDPLGKGFHTIQAVIAIGSGGPLGKGYLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEFGLVGGLVLLTLYMALIARGLYIAAQGATLFGRLLAGSLTLAFFVYAFVNIGMVS
FT                   GVLPVVGVPLPFMSYGGTALTTLGIAVGLIMSVGRQKRLMKS"
FT   gene            complement(172303..174711)
FT                   /locus_tag="BTH_I0143"
FT   CDS_pept        complement(172303..174711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0143"
FT                   /product="penicillin-binding protein 2"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37391"
FT                   /db_xref="GOA:Q2T298"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T298"
FT                   /protein_id="ABC37391.1"
FT                   /translation="MTEFKDTQQQLSKFRLRVAAAGVFVFVCFGLLATRFFYLQVWQHG
FT                   KYALQAEENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLTDTLESTINALS
FT                   EIVQIDARDRRRFKKLQEDSKNFESLPIRTRLTDGEVARFTAQRWRFPGVDVRARLFRQ
FT                   YPLGPTAAHVIGYIGRISKRDQDRIDAMSDDNDSDPESYDPRRDANNYKGTDYIGKVGV
FT                   EQSYETELHGITGFEEVEVTAGGRPVRTLSRTQATPGSNLVLSLDIGLQQVAEQAFAGK
FT                   RGALVAIEPKTGDVLAFVSSPSFDPNSFVDGIDQQTWDELNNSPDKPLLNRPLHGTYPP
FT                   GSTYKPFMALAGLTLGKRTPGWGFQDPGYFTFGGHTFRNDVRSGQGWVDMNKAIMVSND
FT                   TYFYMLARDLGVTAIANFMKPFGFGQLTGIDIQGEARGVLPSPEWKKKTFKKAAQQKWF
FT                   DGETISLGIGQGYNSFTILQLAHATATLANDGVVMKPHLVKEVENPISRERHLTVPKES
FT                   GVIPLKQSDLDVVKRGMENVVENPSGTAFKVFRGAPYLAAGKTGTAQVFSLQGGNYRGH
FT                   LLAEHLRDHALFIAYAPVDHPQIALALIVENGGWGAQSAGPIARRVLDFYLLDRKNPAT
FT                   EAAAVAAAASATEPINAPVIGDATKPVGVAAGFKALPQPTPPTPASGAAGASGASGTET
FT                   GQASAGAGSPGGDAATGGAAGVSASVTGGAANGSSATPTAGAAASAPPALRRLPSRKPR
FT                   RTPASGAAITAAAPLDDQRKSPSGDRKKSPQDDNPAVSAAKPAAGGIDE"
FT   gene            complement(174875..175387)
FT                   /gene="mreD"
FT                   /locus_tag="BTH_I0144"
FT   CDS_pept        complement(174875..175387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="BTH_I0144"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="identified by match to protein family HMM PF04093"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37965"
FT                   /db_xref="GOA:Q2T297"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T297"
FT                   /protein_id="ABC37965.1"
FT                   /translation="MSRPQYILQPVNPYFIVFSLAAAFLLNLMPWGRIPGVPDFVALVL
FT                   LFWNIHQPRKVGMGVAFALGILMDVHDASLLGEHALAYTLLSYGAITIHRRVLWLPLGV
FT                   QIFYVAPLLVLAQLVPFVIRLLMGAAFPGWSYLVDGFVEAALWPVASHLLLMPQRRPVD
FT                   PDDTRPI"
FT   gene            complement(175384..176463)
FT                   /locus_tag="BTH_I0145"
FT   CDS_pept        complement(175384..176463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0145"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="identified by match to protein family HMM PF04085;
FT                   match to protein family HMM TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38885"
FT                   /db_xref="GOA:Q2T296"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T296"
FT                   /protein_id="ABC38885.1"
FT                   /translation="MEYSPPPLFKQGPSALARLIFFVVLAIALLVSDARFNTLEIARGV
FT                   LGTVLYPLQRAALVPRDLIVGAAELATSSTALRHENQQLRDRNLKLSLQANQAGQLAAD
FT                   NAHLRAVLELRQQIATQATPVEIQYDTGDPFSQKIIIGHGSQAGIQNGAPVVSEDGVIG
FT                   QVTRVFPLQSEVTLVTDRDLAIPVQVLRTGLRSVIYGTPKGDALDLRFVPTSADLLAGD
FT                   ELVTSGLDGVYPPGLPVAKVVRVDKLADTAFAHVICAPIAAVRGAREMLVLHYRTDIPP
FT                   RPATDDAASDAKTAKGKKAAKGADKNAKAADKGAAKGADKGAKPAAPPPAPAQNRPAAA
FT                   AQPAALLKPAAAPSQGAPR"
FT   gene            complement(176583..177626)
FT                   /locus_tag="BTH_I0146"
FT   CDS_pept        complement(176583..177626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0146"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="identified by match to protein family HMM PF06723;
FT                   match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39383"
FT                   /db_xref="GOA:Q2T295"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T295"
FT                   /protein_id="ABC39383.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   gene            177992..178291
FT                   /gene="gatC"
FT                   /locus_tag="BTH_I0147"
FT   CDS_pept        177992..178291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BTH_I0147"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38557"
FT                   /db_xref="GOA:Q2T294"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T294"
FT                   /protein_id="ABC38557.1"
FT                   /translation="MALTLTDVKRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVD
FT                   TTGIAPLAHPIEQILEVAQRLRDDVVTEHVNRDDNQRPAPAVQDGLYLVPKVIE"
FT   gene            178418..179908
FT                   /gene="gatA"
FT                   /locus_tag="BTH_I0148"
FT   CDS_pept        178418..179908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BTH_I0148"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39463"
FT                   /db_xref="GOA:Q2T293"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T293"
FT                   /protein_id="ABC39463.1"
FT                   /translation="MHAKSLTELRAALDAKECSAVELAQHYLKRIDAARDLNAFVHVDA
FT                   ELTLAQAKAADAALAKGEAGPLAGLPIAHKDVFVTRGWRSTAGSKMLANYASPFDATVV
FT                   ARLSAAGMVTLGKTNMDEFAMGSSNENSAFGPVKNPWDTNAVPGGSSGGSSAAVAARLA
FT                   PAATGTDTGGSIRQPASFAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMARSAADCALL
FT                   LNAMAGFDERDSTSLERADEDYTRHLGKTWAAGGDAGKPLAGLRIGLPAEYFGAGLADD
FT                   VRAAIDAALKTYETLGATLVPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAA
FT                   EYRDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAF
FT                   KSCDVIMGPASPTVAWDIGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAK
FT                   RPVGLQIIGNYFDEARMLQVADAFQRATDWHVQEPAGV"
FT   gene            179911..181383
FT                   /locus_tag="BTH_I0149"
FT   CDS_pept        179911..181383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0149"
FT                   /product="glutamyl-tRNA"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36765"
FT                   /db_xref="GOA:Q2T292"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T292"
FT                   /protein_id="ABC36765.1"
FT                   /translation="MTQWEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLAL
FT                   PGVLPVLNRGAVERAIRFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGG
FT                   QITIQVPANEKAGKQAYSKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIV
FT                   TEPEMRSAAEAVAYAKALHGLVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEI
FT                   KNLNSFRFLEDAINYEVRRQIELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYF
FT                   PDPDLMPLVIGADWIERVKGEMPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFEA
FT                   VVAKAGAANAKIAANWLMGDVSSQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIA
FT                   KEIFVAIWDEKAADEGAADRIIDAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKE
FT                   KAFNALVGQAMKATKGKANPQQVNELLKKKLG"
FT   gene            181510..182349
FT                   /locus_tag="BTH_I0150"
FT   CDS_pept        181510..182349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0150"
FT                   /product="Domain of unknown function (DUF344) superfamily"
FT                   /note="identified by match to protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37729"
FT                   /db_xref="GOA:Q2T291"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T291"
FT                   /protein_id="ABC37729.1"
FT                   /translation="MAKQPSLDDYRVPYHTHEKETAAFTLDAFDPAAKPFSSGSKETDR
FT                   ERLSAVSMQLDTLQDRLHTQQWKRMLLVLQGMDTSGKDGTVRAVFREVDPLGLRIVSFK
FT                   SPTPVELAHDFLWRVHAQAPAAGELAIFNRSHYEDVLVPRVLGAIDKTECERRYRQIRQ
FT                   FEEMLVESGATIVKCFLHISKNEQRDRLQARVDDPSKHWKFDISDLDARKHWDAYQAAY
FT                   RDALAATSAEHAPWYVIPADSKTHRNVMIAELLLQVLTGMKLDYPPGKPELAGVRIQ"
FT   gene            182381..183151
FT                   /gene="xth-1"
FT                   /locus_tag="BTH_I0151"
FT   CDS_pept        182381..183151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth-1"
FT                   /locus_tag="BTH_I0151"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00195; match to protein
FT                   family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38673"
FT                   /db_xref="GOA:Q2T290"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T290"
FT                   /protein_id="ABC38673.1"
FT                   /translation="MLRVITANLNGIRSAAKKGFFEWLGEQNADCVCVQEIKVSADDLP
FT                   AEFVGPHGFRSYFHHAQKKGYSGAGLYSRREPDDVIIGYGSSEFDAEGRYVEARFGKLS
FT                   IVSVYVPSGSSGDERQQAKYRFMDEFMPHLAELKSKREVILCGDVNIVHKEIDIKNWKS
FT                   NQKNSGCLPEERAWLTKLFDEVGYVDVFRTLDSRPEQYTWWSNRGQAYAKNVGWRIDYQ
FT                   IATPGVAGTAKGTSIFRDIKFSDHAPLTVDYDYK"
FT   gene            complement(183292..184356)
FT                   /locus_tag="BTH_I0152"
FT   CDS_pept        complement(183292..184356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0152"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38781"
FT                   /db_xref="GOA:Q2T289"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T289"
FT                   /protein_id="ABC38781.1"
FT                   /translation="MSTTYAYAATSATTPLAPFEFQRRALRDLDVQIEILYCGVCHSDL
FT                   HQARNEWKNTTYPVVPGHEIVGRVTAVGPQVTRFKTGELVGVGCLVDSCRTCPSCEEGL
FT                   EQYCENGFVGTYNGRDRATGDVTFGGYSTQIVVDEAFVLRVPDTLDPAGAAPLLCAGIT
FT                   TYSPLRQWGAGPGKKVGVVGLGGLGHMGVKLARAMGAHVVLFTTSPSKIDDGKRLGAHE
FT                   VVISKDEAQMNAHLNSFDFILNTVAAQHDLNPFLHLLKRDGTMTLVGAPEHDHPSPQVF
FT                   NLIFKRRRLAGSLIGGIAETQEMLDFCALHGITSDIEVIPMSQVNAAYERMLKSDVKYR
FT                   FVIDIGSIRPPRAA"
FT   gene            184575..185519
FT                   /locus_tag="BTH_I0153"
FT   CDS_pept        184575..185519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0153"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF06719"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36437"
FT                   /db_xref="GOA:Q2T288"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T288"
FT                   /protein_id="ABC36437.1"
FT                   /translation="MSFDPLFPDGGARLQRRILALFDQLAPNEGYTHAPIDGVRFIRSN
FT                   RPVPRMPVLYDPSIIVVCQGRKRGYVGEQTFVYDARQYLVLSVPLPFECETFATPDEPF
FT                   LAISIRIDLAVIAELAILLDETHGASISEPRGIYSTPLDAPLADAVLRLLEALASPADT
FT                   RVLGPAIMREIGYRVLTGAQGDAIRAALAQQHHFGRVARALRRIHADLSGELDVETLAS
FT                   EAGMSLAVFHAQFKSVTASSPMQYVKATRLHHARLMMVQDGLNAGAAAARVGYASASQF
FT                   SREFKRLFGRSPSDEVRWVQAGGRQPAGLDTGE"
FT   gene            complement(185747..186787)
FT                   /locus_tag="BTH_I0154"
FT   CDS_pept        complement(185747..186787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0154"
FT                   /product="Peptidase family M48 family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37288"
FT                   /db_xref="GOA:Q2T287"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T287"
FT                   /protein_id="ABC37288.1"
FT                   /translation="MPAKLRAARAALTLVGGVALGVAGPALGLELCMAEPMLVADNGTP
FT                   SAPPAPSAPSAAAPAAPAAAPAAGNPKPYGLGDQQVRYGNAIVFRSLIPSPLLEQLTDN
FT                   EYRQTVQDAAQRERLLPPNNARVKRLRTIVTRLAPYAVKWSERVKGWNWEIEVLRSRSI
FT                   RAFCLPGGKVLVDSGLLDRLRLTDDEIGVLFAHEIAHALREHARSSLGEQQAASLGTGA
FT                   TPLPPLFGLSEPLPAPLGVVERFASVRYDPTDETEADVIGGDIAARAGFDPRAAITLWD
FT                   KLAVATRADKDNGFIYAHPYDTRRRNDLRKRLADLMPLYRKALVKNAAAGAAAGAKQRG
FT                   AATANR"
FT   gene            complement(186777..188090)
FT                   /locus_tag="BTH_I0155"
FT   CDS_pept        complement(186777..188090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0155"
FT                   /product="AmpG-related permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38305"
FT                   /db_xref="GOA:Q2T286"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T286"
FT                   /protein_id="ABC38305.1"
FT                   /translation="MTKPPHDAPALNAHEDHPGWRAYLNTHMLICVFLGFTSGLPLFTL
FT                   VYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFLWAPLMDRFIPRLPGWRPGRRRGWMLV
FT                   TQLLVAAAIAALGFVSPRESIWTVAALTTLVAFFGASADIVIDAYRRELLRDTEQGLGN
FT                   AVHVNAYKVAALIPGSLSLILSDHLPWDAVFALTAAFMLPGIVMTLVVREPDVHGAPPK
FT                   NLSEAVILPFREFIGRDGWRGALLVLGFIFLYKLGDTMATTLSTSFFLDLGFNKTQIGV
FT                   IAKTTAFWASLAGGIIGGVWLVKIGIARGLWIFGVLQIVSTLGFAWLAKAGPDSVLMAA
FT                   IYGFETFSTGLTLAAFTAYIASTTDPRYTATQFALFTSLASVPRTLASASSGFIVAQIG
FT                   WFDYFLVCAALGIPGMLLLFKIAPWNGSMSGNEAARAG"
FT   gene            complement(188102..188716)
FT                   /gene="metW"
FT                   /locus_tag="BTH_I0156"
FT   CDS_pept        complement(188102..188716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="BTH_I0156"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="identified by match to protein family HMM PF07021;
FT                   match to protein family HMM TIGR02081"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38422"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T285"
FT                   /protein_id="ABC38422.1"
FT                   /translation="MNQQALNTLSARADFRAIARWVEPRSTVLDLGCGDGSLLSLLTEE
FT                   LEVSGYGVEINDAGVLASVKNGINVIQQNLEDGLRLFEDHSFDFAILSQTLQTIHQTAA
FT                   ILRETARVGRECIVSFPNFGYWSHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIKDFEA
FT                   LAPEVGVEILDRAVLHEGQPIRWGVNWRGSLAVYRVKRRQP"
FT   gene            complement(188713..189858)
FT                   /gene="metX"
FT                   /locus_tag="BTH_I0157"
FT   CDS_pept        complement(188713..189858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="BTH_I0157"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37574"
FT                   /db_xref="GOA:Q2T284"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T284"
FT                   /protein_id="ABC37574.1"
FT                   /translation="MESIGVVAPHTMHFAEPLRLQSGSVLGNYQLVVETYGELNAARSN
FT                   AVLVCHALNASHHVAGVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTG
FT                   PMSIDPATGTPYGARFPVVTVEDWVHAQARVADAFGIERFAAVMGGSLGGMQALAWSLL
FT                   YPERVAHCIDIASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPRRGLRVARM
FT                   IGHITYLSDDDMAEKFGRALRRADGALDAYNFNFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFNGNLSAALAHTKAKYLVASFTTDWRFAPARSREIVKALLDNR
FT                   RSVSYAEIDAPHGHDAFLLDDARYHNLVRAYYERIAEEVGA"
FT   gene            complement(190164..190856)
FT                   /locus_tag="BTH_I0158"
FT   CDS_pept        complement(190164..190856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0158"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36581"
FT                   /db_xref="GOA:Q2T283"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T283"
FT                   /protein_id="ABC36581.1"
FT                   /translation="MQPTHPQDPAVTAAAGDKRNAASRARPKPGERRVHILQTLASMLE
FT                   SPKREKITTAALAARLDVSEAALYRHFSSKAQMFEGLIEFIEETFFGLVNQIAANEPNG
FT                   VLQARSIALMLLNFSARNPGMTRVLTGEALVGEHERLAERVDQMLERVEASIKQCLRVA
FT                   LLDANARADGAGGGAPPPVPLPDDYDPALRASLVVSYVLGRWHRYAKSGFTKAPGEHAD
FT                   AQLRLILQ"
FT   gene            complement(190823..191626)
FT                   /locus_tag="BTH_I0159"
FT   CDS_pept        complement(190823..191626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0159"
FT                   /product="HAD-superfamily hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01993"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39388"
FT                   /db_xref="GOA:Q2T282"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T282"
FT                   /protein_id="ABC39388.1"
FT                   /translation="MSARRQPRRTASPPASKQPPERRRERRARPQAGGPVWLFDLDNTL
FT                   HHASHAIFPAINRAMTQYIIDTLKVERAHADHLRTHYTRRYGAALLGLARHHPIDPHDF
FT                   LKVVHTFADLPSMVRAERGLARLVAALPGRKIVLTNAPEAYARAVLRELKIERLFERVI
FT                   AIEQMRDRRAWRAKPDATMLRRAMRTAHARLSDTILVEDTRGHLKRYKRLGIRTVWITG
FT                   HLPGHLPSYGRPHYVDRRIGSLKSLRLGTRSGRRKCSRLTRRTRQ"
FT   gene            complement(191623..192690)
FT                   /locus_tag="BTH_I0160"
FT   CDS_pept        complement(191623..192690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0160"
FT                   /product="acetylglutamate kinase"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38474"
FT                   /db_xref="GOA:Q2T281"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T281"
FT                   /protein_id="ABC38474.1"
FT                   /translation="MEIACGSRRKTSLFPAPPPGFETLAAPWPNGQKPHAALRHSCTIP
FT                   PVSTFRTRAAAMSEPIDLSQISPSLKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERL
FT                   KQGFARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVVEWV
FT                   LGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARKLMMPDRDNPGEYVDIGQVGEVEAI
FT                   NPAVVRALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLATVLNAEKLVMMTNIPGVM
FT                   DKEGNLLTDLSAREIDALFEDGTISGGMLPKISSALDAAKSGVKSVHIVDGRIEHSVLL
FT                   EILTEQPFGTMIRSH"
FT   gene            192848..193105
FT                   /locus_tag="BTH_I0161"
FT   CDS_pept        192848..193105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38003"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T280"
FT                   /protein_id="ABC38003.1"
FT                   /translation="MTEPAATSGLISKRCPRCGSAFDCGARTRPFTCWCAAMPAMPPGA
FT                   QPATGARCLCPECLADEIARRIAAGAVGAGAGADRPKRED"
FT   gene            193123..194403
FT                   /locus_tag="BTH_I0162"
FT   CDS_pept        193123..194403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0162"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37023"
FT                   /db_xref="GOA:Q2T279"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T279"
FT                   /protein_id="ABC37023.1"
FT                   /translation="MQRITTTGRVNLSHLFWLRNLAIIGQLVTIAVVQTYFGVHLPLPA
FT                   MLMVIALEIVFNALTWVRVLRARPETNFELLGQLWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWHLMIWLAAFAVACYLALGFDSVPLNLDNPANLFDYFRAGMWVNFMV
FT                   SVGLIAWFVARMSSALRQRDAALGEAQQALLRDERAVALGVQAATVAHEMGTPLSTIAM
FT                   LTEELREAARTDAGLARYDADLKVLEEQMSQCTSALARLRSRASERPSREPVGEWLDTF
FT                   VEHWRLRHPHVLFEQLGPRPAGVALDDTVAVGQILTILLDNAARASRDRVTLAATIAHD
FT                   GARDEIEFEVCDNGPGIPAALRDTLGAAPVDSTQGGHGVGLYLAFSAAARLGGSIELAD
FT                   AQPRGTRVILRLPVARQVAAEMANENG"
FT   gene            194423..194965
FT                   /locus_tag="BTH_I0163"
FT   CDS_pept        194423..194965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0163"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36571"
FT                   /db_xref="GOA:Q2T278"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T278"
FT                   /protein_id="ABC36571.1"
FT                   /translation="MSDKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGA
FT                   EKFEFITVDLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAK
FT                   PANVESILAALQTNATEVQAEEALENPVVLSVDRLEWEHIQRVLAENNNNISATARALN
FT                   MHRRTLQRKLAKKPVRQ"
FT   gene            complement(195371..196714)
FT                   /gene="hslU"
FT                   /locus_tag="BTH_I0164"
FT   CDS_pept        complement(195371..196714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="BTH_I0164"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM TIGR00390"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38922"
FT                   /db_xref="GOA:Q2T277"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T277"
FT                   /protein_id="ABC38922.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQDKAKKAVAVALRNRWRRQQVAEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASVEHANDDNNATRQTFR
FT                   KRLREGQLDDKEIELDIEQPTVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIK
FT                   EALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGV
FT                   QRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLS
FT                   VKDFEAILVATDASLVKQYQALLATEDVALEFADDGIRRLAEIAYAVNEKTENIGARRL
FT                   YTVIEKLLEEVSFAAGNHAGQSVTIDAAYVDRALGEVSKDEDLSRYVL"
FT   gene            complement(196724..197368)
FT                   /locus_tag="BTH_I0165"
FT   CDS_pept        complement(196724..197368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0165"
FT                   /product="protease HslVU, subunit HslV"
FT                   /note="identified by match to protein family HMM PF00227"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38369"
FT                   /db_xref="GOA:Q2T276"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T276"
FT                   /protein_id="ABC38369.1"
FT                   /translation="MKTMRVEPACEARSRAPQHAAAPPRAPLPRLSRGLQMEQFHGTTI
FT                   VSVRRGDKVALGGDGQVTLGNIVMKGGARKVRRIYNNQVLVGFAGGTADAFSLLDRFEA
FT                   KLEKHQGNLTRAAVELAKDWRTDRMLRRLEAMLITADATTTLVITGNGDVLDPEGGICA
FT                   IGSGGSYAQAAARALAENTDLSPREIVEKSLAIAGDMCIYTNHNRIIETIE"
FT   gene            complement(197522..197938)
FT                   /locus_tag="BTH_I0166"
FT   CDS_pept        complement(197522..197938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0166"
FT                   /product="DnaK suppressor protein"
FT                   /note="identified by match to protein family HMM PF01258;
FT                   match to protein family HMM TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37402"
FT                   /db_xref="GOA:Q2T275"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T275"
FT                   /protein_id="ABC37402.1"
FT                   /translation="MTKKLLTEAEILKMSDKDYMNEDQLAFFKNRLEQLQAEILRNAGQ
FT                   TTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSLARIESGDYGWCEET
FT                   GEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
FT   gene            complement(198279..198446)
FT                   /locus_tag="BTH_I0167"
FT   CDS_pept        complement(198279..198446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T274"
FT                   /protein_id="ABC39188.1"
FT                   /translation="MRERRAPAHGARRYGGERGAPRERRFACPPAGPAAHAGKPAAPAA
FT                   DPRTAVIAFS"
FT   gene            complement(198460..199533)
FT                   /locus_tag="BTH_I0168"
FT   CDS_pept        complement(198460..199533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0168"
FT                   /product="cobalamin synthesis protein/P47K family protein"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM PF07683"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37339"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T273"
FT                   /protein_id="ABC37339.1"
FT                   /translation="MAIPVTILTGFLGSGKTTLLKRILNEQHGMKIAVIENEFGEENID
FT                   NEILVQDSTEQIIQMSNGCICCTIRGDLARALADLAAKKRDGTFDFDRVVIETTGLANP
FT                   GPVAQTFFIDSEIADEFLLDAVITLVDAKHADAQLDEHEVVQRQVGFADRLFITKADLV
FT                   DDEAVSELKHRLLHMNPKAAIKVVNFGDADIKEIFDLRGFNLNAKLEIDPDFLAEDEHE
FT                   HAHHHEHGHDHAHCDHDHGHCEHDHEHGHHHHHAHHDDKIKSFVYRNDRPFDPNKLEDF
FT                   LGGILQIYGERMLRYKGVLYMKGVDRKVVFQGVHQMMGSDLAAKWLPAEKKTNKMVFIG
FT                   VDLPRDLITDGLDACLA"
FT   gene            complement(199711..200982)
FT                   /locus_tag="BTH_I0169"
FT   CDS_pept        complement(199711..200982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37322"
FT                   /db_xref="GOA:Q2T272"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T272"
FT                   /protein_id="ABC37322.1"
FT                   /translation="MHTVTLKPSKDKSLLRRHPWVYANAIDRVDGKPAPGATVIVRAHD
FT                   GRFLARAAYSPHSQIRLRVWSFDENEPIDHAFFKRRVQRAVAHRRAMIAGTGAVRLVFG
FT                   EADGLPGLIVDHYVAAPIPAGDAAACAAEGGATQQAEPAEGAGRGQLVCQFMAAGVEHW
FT                   KDAIVAALVAATGCPNVYERSDVSIREKEGLEQTTGVLAGDAPPDTLIANENGVLYHVD
FT                   VRNGHKTGFYVDQRENRALVAQYARDRDVLNCFCYTGGFSLAALKGGAKRVVSIDSSGD
FT                   ALALAQRNVAANGFDAARAQWLDADAFKTLRRLVDEGERFDLIVLDPPKFAPTRDSVDR
FT                   AARAYKDINLSGFKLLRPGGLLFTYSCSGAIDMDLFQKIVAGAAADAKVDARILKRLGA
FT                   GVDHPLLTAFPEGEYLKGLLLQIA"
FT   gene            complement(201065..201985)
FT                   /gene="xerC"
FT                   /locus_tag="BTH_I0170"
FT   CDS_pept        complement(201065..201985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="BTH_I0170"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899; match to protein
FT                   family HMM TIGR02224"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38064"
FT                   /db_xref="GOA:Q2T271"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T271"
FT                   /protein_id="ABC38064.1"
FT                   /translation="MTTDPIADYLSNLRHVRKLSDHTLRAYAHELGELRKLANGRPLES
FT                   LTAVDMRGAVARAHAGGLSARSISHRLSAWRAFYRWFSQHVEMNANPVAAVRAPKRAKT
FT                   LPKALSVDDAAALMDAPTAGTAEHLRDHAILELFYSSGLRLAELIGLDVEYTKDGDYRS
FT                   EGWLDLAEAEVTVRGKGEKERKVPVGRKAIDALNAWLAVRGEFVKRDARPLFLSVRGNR
FT                   MSPGVVRERVKRAALAAGIPANVHPHVLRHSFATHVLQSSGDLRAVQELLGHASISATQ
FT                   VYTSLDFQHLAKIYDSAHPRAKKRD"
FT   gene            complement(202015..202767)
FT                   /locus_tag="BTH_I0171"
FT   CDS_pept        complement(202015..202767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04340"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37038"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T270"
FT                   /protein_id="ABC37038.1"
FT                   /translation="MQPDLSFAEAERSAMNDREVADYLLANPEFFAQHAELLATIKLAN
FT                   PHGKAAVSLQERQMEMLRDKNKHLERRLAELLRYGHENDGLAAKFNRWTARVIAERDPY
FT                   ALPRAIAGGLADAFDVPQTALRLWDVAETYAQADFARNVGEEVRLFTNSLATPYCGANT
FT                   GFEAAQWLAPVTAATAGDGEAPAASGAAESVALIALRAPDAGEGAGAFGLLVLGSPDPR
FT                   RFHDGMGTDFLTQIGTLASAALTRLLPH"
FT   gene            complement(202772..203641)
FT                   /gene="dapF"
FT                   /locus_tag="BTH_I0172"
FT   CDS_pept        complement(202772..203641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="BTH_I0172"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by match to protein family HMM PF01678;
FT                   match to protein family HMM TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37078"
FT                   /db_xref="GOA:Q2T269"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T269"
FT                   /protein_id="ABC37078.1"
FT                   /translation="MKLSFTKMHGAGNDFVVLDGYSRALPPLTDALVRALADRHFGIGA
FT                   DQLLLVEKPTVDGADFKYRIFNCDGGEVEHCGNGARCFVKFVRDHGLTDKASVRVEVKH
FT                   GVITLTMQDNGEVVVDMGAPVFEPARVPFDTSGLDGRREGADTLWPLPVNGATRWISVV
FT                   SMGNPHAVQIVDDAEAFPVLADGPAIERDPRFPQRVNAGFMQIVSRHEVKLRVYERGAG
FT                   ETLACGTGACAAVAAGIRRGQLDSPVTVHTHGGTLTISWDGARDERAPLMMAGPATTVF
FT                   EGVIDLPA"
FT   gene            complement(203682..204566)
FT                   /locus_tag="BTH_I0173"
FT   CDS_pept        complement(203682..204566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0173"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37799"
FT                   /db_xref="GOA:Q2T268"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T268"
FT                   /protein_id="ABC37799.1"
FT                   /translation="MLGRLGTQLAVAFLKFLAVLPYGLTARLGDGLGWLLYQIPSRRKR
FT                   IVHINLKLCFPDWSDARREEIAGKHFRHAIRSYVERSVQWFGSAKKLEKLIQVDSAVDL
FT                   TDPNLPPTLFLGLHFVGIEAGSIWLNRSLRRRCGSLYQPFSNPTLEAVAKAARGRFDAE
FT                   MVGRADSARVVLRWLRDRKPVMLGADMDYGLRNSTFVPFFGVPACTLTAVGRLAKTGHA
FT                   QVVPFIGEVLPNYQGYRLKIFKPWENYPTGDDDLDARRMNAFLEEQIPLMPEQYYWVHK
FT                   RFKTRPPGEPSFY"
FT   gene            204833..206020
FT                   /gene="metK"
FT                   /locus_tag="BTH_I0174"
FT   CDS_pept        204833..206020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BTH_I0174"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38395"
FT                   /db_xref="GOA:Q2T267"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T267"
FT                   /protein_id="ABC38395.1"
FT                   /translation="MANDYLFTSESVSEGHPDKVADQISDAILDAILAQDKYSRVAAET
FT                   LCNTGLVVLAGEITTTANIDYIQIARDTIKRIGYDNTDYGIDYRGCAVLVAYDKQSPDI
FT                   AQGVDRAHDNNLDQGAGDQGLMFGYACDETPELMPLPIHLSHRLVERQANLRRDGRLPW
FT                   LRPDAKSQVTVRYVDGKPHSIDTVVLSTQHAPDIDLPALREAVIEEIIKPTLPADLIKG
FT                   DIKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYA
FT                   GRYVAKNIVAAGLASRALIQVSYAIGVAEPTSVMVNTFGTGRVSDETITKLVREHFDLR
FT                   PKGIIQMLDLLRPIYEKTAAYGHFGREEPEFSWEAADKALALAEAAGVEPAVQVA"
FT   gene            206139..206519
FT                   /locus_tag="BTH_I0175"
FT   CDS_pept        206139..206519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38887"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T266"
FT                   /protein_id="ABC38887.1"
FT                   /translation="MSAVRGAARRNAARGPCVQRAANTNQPVLAARRRGRLIRRGATLA
FT                   RCSDGARSRSDGFCSSERSAVRRAAAWALISDRNACSHARRPSSRGGCWRARSASTLAR
FT                   ALWWRNARTIRCGADGALFGVR"
FT   gene            206762..207682
FT                   /locus_tag="BTH_I0176"
FT   CDS_pept        206762..207682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0176"
FT                   /product="Phytanoyl-CoA dioxygenase (PhyH) family"
FT                   /note="identified by match to protein family HMM PF05721"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38284"
FT                   /db_xref="GOA:Q2T265"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T265"
FT                   /protein_id="ABC38284.1"
FT                   /translation="MARARPTVPLRYIKFAATIARRFSLRGIVASMSRRSALQSIVDNN
FT                   HVDPPMSSLHPELIHTQVQTLRERGFVVAPGLVAPERCAQLKAIAERQLHEAVPPLEFE
FT                   ADLRYPGAPESRHAPGGHTVRRLLDAYARDAAFAERATAPEIGAWMRAYFGEPPVLSRA
FT                   HHNCVMTKHPAYGSLTGWHRDVRYWSFKRADLVSVWLALGTETNDNGALWLVPGSHDAE
FT                   FGPESFDEAKFFRSDVPANRQLIEQAVCPELAPGDVVFFHCNTLHSAGQNRSDQVKFSL
FT                   VFTYHGDSNRPVPGSRSASKPEVRF"
FT   gene            207743..208126
FT                   /locus_tag="BTH_I0177"
FT   CDS_pept        207743..208126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36855"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T264"
FT                   /protein_id="ABC36855.1"
FT                   /translation="MRRPARDCRARPCIAQTADDRTKRAAHACVPPAWFFGASRRAGAR
FT                   QRLPLGIDRPISPTSVATTPPAISMIVFVEGDPVKKRATPSLIEWNDWPPKYSSTTPPT
FT                   MSATEIARVMKILAETDDGDAAV"
FT   gene            208260..209303
FT                   /locus_tag="BTH_I0178"
FT   CDS_pept        208260..209303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0178"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38726"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T263"
FT                   /protein_id="ABC38726.1"
FT                   /translation="MTYEAASERYADMQYRVSGKSGLKLPALSLGLWHNFGDTTPISTQ
FT                   REILRTAFDLGITHFDLANNYGPPYGSAETNFGRLLREDFRPYRDELLISTKAGWDMWP
FT                   GPYGSGGGSRKYVLASLDQSLQRMGLDYVDIFYSHRFDAHTPLEETASALATAVQQGKA
FT                   LYVGVSSYSAAKTREIAKLLAEYKVPLLIHQPAYNLLNRWIERELLDALDETGSGCIAF
FT                   TPLAQGLLTSKYLNGVPADARINKPGGGSLKEGHLSAENLEHVRKLNEIAQRRGQSLAQ
FT                   MALAWVLRDSRVTSALIGASRAQQVRENVAALANLSFSNDEIAEIDRYATEGGINLWEK
FT                   PSTDQAL"
FT   gene            complement(209390..209575)
FT                   /locus_tag="BTH_I0179"
FT   CDS_pept        complement(209390..209575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37652"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T262"
FT                   /protein_id="ABC37652.1"
FT                   /translation="MSTYFTIADFILLIPMALAGALFLGAVPCATEFRHNVLRVLGAML
FT                   GVAVAVLLVEGLPALI"
FT   gene            complement(209832..210695)
FT                   /locus_tag="BTH_I0180"
FT   CDS_pept        complement(209832..210695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0180"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39004"
FT                   /db_xref="GOA:Q2T261"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T261"
FT                   /protein_id="ABC39004.1"
FT                   /translation="MASLKPALAAHGATSLFVLLWSSGAIFAELGLRHACAFAFLIARF
FT                   ALASFVLLVLSLARRRWLPPPGARRATVATGLLLTGGYSILYLLALERGLAPGILATIL
FT                   GVQPILTLVVLERRASGARLAGLALALTGLSLVVRRSIALGDAPVSGASCALGALLAIT
FT                   AGALLQKRVRAAPIDMLPLQNALGLGLCALIAPFEPIAFEASWSLLLPLAWLGIVISVF
FT                   AQLLFYRLMQQGDLVNVTSLFYLVPVVTALMDAVWLGNRLAPVEIAGMIAILAGLALAF
FT                   RRAARD"
FT   gene            complement(211087..212667)
FT                   /locus_tag="BTH_I0181"
FT   CDS_pept        complement(211087..212667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0181"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38253"
FT                   /db_xref="GOA:Q2T260"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T260"
FT                   /protein_id="ABC38253.1"
FT                   /translation="MRRRIARIPLFLVHGIAKARTDDKRAAHSRDASIPPLRRAAFETF
FT                   RGSASLHHTPARSAAIRRFTRKCGQKPTRRLTKRRRTGNRRIVEVCLAWRTSVTVSPGA
FT                   PPPAAGARPSPAHAARGASPDSCAPYLERGSRSYWHASVALLFAGYATFSLLYYVQPLL
FT                   PEFSKAFGVSPAQSSLALSFSTAALAAAVFVAGFVSEALSRHLLMTASLTASSLLTLAA
FT                   AFAPHWHQLLILRALTGLALGGVPAVAMAYLAEEVHPDGLGLAMGLYVGGTAIGGMAGR
FT                   VITGILTDLFSWRIAVGAIGVLGLASMLAFRMLLPPSRHFTPRRGLNLAHHRTSLAHHL
FT                   GKQRELPALFVMAFVLMGSFVTLYNYLGYRLLAPPYSMGQATISAIFVVYLVGVVASPL
FT                   SGRLADTLGRGRVLIASLVVMLAGVALTLLHPVAAIATGIACVTFGFFAGHAVASGWVG
FT                   RLARHGKGQAAALYLLAYYIGSSVVGSLGGRFWSALGWPGVAALVGALLALGIVVAVWL
FT                   RARERAGAA"
FT   gene            212733..212945
FT                   /locus_tag="BTH_I0182"
FT   CDS_pept        212733..212945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0182"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37958"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T259"
FT                   /protein_id="ABC37958.1"
FT                   /translation="MHVGSIVCTTHIAVPKGARGIVQRILGDMAMVTWYAGVPGESKEL
FT                   NTEPFFLEDLIDTGESVLPAGAALH"
FT   gene            212977..214017
FT                   /locus_tag="BTH_I0183"
FT   CDS_pept        212977..214017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0183"
FT                   /product="Bacterial protein of unknown function (DUF954)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06111"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37418"
FT                   /db_xref="GOA:Q2T258"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T258"
FT                   /protein_id="ABC37418.1"
FT                   /translation="MRSMNDATSESNTAGASAGLPFAGLTPERVLDALDSVLIPAGSRT
FT                   DGRLLALNSYENRVYQAGVEDGAPIVAKFYRPHRWSNEAILEEHAFVAELAAREIPAVP
FT                   ALAFDGRTLHEFEGFRFAIFERRGGRAPELDRRDTLEWLGRFIGRIHAVGASKPYAARP
FT                   MLDIHTFGYEPRDFLLSHDFVPDDVRPAYEAAVTLALEGVERAYERAGDVRMLRAHGDC
FT                   HPSNVLWTDAGPHFVDFDDSRMAPAVQDLWLLLPGDRPGASLALADLLAGYEDFCEFDP
FT                   RELHLIEALRTLRLIHYAAWLARRWEDPAFPAAFPWFNTHRYWEARVLELREQIGAMQE
FT                   GPLWPV"
FT   gene            complement(214049..215020)
FT                   /locus_tag="BTH_I0184"
FT   CDS_pept        complement(214049..215020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0184"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37836"
FT                   /db_xref="GOA:Q2T257"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T257"
FT                   /protein_id="ABC37836.1"
FT                   /translation="MSGFLHRERFKSKITNDLINTDFGSMFELSQLRCFVAVAEELHFG
FT                   RAAERLHMTQPPLSRQVRLLEHQIGTELLERTSRSVKLTAAGRGFLPDAARILRLADEA
FT                   AATARRIATGAAGTLAIGFTASVGYGLLPSLVSAVRAASPDVRLTLKEMVSGAQLEALD
FT                   ARLIDVGLLRPPVEHGELASLPCMREALVLALPAASADAWPKRPTLRDCEGKPLLMYSP
FT                   YEARYFHQLVSGLLERTDVLPDIVEYVSQIHSMLALVRAGIGAALIPAAASMLHFEGVV
FT                   YRPVRTMPAKPVELTLAYRKDNDNPVFAALKDVLRKSLAASR"
FT   gene            214983..215993
FT                   /locus_tag="BTH_I0185"
FT   CDS_pept        214983..215993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0185"
FT                   /product="Dihydrodipicolinate synthetase family
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38095"
FT                   /db_xref="GOA:Q2T256"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T256"
FT                   /protein_id="ABC38095.1"
FT                   /translation="MDLNRSRCKNPLTTCHAAPARTLMSRYTPTEFARQIGSGLLSFPV
FT                   THFRADLSFDEAAYRANLGWLFSHDAAGLFAAGGTGEFFSLTPAEVDRVVRAAVAETGG
FT                   RLPVIAPAGYGTAMAIDYCKAAEAAGADGILLLPPYLTEASADGVAAHVEQVCRATRLG
FT                   VIVYNRANQVLDENALARLAERCPNLVGFKDGVGDIELMTRIYTRLGERFTYIGGLPTA
FT                   ETFALPYLTLGVTTYSSAIFNFVPRFALDFYAAVRAQDHAKVYAMLDQFVLPYIALRNR
FT                   KRGYAVSIVKAGMRVVGRSAGPVRAPLTDLTGAELAELSALVARIADVAEAQACL"
FT   gene            215984..217558
FT                   /locus_tag="BTH_I0186"
FT   CDS_pept        215984..217558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0186"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38348"
FT                   /db_xref="GOA:Q2T255"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T255"
FT                   /protein_id="ABC38348.1"
FT                   /translation="MSVSGELMLGGERVAPGERAAVRATDPATGATLEPPFALATHADV
FT                   ARACELAAASFDAYRDTAPEARAAFLEAIATEIEALGDALIERAIAETALPRARLEGER
FT                   ARTCGQLRLFAAVVRAGDAFGARIDPALPERRPLPRADLRMRRIALGPVAVFGASNFPL
FT                   AFSVAGGDTASALAAGCPVVVKAHPAHPGTSELVGRALAAALARCGLPAGVFSLVQADN
FT                   DVALALVADARIQAVGFTGSRAGGQALLRVAQSRAQPIPMYGELSAINPVFLLPDALAR
FT                   RGGALGRQFVASLTLGAGQFCTNPGLLLAIDGPGLDAFSNAAADALVTSVAQPMLTPGI
FT                   HAAYVRGVERLADSDHVRCVARGEASDLPNRGCAGLFDTDARHFIAQPALHDEIFGATA
FT                   LLVRCRDAAELRAVAEMLDGQLTATLHLDDGDAPLARALLPVLERKAGRIVANGWPTGV
FT                   EVCDAMVHGGPWPATTDARATSVGTAAIERFLRPVCYQDLPAGLLPPALRDDNPQRLRR
FT                   LVDGNWV"
FT   gene            217652..219007
FT                   /locus_tag="BTH_I0187"
FT   CDS_pept        217652..219007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0187"
FT                   /product="MFS transporter, phthalate permease family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00893"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39458"
FT                   /db_xref="GOA:Q2T254"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T254"
FT                   /protein_id="ABC39458.1"
FT                   /translation="MDIKAPAVGARSTPRVERMSRVRFTILAMLFVVTTINYADRATIS
FT                   IAGSAMQKDLGIDAVSLGYIFSAFGWAYVIAQIPGGWLLDRFGSRRVYAASILTWSVFT
FT                   LAQGAIGLFTGMAAIVAVFSLRFLVGIAEAPSFPANSRIVAAWFPANERGTASAIFNSA
FT                   QYAATVIFAPLMAWLVHRFGWHEVFVVMGAIGIAAAFAWRAVVRDPKDHPRMNRAEIEY
FT                   IENGGGLVNMDRAGVANAQGPDLGYIGQLLKNRMMMGVYVAQYCINALTYFFITWFPVY
FT                   LVQARGMSILKAGFVASVPAVCGFLGGILGGIVSDALLRRGASLSVARKVPIVLGMLLS
FT                   VSMVVCNYVDTQGIVVAVMALAFFGKGMGALGWAVNSDTAPKQIAGLSGALMNTFGNLS
FT                   SITTPIAIGYIVNRTGSFNGALAYVGLHALVACVCYLFVVGEIKRVELKPAS"
FT   gene            219016..219486
FT                   /locus_tag="BTH_I0188"
FT   CDS_pept        219016..219486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0188"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38237"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T253"
FT                   /protein_id="ABC38237.1"
FT                   /translation="MSNMTSNAIEAAAQAHANTHTPSPSVAQRCDEWGRTWGSHSNHHF
FT                   DISLAMFTHVAAAAPGNITAIDAHWIWQEADERLTREPLAIARGHVAVPEGPGLGIALD
FT                   MDRVMQAHALYETLGPGARDDARAMQYRVPGWAYHPKRPSFGSAARAAARGA"
FT   gene            219483..220856
FT                   /locus_tag="BTH_I0189"
FT   CDS_pept        219483..220856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0189"
FT                   /product="glucarate dehydratase"
FT                   /EC_number="4.2.1.40"
FT                   /note="identified by match to protein family HMM PF01188"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37349"
FT                   /db_xref="GOA:Q2T252"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T252"
FT                   /protein_id="ABC37349.1"
FT                   /translation="MNALMETLVMRTELSRTTTPVVSDLRVVPVAGRDSMLLNLSGAHG
FT                   PFFTRNIVLIRDSAGNTGVGEVPGGEGIRRTLEDARALVVGQPLGRWQDVLNAVRARFA
FT                   DRDAGGRGLQTFDLRITIHAVTALEAALLDLLGQHLGVPVAALLGEGQQRSRVPMLGYL
FT                   FYIGDRKRTDLDYRSEPQADDAWFRLRNEVALTPDAIVRLAEAAHARYGFQDFKLKGGV
FT                   LSGDDEIAAVTALAKRFPNARITLDPNGAWSLQEAIRLCRGKGDVLAYAEDPCGAENGY
FT                   SGREIMAEFRRATGLPTATNMIATDWRQLGHALRLGSVDIPLADPHFWTMRGSVRVAQL
FT                   CDEWGLTWGSHSNNHFDISLAMFTHVAAAAPGNITAIDTHWIWQDGQRLTREPLRIEDG
FT                   HVAVPQRGGLGVEIDEDALAGAHELYLEHGLGSRDDAVAMRYLVPDWTFDNKRPCLVR"
FT   gene            220786..222480
FT                   /locus_tag="BTH_I0190"
FT   CDS_pept        220786..222480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0190"
FT                   /product="D-galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /note="identified by match to protein family HMM PF04292;
FT                   match to protein family HMM PF04295"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37628"
FT                   /db_xref="GOA:Q2T251"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T251"
FT                   /protein_id="ABC37628.1"
FT                   /translation="MRSRCGTWCRTGRSTTSAPVSCAERSRLFMERSMREPTSPDGTRT
FT                   ERALTIRVHESDNVAIVVNARGLPAGAILADGTALVEGVPQGHKVALADLAEGDAVVRY
FT                   GEVIGHAAKPLPRGVWVGEHAVKLPLAPALDELPLATRAAAKRPKLDGYTFDGYRNADG
FT                   TVGTKNVLGIMTSVQCVAGVTDHVVARIKRELLPRYPNVDDVVALNHTYGCGVAINAPA
FT                   AIVPIRTLQNLALNPNFGGEVMVIGLGCEKLAPERLVPASLAPGGRIPIGVAGTADSPV
FT                   LRLQDEAFGGFGAMVDAIMEMADKRLDQLNRRRRESCPASDLVVGVQCGGSDAFSGVTA
FT                   NPAVGFAAGLIVRAGGTVMFSEVTEVRDAIHLLTPRAIDAEVGRALLREMAWYDDYLLR
FT                   GETDRSANPSPGNKTGGLSNVVEKALGSIVKSGTSPIVDVLGPGQRMRRKGLIFAATPA
FT                   SDFVCGTLQLASGINLQVFTTGRGTPYGLAMAPVVKVATRKALSERWHDLIDLDAGRIA
FT                   TGEASIADVGWELFHLILDVASGRRQVCADKLGLHNALVLFNPAPVT"
FT   gene            222417..223352
FT                   /locus_tag="BTH_I0191"
FT   CDS_pept        222417..223352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38304"
FT                   /db_xref="GOA:Q2T250"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T250"
FT                   /protein_id="ABC38304.1"
FT                   /translation="MRRQARAAQRARPVQSRAGDLIMTDLHHSNQDANAAGGDPLDGVP
FT                   THCGRILLTGAAGSLGRVLRGRLRRYADVVRVSDIAPLDGARDGEECVRCDLADAAAVD
FT                   ALVRDVDVIVHFGGVSVERPFDTVLPANITGAYHVYEAARRHGVRRIVFASSNHVTGFY
FT                   EQGERIDTAAPPRPDGYYGLSKAFGEQLARFHHDRYGIESVCIRIGSSFPEPKDRRMLV
FT                   TWLGYDDLEQLVRRAMFVPSVGCTIVYGMSANRDAWWDNAPAAHLGYRPTQSSEQWRER
FT                   IERAQPPLADDDPVRRYQGGAFVVAGPFEG"
FT   gene            complement(223526..224944)
FT                   /locus_tag="BTH_I0192"
FT   CDS_pept        complement(223526..224944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0192"
FT                   /product="coniferyl aldehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38997"
FT                   /db_xref="GOA:Q2T249"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T249"
FT                   /protein_id="ABC38997.1"
FT                   /translation="MKNDLPGLATLDALLRDQRAAYLRAPYPSWATRADHLRALRKMLL
FT                   DNRDALAAAIDADFGHRAKEEVLMSEIWLAKEEIDEALKHGKRWIKPKSRAMNKWMRPA
FT                   RAKVMPQPLGVVGIVVPWNYPVLLAAGPLICALAAGNRAIIKMSELTPRTSQLFEELIS
FT                   KTFARDHVAVVNGDAEISAAFSGLPFDHLLFTGSTNVGRHVMRAAAENLTPVTLELGGK
FT                   SPVIIGPRARFDAAVDAIITGKTLNAGQTCIAPDYVLVPRGKEAEFVARARARMAKLYP
FT                   NLSTNPDYTSIISERHFARLQRLASDAQQAGAQLHPLTDAAPDPALRRLPPVLVTQAPD
FT                   ASQLMQEEIFGPLLPIVPYDTLDDAIAYVNARARPLALYLFDEDRSSVERVMRDTISGG
FT                   VTVNDTLMHIACGTLPFGGVGASGMGAYHGYDGFVTFSKMKPVLTQPRLNTRAMIAPPY
FT                   GKRFAAILKLMLKF"
FT   gene            complement(224979..226658)
FT                   /locus_tag="BTH_I0193"
FT   CDS_pept        complement(224979..226658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0193"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36402"
FT                   /db_xref="GOA:Q2T248"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T248"
FT                   /protein_id="ABC36402.1"
FT                   /translation="MQQDLMTATHRVTNQAPPLSDYNAFETDAALVEAVQRYDASWRQT
FT                   ALARDGAALTTPDVLALADLANRHAPELATHSPRGERIDALEFHPSWHQLLALLRGEGL
FT                   HALPFSEPQPGAMAARCAGYYLHAQLESGSLCPLTMTFASIPVLRHEPALFATLRDKLY
FT                   SREHDARDVPLSQKRSMMVGMGMTEKQGGSDVRSNETHASPLGAPGRGQAYRLVGHKWF
FT                   FSAPQCDAHLVLARTSGHAGISCFYVPRFSPDGSKNAVHVQRLKDKLGNRSNASGEVEF
FT                   LNAYGVMIGDEGRGVPTIIEMANYTRLDCVIGSAALMRAALVQAIHHARHRSAFGRLLA
FT                   DQPLMRNVLADLALESEAATALFMRLAHAFEEEASARSPQARGWRRIVTPAAKFWVCKR
FT                   TLEFTGEAMEVWGGNGYVETAPMARFYREAPVNSIWEGSGNVMCLDVLRAIEREPDAAA
FT                   ALLDEWRDAARHSAPLASALAELTHLLSLEPEPREACARRIAQRIALVAQASLLLRDGP
FT                   PAVAHAFVATRFGETSSETGRVFGTLPATIDHAALIERAFPA"
FT   gene            226893..228539
FT                   /locus_tag="BTH_I0194"
FT   CDS_pept        226893..228539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0194"
FT                   /product="oxidoreductase, GMC family"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37180"
FT                   /db_xref="GOA:Q2T247"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T247"
FT                   /protein_id="ABC37180.1"
FT                   /translation="MQYDYIIVGAGSGGSSLAGRLADACPDATIALIEAGGHTERNLLV
FT                   NMPVGIAALVPFKLGTNYGYETVPQPGLGGRRGYQPRGRGLGGSSAINAMIYTRGHPLD
FT                   YDEWEQLGCTGWGWRDVLPYFRRAEGNERGANEWHGADGPLTVSDLRFRNPFSERFIAA
FT                   AHEAGYPLNDDFNGERQEGVGFYQVTHRDGSRCSVARAYVYGRTRPNLHVIVDATVLRV
FT                   VFDGKRATGVELARGGRVEKLDARAEVILSAGAFNTPQLLMCSGVGPAAQLRRHGIALV
FT                   HDAPDVGQNLIDHIDFIVNKRVNSSELVGICLRGIAKMTPALFSYLSRRRGMMTSNVAE
FT                   AGGFIKSAPGLDRPDLQLHFCTALVDDHNRNMHWGFGYSLHVCALRPKSRGNVALASSD
FT                   ARVAPLIDPRFFSDERDLDLLVTGAKAMRRILSAASLASQGGRELYTDPGDTDAQLRAA
FT                   IVAHADTIYHPVGTCRMGADARAVVDPQLRVKGVDGLRIVDASVMPTLIGGNTNAPTVM
FT                   IGERAADFIVAARNGQAVPAPRERLAAAHGG"
FT   gene            complement(228576..229973)
FT                   /locus_tag="BTH_I0195"
FT   CDS_pept        complement(228576..229973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0195"
FT                   /product="Flagellar hook-length control protein, putative"
FT                   /note="identified by match to protein family HMM PF02120"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37918"
FT                   /db_xref="GOA:Q2T246"
FT                   /db_xref="InterPro:IPR001635"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T246"
FT                   /protein_id="ABC37918.1"
FT                   /translation="MPPLPLIGMLLGTASTMIKSSSGAAAHASGASSAPSGDAAPTAPF
FT                   AQTLKRNVQTQRQTNAGAGAGAPNAGNATNAATSGTANASTTSSASEPATTNAGNTKAS
FT                   GKPDDQDDDKNATQSASADAAAALAAAASLQAQLQARPDAQAAQAAAPQAGASDAAHPP
FT                   TTLATNTAAAGDADTSALAGAQQPVGEALNAALSKLTGAGPAGAAATQRAQPAGRNDGA
FT                   PTPLAANGPFDKMLAGAKAPAAPATLTDASGTNPAVSTAAQPAASGAIAALQDAADSAR
FT                   ATLAASSAPAALQQAAPAALAANANAAAATAAPSLAPPVGTPDWTEALSQKVVFLSNAH
FT                   QQSAELTLNPPDLGPLQVVLRVAENHAHALFVSQHAQVRDAVEAALPKLREAMEAGGLG
FT                   LGSASVSDGGFASAQQQQTPQRQSSDGSAARRASGAPTADAALGEVSAVSSGGVTRRSV
FT                   GMVDTFA"
FT   gene            complement(230008..230460)
FT                   /gene="fliJ"
FT                   /locus_tag="BTH_I0196"
FT   CDS_pept        complement(230008..230460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="BTH_I0196"
FT                   /product="Flagellar FliJ protein"
FT                   /note="identified by match to protein family HMM PF02050;
FT                   match to protein family HMM TIGR02473"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37441"
FT                   /db_xref="GOA:Q2T245"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="InterPro:IPR018006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T245"
FT                   /protein_id="ABC37441.1"
FT                   /translation="MAQSFPLQLLLDRAQDDLDTATKQLGHAQRERTDAQAQLDALVRY
FT                   RDEYRERFAASAQSGMPAGNWRNFQAFLDTLDAAIEQQRRVLAAAQTRIDAARPEWQAK
FT                   KRTLGSYEILQARGARQDAQRAAKREQRDADEHAAKVLRMRADAAK"
FT   gene            complement(230466..231995)
FT                   /locus_tag="BTH_I0197"
FT   CDS_pept        complement(230466..231995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0197"
FT                   /product="flagellum-specific ATP synthase FliI"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM TIGR01026; match to protein
FT                   family HMM TIGR02545"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36961"
FT                   /db_xref="GOA:Q2T244"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T244"
FT                   /protein_id="ABC36961.1"
FT                   /translation="MVNDGGGTFGRDDLDALERELALASHGAEHDRAAAQDGGAQHHAP
FT                   PRPLANPYLANWRTHLDGIRERNARALPLRPCGRLTRAAGLVLEAIGLRLSVGAECTIE
FT                   LPAGSSLPYAQAEVVGFAGERLFLMPTTAVAGVLPGARVWPLESAPVADPLAGAKRLPV
FT                   GWELLGRVVDASGRPLDNLGPLASKVDAPLTAPSINPLDREPIHHVLDVGVRAINGLLT
FT                   VGRGQRMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERGREVKEFIEQILGEDGLA
FT                   RSVVVAAPADVSPLLRMQGAAYATTLAEYFRDQGKHVLLLMDSLTRYAMAQREIALAIG
FT                   EPPATKGYPPSVFAKLPALVERTGNGPEGGGSITAFYTVLTEGDDQQDPIADSARAILD
FT                   GHIVLSRSLAEAGHYPAIDIEASISRAMTALIDDAHLERVRQFKQMLSRYQRNRDLIAV
FT                   GAYAPGRDAQLDRAIALYPRIESFLQQGFRECAPYAPSLAALDALFESEGG"
FT   gene            complement(231989..232612)
FT                   /gene="fliH-1"
FT                   /locus_tag="BTH_I0198"
FT   CDS_pept        complement(231989..232612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH-1"
FT                   /locus_tag="BTH_I0198"
FT                   /product="Flagellar assembly protein FliH"
FT                   /note="identified by match to protein family HMM PF02108"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38948"
FT                   /db_xref="GOA:Q2T243"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T243"
FT                   /protein_id="ABC38948.1"
FT                   /translation="MASFDPPPPPPPDDGGAAAAALAAELQRVRDAAHAEGLAAGHVEG
FT                   QALGYQAGYEQGRAKGFDEGQAEAHAHGAQLAALAASFREALAGVERDLADDIATLALE
FT                   IAQQVVRQHVQHDPAALIAAAREVLAAEPALAGAPHLIVNPADLPVVEAYLKDELDTLG
FT                   WSVRTDAGVERGGCRAHASTGEIDATLATRWERVAAALGKVSAW"
FT   gene            complement(232662..233657)
FT                   /gene="fliG"
FT                   /locus_tag="BTH_I0199"
FT   CDS_pept        complement(232662..233657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="BTH_I0199"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="identified by match to protein family HMM PF01706;
FT                   match to protein family HMM TIGR00207"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38398"
FT                   /db_xref="GOA:Q2T242"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T242"
FT                   /protein_id="ABC38398.1"
FT                   /translation="MNAEGLTKSALLLMSIGEEEAAQVFKFLAPREVQKIGAAMASLKN
FT                   VTREQVEDVLSEFVHEAEKHTALSLDSSEYIRSVLTKALGEDKAGVLIDRILQGSDTSG
FT                   IEGLKWMDSAAVAELIKNEHPQIIATILVHLDRDQASEIASCFTERLRNDVLLRIATLD
FT                   GIQPTALRELDDVLTGLLSGSDNLKRAPMGGIRTAAEILNFMTSVHEEAVLENVKQYDP
FT                   DLAQKIIDQMFVFENLLDLEDRAIQLLLKEVESEALIVALKGAPPALRQKFLSNMSQRA
FT                   AELLAEDLDARGPVRVSEVETQQRKILQVVRNLAESGQIVIGGKAEDAYV"
FT   gene            complement(233647..235680)
FT                   /gene="fliF-1"
FT                   /locus_tag="BTH_I0200"
FT   CDS_pept        complement(233647..235680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF-1"
FT                   /locus_tag="BTH_I0200"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by match to protein family HMM PF01514;
FT                   match to protein family HMM TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37528"
FT                   /db_xref="GOA:Q2T241"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T241"
FT                   /protein_id="ABC37528.1"
FT                   /translation="MISAKEAGPRGPGGGGPRLPASVARAGLRKSIAAAPRRKPKKYGR
FT                   NPALFVRSHLTALRIIAPCQCPPALPSRHSARSGDTRRMDSQANSLINPDARSSLAGAP
FT                   PQAAGALPGAAAGGADFGLGGFAERIPGLARMKTNPRLPFLIGAALAIAAIVALVLWSR
FT                   APDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMGLP
FT                   KGGSVGFELMDNQKFGISQFAEQVNYQRALEGELQRTVESVNAVRAARVHLAIPKPSVF
FT                   VRDREAPSASVLVDLYPGRVLDEGQVLAITRLVSSSVPDMPAKNVTIVDQDGNLLTQTA
FT                   SATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYAP
FT                   NGTPQQSAIRSQQTSTSTELAQSGTSGVPGALSNTPPQPASAPIVASNGQPAAPAATPV
FT                   SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLTADKLAQ
FT                   VQQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAA
FT                   AAAALYFMFVRPALRRAFPPPAEPAAAVPALDGPDDALALDGLPSPDKKQLAEEDEEHP
FT                   ALLAFESEKNRYERNLDYARTIARQDPKIVATVVKNWVSDER"
FT   gene            235681..236025
FT                   /gene="fliE-1"
FT                   /locus_tag="BTH_I0201"
FT   CDS_pept        235681..236025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE-1"
FT                   /locus_tag="BTH_I0201"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /note="FliE; identified by match to protein family HMM
FT                   PF02049; match to protein family HMM TIGR00205"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37467"
FT                   /db_xref="GOA:Q2T240"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T240"
FT                   /protein_id="ABC37467.1"
FT                   /translation="MVAPVNGIASALQQMQAMAAQAAGGAASPAASLAGSGAATAGSFA
FT                   SAMKASLEKISGDQQKALGEAHAFEIGAQNVSLNDVMVDMQKANIGFQFGLQVRNKLVS
FT                   AYNEIMQMSV"
FT   gene            236158..236592
FT                   /gene="fliS-1"
FT                   /locus_tag="BTH_I0202"
FT   CDS_pept        236158..236592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS-1"
FT                   /locus_tag="BTH_I0202"
FT                   /product="flagellar protein FliS"
FT                   /note="identified by match to protein family HMM PF02561;
FT                   match to protein family HMM TIGR00208"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36539"
FT                   /db_xref="GOA:Q2T239"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T239"
FT                   /protein_id="ABC36539.1"
FT                   /translation="MFTPGHAGASAYARVGVETGVMGASAHRLIAMLYQGARQAIAHAR
FT                   LHLQQGNVAARGEAIGKAIRIVESGLQQSLNLEVGGDIASRLDALYTYICRRLLQANAD
FT                   ASEPMLIEVDGLLATLEDAWTGIGPEVARMTAQAATEQSR"
FT   gene            236589..236915
FT                   /locus_tag="BTH_I0203"
FT   CDS_pept        236589..236915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38754"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T238"
FT                   /protein_id="ABC38754.1"
FT                   /translation="MNRKDEYLARYEAIADVSGRMLVAARDAAWHAMSGLQEEYLRLVD
FT                   GLKEAEQGVLLDETERTRKFELIRRILADDAAIRDLASPEVARLSAFFHAGRSTLKDLY
FT                   RARG"
FT   gene            237025..238545
FT                   /locus_tag="BTH_I0204"
FT   CDS_pept        237025..238545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38408"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T237"
FT                   /protein_id="ABC38408.1"
FT                   /translation="MTGIDTAAAAILASRIDSLLDAIQPSAGGAAATQVGTSGAPPAAA
FT                   TPQQPAGGPPPASAQTALSEVGLTLDAISRYGGGATPAVVGAAPLLPAAFVASAAQAAL
FT                   SDPLPATPDARAGNPASSAAASGPQSAQAAAQAALAASPAAALSLALAQAVAQSGLFYE
FT                   SHLAQWLAGQRTTAELAREPQARLASGAQPGAQAGQTGDGFDDALAARLPLPQGGRDAP
FT                   AQRPAPAPGRPAGGADEGAMASGRAPANAAALARSVDAYAALADADGKPVGALAAHAAL
FT                   ARPGMPQAGADAPASVAASLHAATLPIVRQQLDLLATDQFRWIGEAWPGARLDWTIEPD
FT                   EQQGRERPAPDADFPEARGWRTRLTLALPSLGTVDAELVLNGEQLAARLRVSGTGAARL
FT                   APHGEALRARLQALGLQVSGLSIRAIDGVPDGFGAVAARAAASAYAREAAGGEGGAAAV
FT                   SRAAAVSRAAGADGDAGAASAGVSAGAERRVPPAPPPVETDDDWELAR"
FT   gene            238542..238868
FT                   /locus_tag="BTH_I0205"
FT   CDS_pept        238542..238868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0205"
FT                   /product="flagellar biosynthetic protein FlhB domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38762"
FT                   /db_xref="GOA:Q2T236"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T236"
FT                   /protein_id="ABC38762.1"
FT                   /translation="MSGRQRKRAAVLAYDAKGGDSAPRVVAKGYGLVAERIIERARDAG
FT                   LYVHTAPEMVSLLMQVDLDARIPPQLYQAVAELLAWLYALESGAGGDGGGAQPAFPPLP
FT                   TRPR"
FT   gene            239376..240122
FT                   /locus_tag="BTH_I0206"
FT   CDS_pept        239376..240122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0206"
FT                   /product="PepSY-associated TM helix family"
FT                   /note="identified by match to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38787"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T235"
FT                   /protein_id="ABC38787.1"
FT                   /translation="MFCANGSRSVNAPESIEKHSGVVLPYPGPPRKLDESELAERRRRS
FT                   RRATFIKWLRKVHGWIGLWGAVLGLLFGVTGVLLNHRAPPLKISSGEPQVSQIQLALPS
FT                   PAPATPHAMAAWLRRELAFDGRLGRVRKDSAQPVAWGDRRVEQPEHWQFGLFGPSRNVQ
FT                   VEYWKGNGYVSVKRTDNAFLTTLNNLHRGVGMNLFWVLLMDTIAGSMVLLSLTGVLLWT
FT                   ELNKRRTVGVILVAGSVAAALAAGLT"
FT   gene            complement(240190..241551)
FT                   /locus_tag="BTH_I0207"
FT   CDS_pept        complement(240190..241551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0207"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM PF02625"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38055"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T234"
FT                   /protein_id="ABC38055.1"
FT                   /translation="MPVPDAEPAARHVDRVPDVARDRPLRVLRLLAQPLEACARRAAAL
FT                   TRRFTRCAPRAGRIARERAFRSRRNAPGFRERFFSRASAPARFHRTRHNRAIERPALPP
FT                   AGKPQGRIMESVDLEVLRTSARWLDEGRRALLVTVVRTWGSSPRPEGAMLAVRDDGLVV
FT                   GSVSGGCIEDDLIARVQASGVSSGTRPEAVKYGVTAEEAHRFGLPCGGTIELVLEPLAP
FT                   ASGIAALCEAVEHGRLVTRTLELATGEATLAPAIATDGLHFDGARLVTIHGPRYRMLVI
FT                   GAGQLSRYLCQIAAGLDYQVTVCDPREEYTDAWDVPGTRVVRTMPDDTVLDMRLDRRSA
FT                   VIALTHDPKLDDLALMEALKTPAFYVGALGSRRNSQARRERLREFDLSAAELARLHGPA
FT                   GIYIGSRTPPEIAVSILAEVTAAKNGVSLPTILQVEGAKAAREIEANSGVACGI"
FT   gene            complement(241416..242819)
FT                   /locus_tag="BTH_I0208"
FT   CDS_pept        complement(241416..242819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0208"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37075"
FT                   /db_xref="GOA:Q2T233"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T233"
FT                   /protein_id="ABC37075.1"
FT                   /translation="MSLFRKKNVDRMIAGAHAAGLKKALGAVDLTFLGIGAIIGTGIFV
FT                   LTGTGAVQAGPALMLSFVIAAIACGLAALSYAEFASTIPVAGSIYTYSYATLGELVAWI
FT                   IGWDLMLEYGLAASAVSVGWSGYLQSLLQGFGVSLPAALTAAPGALPGVVTYFNLPAFL
FT                   VMLVITTLLSIGIRESTRVNNIMVFIKVAVVLLVIAVGIFHVTPANWKPFMPHGWNGVF
FT                   GAAAVMFFAFIGFDAVSSAAEEVKNPKRDLPVGIIASLGVCAFLYVAVAAIATGIVPWA
FT                   QYANVSHPISYALQVAGEKWVAGFIDLGAVIGMLTVILVMSYGQTRIIFAMSRDGLLPA
FT                   ALSRVHPRFATPFLTTWLVGLFFGLIAALIPLNVLAELINIGTLAAFSMVSIAVLVLRR
FT                   THPDLPRAFRCPGVPFVPILAVAACLFLMLNLQPVTWIAFLTWLVIGLFVYFAYSRSRS
FT                   KLAHGAQQH"
FT   gene            complement(243053..243709)
FT                   /locus_tag="BTH_I0209"
FT   CDS_pept        complement(243053..243709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0209"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39197"
FT                   /db_xref="GOA:Q2T232"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T232"
FT                   /protein_id="ABC39197.1"
FT                   /translation="MSLQILLVDDHAIVRQGIRQLLIDRGIAREVVEAECGGEALAIVE
FT                   KGEFDVVLLDISLPDMNGIEVLKRLKRRLPRTPVLMFSMYREDQFAVRALKAGAAGYLS
FT                   KTVNAAQMVSAISQVAAGRKYVSPAMAEALAEYVSFENEPLPHEKLSDREYQTLCMIAS
FT                   GKRLTDIAHALSLSVKTVSVYRTRLLEKMKLSNNAELTFYVMSNRLVDMNPAIGA"
FT   gene            complement(243706..244548)
FT                   /locus_tag="BTH_I0210"
FT   CDS_pept        complement(243706..244548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0210"
FT                   /product="sensor kinase protein"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39199"
FT                   /db_xref="GOA:Q2T231"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T231"
FT                   /protein_id="ABC39199.1"
FT                   /translation="MDTPSIAPSTASVPASSSSDLASEVGIPFVSRSAPRAPTAERLGA
FT                   RVAQLSAELVAADESARRHLAGELHDGLGADLTAARFALANVDTWLPDDAADACRRALA
FT                   LAQQALDAATAANRRLIDGLCTPALEAGLVGTLAAWIGAHGARTGLRTSFVCAADARVT
FT                   QLSADGALAVFRVAQEALANVAKHAHASAADVRIDVDDTHLTLVVADDGVGIATTRRRG
FT                   GYGLGSMRARCEALGGTLEFASPRSGGAGTALRARFAWGALVAARTPAAARRVRKEAR"
FT   gene            complement(244962..245777)
FT                   /locus_tag="BTH_I0211"
FT   CDS_pept        complement(244962..245777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0211"
FT                   /product="ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38486"
FT                   /db_xref="GOA:Q2T230"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="PDB:4F7D"
FT                   /db_xref="PDB:4FK8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T230"
FT                   /protein_id="ABC38486.1"
FT                   /translation="MGPLWGPLYAPVSESMSKFDTATVLSVHHWTDTLFSFTCTRDQAL
FT                   RFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPV
FT                   LIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKG
FT                   ELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVTREEFENEGRITDLIASGKLFTDLDMP
FT                   PFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFVD"
FT   gene            complement(245947..246246)
FT                   /locus_tag="BTH_I0212"
FT   CDS_pept        complement(245947..246246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0212"
FT                   /product="threonine efflux protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36950"
FT                   /db_xref="GOA:Q2T229"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T229"
FT                   /protein_id="ABC36950.1"
FT                   /translation="MRDYLRAYRTGLFTCLTNPKSCAFWTSVFAAMMPAHVPLWFNGAT
FT                   LLAIGAMSGGWYCGVAYLFANPRARRGYRRVRRPLDALCGTALVGLGAKLAADR"
FT   gene            complement(246319..247011)
FT                   /locus_tag="BTH_I0213"
FT   CDS_pept        complement(246319..247011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36458"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T228"
FT                   /protein_id="ABC36458.1"
FT                   /translation="MRNWVESTHADIYFLQEAMARRMPRPVLASGFGTPMTEPADDIWH
FT                   CQATEIAHALDWQIALGPNVFKPSWRHGNAILSPHPLDLGGRWDISAHRFERRGLLVAR
FT                   ATLGGGAPVTLLCAHLALTRAARLRQMHWIAHWIERNAGAGPLVLAGDFNDWRNDSIPL
FT                   FGEIGLSEVATLLGESGRTFPAFSPALALDKMFVRGMTPLEWRAPGDETAWLSDHLPYV
FT                   ARLRLDTP"
FT   gene            complement(247138..247746)
FT                   /locus_tag="BTH_I0214"
FT   CDS_pept        complement(247138..247746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37819"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T227"
FT                   /protein_id="ABC37819.1"
FT                   /translation="MNRAKTRAVGSSMISFKRKMSACPARRLARAGKFVLEACAAGALA
FT                   GAALVAHAQSGPQPVIDWEIQVVRDGQTIDSFEQKTTVGQARTDTHSFPVAPAAGCAAT
FT                   GASAASADAPGSVPSRTITVAPLYVEDGAVALAIDAQETFADEGAAPSAGAPCTFPPPR
FT                   RIVASHPGLAARAAQWTDWTLAERKPQLVYRVRARVVED"
FT   gene            247787..247978
FT                   /locus_tag="BTH_I0215"
FT   CDS_pept        247787..247978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0215"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T226"
FT                   /protein_id="ABC37866.1"
FT                   /translation="MRDARIFQASGDATNRRADGASGECIGVARGAQALRTADGGAMRD
FT                   VNTRSYARRVPRAASRAC"
FT   gene            248079..249059
FT                   /locus_tag="BTH_I0216"
FT   CDS_pept        248079..249059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0216"
FT                   /product="ATP-dependent protease domain protein"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36933"
FT                   /db_xref="GOA:Q2T225"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T225"
FT                   /protein_id="ABC36933.1"
FT                   /translation="MTTAMVKQELAVASFSTVYDIERVETALGDLNEGASDALRATYEK
FT                   MLKTGNLRFCVKPTRMPAFDSLAEELPNFAEPLDDVRKQVALCLETDDRLELMPILLLG
FT                   EPGIGKTHFAKALAKMLGTAYHYVPMSSLTAGWVLSGASSQWKNAKPGKVFDALVNGCY
FT                   SNPVIAIDEIDKAGSDAQYDPLGALYALLEHDTACAFVDEFAEVPIDAGNVIWIATAND
FT                   ASAIPEPIMNRMNVYEIEPPDASGARRIAQTIYGEIRNAHAWGQRFPGALGDDALDVLA
FT                   AMPPRTMRRVLLHAFGAARLDGRDAIAPRDIRTDESAGRRRPIGF"
FT   gene            249129..250250
FT                   /locus_tag="BTH_I0217"
FT   CDS_pept        249129..250250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0217"
FT                   /product="oxidoreductase, FAD-binding family protein"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38951"
FT                   /db_xref="GOA:Q2T224"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T224"
FT                   /protein_id="ABC38951.1"
FT                   /translation="MTMERIDCVVIGAGVVGLAIARELAARGRETLILEAADAIGTGTS
FT                   SRNSEVIHAGLYYPRGSLKASLCVHGRDLLYDFCDTHQVPHRRCGKLVVATSPAQAKQL
FT                   KAIAARAEENGVLDLLTLSRDEVQALEPELECLEALFSPSTGIVDSHQLMLALLGDAER
FT                   DGASCALRSPVDSIDAAGGRFVVRTGGDAPTAIEAACVINSAGLGAQALAKRIRGLDSR
FT                   WVPPLYLARGNYFGLSGRAPFAHLVYPVPDRAGLGVHLTLDLAGGARFGPDVEWIDALR
FT                   YDVDPRRADSFYASIRAYWPGLPDGSLQPAYAGIRPKVCGPGEPAADFVIQGAAQHGVR
FT                   GLVNLFGIESPGLTAALAIAQRVGEMAARTPHA"
FT   gene            250256..250699
FT                   /locus_tag="BTH_I0218"
FT   CDS_pept        250256..250699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0218"
FT                   /product="high potential iron-sulfur protein, putative"
FT                   /note="identified by match to protein family HMM PF01355"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38012"
FT                   /db_xref="GOA:Q2T223"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T223"
FT                   /protein_id="ABC38012.1"
FT                   /translation="MEISCFRSAYLRNFRRHIGAHERYACALLPLEQRQPTMLERIPMK
FT                   TSRRSFLITSVGAVSALALTREAFSADLPMLSETDPTAVALGYKADATKVDKAKFPKYA
FT                   AGEICSGCMLYQGKKGSASGPCGAFPGKQVSAKGWCNAFTKMA"
FT   gene            250931..252223
FT                   /locus_tag="BTH_I0219"
FT   CDS_pept        250931..252223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0219"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37133"
FT                   /db_xref="GOA:Q2T222"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T222"
FT                   /protein_id="ABC37133.1"
FT                   /translation="MASIAASTKTAGHALNRRAVAAAVIGNALEWYDFTVFSFMTVVIA
FT                   QLFFPTSNEYSSLLLTTATFGVAFFMRPIGGIVLGLYADRAGRKAALSLVILLMTLGIF
FT                   LIAVAPPYAAIGIGGPLLIVLGRLLQGFSAGGEFGSATALLIEAAPFSRRGYYGSWQMA
FT                   SQAAALLFGSLVGAAVTRGLSTEALHAWGWRVPFLIGLVIGPVGFYVRRHLVDSEAFLQ
FT                   ARERGERVTLREVFARHGRAVVCGLGAVIALTVTVYVLISYLPTFAVKQLKLPYGQSFY
FT                   AVIIGNLLLTALSPVAGAWSDRIGRKGLSLWALGFTLALIYPLFEWLDASPSIARLIVV
FT                   QAVLSVTLAGYYGPFGAMIAELFPANVRSTGLSLAYNVAVMVFGGFGQFIVTWLIKTTG
FT                   TPLAPTYYVMAGLALSLVALAFVPARSGDLD"
FT   gene            252601..254229
FT                   /locus_tag="BTH_I0220"
FT   CDS_pept        252601..254229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0220"
FT                   /product="dipeptide ABC transporter, periplasmic
FT                   didpeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39128"
FT                   /db_xref="GOA:Q2T221"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T221"
FT                   /protein_id="ABC39128.1"
FT                   /translation="MEHNRLLRALRVTAIAGVAAASFGVAGSAFAQIPNKTLVYCSEGS
FT                   PAGFDSAQFTTGVDFTASTFPIYNRLVEFERGGTKVEPGLAEKWDISPDGKVYTFHLRH
FT                   GVKFHTTDFFKPTREFNADDVAFTFERMIDPNQPFRKAYPVSFPYFTDMGLDKLIVKIE
FT                   KVDPYTVRFTLKEPNAPFIQNLAMEYASILSAEYADQLMKAGKAADINQKPIGTGPFIF
FT                   RSYTKDATIRFDGNPDYWKKGAVKISKLIFSITPDPGVRVQKIKRNECQVMSYPRPADI
FT                   ATLKADPNVDMPSLPGFNLGYLAYNVQHKPVDKLEVRQALDMAINKKAILESVYQGAGQ
FT                   AASAPMPPTQWSYDKNLKAAAYDPAKAKALLAKAGYPNGFPITLWAMPVQRPYNPNAKL
FT                   MAEMIQADWAKIGVQAKIVTYEWGEYIKRAHAGEHDTMLIGWNGDNGDPDNWLGTLLGC
FT                   EAVKGNNFSEWCYKPFDELIQKGRVTTSQDARAKIYMQAQQIFAQQLPFSPIANSTVYQ
FT                   PVRKNVVDMRIEPLGYARFDGVSVK"
FT   gene            254341..255351
FT                   /locus_tag="BTH_I0221"
FT   CDS_pept        254341..255351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0221"
FT                   /product="dipeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38218"
FT                   /db_xref="GOA:Q2T220"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T220"
FT                   /protein_id="ABC38218.1"
FT                   /translation="MFRFVLRRVGMVIPTFIGITVLAFALIHLIPGDPIEVMMGERGVD
FT                   PAMHAEALHRLGLDEPLPMQYLHYVGRALHGDLGTSIITNTSVMGEFLARFPATVELSI
FT                   CALAFALAFGLPAGVFAALRRGTIVDHGVMGTALTGYSMPIFWWGLILIMVFSSYLGWT
FT                   PVSGRIAVEYEIPHTTGFMLIDTLLSGEEGAFASAVSHLILPAIVLGTIPLAVIARMTR
FT                   SSMLEVLREDYIRTARAKGLSPARVVVVHALRNALIPVVTVIGLQVGTLLAGAVLTETL
FT                   FSWPGVGKWLIDAIGRRDYPVVQGGILMIATLVIVVNLVVDLLYGVLNPRIRHTR"
FT   gene            255450..256367
FT                   /locus_tag="BTH_I0222"
FT   CDS_pept        255450..256367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0222"
FT                   /product="dipeptide transport system permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36854"
FT                   /db_xref="GOA:Q2T219"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T219"
FT                   /protein_id="ABC36854.1"
FT                   /translation="MSNMQNTMPSQAAPVSGRVLALREFWANFSRNRGAVGAGVVVLVL
FT                   VAVALFAPLLAPHSPIEQYRDSVKIPPAWLAGGNWQFVLGTDEAGRDILSRLMYGARMS
FT                   FWIGFVSVVLALIPGVVLGLVAAFFQKWADTPVMRVMDVLLALPSLLLAVAVVAIIGPG
FT                   LTNTMFAIAIVALPAYVRLTRASALGELQKEYVTASRVAGAGTLRLMFSQVLPNCTAPL
FT                   IVQATLGFSSAILDAAALGFLGLGVQPPTAEWGAMLASARDYIDNAWWIVTMPGLSILI
FT                   SVLAINLLGDGLRDALDPKLKRMA"
FT   gene            256369..257361
FT                   /locus_tag="BTH_I0223"
FT   CDS_pept        256369..257361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0223"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39139"
FT                   /db_xref="GOA:Q2T218"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T218"
FT                   /protein_id="ABC39139.1"
FT                   /translation="MSDLLTIRNLAVNFNGLPAVDRINLSVARGEVVGVVGESGSGKSV
FT                   TMMALMGLIDAPGIVTADEVTFDGVDLLKASPKARRRIIGKDIAMVFQDALTSLNPSYT
FT                   VGYQIKEVLKLHEGLRGDALNRRALELLDQVGIPDAKNRIGTFPHQMSGGMNQRVMIAM
FT                   AVACNPKLLIADEPTTALDVTIQAQIMDLLVTLQKERGMALVLISHDLAVVSEVAQRVA
FT                   VMYAGEIIETNRVPDIFAHPHHPYTEALLAAIPEHNAGAKRLAALPGMVPGRDDRPSGC
FT                   LFAPRCKYVVDDCVKARPALAELAPGTGMRARCIKPLNLQAAYTQGGAR"
FT   gene            257358..258374
FT                   /locus_tag="BTH_I0224"
FT   CDS_pept        257358..258374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0224"
FT                   /product="dipeptide ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38678"
FT                   /db_xref="GOA:Q2T217"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T217"
FT                   /protein_id="ABC38678.1"
FT                   /translation="MNAVHETREAAARDDIVLVADNLAKHYTVRRGMFGHGTVKALNGV
FT                   SFSLARGKTLAVVGESGCGKSTLARQLTMIEPPSSGHLSIDGRDVAGADRETVAALRRR
FT                   VQMVFQNPFASLNPRKTVEQTLAEPLAINTHLTAAERAQRIAQIMHTVGLRPEHAKRYP
FT                   HMFSGGQRQRVAIARAMILDPQIVVADEPVSALDVSIQAQILNLFMDLQEQFKTSYVFI
FT                   SHNLSVVEHIADDVMVMYFGSVAELGDKKTIYARPRHPYTRALMSATPAIFEADRKIQI
FT                   KLQGELPSPLNPPSGCAFHQRCPYAVERCRAEEPKLRDVDGRLVACHRAEEVGEANA"
FT   gene            258379..259515
FT                   /locus_tag="BTH_I0225"
FT   CDS_pept        258379..259515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0225"
FT                   /product="GumN family protein"
FT                   /note="identified by match to protein family HMM PF07446"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37226"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T216"
FT                   /protein_id="ABC37226.1"
FT                   /translation="MAAREAARRSRNGVRRAATHAGRTPRRWRARALASAVLAGACAAG
FT                   GLAWPPVGALAAGSVATAPLPQAPIPAPSMQLPGFHAPPPSTSNGTVASGAVRTQPARM
FT                   PFYVATKGKVTIYVLGTLHVGDPADYPANQPFRRPILAALAVSPTLALELSPDDLLESQ
FT                   DDVSKYGVCNYACLPRLLPRPLWQKLANRLRGNPAALAGIRNMRPWLASLVVETYDSLS
FT                   AGLQTEYGTEAQLQNVFLRKKGGKVVGLETLAEQMRAFTGLSLAQQREMLAQDMVQTPA
FT                   QNAADVRTLHRLWRIGDADAIAAWANAKTERLARAQSIAESIDNKIVYERNRRFVARMT
FT                   AIAAPNRPLFVAIGALHLGGPKGVLELLRQQGYRVDAG"
FT   gene            complement(259988..260944)
FT                   /locus_tag="BTH_I0226"
FT   CDS_pept        complement(259988..260944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0226"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06166"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36331"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T215"
FT                   /protein_id="ABC36331.1"
FT                   /translation="MTLTIDYLFWLVGLVLLAVGATIVTDRAHPRRFTAGGFWLLYALV
FT                   FLVGDKLPVELVGAIVIAMALIAGFGGVTAARPKLPSDDARRASAARIGNRLFAPALTI
FT                   PFVTVAITLAASHLHIGGAPLVDPKNVTLIGFGIGCVIALGLACWITRDSVGQSLQEAR
FT                   RLVDALSWAAVLPQMLGMLGLVFSDAGVGKAVAHVTTAYVNLDYRLAAVAVYCIGMALF
FT                   TMVMGNGFAAFPVMTGGVGVPILVNVFHGDPAVMVAIGMFSGYCGTLMTPMAANFNVVP
FT                   AALLELPDKNGVIKAQIPTALALLATNIVLLNLLMFR"
FT   gene            complement(260941..261684)
FT                   /locus_tag="BTH_I0227"
FT   CDS_pept        complement(260941..261684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0227"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06149"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38464"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T214"
FT                   /protein_id="ABC38464.1"
FT                   /translation="MQGTVVSLWPLIGVAVIVVGFALRFNPMLIVATAAIVTAASAHFP
FT                   PERILAAIGAGFIKTRNIPLIILLPLAVIGLLERHGLRERAQAWIASIRAATAGRLLIL
FT                   YLLVRELTAAVGLTGLGGHPQMVRPLIAPMAEGATENRFGPLPDAIRHRLRAYAAATDN
FT                   VGLFFGEDIFVAFGAIVLMVTFLKEAGIAVEPMHVALWGIPTAASAFLIHGFRLWRLDR
FT                   KLERELRASAASHIAANAADNGGHA"
FT   gene            complement(262145..262909)
FT                   /locus_tag="BTH_I0228"
FT   CDS_pept        complement(262145..262909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0228"
FT                   /product="LamB/YcsF family protein"
FT                   /note="identified by match to protein family HMM PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39152"
FT                   /db_xref="GOA:Q2T213"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T213"
FT                   /protein_id="ABC39152.1"
FT                   /translation="MEIDLNADLGEGCGSDEALLDLVTSANIACGWHAGGAPAMRDCVR
FT                   WAVEKGVSIGAHPSFHDPENFGRKEMDLPASEIYAGVLYQLGALSAIAQAEGGRIAHVK
FT                   PHGALYNQAARDAEIADAVVSAIHDFDPSLAVFGLASSGFVDAARHAGLVAVEEVFADR
FT                   GYRADGSLVPRSQPGALVDDEREMLARTLEMVRGQRVRAVTGEWVPLNAQTVCLHGDGP
FT                   HALAFAKRIREALEAAGIDVHAPGALHAGERA"
FT   gene            complement(262965..264044)
FT                   /locus_tag="BTH_I0229"
FT   CDS_pept        complement(262965..264044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0229"
FT                   /product="urea amidolyase-related protein"
FT                   /note="identified by match to protein family HMM PF02626;
FT                   match to protein family HMM TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37035"
FT                   /db_xref="GOA:Q2T212"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T212"
FT                   /protein_id="ABC37035.1"
FT                   /translation="MTSRQATGGIEVLRAGPLSTVQDLGRRGYRHLGVAQSGALDSLAL
FT                   EVGNRLVGNRPDAAAIEITLGPASFRFPRATRIAITGTEFGATLDGAPIYSWWSVPVAA
FT                   GQTLALPVAKRGMRGYLCVAGGIDVLPMLGSRSTDLASRFGGLGGRVLRDGDRLPVGAP
FT                   PAAAPACVGPDAPEFGVKAPAWCAFARVDKEPRRPKHAHAAWAMPVRVLPGPQYASFTP
FT                   ASQQTFWDEEWVVTPNSNRMGYRLAGAKLERAETGDLLSHAVLPGTIQVPGNGQPIVLM
FT                   NDAQTTGGYPRIGAVIRADLWKLAQARLNLPVRFVRVTAAAARDALAAERAYLRQIDIA
FT                   IEMREEALQRALAARAAAA"
FT   gene            complement(264041..264820)
FT                   /locus_tag="BTH_I0230"
FT   CDS_pept        complement(264041..264820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0230"
FT                   /product="conserved hypothetical protein TIGR00370,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF02682;
FT                   match to protein family HMM TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37779"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T211"
FT                   /protein_id="ABC37779.1"
FT                   /translation="MRESVRQSRPHDVRRIFLTRSYRHFIDNVFFTRLNAVCLPPMTTP
FT                   RIYPLGDTALVCESPPPATLECQRRVWAVASAAAGWPHVVDVVPGMNNLTIVFDPLETT
FT                   ADTLAPLMKAAWRDADGVAESGREIEIPVEYGGAFGPDLDAVAKHTGLARDEVVRRHSA
FT                   GTYVVFFLGFQPGFTYMGGLDGSLHTPRRAAPRLEVPAGSVGIGGEQTGIYPAAAPGGW
FT                   QLIGRTPLALFDPARTPPTLLQPGDRVRFTVAGVHTG"
FT   gene            264847..265359
FT                   /locus_tag="BTH_I0231"
FT   CDS_pept        264847..265359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38040"
FT                   /db_xref="GOA:Q2T210"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T210"
FT                   /protein_id="ABC38040.1"
FT                   /translation="MPRHPTKIVSSEHLVSETSAELSELEYALIMAGNAFNRWMVRCMA
FT                   AAGAKDMTAVEVSLLHHVSHRDRKKKLADICFVLNIEDTHVATYALKKLVARGYVKSEK
FT                   TGKEVFFDATDAGRALCLKYRDVRERCLIETLKDSGLTNEQIGDAAQLLRHASGLYDTA
FT                   ARAAASL"
FT   gene            complement(265424..266020)
FT                   /locus_tag="BTH_I0232"
FT   CDS_pept        complement(265424..266020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0232"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01812"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36837"
FT                   /db_xref="GOA:Q2T209"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T209"
FT                   /protein_id="ABC36837.1"
FT                   /translation="MSESIARAQAPNPKQTLRETLAQRRLDAHRSPLAHEALAQRVLAI
FT                   LAQCAPRTVGFYWPLPGEFDARDAIASWLAGDASRQAALPVIGAPRTPLEFHAWTPDAP
FT                   MREGRHRIAEPAAGARLVPDLLLIPCVGFDHGCFRLGYGGGYYDRTLAAWPGAAPPATV
FT                   GVAYDACGVRELPREAHDLPLDWIVTETRLYRSGD"
FT   gene            266042..267997
FT                   /locus_tag="BTH_I0233"
FT   CDS_pept        266042..267997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0233"
FT                   /product="lytic murein transglycosylase, putative"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38105"
FT                   /db_xref="GOA:Q2T208"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T208"
FT                   /protein_id="ABC38105.1"
FT                   /translation="MSTSLFRVYRAVAAPLVAVVLAAGTAACAAQTADEMSSNDDRVFV
FT                   QLREAARKNDPVRAAQLAAMIPNYPAPSYLEYFQIKPQLFDSAGHARLDAPDAPVLSFL
FT                   SRYDGQAIADRMRNDYLLVLGARHDWRNFDDQYKRFVLDDDTQVKCYALESRAARGENV
FT                   ADMARELLVEPKYYGDACVDLITALATNKQFSSDDVWAQVRLAYEQNYTTLGGKIADAL
FT                   GPRPVGLDQVTSAPPLFLARGVGSDATSRQLALVAITRMARNDPEAAAGQLTSLASTLS
FT                   ANEQAIGWGEIGYQAAVKRMPQAASWYRKSMGAPLSNPAYEWRVRAALLAGDWAMVRRS
FT                   IEQMPERLRDDTTWIYWRGRALKEGGDTLKANQEFERIAGQFNFYGQLAGEELGQKTTV
FT                   PPRTKVTDAEIDAMSKVPGFALAQRFYALNLRLEGNREWNWPLRGMTDRQLLAAAEYGK
FT                   RVDLLDRTVNTADRTTAEHDFSLRYPSPYRDIVERYARTNGLDVEWAYGLIRQESRFIT
FT                   NARSSVGAGGLMQLMPATAQLVAKKLGLGTVTRAQMHDIDTNVQLGTWYLSDIYQKFDD
FT                   SAVLATAGYNAGPGRPAQWRQVLARPVEGAIFAETIPFNETREYVKNVLSNETYYAALF
FT                   EKKPQSLKARLGFIAP"
FT   gene            268117..269076
FT                   /locus_tag="BTH_I0234"
FT   CDS_pept        268117..269076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0234"
FT                   /product="NADH-ubiquinone oxidoreductase, putative"
FT                   /note="identified by match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38826"
FT                   /db_xref="GOA:Q2T207"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T207"
FT                   /protein_id="ABC38826.1"
FT                   /translation="MQGQTIAMLGGTGFIGSRLVNALVDAGAHVRIGARRRDHARHLAT
FT                   LPVDIVELTAFDVRELARFVAGAHAAVNLVGVLHGGRGKRYGEGFERLHVALPAALAAA
FT                   CIEARVPRMLHVSALGADPNAPSMYLRSKGDGEAALHAQAAAGVLDVTVFRPSIVFGPG
FT                   DAFLNTFARLQRIFPVLPLAMPDALMQPIYVGDVAQAIANACARDATRGRTYELGGPRT
FT                   YRLEEIVRYAGRLVGRPARIVRLPDALARLQACVFEMLPGEPLITRDNLASLSVPSVMT
FT                   GPIAPELGITPASLESIAPTYIGDAALRSRFSDWRARR"
FT   gene            269084..269788
FT                   /locus_tag="BTH_I0235"
FT   CDS_pept        269084..269788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0235"
FT                   /product="glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36799"
FT                   /db_xref="GOA:Q2T206"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T206"
FT                   /protein_id="ABC36799.1"
FT                   /translation="MRPRPPRVDRTIDNYRMNPMKLVIGDKNYSSWSMRPWVLMKHFGI
FT                   PFDEVMIGLRLDDTAQRILAHSPSGKVPCLVDDDGGAVWDSLAIVETLAERFAQHALWP
FT                   RDPAARAHARSVSAEMHAGFPALRSEMPLNVRESHPGRGATPAALADVARIDELWRTCL
FT                   AASGGPFLFGEFSIADAMYAPVVLRFKTYAPPLSPEASAYAARVAELPAVREWVEGARG
FT                   ETRVIDIYGPSR"
FT   gene            269728..271026
FT                   /locus_tag="BTH_I0236"
FT   CDS_pept        269728..271026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0236"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37823"
FT                   /db_xref="GOA:Q2T205"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T205"
FT                   /protein_id="ABC37823.1"
FT                   /translation="MGRGRARRDPRDRHLRAVAMKIYAVGGAIRDALLGLPVRDRDYVV
FT                   VGATPERMAAQGFKPVGKDFPVFLHPDTREEYALARTERKTAAGYHGFQFYYAPDVTLE
FT                   QDLVRRDLTINAMAREVSPDGALVGPVVDPFGGQADLRAKLFRHVGGAFVEDPVRVLRV
FT                   ARFAARFADFAVAPETSALMREMVDAGEVDALVPERVWQELARGLMEAKPSRMFAVLRE
FT                   CGALVRILPEIDALFGVPQRADYHPEVDTGVHVMMVIDHAAKQGYSLPVRFAALTHDLG
FT                   KATTPADALPRHIGHEGRSVDLLKPLCERLRVPNECRDLALVVAREHGNLHRVMGMGAA
FT                   ALVRLFERADALRKPARFAEALQASEADARGRLGLETTSYPQAERLRQALVAARSVDAG
FT                   AIAQGLAGEPAKIKDAVHRARVRAVAQATGVAE"
FT   gene            complement(271136..271576)
FT                   /locus_tag="BTH_I0237"
FT   CDS_pept        complement(271136..271576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0237"
FT                   /product="flagella synthesis protein FlgN, putative"
FT                   /note="identified by match to protein family HMM PF05130"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38347"
FT                   /db_xref="GOA:Q2T204"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T204"
FT                   /protein_id="ABC38347.1"
FT                   /translation="MRDELLATVNDEHATVEAFASLLAYEEKALTTASPLDALPGIVDR
FT                   KTALLEKLAQLERRRDTLLASLGLPAGKKGMDLAAEHDARLANGWQLLQQSADRARHAN
FT                   AINGMLIRIRMDYNERTLSVLRAAPQRNGFYGPDGRVAATAR"
FT   gene            complement(271656..272000)
FT                   /locus_tag="BTH_I0238"
FT   CDS_pept        complement(271656..272000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0238"
FT                   /product="negative regulator of flagellin synthesis FlgM,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39224"
FT                   /db_xref="GOA:Q2T203"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T203"
FT                   /protein_id="ABC39224.1"
FT                   /translation="MKVDSTTTSNARTLTNASAGAARTQAGQPAAAQAPAGAAGAPTGG
FT                   DANVSLSGLSSTLRSLAASGSADIDTAQVDAIRDAIKNGTLSIDTGKIADGILQTARDL
FT                   LKPPPQAGNS"
FT   gene            complement(272104..273720)
FT                   /locus_tag="BTH_I0239"
FT   CDS_pept        complement(272104..273720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0239"
FT                   /product="FlgA family protein"
FT                   /note="identified by match to protein family HMM PF03240"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36549"
FT                   /db_xref="GOA:Q2T202"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T202"
FT                   /protein_id="ABC36549.1"
FT                   /translation="MTTDASRATRMRFAVALALASGMCAALAQQADDTGMIVIPGRGES
FT                   AQTALANANAASARGANAAGAAGPNGAGHAASPSGWNAAAAAQAAAEWAGRAGATPGAE
FT                   SGEPGGVHAMNEPGNGLIVIEPRPAESNSRMAAAAPNGWSRPATSAMPRTGPNGNANPA
FT                   ASTAGSYFPASPASARAGWNAPAGATASVAANPNNPMTPVATGVNPEFRAGAASHAPAR
FT                   APAWVPARVPADARRVAMVVAQDAPPPAGQPANTRAAAQSWQAARMQGATTAQGGVIPV
FT                   SFRSQPAPRMLPPRPEPIRAAAATASASGAPPAAATAAATGAAAAPPPPAGQQDGESIR
FT                   RAALAFLQQQAAGLPGKTTITVAPAFPRGLAACTTLEPFLPSGARLWGRTTVGVRCAGA
FT                   RPWTIYLQAKLAVQATYYVAARQIAPGETLTAADLVARDGDLTMLPLAVITDAQQAVGA
FT                   TALTRVAAGLPLRQDLLKSAASVSIGQTVRVVASGHGFTISTEGSVLNNAAPGQQVRVR
FT                   MAAGQIVTAIVKDAATVEIPL"
FT   gene            273979..274470
FT                   /gene="flgB-1"
FT                   /locus_tag="BTH_I0240"
FT   CDS_pept        273979..274470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB-1"
FT                   /locus_tag="BTH_I0240"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM TIGR01396"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37466"
FT                   /db_xref="GOA:Q2T201"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T201"
FT                   /protein_id="ABC37466.1"
FT                   /translation="MLDKLDAEFAFGRQALDVRAYRQELLSSNIANADTPGYRARDVDF
FT                   SSTLARALKQDGAASAGNAAALPLAQPAGVTSGMSMATTSGAHLAGNVKLTPTGGPSDD
FT                   YGRAQYRIPQQPALDGNTVDLDTERVQFADNAVHFQAGMTVLTQQIKTMIAAITSNSGS
FT                   "
FT   gene            274554..274979
FT                   /gene="flgC-1"
FT                   /locus_tag="BTH_I0241"
FT   CDS_pept        274554..274979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC-1"
FT                   /locus_tag="BTH_I0241"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37945"
FT                   /db_xref="GOA:Q2T200"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T200"
FT                   /protein_id="ABC37945.1"
FT                   /translation="MPSLMNIFDVAGSAMSAQSQRLNVTASNLANADSVTGPDGKPYKA
FT                   KQVVFATAPMGGARTASGQGVGGVQVTKVIDDPSPMKTTYDPSNPAADQNGYVTMPNVD
FT                   PVQEMVNMISASRSYQANVETLNTAKQLMLKTLTIGS"
FT   gene            275033..275869
FT                   /locus_tag="BTH_I0242"
FT   CDS_pept        275033..275869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0242"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /note="identified by match to protein family HMM PF03963"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38026"
FT                   /db_xref="GOA:Q2T1Z9"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z9"
FT                   /protein_id="ABC38026.1"
FT                   /translation="MTSSFTTIGGSGTTVNSLPYDTMSSNGQSSSPSGTSNTPGGTAGA
FT                   SGASSGINVASSLSTTSAADLQTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSG
FT                   IAQLNTALTSLSSQLTAGQQTQAAMLIGSNVLAPGNTVPVKGGAASPFGVQLTSAVSNL
FT                   TITVKNASGAVVNTINAGAQAAGTVPFNWTPTDAAGNTLPDGTYSISASYTDTSGKQYA
FT                   PTTLSSAQVLSVIKQADGTPGLVLSNGATVGFSQVASIFPNTTKSASTGSASSSTN"
FT   gene            275896..277137
FT                   /locus_tag="BTH_I0243"
FT   CDS_pept        275896..277137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0243"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM PF07559"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37299"
FT                   /db_xref="GOA:Q2T1Z8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z8"
FT                   /protein_id="ABC37299.1"
FT                   /translation="MGYQQGLSGLAGASSDLDVIGNNIANANTVGFKGSTAQFSDMYAN
FT                   SVASAVNNPIGIGTMLASVQQQFSQGTITSSTSSLNVAINGNGFFQMSNNGVLTYSRDG
FT                   TFQRDKNGYIVNSQGLNLMGYQADKNGVINPAQTVPLQAPTNNIAPTATTKITGQFNLN
FT                   SQDTVPTNTPFNYTDSTTYNFQTAVQVYDSLGGSQQVNMYFVKSAAGTWEAYAGVKNQT
FT                   PTDLGTVTFDTSGAIKSTTLPGSTTPTTTLGQFQFSIPNTDGSATPQALKLDLTGTTQY
FT                   GGKDGVTNLAQDGFASGTLTTFSIGNDGKVTGNYSNGQTATLGQIVLANFNNPNGLVNV
FT                   GNNQYVETAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQANAQT
FT                   IKTQQTVDQTLINL"
FT   gene            277164..277925
FT                   /locus_tag="BTH_I0244"
FT   CDS_pept        277164..277925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0244"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02490"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38415"
FT                   /db_xref="GOA:Q2T1Z7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z7"
FT                   /protein_id="ABC38415.1"
FT                   /translation="MDRLIYTAMTGATQSLEQQSVVANNLANASTTGFRAQLATFRAVP
FT                   MNFEDGSGNVDPATTRTYTLSSTPGADFAPGPIERTGNPLDVAIQGPGWLSVMLPDGSE
FT                   AYTRAGNLHVDQNGQLVTANNLPVVGNGGPLAVPPNAQLTIGADGTVSALMPGDPPTAV
FT                   AMIDQLKLVNPDPATMKRGDDGLFRTADGNPADADPAVKVVPNSLEGSNVNPVAAMVSM
FT                   IDNARAFELQTKLIQSADQNEQAANQLLNFS"
FT   gene            277958..278746
FT                   /locus_tag="BTH_I0245"
FT   CDS_pept        277958..278746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0245"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02488"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39503"
FT                   /db_xref="GOA:Q2T1Z6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z6"
FT                   /protein_id="ABC39503.1"
FT                   /translation="MNRSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLL
FT                   YQTVRQPGANSTQQTELPSGLQLGTGVQQVATERLYTQGSLTQTGNSKDVAINGQGFFQ
FT                   VLMPDGTNAYTRDGSFQTNAQGQLVTSSGYQVIPAITIPQNATSLTIGSDGVVSVTQPG
FT                   SNNAVQIGALQIATFINPAGLDARGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVEAS
FT                   NVNVVQELVNMIQTQRAYEINSKAVTTSDQMLQTVTQMSR"
FT   gene            278767..279489
FT                   /gene="flgH-1"
FT                   /locus_tag="BTH_I0246"
FT   CDS_pept        278767..279489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH-1"
FT                   /locus_tag="BTH_I0246"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="identified by match to protein family HMM PF02107"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36753"
FT                   /db_xref="GOA:Q2T1Z5"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z5"
FT                   /protein_id="ABC36753.1"
FT                   /translation="MKQVRFLPQPARRARIAAARRGSAAALAAAALALAGCAQIPREPI
FT                   TQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSG
FT                   ANTNRQGNTSFDVPTAGFLGGLFNKANLSAQGANKFAATGGASAANTFNGTITVTVTNV
FT                   LPNGNLVVSGQKQMLINQGNEFVRFSGVVNPNTISGQNSVYSTQVADARIEYSAKGYIN
FT                   EAETMGWLQRFFLNIAPW"
FT   gene            279483..280688
FT                   /gene="flgI-1"
FT                   /locus_tag="BTH_I0247"
FT   CDS_pept        279483..280688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI-1"
FT                   /locus_tag="BTH_I0247"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /note="identified by match to protein family HMM PF02119"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37683"
FT                   /db_xref="GOA:Q2T1Z4"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z4"
FT                   /protein_id="ABC37683.1"
FT                   /translation="MVKTMRTLLARAMRSLVPSNRRAAACCALAACMLALAFAPAAARA
FT                   ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSA
FT                   NGAGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLK
FT                   GADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVL
FT                   QLQLNDMDYGTAQRIVSAVNASFGAGTAMALDGRTIQLTAPADSAQQVAFMARLQNLEV
FT                   SPEKAAAKVILNARTGSIVMNQMVTLQNCAIAHGNLSVVVNTQPVVSQPGPFSNGQTVV
FT                   AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLE
FT                   II"
FT   gene            280689..281621
FT                   /locus_tag="BTH_I0248"
FT   CDS_pept        280689..281621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0248"
FT                   /product="flagellar protein FlgJ"
FT                   /note="identified by match to protein family HMM PF01832;
FT                   match to protein family HMM TIGR02541"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37374"
FT                   /db_xref="GOA:Q2T1Z3"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013377"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z3"
FT                   /protein_id="ABC37374.1"
FT                   /translation="MTTFSKANDLSQRFALDVQGFDALRSKAAAVPPREGVKMVAGQFD
FT                   AMFTQMMLKSMRDATPSDGLLDSNSSKMYTSMLDQQLAQQMSSKGIGVADALTKQLLRN
FT                   ANVAPDAQSEGGLAAMNALAKAYANSNASSGNGALAGTHGYSAASALTPPLKGNGSPQA
FT                   EAFVEKMAGAAQAASAATGIPARFIVGQAALESGWGKREIRGANGESSYNVFGIKATKG
FT                   WTGRTVSAVTTEYVNGKPHRVVARFRAYDSYEHAMTDYASLLRNNPRYASVLNAGHSAE
FT                   GFANGMQKAGYATDPHYAKKLISIMQQIG"
FT   gene            281837..282595
FT                   /locus_tag="BTH_I0249"
FT   CDS_pept        281837..282595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0249"
FT                   /product="YcgR protein superfamily"
FT                   /note="identified by match to protein family HMM PF07317"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37916"
FT                   /db_xref="GOA:Q2T1Z2"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z2"
FT                   /protein_id="ABC37916.1"
FT                   /translation="MNTEQSTSPPANAAAHSGHDYGRRNPLEIGVQLRNLVNRGDFLTV
FT                   QYQGGQLVTRILDVDVGARTFVFDWGALADQNAGILAAQRCVFHASPDGVRVEFSTATP
FT                   RETRYENLPAFEADFPDVLYCVQRREYFRVDAPILDPYVCRGKLPDGESFLFEVHNLSL
FT                   GGLGLRTGDDRVASFEPGMTLPDVELNLNGHGMLSLDLQLVSHRATETPSGARRYQLGF
FT                   RFLSLPGNAENTLQRIITQLEMKRRQLARA"
FT   gene            282789..284792
FT                   /locus_tag="BTH_I0250"
FT   CDS_pept        282789..284792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0250"
FT                   /product="flagellar hook-associated protein 1"
FT                   /note="identified by match to protein family HMM PF06429;
FT                   match to protein family HMM TIGR02492"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38866"
FT                   /db_xref="GOA:Q2T1Z1"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z1"
FT                   /protein_id="ABC38866.1"
FT                   /translation="MSNTLMNLGVSGLNAALWGLTTTGQNISNAATPGYSVERPVYAEA
FT                   SGQYTSSGYLPQGVSTVTVERQYNQYLSNQLNAAQTQGSSLSTYYTLVAQLNNYVGSPT
FT                   AGIATAITNYFTGLQTVANNAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQL
FT                   TDTVTQINSYTSQIAQLNEQIASASSQGQPPNQLLDQRDLAVSKLSQFAGVQVVPTNGS
FT                   YSVFLAGGQPLVVGNASYQLAAVASKSDPSELTIVSNGVAGANPQGSPQYLPDASLTGG
FT                   TLGGLLAFRSQTLDPAQAQLGALAVSFASQVNAQNALGVDMSGNPGGNLFTAGSPIVYA
FT                   NQGNTSSSTLSASIANGAQPPSSDYALSYDGSKYTLTDRATGSVVGTATPATNPPTMTI
FT                   GGLNLSLSATPNAGDSFTVLPTRGALEGFSLATANGSAIAAASPVLAAGVSTNSGTGVI
FT                   SQGAVSAGYQLPAGTTTLTYNASSKTLSGFPVGTTVTIAGTPPTSINITSATTPVSYDP
FT                   TKGASLTISSTTQPAPSGVMNGVSVSLSGTPADGDQFTIGANKGTNDGRNALALSQLVN
FT                   SKTMNNGTTTLTGAYAGYVNAIGNAASQLKASSAAQTALVGQITQAQQSVSGVNQNEEA
FT                   ANLMQYQQLYQANAKVIQTANSVFQTVLGLFN"
FT   gene            284808..286040
FT                   /locus_tag="BTH_I0251"
FT   CDS_pept        284808..286040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0251"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM TIGR02550"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37924"
FT                   /db_xref="GOA:Q2T1Z0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Z0"
FT                   /protein_id="ABC37924.1"
FT                   /translation="MRISSSQLYSLNVDMMNDQQAQIAQLYQQVSSGISLTTPADNPLA
FT                   AAQAVQLSATSATLSQYTQNQTIVQTALQTEDTTLTSVNDVLNAAYQSIMHAGDGGLSD
FT                   SDRAALAAQIQGSRDHLLTLANTADGAGNYLFAGFQPTTQPFSNKPGGGVTYAGDYGAR
FT                   TVQIADTRTVSQGDNGASVFMSVPFLGSLPVPAAGASNTGTGTIGAVSITNPSDPTNTH
FT                   QFTITFGGTAAAPTYTVTDNTVTPPTTTAAQPYSSGQGINLGGQTVAVSGTPAVGDTFT
FT                   VTPAPQAGADVFATLDTVIAALKTPVGNSPSASTALTNTLATTSTKLMNTMTNVLTVQA
FT                   SVGGRLQEVKAMQSVTSTNSLQTTNSLSNLTATNLPAAISQFLQLQNSLSAAQKAFVQM
FT                   QNLSLFQYLNP"
FT   gene            286115..287776
FT                   /locus_tag="BTH_I0252"
FT   CDS_pept        286115..287776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0252"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM TIGR00801"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37723"
FT                   /db_xref="GOA:Q2T1Y9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y9"
FT                   /protein_id="ABC37723.1"
FT                   /translation="MFGSGLSPGAGGAEASYVGTKRAARAARFVLGRGGRVVAACRRIP
FT                   AHASAYPHASAAARGPRAFPYPFLAFAPRAPPARRVFLRAACQRDSRFVHSRVIFTLTR
FT                   RRARLNPDNQENPAMADSYFPRWRAQPRDDAARVVAPDERLPWPQTFAMGVQHVVAMFG
FT                   STVLAPLLMGFDPNLCILMSGIGTLLFFVLVGGRVPSYLGSSFAFIGLVIAVTGYAGGG
FT                   ANPNIPVALGGIVACGVVYALIGLVVSAVGTRWIETLMPPVVTGAIVAVIGLNLAPIAV
FT                   KSVSASTFDSTLALVTVLCVGGVAVFARGMLQRLLILVGVVIAYAIYAALTNGMGLGKP
FT                   IDFAIVAHAAWFGVPTFHRPVFDPHAMLLIAPVAVILVAENLGHIKAVSAMTGRNLDRY
FT                   VGRAFIGDGLATIVSGSMGGTGVTTYAENIGVMAVTRIYSTLVFVAAALIAILLGFSPK
FT                   FGAVIQTIPGPVLGGVSIVVFGLIAVTGARIWVVNRVDFSDNRNLIVAAVTLVLGAGDF
FT                   SLKLGGFALGGIGTATFGAIILYALLRKEKEPGPMV"
FT   gene            complement(287955..288836)
FT                   /locus_tag="BTH_I0253"
FT   CDS_pept        complement(287955..288836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0253"
FT                   /product="LysR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36757"
FT                   /db_xref="GOA:Q2T1Y8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y8"
FT                   /protein_id="ABC36757.1"
FT                   /translation="MARDLPPFPALRAFEAAARHESFSAAGEELHVTHGAISRQIAAFE
FT                   AWLGKPVFHRHGKRVRLTEEGRRYLATVEAAFDSIARATGQLRETGAARVLRINALPTF
FT                   AMKWLLPRLSRFQREVPNVELKLSTSNAPLGSLDGFDVAIRRGPGRWPGCTSGRFLDES
FT                   VIPVCSPALLKRTPIASADDLARHVLLHSDTRPDAWREWFAAACAPRKGRKKQSFDHFY
FT                   LALQAAVDGLGVALGPLPLIADELASGRLVTPLPGPRIATRSYWWIAPRETASDALVGR
FT                   FCAWLDAQAQAS"
FT   gene            288934..289533
FT                   /locus_tag="BTH_I0254"
FT   CDS_pept        288934..289533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0254"
FT                   /product="chromate transport protein, putative"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39412"
FT                   /db_xref="GOA:Q2T1Y7"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y7"
FT                   /protein_id="ABC39412.1"
FT                   /translation="MQSRSEPDGGDAPDVSVADLFAGFLGLGLISFGGALPFARRALVE
FT                   ERRWLSADEFTDLLGLCQFLPGGNVINLSVAVGMRFRGVPGAIAGLLGLVAGPTLVVIA
FT                   LGVLYAKTQQNPAVHHLFGGLAAAAAGLLIAMAVKVAKPLRHARMAACVAALAFVAIAV
FT                   MRVPLLPTMLVITPASIWLASRAPRGAAAGAQGARR"
FT   gene            289530..290060
FT                   /locus_tag="BTH_I0255"
FT   CDS_pept        289530..290060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0255"
FT                   /product="Chromate transporter family"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38880"
FT                   /db_xref="GOA:Q2T1Y6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y6"
FT                   /protein_id="ABC38880.1"
FT                   /translation="MSDTLAALAAIFGQLSLLAFGGGNTILPEMQRQVVDVHHWMSAQA
FT                   FTALFALAQAAPGPNMMIVPLVGWHVASWPGLLVSSVAKFGPSSIVTMLALHAWERFKD
FT                   KPWRRYVQQGMMPVTAGLVVASAVLISEASNRSALQWGITAAVAALAYRTRLHPLWLLA
FT                   GGALAGLVGGCFA"
FT   gene            complement(290357..290809)
FT                   /locus_tag="BTH_I0256"
FT   CDS_pept        complement(290357..290809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37978"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y5"
FT                   /protein_id="ABC37978.1"
FT                   /translation="MVLQPCLQLIEYVKVYSPARTRRTHPAIRLPIHCIHPSMTAAKFF
FT                   LRYTLVPFVAIVLVVVWAFNRESDEIDARQYAALVSAYPGFTPDLRGEVNRAMRDGKLA
FT                   KSDYASIVRDSLNHGYVLDWSSTNVDLNTERGKLLGLVKRDARTPE"
FT   gene            290808..291152
FT                   /gene="phnA-1"
FT                   /locus_tag="BTH_I0257"
FT   CDS_pept        290808..291152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA-1"
FT                   /locus_tag="BTH_I0257"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="identified by match to protein family HMM PF03831;
FT                   match to protein family HMM TIGR00686"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37438"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y4"
FT                   /protein_id="ABC37438.1"
FT                   /translation="MSTLPACPQCAMENTYPDGEHYICADCGHEWPIAGDASAADDDAA
FT                   AVVKDANGNVLADGDAVVLIKDLKVKGSSITLKMGTKVKSIRLVGGDHEVDCKMDAGNF
FT                   MLKACYLKKV"
FT   gene            291170..291910
FT                   /locus_tag="BTH_I0258"
FT   CDS_pept        291170..291910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0258"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36535"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y3"
FT                   /protein_id="ABC36535.1"
FT                   /translation="MNLDAASRNLTVASLLTLSGGYLDAYTYVGHGHVFANTMTGNVAL
FT                   LGINVSAGDWSQALHHVPPLAGFVIAVFVAHTLGLAAQKGWVRHTAFISLIVEIGFLAI
FT                   ALAGWPAMSSAWLIPGISFVATLQTLSFTHLENLSYTSVMTTGNLRRSAQLLFAGLIPR
FT                   YDALALHDSGLLAVISLCFLAGAVAGGFITRTVGDGALWGAVLLLGAAFAEIVRRARHD
FT                   AGGGAGKTEAAARDASAGRTEDGR"
FT   gene            292043..292222
FT                   /locus_tag="BTH_I0259"
FT   CDS_pept        292043..292222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0259"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y2"
FT                   /protein_id="ABC37390.1"
FT                   /translation="MPLHAEVRRDALILHPSERHGDTTPGSTILVPLEGIDARAAELNG
FT                   KRNPHARPGVERHD"
FT   gene            292482..293618
FT                   /locus_tag="BTH_I0260"
FT   CDS_pept        292482..293618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0260"
FT                   /product="porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36495"
FT                   /db_xref="GOA:Q2T1Y1"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y1"
FT                   /protein_id="ABC36495.1"
FT                   /translation="MKQTTKLAGLVGGAMLAIAGQQAMAQSSVTLWGVADVSLRYLSNS
FT                   NAQNDGRFFMTNGAITNSRIGLHGSEDLGGGLKAIFNLESGVNLQDGSFSDSKRIFNRA
FT                   AYVGLTSQYGTLTLGRQKTVLFDLLSDTYDPLTVGNYLENAWLPVALGAGLYADNSVKY
FT                   RGTFGGLTIGAMYSFGTDSTSSTGAGGFSGQIPGHMGAGNMYGFSLSYIAGPVSVAAGV
FT                   QQNSDNSNRKQTIYHANVVYAFSKAKIYAGYLHSKDDTGFVDAVLAQQPGLFANGAPKR
FT                   TGRIDDGPFAGVSWQATPALTLTGAFYYDRMRNATIANGQLDSGNRYTVVGLVEYALSK
FT                   RTEIYGTVDFNKVNGAATVEMPGRSNQTGVAIGLRNIF"
FT   gene            complement(293803..294636)
FT                   /locus_tag="BTH_I0261"
FT   CDS_pept        complement(293803..294636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39278"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Y0"
FT                   /protein_id="ABC39278.1"
FT                   /translation="MKKLVTLMIAGALVALPYSTPLNAAQAATVTPAAAASPGSAIVFV
FT                   NGINNTFDDAIASLQVLKSQLNARDANNAYVYGNAYNATQGTFSDLWQVFKQKSVEGTS
FT                   PADFWRAIDGGAIPAGGMDAALQQKYIDILTKSETPELPDHLNQYRTYLQQNRKVVLVG
FT                   HSQGTLYANFEVNLLITGPERAQGRISSVNVGNAARYLLPGSSYLTSSSDTVIGSLGLV
FT                   QTVMPSNFSLGLHLLTDPLGHSFTKIYMNQSFAAAKQILTQVSQQANGTAKAAMR"
FT   gene            complement(294684..295247)
FT                   /locus_tag="BTH_I0262"
FT   CDS_pept        complement(294684..295247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0262"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39301"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1X9"
FT                   /protein_id="ABC39301.1"
FT                   /translation="MRWQYPVAAALAIAALVWACARIVSTDAAPAAAPAEQTESTSSTA
FT                   LASAFAIASSATPRSAPPPLPPRVAEYIAHEYANSAVTREALTQIAYGWSQAVNDVHDP
FT                   GDAKTAGDAIAKGIACALSARVLVKAGVDQQTMLDRIKSTRAIMLDTEADTLAYIRFQS
FT                   LAGGQFFDDPGPASCGFNPTSMPN"
FT   gene            complement(295609..296646)
FT                   /locus_tag="BTH_I0263"
FT   CDS_pept        complement(295609..296646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0263"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38701"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1X8"
FT                   /protein_id="ABC38701.1"
FT                   /translation="MQNEPMRSPHDARDARNRQMMKHAGRIAALAGLAVSLWLVARDDP
FT                   RAVLDLLRAAGIGLVVAAASHLLPMLANAKDWQTLIAPPDRPSLRAMLQLVWIRESVNG
FT                   LLPVARIGGELASFRLLRAHGLTAPAAVASLVADMQLTLISQALFALAGVGFLLVRATS
FT                   DTARVAGMFAWGLAALAPLLILFALVQHAKPFERAMHALNRVAGGQLASLVERSAQIDD
FT                   ALKAVWRRRGIVVRYLFFWQPLQHLATSLEIWLALHFLGAPVSFIDALVIEALIQALSS
FT                   AAFFVPGGLGVQEGGFVLIGGALGLDPATSLGLAGARRIRDLLIFVPGLFAWQHAEASV
FT                   AASSS"
FT   gene            complement(296681..297928)
FT                   /locus_tag="BTH_I0264"
FT   CDS_pept        complement(296681..297928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0264"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37406"
FT                   /db_xref="GOA:Q2T1X7"
FT                   /db_xref="InterPro:IPR017835"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1X7"
FT                   /protein_id="ABC37406.1"
FT                   /translation="MKALAWLAGAVCALLAAELISFGDIGRFVALLACLLAAPCAIAAA
FT                   FGCAYTLVAAALTHRFFARAPREPRACPPVTIVKPLHGNEQTLFANLASFCEQRYDGPI
FT                   QFLFGVHDRDDPALRAVDALRDAFPGAHVTIVADARLYGPNRKIANLVNMLPAAVHDVL
FT                   IFADSDVSVGPDYVRHIVGELDEPDVGLVTCVYRGRPDPGFWPRVEALVTNHQFLPGVV
FT                   TGLALKLARPCFGQTIAMRRATLDAIGGLAQFAHHLAEDHAIGEAVRACGARVVVPPFA
FT                   IEHGCVETRVAQLVEHELRWSRTIRAVDPRGHLGSLLTHPLALALLASVLSSGAAWAWP
FT                   LVPASLAARAVSKCIVDHATKRPVRDLWPLPLADLIAFGIFVASFSSSRVIWRGFSFDV
FT                   DRDGRLCPAPEKRPNA"
FT   gene            298461..298868
FT                   /locus_tag="BTH_I0265"
FT   CDS_pept        298461..298868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0265"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38110"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T864"
FT                   /protein_id="ABC38110.1"
FT                   /translation="MEISEAQFKQIEHCLPRQRGNVSLSNLQVLNAILYVAEHGCKWRG
FT                   LPPRFGRWHTIYTRMNRWSRNGVLDRVFTELQRAQIIRVRIEAVSLDSTIVKVHPDGTG
FT                   ALKKMDLKPSASLAEDGQPRFIWLPRMLEQP"
FT   gene            298838..299218
FT                   /locus_tag="BTH_I0266"
FT   CDS_pept        298838..299218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0266"
FT                   /product="Transposase (IS4 family)"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36334"
FT                   /db_xref="GOA:Q2T863"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T863"
FT                   /protein_id="ABC36334.1"
FT                   /translation="MVAADARTAITFALSPGQAGDAPQGRALLERLGPPNRPLHLLMDK
FT                   AYEGNETRQLALDLGFIPVVPPLSTRVEPWEYDREMYKRRNEVERLFRRLKGFRRIFSR
FT                   FDKLDLMFIAFINFALIIEALR"
FT   gene            complement(299336..300880)
FT                   /locus_tag="BTH_I0267"
FT   CDS_pept        complement(299336..300880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0267"
FT                   /product="carbohydrate porin, OprB family"
FT                   /note="identified by match to protein family HMM PF04966"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36504"
FT                   /db_xref="GOA:Q2T1X4"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1X4"
FT                   /protein_id="ABC36504.1"
FT                   /translation="MKKTVHHMLVTSGVASGLPLLLSLGVPHAALAQAASASAAASASE
FT                   SAAQASPAAAATSAALAIDGVQTRSAAPAPDAAATPAPTGFWERSNLFGDMGGLRSKLG
FT                   DHGITLNLQETSEYLRNLSGGTSRGGAYGGLTQFGFSVDTEKAIGLPGGTFNVSGLQIH
FT                   GTSLTSRNLQLLQTASGIEAEGTTRLWELWYQQSFANGRADVKIGQQSLDQEFMVSQYA
FT                   STFINATFGWPVLPAVDMPAGGPAYPLSSLGVRLRAKPSDAWTVMAGVFDGNPAGGVGD
FT                   AQQLNRHGTNFNLRNGALFIGELQYALNAPPADPKAPQPAGLPGMYKLGVWYNSERFAD
FT                   PRYDTNGVALADPASNGIAATHRGNYGFYAVADQMVWRPGADSPRSLNVFARVMGAPGD
FT                   RNTVDFTLNAGVTLRAPFAGRDNDTAGLAVSYAKVGSHARGADGDAGVFQTPGYPVRRA
FT                   ETLLEATYQYQMTPWWQLQADFQYAFRPGGGIPNPNEPGTRIGNEAIVGVRTTIAF"
FT   gene            complement(300979..301248)
FT                   /locus_tag="BTH_I0268"
FT   CDS_pept        complement(300979..301248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39077"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1X3"
FT                   /protein_id="ABC39077.1"
FT                   /translation="MLVRFFKAKLGRHAQLASRRIVVSSISPRAHAANAASHGTLPGTR
FT                   FPARPVGCAIVGAIAGAVAIVALLSASDYRTGLNQAMRVSWWFS"
FT   gene            302296..304230
FT                   /locus_tag="BTH_I0269"
FT   CDS_pept        302296..304230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0269"
FT                   /product="manganese/iron transporter, NRAMP family"
FT                   /note="identified by match to protein family HMM PF01566"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37503"
FT                   /db_xref="GOA:Q2T1X2"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1X2"
FT                   /protein_id="ABC37503.1"
FT                   /translation="MRENPRPENHHAIRSASVATAARQRIARPLRRDAVARSRRQAGIR
FT                   LVLAAPENPDFLNLDALSHTQARPPRRGACACRTSAPTQAIPVGKSSMSTPTDVSPPIA
FT                   IERSAVLDHAHVGDIKGALGTIALHDTAPRNTWWARVRTLLAILGPGLIVMVGDNDAGA
FT                   FGTYTQVGQNYGTTLLWTLLLLVPVLFVNQEMVLRLGAVTGVGHARLIFERFGKFWGAF
FT                   SVVDLFVLNALTIVTEFIGITFVLDFFGVSKVAGVCIAAALTMAAVSTGDLRRFERFAV
FT                   ALCLLSLLLVPVLVSIHPPVHQMTRDLFVPGWPAHAKLSDVMLLVIGIVGTTIAPWQLF
FT                   FQQSYVIDKRITPRFMKYEKADLWIGIVLVMIGAIAMIAFCAALFEGRPEAGNFTDAGG
FT                   VIAGLAKYAGHTSATLFAIALLDASIIGAAAVSLATAYAIGDVFKIRHSLHRSVSDAKG
FT                   FYLVYFGIVAAAAALVLIPGSPLGLLTEAVQTLAGVLLPSATVFLLLLCNDKAVLGPWV
FT                   NSRKLNLFTGAVIWVLVMLSIILTASVMYPDMTGETMIEVLAGGTLLAALGCVATLALR
FT                   KRGGEPPEPAESAVERSLRDTWRMPPLDALPAPRITLSTRIWMGVLRGYLVLAVGLVIV
FT                   KVVQMAFFR"
FT   gene            304234..304422
FT                   /locus_tag="BTH_I0270"
FT   CDS_pept        304234..304422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0270"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36871"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1X1"
FT                   /protein_id="ABC36871.1"
FT                   /translation="MHAAVRRAAAVFRRFDSFGRDRMKRYAWAASMTAVLLLAACTRTD
FT                   DAVSSKTNDAPASGASE"
FT   gene            304766..304999
FT                   /locus_tag="BTH_I0271"
FT   CDS_pept        304766..304999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36903"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1X0"
FT                   /protein_id="ABC36903.1"
FT                   /translation="MIAMGILNTVGEIAGAVAAVEAAEKVDPDAGLLTKAAAAVAGFKG
FT                   AEALENLVEKKKDDEAADGDNTAAPDGDTSQA"
FT   gene            305194..306555
FT                   /gene="gor"
FT                   /locus_tag="BTH_I0272"
FT   CDS_pept        305194..306555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="BTH_I0272"
FT                   /product="glutathione-disulfide reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR01424"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39329"
FT                   /db_xref="GOA:Q2T1W9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006324"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1W9"
FT                   /protein_id="ABC39329.1"
FT                   /translation="MEFDYDLFVIGAGSGGVRLSRVAASYGARVGIAEEERIGGTCVLR
FT                   GCIPKKLLVYASHYGHDVEDAAGFGWTFDIGLFSWPALIEAKDREIARLSGIYGDLLNK
FT                   SGVEIHAGRATLVDAHTVDVAGRRITARHIGVATGSRPVLPPIPGIEHAITSREALDLP
FT                   ELPRRIAIVGGGYIAVEFAGIFNGLGADVDLFYRGAQILRGFDDDVRRALHGEMTKHGI
FT                   AIHTHAGIDAIERGADGALTLRLAQGAYGPYDAVLYATGRVANGDGLGLEAVGVARDAR
FT                   GAIEVDAYSTTTVPSIHAIGDVTARPQLTPVATRDGMLLAANLFGGKRIAADHRYIPSA
FT                   VFSQPEIATVGLTEADARAELGALDIYKTSFRALRHTLSGRDEKTFMKLVVARDSQRVV
FT                   GAHMVGRDAAEIIQGIAIAIRAGATKAQFDETVGIHPTAAEEFVTLRQKEPDDA"
FT   gene            complement(306630..307139)
FT                   /locus_tag="BTH_I0273"
FT   CDS_pept        complement(306630..307139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37953"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1W8"
FT                   /protein_id="ABC37953.1"
FT                   /translation="MNNYLDIRVKSQSRVLRQRADETNFIRALPFRQIATLSLHSAIRA
FT                   TAGIAGQSIGCSNRNIEYTKEPQMKYPVRTLACAFALTFGAAAHAAPKLTPEQCSDYPF
FT                   VHTKGPVTRAQLMNELSELESVGYDPSAGDESGYPDDIDDAQQKLMQKYQTDCVGAGGS
FT                   IASNGN"
FT   gene            307684..308502
FT                   /locus_tag="BTH_I0274"
FT   CDS_pept        307684..308502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0274"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37423"
FT                   /db_xref="GOA:Q2T1W7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1W7"
FT                   /protein_id="ABC37423.1"
FT                   /translation="MRRGSRRGARRPRSEELIPNMATCMPANNPSCPPRTVVPSVAAPD
FT                   TLMSRVLTIEDDEITANEIVGELKSRGFTVDWVANGRDGMARAISDDYDVITLDRMLPG
FT                   VDGLTILTTMRSIGVRTPVLMLSALGDVDERVRGLRAGGDDYLTKPFDTEEMTARLEVL
FT                   LRRSQASPAPFETTLAVGPLTLDLISRKVYRDGAEIALLPTEYRVLEFMMRHAGQTITR
FT                   MMLFEAVWGYHFDPGTNLIDVHMGRLRKKIDPPDATPMIRTVRGAGYILS"
FT   gene            308516..310231
FT                   /locus_tag="BTH_I0275"
FT   CDS_pept        308516..310231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0275"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38855"
FT                   /db_xref="GOA:Q2T1W6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1W6"
FT                   /protein_id="ABC38855.1"
FT                   /translation="MDASRHAPAAPGRRWYSTTFRLLTVYAATFSISVMVLLGFIAAAI
FT                   THDMERETDVVIDWQMIYFDAMPDGDIAGAIHRRLEHERMHTNYYGLFSANGTHIAGDV
FT                   LAFPSELTTYRTGTTLDHTLKIAGDQVAPVVRAMAEVRANGDKLVLARDLTHILRIREA
FT                   IINALIGGGVLCLVAGIAGGLALSVRQMSRLKAIRHVTQRIAQGDLGQRLPVGGRDEID
FT                   MLSHLVNHMLEEVERLMNEVKGVCDGIAHDLRTPLAHVHTLLAHAAQRADTLDDVALSS
FT                   LVERARTETDGLLARFRAMLRISEIGTLQRRGGFAALQQRHEHARVEIGRDKRERQLRD
FT                   AHVVERGDAHHRAVFRYEHAARVNAIRAARIGEFPRARGAVRYRKQAVLAELGRIVRRA
FT                   VAREIGRRRDCHLADRRQRAAHERRAREMAIVGEAHVVRAFDHVDVRIERRHVERDARV
FT                   QDAVRGEQRPEARGGEAHRRRDAQRAARIARRLHEIRFDFVELVDDRAAAVQVLAAGLG
FT                   ERQAARCAVQQAHVQMGFQHADAARDGRGRHAELSRGEVEAREIDHAREDAHHL"
FT   gene            complement(308525..310240)
FT                   /locus_tag="BTH_I0276"
FT   CDS_pept        complement(308525..310240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0276"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37722"
FT                   /db_xref="GOA:Q2T1W5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1W5"
FT                   /protein_id="ABC37722.1"
FT                   /translation="MNQLQVMRVFTRVVDLASFNLAARQLGMSAAAVTRSIGMLEAHLN
FT                   MRLLNRTTRSLSLTEAGREYLDGCRAIIDKLDEIESNLVQATRDPRGTLRIASSMSFAA
FT                   SGLGPLLAAYRILHPRVAFDVTTFDTHVDMVEGAYDVCFSDDRHLASSTLVSRALTTIR
FT                   EVTVASPAYLARHGTPHNPAELGEHSLLAISDGTARSWEFADASGAYRVYAGSVLVSEN
FT                   SAMVRIAALNHMGIAQLPLPLVAADLDARMLVPLLQRRKTAAPLQRADLRDAQHRAKTR
FT                   EQAVRFGSRALDEARQCDVVERVRTLRRVREQRMHVRERRAQIVRDAVAYALHLVHQTF
FT                   DLLEHVIDEVRQHVDLVAPADGQALPEIALRDALRDVADRLEPAHLPHAQSESARDAGH
FT                   EAQNAAADQCVDDRLANAQDVREVACEHELVAVRAHLGHRAHDGRNLIACDLQRVVERR
FT                   AGAIRRQLGRKREHVARDVRAVRGEEAVIVRVHSLVFEPAMNRAGDVAVRHRIEVDHLP
FT                   VDHDIGLAFHVVRDRRRDEAEQHHYRNRERRRIDGEQTERRRIPPTSRRGGRMA"
FT   gene            complement(310311..310691)
FT                   /locus_tag="BTH_I0277"
FT   CDS_pept        complement(310311..310691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39313"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1W4"
FT                   /protein_id="ABC39313.1"
FT                   /translation="MTSPIRTARASLPSTNRLRSACGHACLATAAPAFRPGALNAIRRS
FT                   RRRASDDIRCDAHRMSRDVPTFRVAHYAIHLAPHVLRFALRASHFAFRISHFAFRTQRV
FT                   TPATHLIHDHRLCSHCANMKNP"
FT   gene            complement(310887..311261)
FT                   /locus_tag="BTH_I0278"
FT   CDS_pept        complement(310887..311261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38419"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1W3"
FT                   /protein_id="ABC38419.1"
FT                   /translation="MSRPMSIEMVDERGKKTVMVSIDQASVLLDPEDVDAVIQYLSLLR
FT                   ASMQPAIPEVPPRSQQYVMEMDPCWYTEKHPLYDGAVLFLRHTGLGWASFALPTHSLAK
FT                   LHESLARHLDAEQPMFSLPN"
FT   gene            312089..313429
FT                   /gene="argG"
FT                   /locus_tag="BTH_I0279"
FT   CDS_pept        312089..313429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="BTH_I0279"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37394"
FT                   /db_xref="GOA:Q2T1W2"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1W2"
FT                   /protein_id="ABC37394.1"
FT                   /translation="MTTILENLPAGQKVGIAFSGGLDTSAALHWMRIKGAVPYAYTANL
FT                   GQPDEDDYDAIPKRAIQYGAEGARLIDCRAQLVAEGIAALQCGAFHISTAGVTYFNTTP
FT                   IGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLVNPDLKIYKPWLDQQFI
FT                   DELGGRAEMSEFMRQAGFEYKMSAEKAYSTDSNLLGATHEAKDLESLESGIKIVNPIMG
FT                   VAFWRDDVKIDKEAVTVRFEEGRPVALNGVEYKDAVELLLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGLALLYIAYERLVTGIHNEDTIEQYRENGRRLGRLLYQGRWFDPQ
FT                   AIMLRETAQRWVARAVTGEVTVELRRGNDYSILATRSPNLTYQPERLSMEKVQSTFSPR
FT                   DRIGQLTMRNLDITDTRDKLRIYSEVGLLTPGESSALPKLKEDESGN"
FT   gene            313730..314233
FT                   /locus_tag="BTH_I0280"
FT   CDS_pept        313730..314233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38910"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1W1"
FT                   /protein_id="ABC38910.1"
FT                   /translation="MFQMLPSMTFGRRLSVWWSCMWRQTLASAPVWILGVAIVGLAIWQ
FT                   PHPVAGEPPSGKAMALAIVVFVVCFAICLPITGYTVRRGFAAHALTAPGRVSFRQALMI
FT                   GLTTAGWAALAALPISAVTLPLRHGGHLLAGQAIGLVLNVVAGMYIVLPRQARRLRRLA
FT                   GESA"
FT   gene            314280..315020
FT                   /locus_tag="BTH_I0281"
FT   CDS_pept        314280..315020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37200"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1W0"
FT                   /protein_id="ABC37200.1"
FT                   /translation="MNWGIRMRAAAAFSAGLSASLLASLSAIAAGPAIDSGRYLYVEGG
FT                   SAHGVLSIKGNAFDIETMGSNCHTCALSGTLEGRVGIARDGDNVCRIAVSGGHGAVKLD
FT                   TSGSDACRDFCGMRASFDGEYRRPGAACTDRARDVRTERSHKQYAAHDYDAARATLKSL
FT                   LDECSGFMGWIELDRAKSDLALTEYHRGDRAQCVAVLSDTVAYRAQQDHSEAFGLPPCD
FT                   ADNYQSTGDAILHNLALCRAPAKR"
FT   gene            315073..315540
FT                   /locus_tag="BTH_I0282"
FT   CDS_pept        315073..315540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0282"
FT                   /product="heavy-metal-associated domain protein-related
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00403"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39088"
FT                   /db_xref="GOA:Q2T1V9"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1V9"
FT                   /protein_id="ABC39088.1"
FT                   /translation="MSIAARAALGSAPTRGLPAGIAANASAASRVRGAAAFDSRFEATS
FT                   DAPRRRPARASASASASASGRPRLTFPLWEDSSCDRLISLWRSNMKLEVKDMSCGGCAN
FT                   AITQAIKAVDSSATVSVDIASKVVDVGSTLGVERMVAIIEAAGFHPSVVAA"
FT   gene            complement(315678..318101)
FT                   /locus_tag="BTH_I0283"
FT   CDS_pept        complement(315678..318101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0283"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM PF04945; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36531"
FT                   /db_xref="GOA:Q2T1V8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1V8"
FT                   /protein_id="ABC36531.1"
FT                   /translation="MHDAHVHHDHGRDADERHDPHRAHGAATPGETAVDPVCGMKVPID
FT                   APRRHDHQGRTYRFCSDACLTAFRASPQRFVGMPKQPASESAAPPGTIYTCPMHPQIRA
FT                   NAPGDCPICGMALEPLAPGAAEVRNPELESMTKRFWVGLALSVPLVLMTMGRMALPFDI
FT                   GAGIDALLARWPPPHWMAASWSQCAQAALATPAVLWGGWPVFVRGWKSLVTRQLNMFSL
FT                   IALGVAAAYLFSVFALLFPDALPRAFRSGHEIPLYFEASAVIVTLVLLGQVLELRARSR
FT                   TSSAIRDLLQLAPHTAVRVNPDGSEQTVPLEAVVVGDTLRVKPGSKVPVDGVVVEGHSS
FT                   VDESMITGEPVPAEKTVGSPVTGATVNQTGTFAMRAEKIGADTLLARIVQMVAEAGRSR
FT                   APIQKLADQVSGWFVLAVIALAAIAFAAWAAFGPAPALANALVVAISVLIIACPCALGL
FT                   ATPVSIIVGVGRGAREGVLIKDAEALELMEKVDTVVVDKTGTLTEGRPRVQTVVALDPQ
FT                   RERALLGDAASLEGASEHPLAQAIVEHAMQAGAERKPVASFDSVPGKGVQGMIDERAVA
FT                   LGNAHLMADLAVDCASVETDSNRLREAGQTVMYVAIDGRLAGYIGVADPIKETTPDAVR
FT                   QLKASGARIVMLTGDNPVTANAVAKTLSLDGVKAGVLPEDKYRHVQTLQQQGHVVAMAG
FT                   DGVNDAPALAQANVGIAMGTGTDVAMNSARIVLVKGDLRGIARARALSVATMKNIRQNL
FT                   FFAFVYNAVGIPVAAGVLYPWFGITLSPIFASAAMAASSVSVIGNALRLRAAKT"
FT   gene            319091..319759
FT                   /locus_tag="BTH_I0284"
FT   CDS_pept        319091..319759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0284"
FT                   /product="LemA family protein"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38487"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1V7"
FT                   /protein_id="ABC38487.1"
FT                   /translation="MRHHSSVPHAMAAWTFPIRAALLAVLAFALSGCGYNAIQVQDEQV
FT                   KASWSEVLNQYQRRADLVPNLVNTVKGYANQERDVLTRVTEARAQVGSIRATPELLSDP
FT                   QAFAKFEAAQAQLTSSLSRLLVVSENYPQLKSDANFRDLQAQLEGTENRITVARNRYIR
FT                   SVQAYNTTIRSFPSNLTAMAFGYQEKPNFSVANEAEISKPPRVDFGAKPAPAPAAGASN
FT                   "
FT   gene            319756..320610
FT                   /locus_tag="BTH_I0285"
FT   CDS_pept        319756..320610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0285"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM PF04536"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39192"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1V6"
FT                   /protein_id="ABC39192.1"
FT                   /translation="MKNLLRAACVAILTFLSLGGGVCRAEQPVPPLAARVTDETGTLTA
FT                   AERATLEQSLKDFEARKGSQIAVLIVPTTQPETIEQYSIRVVEQWKLGRANVDDGALLI
FT                   VAKNDRTLRIEVGYGLEGVLTDATSHRIIDEIIVPGFRRGDFYGGISAGVGSMMRVIEG
FT                   EPLPPPRARRGDEGGLGRLLPLLFVMTIVAGGVLRAILGRLAGSVVTGGVVGFVAWMLS
FT                   GALFVAFAAAAVALFFTLLGGGVGARVGGPFIGGRGGGWGGGSDGFRGGGGGFGGGGAS
FT                   GRW"
FT   gene            320610..321107
FT                   /locus_tag="BTH_I0286"
FT   CDS_pept        320610..321107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0286"
FT                   /product="Domain of unknown function (DUF477) family"
FT                   /note="identified by match to protein family HMM PF04536"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39486"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1V5"
FT                   /protein_id="ABC39486.1"
FT                   /translation="MDIARFARHLLMTRWRVGTAFPKRTLGKIERAIKTSHEKHVGQLR
FT                   FAVEGALHVSMLFRGTTARERAIDAFSELRVWDTEHNNGVLIYLLLADHDVEIVADRGI
FT                   HARVDSDDWEKVCREMEAEFRRGRFEAGSIHGIEAVTALLARHYPARRAPGDELSSAPV
FT                   VL"
FT   gene            321417..321800
FT                   /locus_tag="BTH_I0287"
FT   CDS_pept        321417..321800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0287"
FT                   /product="streptavidin, putative"
FT                   /note="identified by match to protein family HMM PF01382"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36926"
FT                   /db_xref="GOA:Q2T1V4"
FT                   /db_xref="InterPro:IPR005468"
FT                   /db_xref="InterPro:IPR036896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1V4"
FT                   /protein_id="ABC36926.1"
FT                   /translation="MQRLEHALRRVKVGTGTPIDFSGTWKNELGSTMRIEQSGDSVTGT
FT                   YTSAVSEKGGSTSGDLIGYVDGNLIAFVVHWDQFQAITAWVGQCEPGTSDDRISTLWQM
FT                   THQVEAGDEWASINAGADTFVRA"
FT   gene            complement(321874..323706)
FT                   /gene="glmS-1"
FT                   /locus_tag="BTH_I0288"
FT   CDS_pept        complement(321874..323706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS-1"
FT                   /locus_tag="BTH_I0288"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37736"
FT                   /db_xref="GOA:Q2T1V3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1V3"
FT                   /protein_id="ABC37736.1"
FT                   /translation="MCGIVGAVAQRNIVPVLIEGLRRLEYRGYDSCGVAVLGAGAPAPG
FT                   APRRARSVARVADLDAQVRESHLGGVTGIAHTRWATHGAPVTHNAHPIFSSNALALVHN
FT                   GIIENFEPLREGLRAKGYAFVSQTDTEVIAHLIHSLYRGNLFAAVQEAVKQLHGAYAIA
FT                   VIHQDEPHTVVGARQGSPLVVGFGEQENFLASDALALAGSTDRFTFLEEGDVCELTLAG
FT                   VTIVDRDGARAVREVRVVAAYGGAVELGPYRHFMQKEIFEQPRAIADTIAQADAFDPSL
FT                   FGERAGSVFAGIDSLLILACGTSYYSGLTAKYWLESIAKIPTQVEIASEYRYRESVPNP
FT                   RALVVVISQSGETADTLAALKHAQALGHAHTLAICNVATSAMVRQTELQFLTHAGTEIG
FT                   VASTKAFTTQLVALFVLAATLGKLRGHVDAAREADYLKQLRHLPAALNSVLALEPQIIA
FT                   WSEEFARKENALFLGRGLHYPISLEGALKLKEISYIHAEAYPAGELKHGPLALVTEAMP
FT                   VVTVAPNDTLLEKLKSNMQEVRARGGELYVFADADTHIVNDEGLHVIRMPEHYGPLSPI
FT                   LHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE"
FT   gene            complement(323768..325174)
FT                   /gene="glmU"
FT                   /locus_tag="BTH_I0289"
FT   CDS_pept        complement(323768..325174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BTH_I0289"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38024"
FT                   /db_xref="GOA:Q2T1V2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1V2"
FT                   /protein_id="ABC38024.1"
FT                   /translation="MLEWPASNSPYETGAMNIVILAAGTGKRMRSALPKVLHPLAGRPL
FT                   LSHVIDTARALAPSRLVVVIGHGAERVRAAVAAPDVQFAVQEQQLGTGHAVRQALPLLD
FT                   PSQPTLVLYGDVPLTRAATLRRLADAATDARYGVLTVTLDDPTGYGRIVRDQAGCVTRI
FT                   VEQKDASADELKIAEINTGIVVAPTAQLSMWLGALGNDNAQGEYYLTDVVEQAIEAGFE
FT                   IVTTQPDDEWETLGVNSKAQLAELERIHQRKLAEALLADGVTLADPARIDVRGKLTCGR
FT                   DVSIDVNCVFEGDVTLADGVTIGANCVIRNAAIAAGARVDAFSHLDGATLGANTVVGPY
FT                   ARLRPGAVLADDAHVGNFVEVKNATLGHGSKANHLTYLGDADIGARVNVGAGTITCNYD
FT                   GANKFRTVIEDDVFVGSDTQFVAPVRVGRGVTVAAGTTVWKDVAEGMLVLNDKTQTAKS
FT                   GYVRPVKKKS"
FT   gene            complement(325365..326360)
FT                   /locus_tag="BTH_I0290"
FT   CDS_pept        complement(325365..326360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0290"
FT                   /product="PP-loop family family"
FT                   /note="identified by match to protein family HMM PF01171"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36665"
FT                   /db_xref="GOA:Q2T1V1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1V1"
FT                   /protein_id="ABC36665.1"
FT                   /translation="MNAPHTPHLNEADAAAAVEANAAEIGRRALTRREQKEAYENNKLF
FT                   KRLVRQVGQAIGDYNMIEHGDKVMVCLSGGKDSYALLDILLRLRERAPIDFDLVAVNLD
FT                   QKQPGFPEHVLPEYLTKIGVPFHIENQDTYSIVKRLVPEGKTTCSLCSRLRRGILYRVA
FT                   GELGATKIALGHHRDDIVQTLLLNMFYGGKLKGMPPKLQSDDGKNIVIRPLAYAKETDL
FT                   EKYAELREFPIIPCNLCGSQPNLKRAEMKALIRDWDKRFPGRVDNMFNALANVVPSHLM
FT                   DTQLFPFAGLRATGEADPNGDIAFDEDPCGTGASAPGGAKSVSIVQFDDL"
FT   gene            complement(326357..326776)
FT                   /locus_tag="BTH_I0291"
FT   CDS_pept        complement(326357..326776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0291"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="identified by match to protein family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37537"
FT                   /db_xref="GOA:Q2T1V0"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="PDB:3V9O"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1V0"
FT                   /protein_id="ABC37537.1"
FT                   /translation="MTGTTMFAALLHPRLADCRRLYLRNHEVYMNIGAFEHEKRGEQRV
FT                   VINVDLFVPLALTTPVEDKLREVVDYDLMKQSVAQCVARGHIHLQETLCDAIAASLLAH
FT                   DAVRAVRVSTEKPDAYPDCDAVGVEVFRIKDEERA"
FT   gene            complement(326843..327799)
FT                   /locus_tag="BTH_I0292"
FT   CDS_pept        complement(326843..327799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36943"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U9"
FT                   /protein_id="ABC36943.1"
FT                   /translation="MTVPADTCDTSAARTARVVLITGAVHTGAAQACAAEAARAVAPQA
FT                   ADAAPAGDAPSCAPTADGAPMGAPRAGGQQADTASHAARPGGAPTAARPAPDAAAVGRA
FT                   LAVGFARRGWDVALAAAAGDEARAAAALAAEVEALGRRAAVLVADLSAETDVARLVAEC
FT                   GAALGRPACVVAQPAPVADNARDVGYASLACAMARGVAAPLVLARTLADATPDAARDDE
FT                   RERAVVIHLLDETLFHPAPERLSHSLAQAALHRATTAQALALAPKVRVVGLVRGRAPRA
FT                   DDIADAACYLADAPGVTGATLTVDGGEHLAPPADERN"
FT   gene            326873..327841
FT                   /locus_tag="BTH_I0293"
FT   CDS_pept        326873..327841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0293"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U8"
FT                   /protein_id="ABC38896.1"
FT                   /translation="MLAAVDGQRRARHARRIREIARGVGDVVRARRPPAHEADYPHLRR
FT                   ERERLRGGRAVQRGLRERVRQALGRRMKQRLVEQMNHDRALALVVARGVGRRVGERARE
FT                   HERRGDAARHRARERRVADVARVVRDGRGLRDDARRPAERRAALGDEPRDIRLGRQIGD
FT                   EHRRAAAERLDFGGERGGRAGFVARGGRERDVPAAPSEADGERASDGRGVGRGPRGGGR
FT                   AARARGMRSGVRLLPACSRGAHRRAIRRRRAGWRVARRGGIGRLRCDRPCRFGGACLRG
FT                   ARMHGARDQHDPRGAGRGCVAGVGGDGHLQCRDESESSRTR"
FT   gene            327771..329003
FT                   /locus_tag="BTH_I0294"
FT   CDS_pept        327771..329003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0294"
FT                   /product="Uncharacterized ACR, COG1565 superfamily"
FT                   /note="identified by match to protein family HMM PF02636"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37254"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="PDB:4F3N"
FT                   /db_xref="PDB:4G67"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U7"
FT                   /protein_id="ABC37254.1"
FT                   /translation="MSQVSAGTVIYNAGMNPKAHEPASLPVPGPDALAQSEALAASLRA
FT                   EIASAGGWIPFSRYMERVLYAPGMGYYSGGAQKFGRRADDGSDFVTAPELSPLFAQTLA
FT                   RPVAQALDASGTRRVMEFGAGTGKLAAGLLTALAALGVELDEYAIVDLSGELRARQRET
FT                   LGAQAPGLAARVRWLDALPERFEGVVVGNEVLDAMPVRLVAKQARGWCERGVSIDDAGA
FT                   FVFADRPFARAEEAARLAGIDADEGYVTETHDAAVAFVRTVCAMLARGAAFFIDYGFPS
FT                   HEYYHRQRAQGTLMCHYRHRAHGDPFVYPGLQDITAHVEFSAIHEAGVGAGADLLGYTS
FT                   QARFLLNAGITDVLAEIDPSDAQHFLPAANAVQKLISEAEMGELFKVIAFSRGIDGALD
FT                   AFARGDRSHTL"
FT   gene            329024..329218
FT                   /locus_tag="BTH_I0295"
FT   CDS_pept        329024..329218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0295"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39032"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U6"
FT                   /protein_id="ABC39032.1"
FT                   /translation="MLRWLLTTFIAVMVLTRAWPWLSRLGVGRLPGDVTLKLGSRVYPF
FT                   PFMSTLVIMGIVSVIARLW"
FT   gene            complement(329149..329292)
FT                   /locus_tag="BTH_I0296"
FT   CDS_pept        complement(329149..329292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0296"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36358"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U5"
FT                   /protein_id="ABC36358.1"
FT                   /translation="MRCAAGGRLRAPRRNRPNAVPARRRHQSRAITDTMPMITSVDMNG
FT                   NG"
FT   gene            complement(329307..329531)
FT                   /locus_tag="BTH_I0297"
FT   CDS_pept        complement(329307..329531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39070"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U4"
FT                   /protein_id="ABC39070.1"
FT                   /translation="MDGGNTYTKGLYTAKAHTRKTDNGRFQGYVILSRNEGGPPDNTLY
FT                   EVEATSTNEAEAFNEAKALAHRILGELEL"
FT   gene            complement(329726..330634)
FT                   /locus_tag="BTH_I0298"
FT   CDS_pept        complement(329726..330634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0298"
FT                   /product="fructokinase, putative"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39257"
FT                   /db_xref="GOA:Q2T1U3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U3"
FT                   /protein_id="ABC39257.1"
FT                   /translation="MSAGFPQFVSAGDILTDMVRTGGAHWTSRPGGAGWNVARAVARLG
FT                   APSACAGAVGRDCFSDALWRESEAAGLDLRFLQRVDRAPLLAIVHETQPPAYFFIGENS
FT                   ADLAFDPKRLPDGWREHVKWAHFGCISLVREPLASTLVALAAELREAGVKISFDPNYRN
FT                   LMTDSYRPTLAKMAELADLIKVSDEDLRHLFAGEDEASATARLRALNPQAALLVTRGPD
FT                   TATLYAHGATLDAQPPRIEVADTVGAGDATIGGLLFSLMTVPARGWREHLAFALAAGAA
FT                   ACRHTGAHAPTLDEVVALVAA"
FT   gene            complement(330631..332043)
FT                   /locus_tag="BTH_I0299"
FT   CDS_pept        complement(330631..332043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0299"
FT                   /product="N-acylglucosamine 2-epimerase (GlcNAc
FT                   2-epimerase) family"
FT                   /note="identified by match to protein family HMM PF07221"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38217"
FT                   /db_xref="GOA:Q2T1U2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U2"
FT                   /protein_id="ABC38217.1"
FT                   /translation="MTTSATPAPRPAPNAPPAAAPYVASFRDPQFLVAHVEDTLRFYAP
FT                   HAFDPSGGFYHFFRDDGSVYERATRHLVSSCRFVFNYAMAYRHFGDARHLEYVRHGLRF
FT                   LRDAHWDAEHEGYDWEIEWRDGEKRSTRDGTRHCYGLAFVLLAAAHAVMAGVEEARPLI
FT                   AHTFDLMEHRFWDRAAGLYADDATPNWTVSSYRGQNANMHATEALLAAYEATGHLTYLD
FT                   RAEKIATNIVQRQAALSRGLVWEHFHADWSIDWEYNKEDSSNIFRPWGFQPGHQTEWAK
FT                   LLLILERHRPLDWLAPRAIELFDAAFSHAWDSDHGGLCYGFGPDYTVCDHDKYFWVQAE
FT                   SFAAAALLARRTGSERFWDWYDEIWRYSWAHFVDHRYGAWYRILTCDNRKYSDEKSPAG
FT                   KTDYHTMGACYEVLHALASTRDGEAPGARTGDGEAAPAARGNGHGGNVVNNGNAGYGKG
FT                   DGAARRRDGGVR"
FT   gene            complement(332040..333059)
FT                   /locus_tag="BTH_I0300"
FT   CDS_pept        complement(332040..333059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0300"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39052"
FT                   /db_xref="GOA:Q2T1U1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U1"
FT                   /protein_id="ABC39052.1"
FT                   /translation="MGTTIRDVAQAANVSIGTVSRALKNQPGLSEATRARIVEIAHRMN
FT                   YDPTQLRPRIKRLTFLLHRQHNNFATTPFFSHVLHGVEDACRERGIVPSLLTTGPTDDV
FT                   IRQMRPHAPDAIAVAGFMEPETLEALAATGRPLVLIDIRAPGLRSINVDNAGGAALAMH
FT                   HLFASGRRRIAFIGGSLAHYSIAQRALGYRRAFFDAGMLFDPSLELSIDTSLGPDAGAA
FT                   HAMRQLLDAGGPLPDAVFAYNDAAALAAMRVCVERGVRVPEDIAFVGFDDIPAAAHAAP
FT                   PLTTLAIDKEALGRQGVELLLADSPAQAELSLPVQLVARASSAGAAHAPRALTSVLGS"
FT   gene            complement(333231..334790)
FT                   /locus_tag="BTH_I0301"
FT   CDS_pept        complement(333231..334790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0301"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36309"
FT                   /db_xref="GOA:Q2T1U0"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1U0"
FT                   /protein_id="ABC36309.1"
FT                   /translation="MNTTRLTVKTRLRILVAVVVLVLVAVGGIGLAGVARVGDALAHVF
FT                   EDRAKTLQRISSIDELVTQTRYAVGDAVLDPSAAKTEAVAAASARDAAAIDRLLADFRA
FT                   TPRAGAEREQAERLAADWATLRDKGIRPAVDLLKANNLSEAQWVVTQTLDPVAQRVKGE
FT                   AAQLRQEQLEAAQRAYDCARGVARLVQWAVAGCVLAGVAAVALLCAAMARALARQLGGE
FT                   PDYAASVANEIASGNLALDVRAADAASGSVLHAMHAMRARLAATIGTLQRAADAIAHAT
FT                   SDIAHGNHDLSRRTDEHAAGLQQTASSMEQLAATVRTNADHARQASSLALAASAQAEQG
FT                   DAAARDAIARMEALSVRSQQIRSISSTIEGIAFQTNLLALNAAVEAARAGQAGRGFAVV
FT                   AQEVRGLAHRSAQAAKEISALIADVTGEVELGADTVQAAGNTIVGMLASVRQVATLVDE
FT                   ISHASDEQRSGIDQVSRAVAQMDEMTQHNALLVQKAASAAGALAGEAAALREAAAIFRT
FT                   AA"
FT   gene            complement(335246..336430)
FT                   /locus_tag="BTH_I0302"
FT   CDS_pept        complement(335246..336430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0302"
FT                   /product="sodium/bile acid symporter family protein"
FT                   /note="identified by match to protein family HMM PF01758"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38928"
FT                   /db_xref="GOA:Q2T1T9"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T9"
FT                   /protein_id="ABC38928.1"
FT                   /translation="MHSSHQSILRMNLPIQSPAATISDRQPPHRPPRGPWRIHRIRPRP
FT                   EMARSRFVPDNFTLALVGTVVLASFLPCRGEAAHAFNWATDIAVGLLFFLHGAKLSREA
FT                   IIAGATHWRLHVVVLLSTFALFPLLGLALKPVLTPLVTPALYAGVLFLCTLPSTVQSSI
FT                   AFTSIAKGNVPAAVCSASASSLLGIFVTPALVGVMVSTQGTGATASPWSTIGAIVMQLL
FT                   VPFLAGQLLRPVIGGWIERNRGVLRFVDQGSILLVVYVAFSEAVNEGLWHQIPPMALAG
FT                   LVVVNVVLLAIALAVTTIVSKRLGFNRADQITIIFCGSKKSLAAGVPMAKVIFAAHAVG
FT                   AIVLPLMLFHQIQLMTCAALAQRWGARDTSRERQPGAHGGRAIGSGANASAAKR"
FT   gene            336683..337168
FT                   /locus_tag="BTH_I0303"
FT   CDS_pept        336683..337168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0303"
FT                   /product="related to SH3-domain protein Cyk3"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38011"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T8"
FT                   /protein_id="ABC38011.1"
FT                   /translation="MTERAIRKIGRWAAGAIGALAATLVFAQPPHGGGPGFGGGRGGAP
FT                   YMAGGGGGWRGAPGYLRAAPRGGGDARIGVNGYRQRWGLRPTPSYGRYATQNPYRPISA
FT                   EARQAPHAPGSANLPMRAGSIRADVARYNEERGGRPAPVPRQDESPRLPFFAPFYRN"
FT   gene            337269..337448
FT                   /locus_tag="BTH_I0304"
FT   CDS_pept        337269..337448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0304"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37454"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T7"
FT                   /protein_id="ABC37454.1"
FT                   /translation="MLRGRRAHAGVFPVFEAPPAIVAGAFGARGKAIRQFETGEPIADA
FT                   RQIAGKLTLTLYPQ"
FT   gene            337573..338649
FT                   /locus_tag="BTH_I0305"
FT   CDS_pept        337573..338649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0305"
FT                   /product="outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36538"
FT                   /db_xref="GOA:Q2T1T6"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T6"
FT                   /protein_id="ABC36538.1"
FT                   /translation="MKSSVSRALQTTFACAAVAALAAGAPSVRAQSSVQLYGQVDEWIG
FT                   AQKFPGGQRAWGVQGGGMSTSYWGLRGTEDLGGGYQAIFTLEDFFRAQNGHYGRFDGDT
FT                   FFGRNAYVGLATPYGTVRAGRLTTQLFVSTILFNPFVDSYVFSPMVYHVFLGLGTFPTY
FT                   TTDQGVVGDSGWNNAIDYTSPSFGGFNAAAMYAFGNTAGDNRSKKWSGQLNYSNGPFAA
FT                   TAVYQYVNFNGGPGDLGALVSGMKSQGVAQVGLSYDFKLAKIYAQYMYTNNERNAGNWH
FT                   VNTVQGGVAVPLGPGSALASYAYSRDSGGLDQTRRTWALGYDYPLSKRTDLYAAYMNDR
FT                   YSGMSSGDTFGAGIRAKF"
FT   gene            338809..339771
FT                   /locus_tag="BTH_I0306"
FT   CDS_pept        338809..339771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0306"
FT                   /product="LysR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37058"
FT                   /db_xref="GOA:Q2T1T5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T5"
FT                   /protein_id="ABC37058.1"
FT                   /translation="MDTLVSMNVFRYVVEVGSFVGAAERMEMSAAMASKHVMHLEHQLG
FT                   ARLLHRTTRRVAPTEAGREYYERLVQALTELDEAGQAVGAASVVPQGRLRVTSLSAFGL
FT                   RHVMDAVTSYAQRYADVTVEITLSDRVVELIDEGYDVAVRAAPAGMKSSSLVARQIATA
FT                   HILLVASPDYLAKHGTPTTIADLQHHSFIRREPNETLLDAAISDVAAASRVPLSGNVIV
FT                   NHLEGLRVAVLDGAGIALLGTEVVGEDIESGRLVPLLLDALPPRELPIYAVYASRRHVS
FT                   AKVRSFVDFLADRFAGQSLCPSIDERLRQFAMPRMKRLG"
FT   gene            complement(339957..340916)
FT                   /locus_tag="BTH_I0307"
FT   CDS_pept        complement(339957..340916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0307"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03060;
FT                   similar to blr1330"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39453"
FT                   /db_xref="GOA:Q2T1T4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T4"
FT                   /protein_id="ABC39453.1"
FT                   /translation="MALPAVLQNLALPVIASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQLQSQLAEHKAANPDAVIGPIAVNQIVHQSNVRLEQDIRVCVEHKVPI
FT                   FITSLRAPAREIVDAVHSYGGIVLHDVINLRHAQKALEAGVDGLILVAAGAGGHAGTTS
FT                   PFALVGEVRKIFDGPIVLSGSIANGGSILAAQAMGADLAYMGTRFIATQEAHAVDAYKH
FT                   AILEAKSADIIYTNLFTGVHGNYIRESIVNAGLDPDALPESDKTKMNFGSDKAKAWKDI
FT                   WGAGQGVGLMDDVPSVAELVARLKREYDDAKARLGIRA"
FT   gene            341156..342106
FT                   /locus_tag="BTH_I0308"
FT   CDS_pept        341156..342106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0308"
FT                   /product="epoxide hydrolase-related protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38964"
FT                   /db_xref="GOA:Q2T1T3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T3"
FT                   /protein_id="ABC38964.1"
FT                   /translation="MTRRSRSYNNVTTIRENKTMSFEEFAPFRVTAQDVDIFGVKGGAG
FT                   PPLLLLHGHPQTHMIWHRVAATLARHFTVIATDLRGYGASGKPPSDARHAPYSKRTMAA
FT                   DQVAVMRHFGFARFYVCAHDRGARVAHRMALDHPDAVERMLLLDIAPTLAMYERTDRAF
FT                   ATAYFHWFFLIQPEPLPETLIGGHSDAYVDAVMGNRSAGLAPFAPEALHAYREALRQPG
FT                   AVHAMCEDYRASATIDLDHDRADLERGHKLACPLRVLWGEHGVVARCFAPLDEWRRVAR
FT                   DVSGRALACGHYIPEEAPVALIDEIVSFFEAREAA"
FT   gene            complement(342187..342675)
FT                   /locus_tag="BTH_I0309"
FT   CDS_pept        complement(342187..342675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0309"
FT                   /product="AsnC family regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38250"
FT                   /db_xref="GOA:Q2T1T2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T2"
FT                   /protein_id="ABC38250.1"
FT                   /translation="MQKRLSTPPAAASALDAIDRELLRALADDARQPVSELARRVGLSA
FT                   PSTADRLRRLEAQGVIARFTVELDPLALGYTLQAIVRVKPLPGQLHLVEELLRRIPAFV
FT                   ECDKVTGEDCFICRLYLRSIEQLDGILAKVTERAETSTATVKSTPVARRLPPLAPEED"
FT   gene            342781..343701
FT                   /locus_tag="BTH_I0310"
FT   CDS_pept        342781..343701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0310"
FT                   /product="Integral membrane protein DUF6 domain protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36373"
FT                   /db_xref="GOA:Q2T1T1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T1"
FT                   /protein_id="ABC36373.1"
FT                   /translation="MHMASSSVSYDARRGALEMVVAMLMSGTIGWLVVSSRQHLMNVVF
FT                   FRCLFGGATMLIICAALGLLRRDLLTKRAIALALTGSVAIVANWVLLFAAYSRASISMA
FT                   TAVYNTQPFMLVALGAIVFRERLTASAVAWLVLAFGGLALVVRVEPAVLAVSGEYLSGV
FT                   ALALGAAFLYAVSSIITKRLKGTPPHLLALFQTGVGALALAPLVHYDALPATAGQWLDL
FT                   VVLGVVNTGIMYVLLYGAIQKLPTATIGALSFVYPVVAIAVDRIAFGQTLAWSQVLGAA
FT                   LILLAAAGVNLGWRIVPPRRVAARG"
FT   gene            complement(343928..344260)
FT                   /locus_tag="BTH_I0311"
FT   CDS_pept        complement(343928..344260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0311"
FT                   /product="Protein of unknown function (DUF1289) family"
FT                   /note="identified by match to protein family HMM PF06945"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39093"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1T0"
FT                   /protein_id="ABC39093.1"
FT                   /translation="MSAVTPTRRATPAECAAGTAGAIDATAHAPAAARPDTSANSRAAA
FT                   APPAAQDTTPTTGVPSPCTNVCRIDAKTGWCEGCRRTRDEIAGWRKLDDDAKRVVLARI
FT                   AARQAA"
FT   gene            complement(344257..344763)
FT                   /locus_tag="BTH_I0312"
FT   CDS_pept        complement(344257..344763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0312"
FT                   /product="ybaK/ebsC protein"
FT                   /note="identified by match to protein family HMM PF04073"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37741"
FT                   /db_xref="GOA:Q2T1S9"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S9"
FT                   /protein_id="ABC37741.1"
FT                   /translation="MTTSAPIDKLPDSARRVALLLRERGHAKGIVMLEETGKTSAEAAA
FT                   GLGCSVAQIAKSILFRRRADGAPVLVVASGANRVDERKVAAQVGEVGRADAKFVRDNTG
FT                   YAIGGVCPIGHLVEPVTLIDRDLLELDSLWAAAGHPHAVFNLSPQELVSLTGAPVADVA
FT                   QRSDA"
FT   gene            complement(344813..345745)
FT                   /locus_tag="BTH_I0313"
FT   CDS_pept        complement(344813..345745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0313"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="identified by match to protein family HMM PF00682"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38657"
FT                   /db_xref="GOA:Q2T1S8"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S8"
FT                   /protein_id="ABC38657.1"
FT                   /translation="MTLPQSVKIVEVGPRDGLQNEQAFVPTDVKIELVNRLSRAGFRNV
FT                   EAASFVSPKWVPQMADGADVMAGIERRAGTVYSALTPNLKGFENALAARADEVVIFGAA
FT                   SEAFSQRNINCSIAESIARFEPVARAAKDAGVRLRASVSCALGCPYQGDVPIAAVVDVV
FT                   ERLAALGCDEIDIADTIGVGTPGRTRAVLDAAAKVFARERLSGHFHDTYGQALANIYAA
FT                   LLEGVAIFHASVAGLGGCPYAKGATGNVATEDVLYMMRGLNIDTGVDLDQVVAAGDFIS
FT                   NAIGRANVSRAGRALLAKQRAAAGPSACA"
FT   gene            complement(345831..346772)
FT                   /locus_tag="BTH_I0314"
FT   CDS_pept        complement(345831..346772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0314"
FT                   /product="2-hydroxyacid dehydrogenase"
FT                   /note="identified by match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38390"
FT                   /db_xref="GOA:Q2T1S7"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S7"
FT                   /protein_id="ABC38390.1"
FT                   /translation="MRILLYTPHQDAQDWKRDIERALPGAQLRAWTPGDDASADYALVW
FT                   RAPREFFAPRADLKAVFNLGAGVDAILALERAHPGLLPRDVPLVRLEDAGMAQQMVEYA
FT                   THAALRYLRRFDEYALLQRERRWQVLEPHSRETFVVGVLGLGALGAEVARALAALGLPV
FT                   RGFSRAPKTLDGVTTFAGAAQLDAFLGGVKLLVNLLPSTADTDGILNARTFSQLAHGAY
FT                   LVNLARGAHLVEADLLDALASGRIAAATLDVFATEPLPADHPFWREPRIAVTPHCSADT
FT                   LRAEAVEQIAAKIGALERGEPIGGIVERDRGY"
FT   gene            complement(346777..347214)
FT                   /locus_tag="BTH_I0315"
FT   CDS_pept        complement(346777..347214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0315"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39509"
FT                   /db_xref="GOA:Q2T1S6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S6"
FT                   /protein_id="ABC39509.1"
FT                   /translation="MSATPRGALRPFHLAFPVTSLEHARRFYGGLLGCPEGRSSDRWID
FT                   FDFFGHQLVAHLAPGETGRSAVNPVDGDDVPVRHFGVVLSMDEWHALADKLKAAGTRFV
FT                   IEPHIRFKGEVGEQATMFFVDPCGNALEFKAFADIGQLFAK"
FT   gene            347364..348002
FT                   /locus_tag="BTH_I0316"
FT   CDS_pept        347364..348002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0316"
FT                   /product="Predicted esterase of the alpha/beta hydrolase
FT                   fold"
FT                   /note="identified by match to protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36914"
FT                   /db_xref="GOA:Q2T1S5"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S5"
FT                   /protein_id="ABC36914.1"
FT                   /translation="MRSCSKSTWPPRLVTVPGLHGSEGAHWQTWLERQFARALRVEQDD
FT                   WDAPHIERWARKVSDLLARERGPFVLAAHSFGCLAAALALSRHAAHANARGADVVGVLF
FT                   VAPANPRKFAFAGDFDARRLTVPSIVVGSESDPWMTLADAREFAHRLGGAFVNLGDAGH
FT                   INTAAGYGPWPRAKHFVDTLVHGAAPLRFRDGDAQAAGALAPAPFVTAA"
FT   gene            complement(348389..350617)
FT                   /gene="plcN"
FT                   /locus_tag="BTH_I0317"
FT   CDS_pept        complement(348389..350617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcN"
FT                   /locus_tag="BTH_I0317"
FT                   /product="non-hemolytic phospholipase C precursor"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by match to protein family HMM PF04185;
FT                   match to protein family HMM PF05506"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38068"
FT                   /db_xref="GOA:Q2T1S4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S4"
FT                   /protein_id="ABC38068.1"
FT                   /translation="MAPTTPPAQRRRPRNPPRIQADRFLPPPLPRRVKGENMTSESRRR
FT                   FLHAVAQSASAAAALTVFPESIRRALAIPAASRTGTIRDVEHIVVFMQENRSFDHYFGH
FT                   LRGVRGYNDRFPITLPNGKPVWYQPSKANPGKPVLPFRLNTLTTSAQCIGDLDHSWYKT
FT                   HAAIDGGRYDQWPANKTDMTMGYHVREDIPFHYALADAFTVCDNYFCSLPGPTHPNRSY
FT                   LMTGTVDPTGKYGGPLLDNSDYVDGDAPPKYDLLTWTTYPERLEANGISWQIYQQGTTG
FT                   ADPLNGNYGTNILQNFANFIDAKPGSSLYRRAQTARTLDDLKADVLANRLPQVSWLLPP
FT                   AAFSEHPKYTPAYGANYTSQILDALTSNPDVWRKTVLFIMYDENDGFFDHVVPPQPATT
FT                   RAQGLSTVPVDGEIHDVVNPGRGGSYTADGLPYGLGPRVPMTVVSPWTKGGFVCSQVFD
FT                   HTSVIRFIAARFGVDEPNITPWRRAVCGDLTSAFDFRTPDATLPPLPDTSNYRSIADQL
FT                   CSTKPAPSVPAAPSPVDPQEPGVRPARALPYELHVNATVHGGARLRIEFANRGEQGAHF
FT                   YVYASNRSDGPWRYTVGAHRSLHDEFDLGATNGAYAFTVYGPNGFVRVFEGLAAAEGHG
FT                   RHAAAHPEVKAGYDVANGNLYLKLTNHGGQSVRLTLADNAYGAPPRQITLRGGDERVEQ
FT                   WALAPSHHWYDVTVSDGATGQFVRRFAGHVENGKSSYSDPAAVAPVTG"
FT   gene            complement(350553..351200)
FT                   /locus_tag="BTH_I0318"
FT   CDS_pept        complement(350553..351200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0318"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38065"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S3"
FT                   /protein_id="ABC38065.1"
FT                   /translation="MPRARRALAPGLAPRHDVSIGGVDVPPSRPAARAIEGPRDRRASR
FT                   LAARRDAPQHATTRRAARPRPTRRPRDAGGQSKANRHNMAVANDSRNRRIVSSYLRTFK
FT                   TRDLSGDTPMRQPLAALAASGACVAALCVAPLVAACGDDASHARARANADASPAPAQGA
FT                   DANAFNGNATAAGDAGASAPLATPVIHYPPEDGADDAPGATAASAQPASNPG"
FT   gene            complement(351216..351674)
FT                   /locus_tag="BTH_I0319"
FT   CDS_pept        complement(351216..351674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0319"
FT                   /product="AsnC family regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39432"
FT                   /db_xref="GOA:Q2T1S2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S2"
FT                   /protein_id="ABC39432.1"
FT                   /translation="MKLDAIDRRILQALQRDGRLQNVELAKEVGLSPSPCLRRVRLLEE
FT                   AGVIERYVAVLNPAKVGRGLTVFTRVWLKEQDADTVDHFAAAVQQLPQVVECHLMAGDC
FT                   DFLLRVVAADIDDYRQFQMHHLTRIKGVQSVKTEIPLQKVKLTSEVPV"
FT   gene            351799..352527
FT                   /locus_tag="BTH_I0320"
FT   CDS_pept        351799..352527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0320"
FT                   /product="brancheD-chain amino acid transport protein azlC"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37070"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S1"
FT                   /protein_id="ABC37070.1"
FT                   /translation="MNSLSTSTVIAEESTARSEARRGLRASLPVMLGFVPFALVLGAQA
FT                   TQKGLSIAEVPLLTGLNFGGGSEFTAIRLWTSPPHILLIVAMSFLVNCRHILMGAAFAP
FT                   YLRHLSRKQTFPALFFMCDESWAMALADARREGRGRVSLPYYLGVSAGLYLTWISCTAL
FT                   GAALGPTIGDVEQYGFDMAFTAVFLVLLRGMWKGARASRPWLVSLVVAAATYLLVPGAW
FT                   YVAAGALAGLVAAVACGEPA"
FT   gene            352524..352826
FT                   /locus_tag="BTH_I0321"
FT   CDS_pept        352524..352826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0321"
FT                   /product="Domain of unknown function (DUF931) superfamily"
FT                   /note="identified by match to protein family HMM PF06063"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37608"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1S0"
FT                   /protein_id="ABC37608.1"
FT                   /translation="MTDVSTLLTIVLMASSTYLSRILGYVVLRNRTLSPRMMAVMENVP
FT                   GCVLVSVIAPAFVSDKPANLLALAITLLAATRLSILPTVIVGIVSAGLLRHLLGQ"
FT   gene            352823..353656
FT                   /locus_tag="BTH_I0322"
FT   CDS_pept        352823..353656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0322"
FT                   /product="lactonase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36604"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R9"
FT                   /protein_id="ABC36604.1"
FT                   /translation="MTNTNDRLRAAEDRWIDTGRGRLFARCWPAPHRAGASDDSPPIVL
FT                   LHDSLGCIRLWRTFPQTLAECTGRGVIAYDRLGFGQSEPRAGPLEAGFVRDEAQRFFAM
FT                   LREAFGFDRFVAFGHSIGGGMAVHCAAAYPSACEALVTESAQAFVEDRTRAGIVQAREQ
FT                   FEQRDAFERLRAYHGDKARWVLDAWIDTWLSPGFADWSLADALPQVMCPTLAIHGSDDE
FT                   YGSNLHPETIVRLVGGPAQIEIVPGVRHVPHRERERWVAERVAAFLREARRGVSE"
FT   gene            complement(353927..354814)
FT                   /gene="dapA-1"
FT                   /locus_tag="BTH_I0323"
FT   CDS_pept        complement(353927..354814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA-1"
FT                   /locus_tag="BTH_I0323"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="identified by match to protein family HMM PF00701;
FT                   match to protein family HMM TIGR00674"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37695"
FT                   /db_xref="GOA:Q2T1R8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R8"
FT                   /protein_id="ABC37695.1"
FT                   /translation="MQSRFEGIWLPIVTPFRAGEIDHPSLARLARHYADEGIAGFVAGA
FT                   TTGEGALLDAGEQEAIFATLRDAAPTHPIVLGISASATHAAAKRARELAALGPNGLLVT
FT                   PPVYVRPTQAGVRRHFEAIVEAADLPVLVYNIPYRTGVSVELDTLQALSRDARVVGVKE
FT                   CGGTIERMLRLVHETPLRILSGDDNQNFAALCAGAHGAIASAAHVLPAWHVRVQALLRE
FT                   GRLDDARRIAVALRPLVADLFAEPNPAPVKALLAAQGWCDNALRLPFLPVSDALAARLI
FT                   AHWEALRQSETADV"
FT   gene            complement(354946..355305)
FT                   /locus_tag="BTH_I0324"
FT   CDS_pept        complement(354946..355305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0324"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38056"
FT                   /db_xref="GOA:Q2T1R7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R7"
FT                   /protein_id="ABC38056.1"
FT                   /translation="MIRWLGIRAARRLDGLAIGASTIRRCAPKRAATGDPTAPRTGMAA
FT                   APDARISARIGAPGMRRHVAAARHLERDGAKIAAQPIYHSAMPAAFDSRSLSLPAALAA
FT                   CARMAGLNLKKRLPN"
FT   gene            355473..356486
FT                   /locus_tag="BTH_I0325"
FT   CDS_pept        355473..356486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0325"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38968"
FT                   /db_xref="GOA:Q2T1R6"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R6"
FT                   /protein_id="ABC38968.1"
FT                   /translation="MKHNRGIGRRLVAGVAVALLATAAHADTSLLNVSYDVTRELYKDI
FT                   NASFVAAYKQKTGETVSVRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAERGQLL
FT                   PKDWRARLPNNSSPYSTTMVFLVRHGNPKGIKDWSDLAKPGVQVIIANPKTSGNGRYAY
FT                   LAAWGYQKLKGATDQQALDFEKAIFRNVPVLDSGGRGATTTFTQRGIGDVLVTFENEVA
FT                   LIGTGAAGASFDAVYPSASILAEPPVAIVDKVVDKKGTRRAAQAYLDYLYSPAAQEIVA
FT                   RHHLRPRDAAVLRKHASEFKPLKTFTVEQIFGNWANAQKTHFADGGTFDKIIVDRR"
FT   gene            357020..358723
FT                   /locus_tag="BTH_I0326"
FT   CDS_pept        357020..358723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0326"
FT                   /product="serine-type carboxypeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00450"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39483"
FT                   /db_xref="GOA:Q2T1R5"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R5"
FT                   /protein_id="ABC39483.1"
FT                   /translation="MKKSMDGGYAGPTRSYGRMSAAAAAAAAMLFALGGCGDDLQSTTT
FT                   PAQLNQPYTDTTAYSPKAGDGLPASQVSERAAVMSHQWSANGATVDYLTTTGHLTAYDP
FT                   SGNAQATMSYVAYTVPSRDGSPRPVTFFYNGGPGSSSVWLRLGSFAPTRVATPDPLMTN
FT                   WPNFPLVDNPESLIATTDMVFIDPPGTGLSEAIQPNTNQTFWGADADVKVMRDFIRRYL
FT                   SVNGRGGSPIYLYGESYGTPRTDMLALALESAGVPLTGIVLQSSILNYMAATGDQAVGT
FT                   LPSYAQVAVYFNQVSPSPTNLGAYAQRIQDFTTAQYTPIVHYATASPPVSPDAGTLAAW
FT                   STQTSMTTASLAAYFQYFYDTEASPGQTTLVPGYTIGRYDGRVSLPNGDARLASDDDPS
FT                   DILISTPFTNALASQMPNYLGYTAPNATYQTLNPAIIGAWNFSHAGQPYPDTIPDLLAA
FT                   LQLNPKLKVLASNGYHDLATPYFETEKELARLQTVSGLNPNLQVTFYQGGHMIYLDDVA
FT                   RPQMQADLVAFYQNRPVANALTLAALPSPWPDESPANTPTAKIARAAAAR"
FT   gene            358766..360364
FT                   /locus_tag="BTH_I0327"
FT   CDS_pept        358766..360364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0327"
FT                   /product="similar to potassium channel protein"
FT                   /note="identified by match to protein family HMM PF01007;
FT                   match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37093"
FT                   /db_xref="GOA:Q2T1R4"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R4"
FT                   /protein_id="ABC37093.1"
FT                   /translation="MNPRYCESRHVPYSPVATHPSGGLICVRRRVFERRIRRNRAGRLV
FT                   CCAVARRRRRSVLPEGRVRRAGIGFGDDGRAVAAAGAKPARREPRRERRASQRRGGHEG
FT                   AGAGRRPRLRRAAFRRDRCRAYRQGHAQAGPAVHRAAASVTECADGRRVRPAEGRARRR
FT                   RESRGPRARDARIALAACYARRTDSGETAMNVDPSSPHSPDPFAQDGAPVRTPPRGGRR
FT                   IWSGTREVIAHGMPASVWRDLYYWALKVSWPVFFASLAALFVVNNTLFALLYQLGDAPI
FT                   ANQSPPGFVGAFFFSVETLATVGYGDMHPQTVYAHMVATLEIFVGMSGIALSTGLVFAR
FT                   FARPRAKIMFARHAIVRPLNGRMTLMVRAANARQNVIAEARAKMRLMRRERSSEGYSLM
FT                   KIHDLKLVRSEHPIFLLGWNMMHVINESSPLFGETPESLAERSAMLLVMIEGSDETTAQ
FT                   VMQARHAWEHAEIRWHHRYVDLMSDVDGMTHIDYTRFDDIEPVERQAADASVVEASGAD
FT                   ANGARPAGGGDDRPV"
FT   gene            360582..364157
FT                   /locus_tag="BTH_I0328"
FT   CDS_pept        360582..364157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0328"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01558;
FT                   match to protein family HMM PF02775"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37725"
FT                   /db_xref="GOA:Q2T1R3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R3"
FT                   /protein_id="ABC37725.1"
FT                   /translation="MNARLPIDGPPALADYRLTDNLSATRGRIFLTGTQALVRLLLMQR
FT                   ALDAAQGVNTAGFVSGYRGSPLGMVDQQLWKAKKQLDASGVRFLPAINEELGGTAVLGT
FT                   QRVEADPERTVDGVFAMWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSS
FT                   SMPHQSDFAMIAWHMPIVNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTV
FT                   DLDALTVRWPAPEGFAPPAGGLHNRWPDLPSLTIEARLAAKLDAVRHFARANSIDKWIA
FT                   RSARANIGIVTCGKAHLDLMEALRRLDLTVADLDAAGVRIYKVGLSFPLEMTRIDAFVD
FT                   GLSEVLVIEEKGPVIEQQIKDHLYNRPPDARPVVLGKHDAAGAPLLSELGELRPSRILP
FT                   VFAEWLARHKSALDRRERVVDLVAPSILSNEADVVRRTPYFCSGCPHNTSTKVPEGSIA
FT                   QAGIGCHFMASWMDRDTTGLIQMGGEGVDWAAHAMFTNTRHVFQNLGDGTYFHSGILAI
FT                   RQAVAARANITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKY
FT                   DGHHDLFPKGTTFHHRRELDAVQRELRETPGVTVLIYDQTCAAEKRRRRKKGEFPDPDK
FT                   RLFINEAVCEGCGDCGVQSNCLSVEPVETTLGRKRRIDQSSCNKDFSCVNGFCPSFVTV
FT                   EGAKLKKAAGVAFDEAALAARVEALPRPATHLADAPYDMLVTGVGGTGVVTVGALVSMA
FT                   AHLEGKSASVLDFMGFAQKGGSVLSFVRIASSDAWLNQVRIDTQQADVLLACDMVVGAS
FT                   ADALQTVRRERTRIVVNTHAIPNAAFVRDPDASLHADALVEKMRHAAGDGFLSRCDAQA
FT                   LATKFLGDTIGANILMLGFAWQQGLVPVSLDAMMRAIELNNVAVPMNRLAFSIGRLAAA
FT                   DAAGLDALWDARHPAHAPLPPQTLDAIVADREARLAEYGGARYAERYRALVGAARATGA
FT                   ERVARAVATTFYRLLAVKDEYEVARLYTDGAFRAALEAQFEGAAGRDFRVKFNLAPPAT
FT                   AKAGSNGAAPRKQVFGQWLWPVLGVLARVRGLRGTRLDPFGRTVERRMERALADDYETT
FT                   MRRAFAVLTPQTADLVARLAELHAKARGYGHVKLANVAGVKRSERELAARLSIDAATSA
FT                   AVQRALDEMKGAGALRGIPIVVAKS"
FT   gene            complement(364390..366354)
FT                   /locus_tag="BTH_I0329"
FT   CDS_pept        complement(364390..366354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0329"
FT                   /product="Na+:H+ antiporter"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM TIGR00831"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38481"
FT                   /db_xref="GOA:Q2T1R2"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R2"
FT                   /protein_id="ABC38481.1"
FT                   /translation="MTKTSAGETCDSRVFIGGPRLFDSSCRQASSKLRAHSRGAAPRRP
FT                   RPGTDAARASHHACMPAGIARTITVHPRSRVASRRPSRAHATLRTVVSSPFRSSMAIVF
FT                   TVLILLLAVALSGIATRVLPLRLPLPLMQIAIGAALAWPKFNLHVTFDPEIFMLLFIPP
FT                   LLFADGWRIPKRELYLQRRAILMLAFGLVFMTVLAVGYFAHWLIPGLPLPIAFALAAVL
FT                   SPTDAVALAGIAGKGRIPPQLMHILEGEALMNDASGLVALKFAIAAALTGVFSLRDASI
FT                   SFVIVASGGLATGAALSWLFSALSTRFLNAAQEGDPAPGIVMTLLVPFASYLIAEHLGL
FT                   SGILSAVASGMMMNYTSFSKSSTVAARVRAESTWAMIEFVFNGMVFIMLGLQLPHIIGR
FT                   ALVDAHHTSDALVGAMIGYVAAMLAALYAIRFAWVWLLRWIASRRAAKQGLAGTMAGLR
FT                   TIAVMTVGGVRGAITLAGVLSVPVALGDGTPLAGRDTAIFVASGVILGSLVVAVIALPL
FT                   LLRGVRPMRNPHAEEERAARAAAAQAAIRAVDAAHDALAVDLDETAAARCADVTARVMD
FT                   LYRRRLAGLAADGATPREEARQTEKIELALKIAAIRAERAVLYRLRGEQKINDETLAKL
FT                   MREIDLSETALSTRKKGIV"
FT   gene            366370..367659
FT                   /locus_tag="BTH_I0330"
FT   CDS_pept        366370..367659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0330"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38052"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R1"
FT                   /protein_id="ABC38052.1"
FT                   /translation="MTIAQQERPVAASPYRFEAEMTSGLERVAAHHHDLTLTSVFQPIF
FT                   SLSHMRAVGYEALLRAHDALDRPVSPLDVFGEAARHGEAAQVDRLAQALHLENFARFGA
FT                   EREWLFLNVHPGVLTDPFQAAALFANLKRLEIPPRRIVLEVLEQRADDIERLADAVREF
FT                   REQGFLIALDDFGAGHSNIERIWQLNPDIVKLDRIMLSHAQHRAGLTAILHGLVTLLHE
FT                   AGKLVLIEGIETEHEAQIALACDADFVQGHFFGRPAPGLPDGAAASACIGELTERYRQQ
FT                   AEASERRDAQRLAPYQRAFERAAERLAAGEPLDEVCWNFLALDHAARCFLLDERGRQAG
FT                   RNVVRRADRARHETRFLPLADAQGANWLRRPYFRSAIAAPGRVQATRPYLSINEALPCV
FT                   TLSIAVRVHDALCVLCGDIDWIDDEASMSA"
FT   gene            367928..368305
FT                   /locus_tag="BTH_I0331"
FT   CDS_pept        367928..368305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38480"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1R0"
FT                   /protein_id="ABC38480.1"
FT                   /translation="MKRPLSLTVLAWFVIVSNVIGLISLPFSLRDPNAVAILRHSPLPL
FT                   EATVAIAVVSEGLHLVAGVAILKRLIWGRTLYALVALVGFAISAFTTPFKGMLIVVAGL
FT                   IALFLFILYRPAATAYFRRAA"
FT   gene            368389..370062
FT                   /locus_tag="BTH_I0332"
FT   CDS_pept        368389..370062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0332"
FT                   /product="alkaline phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38720"
FT                   /db_xref="GOA:Q2T1Q9"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Q9"
FT                   /protein_id="ABC38720.1"
FT                   /translation="MAQGRRSRTDAGRPACRPGPPGNGRSRPEAVRRRHPSAARNHSIS
FT                   ILQSFNFIHIRVISPPYRPRVSERNHTNGKPKNMKRVRLAALLCASVFAAAGCGSDEPK
FT                   TPGASDDGARTSAARNVIFFLGDGMGMTTLTAARIYVVGEDGALTLDTLPETAFVKTYS
FT                   NDAQVTDSAPSMSAYMTGVKTNNEVISMTPDTKAIEPSASLTGNCGANNGKPVPTLLEI
FT                   AKAKGLATGVVTTTRVTHATPAATYAHVCHRDAENDIAAQLVPGGAGYNAALGGGVDVV
FT                   LGGGAQFFVPKDAGGKRADGRNLVNELKAKGYAIAQNRDELLAADATKSGKLAGLFASS
FT                   HMSYDLDRGATKEPSLADMATRALDVLQKNPNGYFLMVEGGRIDHALHDTNAKRALQDT
FT                   VAFDNAIKATLDKVRQTDPDLKNTLIVVTADHDHTLVLNGYAARTGKTEAGKPGVLGVL
FT                   RNYQTGAVAKDADGAPYTIIGFGNGENRVQGSRAGTNLTDAVTGADDYRQEAVVRMAKG
FT                   SETHGGTDVFLGAIGRGAEGFHGVIENNKVFELVRGAAQL"
FT   gene            370094..371494
FT                   /locus_tag="BTH_I0333"
FT   CDS_pept        370094..371494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0333"
FT                   /product="alkaline phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39428"
FT                   /db_xref="GOA:Q2T1Q8"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Q8"
FT                   /protein_id="ABC39428.1"
FT                   /translation="MSTIKRIAAAFAAAALSGGVGQAAHAAGQAKNVIFFLGDGMGPAT
FT                   VTASRLYKVGEAGQLTMETLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMS
FT                   PDTRAVAPGSDANGNKTVNNCGANNGKPVPTLLELAKARGKAVGAITTTELTHATPAAT
FT                   YSHICHRDAQYDIAAQAVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPVANKRGRADGR
FT                   NLLAELQAKGYAVAATKDQLAQAGGGKLIGLFSATSHLEYELDRVAGKGEGATQPSLAE
FT                   MTAKAIDVLRKNPNGYFLMVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLSN
FT                   TLIVVTADHDHTLTINGYAKRGNPVLDISRSYRDGQPNRDADGNTYTTLVFGNGANRPN
FT                   VRTPVDSASATNEAYLQEVGVRMGGAGSETHGGGDVMLFADGADAKAFKGTLDNTKVFG
FT                   LVKSVFGF"
FT   gene            371491..371955
FT                   /locus_tag="BTH_I0334"
FT   CDS_pept        371491..371955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37125"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Q7"
FT                   /protein_id="ABC37125.1"
FT                   /translation="MSATFAMRTFAMKQIVARRVGAAFGAIAMLAAAPAIASRDAAPDL
FT                   DAVLLHESTTVSADGVTRTVTYRERMVRRHGHVWIERVRPSGAKHAQADDAHAHDEHAH
FT                   DGAADARTPPPRGGVRPAAATADAHAGHRHFDFDAAARHVTNDGGKIGVE"
FT   gene            371965..372330
FT                   /locus_tag="BTH_I0335"
FT   CDS_pept        371965..372330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38700"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Q6"
FT                   /protein_id="ABC38700.1"
FT                   /translation="MRRTVVAVPPAEYGTTGFDGSWDNAFYITPPSQLKRLAAKGRPGP
FT                   APGTRWYEQTVGAPRAQGVNRILWSDTLQAPLIVEYRSANGHASRKLTLTPAPRAKVLP
FT                   WRQLQSYARKEYADYLD"
FT   gene            372554..373438
FT                   /locus_tag="BTH_I0336"
FT   CDS_pept        372554..373438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0336"
FT                   /product="cutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38971"
FT                   /db_xref="GOA:Q2T1Q5"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Q5"
FT                   /protein_id="ABC38971.1"
FT                   /translation="MAEKAERNRRGKDRSGRCGVSRRAAPAALRSSPASARAARSRRRL
FT                   RCWLVQLDPGRPMPASSILLEVIATTIGDARAAARAGADRIELVTAISEGGLTPSIGVI
FT                   EAVVAAVPIPVNVIVRPHSRSFRYDASELAAIARDVRAAVAAGANGVVFGMLDAHGDID
FT                   LDALRRIADAADGRDLTFHRAFDVARDLNAAFDTLLRVPCVTSVLTSGGHPSVLDARDV
FT                   VARMVRRAEGTTCTVLAGAGLTVDALGDFVRATGVRAVHFGSGVRERGEVLAPVDERRV
FT                   AKARATLDAAARG"
FT   gene            complement(373545..374564)
FT                   /gene="bioB"
FT                   /locus_tag="BTH_I0337"
FT   CDS_pept        complement(373545..374564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="BTH_I0337"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR00433"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36299"
FT                   /db_xref="GOA:Q2T1Q4"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1Q4"
FT                   /protein_id="ABC36299.1"
FT                   /translation="MTDMTEAQTACPTTETPVAAPVAPRWRVADVIALYELPFNDLLFR
FT                   AQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLAAA
FT                   RTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGLETCVTLGMLEEHQAKALAE
FT                   AGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERA
FT                   GLIAQLANMNPYPESVPINNLVAIEGTPLENAQALDPFEFVRTIAVARITMPKAMVRLS
FT                   AGREQLDDSMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLLARLGMSATEATQLSA"
FT   gene            complement(374614..375336)
FT                   /locus_tag="BTH_I0338"
FT   CDS_pept        complement(374614..375336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0338"
FT                   /product="dethiobiotin synthetase"
FT                   /note="identified by match to protein family HMM TIGR00347"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39482"
FT                   /db_xref="GOA:Q2T1Q3"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1Q3"
FT                   /protein_id="ABC39482.1"
FT                   /translation="MSAPLSLFVTGTDTEIGKTFVSTALLHGFARAGLRAAAMKPIAAG
FT                   AYQRDGVWRNEDADQLDAAANVALPATIRTPFLLKAAAAPHIAAAREGVALDIDTIVGA
FT                   HRRACERADVVVVEGVGGFRVPLAGTRDTADLAVALGLPVVLVVGVRLGCISHALLTAD
FT                   AIAARGLAIAGWVANRVDAAMRFADDNVDTLRAWLEREHGAPLLGDIAHMSPPSPEAAS
FT                   RSLDVNRLLGALRETAPR"
FT   gene            complement(375333..376517)
FT                   /gene="bioF"
FT                   /locus_tag="BTH_I0339"
FT   CDS_pept        complement(375333..376517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="BTH_I0339"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR00858"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36338"
FT                   /db_xref="GOA:Q2T1Q2"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1Q2"
FT                   /protein_id="ABC36338.1"
FT                   /translation="MNLLATLERGLADIDAQGLRRRRRIADTACSAHMSVDGREIVGFA
FT                   SNDYLGLAAHPRLIEAFAEGARRYGAGSGGSHLLGGHSRAHAALEDELAAFSGGFSDAP
FT                   RALYFSTGYMANLAALTALAGRGATIFSDALNHASLIDGTRLSRANVQVYPHGDADALD
FT                   ALLRACDAPTKLIVSDTVFSMDGDVAPLARLVALAEAHGAWLVVDDAHGFGVLGPQGRG
FT                   ALAAHGLRSPNLVYVGTLGKAAGAAGAFIVAHETVIEWLVQRARSYIFTTAAPPSVACA
FT                   VSASLAVIASDEGDARRAHLAALIERTRAILRATPWQPVDSHTAVQPLVIGSNEATLAA
FT                   MAALDAQGLWVPAIRPPTVPAGTSRLRISLSAAHSFADLARLEAALVTPIEAAA"
FT   gene            complement(376514..377860)
FT                   /gene="bioA"
FT                   /locus_tag="BTH_I0340"
FT   CDS_pept        complement(376514..377860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="BTH_I0340"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00508"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37630"
FT                   /db_xref="GOA:Q2T1Q1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Q1"
FT                   /protein_id="ABC37630.1"
FT                   /translation="MSTHATDDWVARSLRAVWHPCTQMKHHERLPLIPVARGERAWLFD
FT                   RAGNRYLDAISSWWVNLFGHANPRINAALKQQLDTLEHAMLAGCTHESAIELAERLAAR
FT                   TQHTLGHAFFASDGASAVEIALKMSFHAWRNRGRGDKREFVCIANGYHGETIGALGVTD
FT                   VALFKDAYDPLIRAAHVVASPDARGARDGETAADVAARALGDVKRLFAERGEKIAALIV
FT                   EPLVQCAAGFAMHDPSYVRGLRALCDAHDVHLIADEIAVGCGRTGTFFACEQAHVWPDF
FT                   LCLSKGISGGYLPLSLVLSRDAIFDAFYDDDVTRGFLHSHSYTGNPLACRAAVATLDLF
FT                   DTDDVLAENARKSALMREALAPLASHPQVRHLRERGTIFAFDVALEGDAAKTFPRRFFE
FT                   RALARETLLRPIGTTVYLMPPYILADGEIEWLASRTRATLDATLSETHA"
FT   gene            complement(378374..379645)
FT                   /locus_tag="BTH_I0341"
FT   CDS_pept        complement(378374..379645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38578"
FT                   /db_xref="GOA:Q2T1Q0"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1Q0"
FT                   /protein_id="ABC38578.1"
FT                   /translation="MAFGKVMTGWIAACVLSAAQAGPLPPDIPSAPAAAPRASGALANA
FT                   ERFDYGDSGLPPVAANLNETVIRIPVDAAGAITLEATVFKPDGPGPFPLVVFNHGKNPG
FT                   DLRAQPRSRPLSFAREFVRRGYAVVAPNREGFAGSGGTYIQEGCDVERNGVAQARDVAA
FT                   TIGYMSKLPYVDAKHVVVAGTSHGGLVSLAYGTEAARGVRGIINFSGGLRQDLCEGWQK
FT                   NLVNAFDTYGSRTHVPSLWLYGDNDSVWSPALVAQLRDAYMSHGASTLFVDFGRYKDDA
FT                   HRIIVDRDGVPIWWPPVASFLAQLSLPTSVRYAVANPHEPKASGYAEIESVDAVPFIDD
FT                   VGRAAYRRFLAQHPSRAFAVSSEGAWSWAEGGDDPMALALDGCRKQGAGACQLYAVDDR
FT                   VVWRDAGTQTADESASAAHALASR"
FT   gene            complement(379779..380231)
FT                   /locus_tag="BTH_I0342"
FT   CDS_pept        complement(379779..380231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0342"
FT                   /product="COG3012:Uncharacterized BCR"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38354"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1P9"
FT                   /protein_id="ABC38354.1"
FT                   /translation="MQATTNVSERPLDCPCGGAAPGASANARAPRYADCCARLIDGHAT
FT                   AATALELMRSRYSAYVLGATDYLRATWDPRTCPPDLDADAGRADAPRWLGLAIKRHAQL
FT                   DDTHAEVEFVARYKIGGRAHRMHETSRFTRDAQGAWRYVDGDVSER"
FT   gene            complement(380264..380941)
FT                   /locus_tag="BTH_I0343"
FT   CDS_pept        complement(380264..380941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0343"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37765"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1P8"
FT                   /protein_id="ABC37765.1"
FT                   /translation="MKTVLIVGASRGIGREFVGQYLRDGWRVIATARDAASLASLDALG
FT                   ARTLALDVARPDDVAAFDARLGDTALDAAVVVSGVYGPRTAGVEPVGAEDFDAVMHTNV
FT                   LGPMLLMPILLPLVEASRGVLAVLSSKMGSISEATGTTGWLYRASKAAVNDALKIASLQ
FT                   ARHAACIALHPGWVRTDMGGAQAALEPQASVAGMRRVIAQAAGDRERANGRFFQYDGVE
FT                   LGW"
FT   gene            complement(380974..382167)
FT                   /locus_tag="BTH_I0344"
FT   CDS_pept        complement(380974..382167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0344"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38081"
FT                   /db_xref="GOA:Q2T1P7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1P7"
FT                   /protein_id="ABC38081.1"
FT                   /translation="MTTVDQDPIVIASAARTPIAGFQGDFASLAAPQLGAVAIAAALER
FT                   AGLKPEQIDEAVMGCVLPAGQGQAPARQAALGAKLPLSVGCTTVNKMCGSGMRAAMFAH
FT                   DMLIAGSVDVIVAGGMESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLM
FT                   GTFAEECAGEYAFSREAQDAFAIESLARAKRANEDGSFAWEIASVTVAGKKGDTVVARD
FT                   EQPFKANPEKIPTLKPAFSKTGTVTAANSSSISDGAAALVMMRASTANRLGVTPLARVV
FT                   GHSTFAQAPSKFTTAPVGAIRRLFDKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHD
FT                   KVNVNGGACALGHPIGASGARILVTLIGALRARAAKRGVASLCIGGGEATAMGIELI"
FT   gene            complement(382154..382906)
FT                   /locus_tag="BTH_I0345"
FT   CDS_pept        complement(382154..382906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0345"
FT                   /product="beta carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38881"
FT                   /db_xref="GOA:Q2T1P6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1P6"
FT                   /protein_id="ABC38881.1"
FT                   /translation="MNTNDHPLSHLFDNNDAWVRRKLADDPHYFSRLADQQAPEYLWIG
FT                   CSDSRVPANQIIGLPPGEVFVHRNIANVVVHTDLNCLSVIQFAVDLLKVKHIMVVGHYG
FT                   CSGVNAALHSRRVGLADNWLHHVQDVREKHAALLEDWPLGEARYRRLIELNAIEQVVNV
FT                   CRTTIVNDAWARGQSLTVHALVYGVHDGRMRNLGMAVSHAEQLDATYRRAVGALSANGA
FT                   HSADNDVVAADAADLIAQTIKETKHDDC"
FT   gene            complement(382968..384779)
FT                   /locus_tag="BTH_I0346"
FT   CDS_pept        complement(382968..384779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0346"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /note="identified by match to protein family HMM PF06315"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36516"
FT                   /db_xref="GOA:Q2T1P5"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1P5"
FT                   /protein_id="ABC36516.1"
FT                   /translation="MNHFPKLLSSQIGFDVAQTILENFDRHYRIFREAAVEAKDLFERS
FT                   DWHGLQRLARERITSYDDRVRECVELLEDEYDAENIDHDVWPQIKLHYIGLLTSHRQPE
FT                   CAETFFNSVCCKILHRAYFNNDFIFVRPAISTEYIENDEPAAKPTYRAYYPGSEGLAAT
FT                   LERIVTNFQLNPPFEDLERDIACIMQAIHDEFGAFDEAVNFQIHVLSSLFYRNKTAYIV
FT                   GRIINGDRVLPFAVPIRHARAGVLALDTVLLRRDQLKIIFSFSHSYFLVDMNVPSAYVQ
FT                   FLRSIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHSSDRFIIAPGIKGLVMLVFTL
FT                   PSFPYVFKMIKDHFPPPKETTREQIMDKYLLVKRHDRLGRMADTLEYSSVALPLARLDD
FT                   ALVRELEKEVPSLIEYEGDSLVIKHLYIERRMVPLNLYLQNGSDAEIEHGVREYGNAVK
FT                   ELIQANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRRVPPPRNDEDEMSGEPW
FT                   YTVGPHDIFPETYAPFLLGDPRVREHFLAHHADFFDPQLWQDSKDRLLRGELPDFFAYE
FT                   PALRFCLRYPERFAPGDAAEDGKRAAA"
FT   gene            385167..386147
FT                   /locus_tag="BTH_I0347"
FT   CDS_pept        385167..386147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0347"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39495"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1P4"
FT                   /protein_id="ABC39495.1"
FT                   /translation="MPLPFALDHINLWLLRDEIDGQAGWTVVDCGIASADIKAHWERIF
FT                   DAHLDGLPVLRVIVTHCHPDHFGLANWLCEGGERGRWNVRLWMTLGEYLFGCLMAAGNG
FT                   SNAGGPAAADHFARHGLADPAALDKLRNRRSYFSDLVPAVPPRYRRLREGDALAIGARE
FT                   WRVVTGYGHSPEHCALHCAADGVLISGDMVLPRISTNVSVFDLEPEANPLALYLDSLGR
FT                   YESMSEGTLVLPSHGKPFRGVRTRIAQLRAHHEARLAEVRAACRERPMSAADIVPIMFK
FT                   RGGLDIHQMTFALGEAIAHLNLLWLAGELARETGADGVIRFRHAG"
FT   gene            complement(386349..387995)
FT                   /locus_tag="BTH_I0348"
FT   CDS_pept        complement(386349..387995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0348"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36709"
FT                   /db_xref="GOA:Q2T1P3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1P3"
FT                   /protein_id="ABC36709.1"
FT                   /translation="MARTAPIGALVALHHVSFRFDDGVTLFDSLDLTFDRTPTAIVGRN
FT                   GAGKSVLARLIAGRLAPTAGAIERHASIAFVAQHDADAMPDPQCTAAAVARLDAPLAAL
FT                   ERVARGDARADDFDLLDGRWDLAERWQAALGDAGLPPIDARTPAHALSGGQLARVAMIG
FT                   ALLSGADLLVADEPTNHLDAPGRDWLRAALAGWRSGLVVVSHDRALLAGVERIVELTPR
FT                   GTRVYGGNYAAYRAQRDAEAQTAQAALDHAHAERDRERRRLAREHDTIQRHAAATRRYA
FT                   ETANLPSGKRVSLKNSAREIMGLVRRDHRDAKAALGDAVREAAQRVEPDAPVLVSLPGT
FT                   EVGARRRLFTLDAARLPWLPAHARAATVTWSAHGPARIAVTGPNGCGKSTLLRMLAGEC
FT                   APRAGRCDTHVPLAYLDQRLALLDPRRSVVEQLAALRTPLAEGELRSRLALLQLDAARA
FT                   TQPAARLSGGERLKAALACALWRETPAQLLLLDEPTNHLDLESVRAFEAALADFPGAIV
FT                   AVSHDAAFIDALAPTHAMRWTSEGWRFEPVA"
FT   gene            complement(388228..389814)
FT                   /locus_tag="BTH_I0349"
FT   CDS_pept        complement(388228..389814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0349"
FT                   /product="peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37651"
FT                   /db_xref="GOA:Q2T1P2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1P2"
FT                   /protein_id="ABC37651.1"
FT                   /translation="MRFTHIAAAALAAASAVAVAKPLTVCTESSPDGFDVVQYNSLVTT
FT                   NASADVIFNTLVSYDEAAKKVVPALADKWDVSADGLTYTFHLRPNVAFQTTDYFKPTRA
FT                   LDADDVVFTFSRMLDDANPWHKVAGASGFPHAQSMGLTKLVKAVTKLDDSTVKFELNEP
FT                   NATFVPILTMGFASIYSAEYAGQLLKAGKQADLNAKPVGTGPFALKSYTKDAVIRYEAN
FT                   PTYWGPKPKVERLIYAITPDPSVRAQKVKAGECQIALSPKPQDVAAAKADRTLKVVETP
FT                   AFMTAFVALNTQKKPLDNDKVREALNLAFDRATYLKVVFDNTATPATNPYPPNTWSYAK
FT                   SIAPYPYDPAKAKQLLAAAGFPNGFSTTIWVRPTGSVLNPNPKAGAELLQADLAKIGVK
FT                   ADVKVIEWGELIKQAKLGQHDLLFMGFAGDNGDPDNILTPQFSCNSVKSGLNFARYCDP
FT                   KLDKLIADAKETADQAKRAKLYEAAQKIIHDEALWIPLGYPTAAAITRPNVAGYRVSPF
FT                   GRQHFDAVSVQ"
FT   gene            complement(390394..390810)
FT                   /locus_tag="BTH_I0350"
FT   CDS_pept        complement(390394..390810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0350"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38155"
FT                   /db_xref="GOA:Q2T1P1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1P1"
FT                   /protein_id="ABC38155.1"
FT                   /translation="MRLLCHCGTLRQATRAITSLYDAHLAKHGIRVTQFTILAALHACG
FT                   TLPTGELATRLLLDQTTLSRTLATLQSNQLVRAESGDDQRVRLWSLTPKGAALFKASRA
FT                   DWEAAQNDVYRRVGKRNMQALDAEIFALAEALSN"
FT   gene            390809..391807
FT                   /locus_tag="BTH_I0351"
FT   CDS_pept        390809..391807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0351"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39091"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1P0"
FT                   /protein_id="ABC39091.1"
FT                   /translation="MGASLIVGPSESFVDNEHSMTHKMHMHDFASVGGGVSALRSAVST
FT                   DESMRLHRFNGKSRMPISARAFFPGEWRHRVRLRARRRPYVTVVLSARIEMKPDDAVVL
FT                   VTGANRGLGRAFVEGLKAAGAKRIYAAARDPARVATPGVQPVRLDVTRADDVAAAARDL
FT                   RDVNLLVNNAGIYRTGSLVADADGGGLQAQLDTNFFGLLAMARAFAPVLRDNGGGAIVN
FT                   VLSVLSWLGVPNAGAYGISKAAAWAATNAIRNELREQRTRVLALHSAYIDTDMVASARG
FT                   VPKNRPEDVVRQTLDALAAGRDEVLVDDLTRAVKAGLSADPAVYTQPPMGA"
FT   gene            complement(391838..392617)
FT                   /locus_tag="BTH_I0352"
FT   CDS_pept        complement(391838..392617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0352"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36430"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1N9"
FT                   /protein_id="ABC36430.1"
FT                   /translation="MNAPPPLKVFITGASSGLGLALAAEYARRGATLGLVARRADALAE
FT                   FAQRFPKATISIHPADVRDADALALAASRFVAAHGCPDVVIANAGISKGAITGEGDLDA
FT                   FREIMDVNYYGMIATFEPFIAPMTAARRGTLVGIASVAGVRGLPGSGAYSASKAAAIKY
FT                   LEALRVELRPAQVAVVTIAPGYIRTPMTEHNPYPMPFLMDADRFAKRAALAISQKAAFR
FT                   VIPWQMGVVAKLLHVMPRWLYDRLFEKAPRKPRAKAG"
FT   gene            complement(392637..393275)
FT                   /locus_tag="BTH_I0353"
FT   CDS_pept        complement(392637..393275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0353"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39237"
FT                   /db_xref="GOA:Q2T1N8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1N8"
FT                   /protein_id="ABC39237.1"
FT                   /translation="MKKLLSSLFLSLSLVAGFAQASPSAPVAGKDFEVMKSPQPVSAPA
FT                   GKVEVIEFFWYGCPHCYEFEPTVEAWVKKQGDKIAFKRVPVAFRDDFVPHSKLFYALAA
FT                   LGISEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGIDKKKFLDAYNSFSVQGQVKQSA
FT                   ELLKSYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL"
FT   gene            complement(393327..394175)
FT                   /locus_tag="BTH_I0354"
FT   CDS_pept        complement(393327..394175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0354"
FT                   /product="sporulation-related repeat protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36706"
FT                   /db_xref="GOA:Q2T1N7"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1N7"
FT                   /protein_id="ABC36706.1"
FT                   /translation="MAKPRRTSKQSKQAGGTFLGIVLGLIVGLAIAVVVALYITRAPSP
FT                   FVSKVAPPADNNASQPQQFDPNRALQGKTPGQPVTPQAAQPAPPNTAPGQAANPSQPPL
FT                   LPEPQIVEVPSSNNNGNGSSSASNNAADNGVAVAPKPADLTPPPAKKPQTAANGSSAPH
FT                   AANNNAQASAAATPPKTAQAPKGASSATTAAAKPTPSADTNTGYFLQVGAYKTEADAEQ
FT                   QRARLGFQGFESKVSKRDVSGVTYFRVRIGPFSKFEDMNSARQRLSDAGVDTAVIRFTK
FT                   Q"
FT   gene            complement(394259..396043)
FT                   /gene="argS"
FT                   /locus_tag="BTH_I0355"
FT   CDS_pept        complement(394259..396043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="BTH_I0355"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39196"
FT                   /db_xref="GOA:Q2T1N6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1N6"
FT                   /protein_id="ABC39196.1"
FT                   /translation="MLPAQKHTLETLLENSVKQVVQASKGDADAAFVLPAIALERPKVA
FT                   AHGDVACNVALQLAKPLGANPRQLAERIVAALTAQPAAAGLVDAAEIAGPGFINLRLTP
FT                   ASKQAVIGAVFAQGRAFGASEREHGKRVLLEFVSANPTGPLHVGHGRQAALGDALANVL
FT                   ASQGYAVHREFYYNDAGVQIGNLAISTQARARGLKPGDAGWPEAAYNGEYIADIARDYL
FT                   NGETVAASDGEPVTGKRDADDLEAIRKFAVAYLRREQDMDLKAFGVKFDQYYLESSLYT
FT                   EGRVEKTVDALIAAGMTYEQEGALWLRTTDEGDDKDRVMRKTDGTYTYFVPDVAYHVTK
FT                   WERGFTKVINIQGSDHHGTIARVRAGLQGLHIGIPKGYPDYVLHKMVTVMRDGQEVKIS
FT                   KRAGSYVTVRDLIEWSGGATPGSEVSPELLDEATITRGRDAVRFFLISRKADTEFVFDI
FT                   DLALKQNDENPVYYVQYAHARICSVLNEWKSRYGATDALLPGADLSPLDSKQAMALMQK
FT                   LAEYPDVLAHAANELAPHAVAFYLRELASEFHSFYNAERVLVDEEAPRTARIALLAATR
FT                   QVLENGLAMLGVSAPSKM"
FT   gene            396246..396569
FT                   /locus_tag="BTH_I0356"
FT   CDS_pept        396246..396569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36929"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1N5"
FT                   /protein_id="ABC36929.1"
FT                   /translation="MITFKSKAAQDLDVLKDFAVYVLGLVGKQLGERGVITSDELDGAI
FT                   AKLEDAVNQAKQARAEHAGHFHEDEPDHAHHEVPPSLAQRVAPFLTMLREAKAQNADIH
FT                   WGF"
FT   gene            complement(396816..399533)
FT                   /gene="metH"
FT                   /locus_tag="BTH_I0357"
FT   CDS_pept        complement(396816..399533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="BTH_I0357"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.13"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM PF02310; match to protein
FT                   family HMM PF02607; match to protein family HMM PF02965;
FT                   match to protein family HMM TIGR02082"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37244"
FT                   /db_xref="GOA:Q2T1N4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1N4"
FT                   /protein_id="ABC37244.1"
FT                   /translation="MTDHTMRLAGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNGQ
FT                   FDEALAVARQQVENGAQVIDINMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKW
FT                   DVIEAGLKCVQGKAIVNSISLKEGEEAFVHHAKLIRRYGAASVVMAFDEQGQADTFARK
FT                   TEICKRSYDVLVNQCGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATRWIKQNLPYA
FT                   KVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYAELDAELRER
FT                   VEDVILNRRADSTDRLLEIADKFKTGAAKKEENLEWRNQPVEKRLAHALVHGITNFIVE
FT                   DTEEARAKIAAAGGRPINVIEGPLMDGMNVVGDLFGQGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKRLLAEAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMV
FT                   PCNEILAKAKVEGADIVGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPNYEGPVVYVPDASRSVSVASSLLSDEGAAKYLDELKSDYERIRTQHANKK
FT                   ALPLVTLDEARANKTKVDWASYQPVKPKFIGRRVFKNYDLNELANYIDWGPFFQTWDLA
FT                   GPYPAILNDEIVGESARRVFSDAKSMLARLIQGRWLTANGVIALLPANTVGDDDIEIYT
FT                   DDTRSEVLLTWRNLRQQSVRPVVDGVMRPNRSLADFIAPKDSGVADYIGMFAVTAGIGV
FT                   DAKEKQFLADHDDYSAIMLKALADRLAEAFAEAMHARVRRELWGYAAGEQLDNDALIAE
FT                   KYAGIRPAPGYPACPDHLVKRAMFEALHTDEIGMSITDSLAMLPAASVSGFYLAHPDST
FT                   YFSVGKISQDQLEDFARRMALSKADAERALAPLL"
FT   gene            complement(399579..400655)
FT                   /locus_tag="BTH_I0358"
FT   CDS_pept        complement(399579..400655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0358"
FT                   /product="Homocysteine S-methyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF02574"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38013"
FT                   /db_xref="GOA:Q2T1N3"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1N3"
FT                   /protein_id="ABC38013.1"
FT                   /translation="MSEPKPIAPSAPSALAASYTRGAALPRLLQQRILILDGAMGTMIQ
FT                   RYKLDEAAYRSERFKDFPRDVKGNNELLSITQPQIIREIHDQYFAAGADIVETNTFGAT
FT                   AVAQADYGMEDLAVEMNVASATLARESAAKYATPDKPRFVAGAIGPTPKTASISPDVND
FT                   PGARNVTFDELRDAYYTQAKALLDGGVDLFLVETIFDTLNAKAALFALDQLFEDTGERL
FT                   PIMISGTVTDASGRILSGQTVEAFWNSLRHARPLTFGLNCALGAALMRPYIAELAKLCD
FT                   TYVSCYPNAGLPNPMSDTGFDETPDVTSGLLKEFAQAGLVNVAGGCCGTTPEHIAAIAK
FT                   ALAEVKPRRWPSQYSEAA"
FT   gene            complement(400848..401105)
FT                   /locus_tag="BTH_I0359"
FT   CDS_pept        complement(400848..401105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36585"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1N2"
FT                   /protein_id="ABC36585.1"
FT                   /translation="MQMIYNSPNYCVVEFPPQDGHHAMNSGGYEIVDKNAQREIFIDGE
FT                   LAARFREHVKQLIQAEPSLDEVDEFLGQFDSLMTQPVVLH"
FT   gene            complement(401290..402621)
FT                   /locus_tag="BTH_I0360"
FT   CDS_pept        complement(401290..402621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36813"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1N1"
FT                   /protein_id="ABC36813.1"
FT                   /translation="MPSSSIVSSNPRIAPRRVRRAAFALALVLALHWLAALWLVRFREP
FT                   FEPVEPDNVPVQVELLKPQPIARAPAPVKPAAGRPQAAQKRAAPAHAPMPRARAPRASQ
FT                   PVLSAAESPIESPAAASAAEPASAATAGATSEATGGAAAGAAGAGAAAPPGDASKGVKF
FT                   ALPPSANLQYDTFYNGMQNMPGTIHWRTDGSGYSLYVSMPVPFVGPYTYESRGRVDAFG
FT                   IAPARYVETRGRRPSDFAIFNRQTKQIVFTGTPNSLALPDGAQDRFSMLMQLAGLVGGD
FT                   PDAYRPGVTREFFVVDRDSGETWPITTIGDETISTGMGSLDTRHFMRLPRRAGDARRID
FT                   IWLAPSLGWLPVRMVQTEPNGAQIELLLHRRTNASDATGERAHADADGNGRAGGDAGAA
FT                   SARASESTTPAPGAPLDADESVNSTDKTDAPPLPPPAPPGRIQP"
FT   gene            complement(402698..403720)
FT                   /locus_tag="BTH_I0361"
FT   CDS_pept        complement(402698..403720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0361"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38798"
FT                   /db_xref="GOA:Q2T1N0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1N0"
FT                   /protein_id="ABC38798.1"
FT                   /translation="MAVARAVLERSEFHREVSRCSDDGRNLFYDGESARRHAPRAARVF
FT                   HSHSSRNAVNKFASNASAPPDDDLADDHDTGEEKVRSGIQSIEVGFRLLDVLTSEPRAM
FT                   MLRDLAQRAAMSPAKAHRYLVSFQRLGLVSQDPVSGRYELGGFALQMGLARLARVDGVK
FT                   LARIALTALRDQLDQTVGIAVWGNQGPTIVHWMESSHPAKASLKLGDVMPLLGSATGLV
FT                   FAAYLPRSKTAAMIERELADTRRAAHYTGPRTHAEVEAALADVRAHRAARVEGMLLPTI
FT                   NAFGMPVFDALGDLALAIIALGHEGAFDIRWGGEVDTALRACAQKLSYELGYSDGARDA
FT                   "
FT   gene            403679..404671
FT                   /locus_tag="BTH_I0362"
FT   CDS_pept        403679..404671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0362"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38100"
FT                   /db_xref="GOA:Q2T1M9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1M9"
FT                   /protein_id="ABC38100.1"
FT                   /translation="MKLASLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWAFY
FT                   APQLRDLYDALNHGRARNAFAFEPADCMAPLPRAFQWADGSAYVNHVELVRRARGAEMP
FT                   PEFWTDPLMYQGGSDDFLGPRDDIVCASEEWGIDFEAEVAVITADVPMGAAPDEALKAV
FT                   RLVTLVNDVSLRNLIPAELAKGFGFFQSKPASAFAPVAVTPDELGEHWRDGRLHRPMLV
FT                   HWNGKKVGQPDAGVDMVFHFGQLIAHAAKTRNLRAGSIIGSGTVSNKDAKRGYCCIAEK
FT                   RCLETIEHGAPQTEFMRYGDRVKIEMVDEAGKSIFGAIEQAVAPADAVA"
FT   gene            404958..405707
FT                   /locus_tag="BTH_I0363"
FT   CDS_pept        404958..405707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0363"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36826"
FT                   /db_xref="GOA:Q2T1M8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1M8"
FT                   /protein_id="ABC36826.1"
FT                   /translation="MSGEGANRSGLAVASEAMHRELADIWRDVDRDPDARVAVIRGEGK
FT                   GFSAGGDLALVERMADDHAVRERVWREARDLVYNVINCSKPIVSAMHGPAVGAGLVAGL
FT                   LADVSIAAKSARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEPVSGEEAERI
FT                   GLVSLAADDHDLLPKAYEIAERLAQGSASAIRWTKYALNNWLRLAGPTFDASLALEFMG
FT                   FSGPDVREGIRSLRERRAPDFTGDAPS"
FT   gene            405796..406635
FT                   /locus_tag="BTH_I0364"
FT   CDS_pept        405796..406635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39085"
FT                   /db_xref="InterPro:IPR005398"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1M7"
FT                   /protein_id="ABC39085.1"
FT                   /translation="MTDTNGSNPFSGFGGFQPAGFLDKMWDMMRLTPFGAMSALPGASQ
FT                   GLPPSLSAMSDLMAPLASVEELDKRITDLRAVEQWLKLNLGMLQSAIQALEVQRATLAT
FT                   LRAFGALAQTSMAAAEAALSPDDSAHRESAPASASSTKREADAGEPAGARAEAETGATA
FT                   DAGGETPPPGADAFDPAGWWNLLQSQFNQLARFAMTQPGMAAAGDAPAAGAAAAPKPSA
FT                   AKKPAARRAAAPRTSGSAADRAPGASSASNASSASSASSAAGAAKPAAAKKPARSRP"
FT   gene            406672..407904
FT                   /locus_tag="BTH_I0365"
FT   CDS_pept        406672..407904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0365"
FT                   /product="patatin"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38361"
FT                   /db_xref="GOA:Q2T1M6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1M6"
FT                   /protein_id="ABC38361.1"
FT                   /translation="MRLALVLMGGGARAAYQVGVLKGLAEIAHDVDPKRRTSPFTVICG
FT                   SSAGAINATSLASHADDFEHGVRRLLEFWEHLRAERVYRTDWLGIAAAGARWLAAMSIG
FT                   WAARRSPRGLLDNAPLAHLLRRELDFRRIELMLEARKLHALSVTALSYSSGRHLTFYQA
FT                   SEPIQAWRRAERTARMVDLSAEHLLASSAIPFVFPAVPLVLDGQIEYFGDGSIRQIAPL
FT                   SPAIHFGSDRIVVVGAADPRPEVPAANGNGRGYPSLAQIGQQVLASVFLDSIGADIERI
FT                   DHVNRMIEHLPAYVEPASGWRHVDVLAIAPSERIELIASKHLKRLPLTVRGLLGAVGGN
FT                   KPAGASFASYLLFEAEFARELVELGYRDAQGQRERLAQWIASAERHGAQAERGPGANVG
FT                   AGANAARRTTT"
FT   gene            408360..409235
FT                   /locus_tag="BTH_I0366"
FT   CDS_pept        408360..409235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36641"
FT                   /db_xref="GOA:Q2T1M5"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1M5"
FT                   /protein_id="ABC36641.1"
FT                   /translation="MNTMLYPELYKSLEAVRWDMEKDIPWDTFDASLLTDEQAKTIKMN
FT                   AITEWSALPATEMFLRDNHHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPELMPTEEE
FT                   LHAVRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYETISRDEARHGG
FT                   AYLRYMKKALNNCGDVARAAFSKIGVLMASARRTEKPLHPTNLHVNQALFPRDTVQSRL
FT                   PDPEWLERWLDEQIRFDGEWEKKVVERILHNLSVLFERTFATAQELNRYRKEVTARLQS
FT                   ESGPAATQPA"
FT   gene            409365..409850
FT                   /locus_tag="BTH_I0367"
FT   CDS_pept        409365..409850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0367"
FT                   /product="ADP-D-glycero-D-manno-heptose synthase"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36614"
FT                   /db_xref="GOA:Q2T1M4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1M4"
FT                   /protein_id="ABC36614.1"
FT                   /translation="MPASFERKLITRDALVALRASLPAPVVFTNGVFDILHRGHVTYLA
FT                   DAKALGACLIVGVNSDASVRMLGKGDDRPINAQEDRMALLAALECVDWVVGFDEKTPVS
FT                   LIEAVHPDILVKGGDYDMDALPETALVRGWGGRSLAIPFEHDRSTTKLLKKVRSQSS"
FT   gene            complement(409902..410303)
FT                   /locus_tag="BTH_I0368"
FT   CDS_pept        complement(409902..410303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0368"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1M3"
FT                   /protein_id="ABC38852.1"
FT                   /translation="MLRWLISILFLANMLAFVVVRGVFGPLPAAGSREPGHALLQVRPD
FT                   ALRVTPVSQAADQPIVGGPIVSPTLEAAPLNALGAAADPASGAAPGSPAASAPASSPAA
FT                   AAASAPAPVAPVAPVAPVAPSAPSAPTAQ"
FT   gene            complement(410409..411188)
FT                   /locus_tag="BTH_I0369"
FT   CDS_pept        complement(410409..411188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0369"
FT                   /product="transcriptional activator, Baf family"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37407"
FT                   /db_xref="GOA:Q2T1M2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="PDB:4O5F"
FT                   /db_xref="PDB:4O8K"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1M2"
FT                   /protein_id="ABC37407.1"
FT                   /translation="MSGVCLLIDAGNSRIKWALADTGRHFVTSGAFEHADDTPDWSTLP
FT                   APRGAWISNVAGDAAAARIDALIDAHWPALPRTVVRACAAQCGVTNGYAEPARLGSDRW
FT                   AGLIGAHAAFPGEHLLIATFGTATTLEALRADGRFTGGLIAPGWALMMRSLGMHTAQLP
FT                   TVSIDAATSLLDELAANDAHAPFAIDTPHALSAGCLQAQAGLIERAWRDLEKAWKAPVR
FT                   LVLSGGAADAIVRALTVPHTRHDTLVLTGLALIAHSA"
FT   gene            complement(411185..412147)
FT                   /locus_tag="BTH_I0370"
FT   CDS_pept        complement(411185..412147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0370"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="identified by match to protein family HMM PF02237;
FT                   match to protein family HMM PF03099; match to protein
FT                   family HMM TIGR00121"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39384"
FT                   /db_xref="GOA:Q2T1M1"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1M1"
FT                   /protein_id="ABC39384.1"
FT                   /translation="MNVATRPPTPANDGPLIDRARVDAQLAPAAREWSIEIVDTTGSTN
FT                   ADLGARLKTLPRRRDALAAPIARIAYEQTAGRGRQGRPWFAKPGDALLCSVACVLPHPV
FT                   GALAGLSLAVGAALADAFAALPAAPGDAPRAGVGGAAPRIALKWPNDLLVATARDGEAA
FT                   IVGKLAGVLIETVWNMSDATAVVIGFGVNVRAADTAAAEVDALRARDATLAGGLPPVAL
FT                   AAVRAGATLTDTLAAALNALAAALPAFAAEGLAPFAARWNALHAYAGREVVLLERGAEL
FT                   ARGVAVGIDETGQLLLDTPAGRQAIAAGDVSLRAPGAPR"
FT   gene            complement(412499..413467)
FT                   /locus_tag="BTH_I0371"
FT   CDS_pept        complement(412499..413467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37338"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1M0"
FT                   /protein_id="ABC37338.1"
FT                   /translation="MTARAANAQRGCAARRPARRPRNRFTSTMNPTKNLLSTRAATPPD
FT                   HARRPSPPRRMLRATLSPFGMLAVAAALAAGVAATGSIGHPASGAPNATRAQLDEWRAM
FT                   VEQASEPNALGRLRALAQRGSTDAQAALGLALAGSRDLALRDEGRRWLETAAHASPPNS
FT                   APTSAGERDARLALGKAWLLGTGDVARDYPRALAMLRPLAAAGDPNAAYYVGLIYRSGY
FT                   GTPADPTEAARWFELAAQHDIPAAQFMLANAYRDGSGVHRDEARALALYRQAADRELPE
FT                   AVQTLAIAYRNGELGLPRDPDAFRAQWIEAAHALKHPALAP"
FT   gene            complement(413464..415581)
FT                   /locus_tag="BTH_I0372"
FT   CDS_pept        complement(413464..415581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0372"
FT                   /product="2`,3`-cyclic-nucleotide 2`-phosphodiesterase"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38583"
FT                   /db_xref="GOA:Q2T1L9"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L9"
FT                   /protein_id="ABC38583.1"
FT                   /translation="MRRSRHPRLNGNRTGIIPMPFPLRFRRRRLAGALVACAALAAGCN
FT                   DDVGSPPPASSGAQTPAGTKATLAVLETTDLHTNVLSYDYFKLAADKSLGFERVATLIA
FT                   QARAQYPNTLLLDNGDTIQGTALADYQALVKPVSCGETLAIYKVMNAAKFDGGGIGNHE
FT                   FNYGLPYLSQVTGNAFAVDGLPDPAQQKKCAGPNFPQVLANVISAKTNAPLFTPYTILT
FT                   KTVTATTPDGRTITAPVKVGIIGFTPPAIMSWDKRWLDGKVYTTGLKEAAEKYIPEMRA
FT                   KGADLVVAISHGGLDNSPYSPTMENGSWWLSTVPGIDAMLIGHSHQVFPDATSTVAQFN
FT                   LPGVDKVKGTVNGVPTVMANYWGKHLGVIKLGLAFDGKAWSVDKSQTSVEARSIQNPDK
FT                   SYVDADPSVAAAIAAEHQATIDYVKTPIGATDYRMTSYFADVGDPGAIQIVNEAQADYV
FT                   ASYVRANLPQYASLPVLSVSAPFKSGFGGGADFTDVAAGALAINNAADLYLYPNTVYAV
FT                   KVSGADIKNWLETAAKRFNTIDPTKATVQKLVSAFPGYNFDMFTSADLRYEIDVTQAAG
FT                   SRIRNLTYKGAPIDPNAQFIVATNNYRASGGGNFPGLDGSKTIFASPDANRDVLIAYIK
FT                   KRGQLTRAADGMQRSWRFTKLASSVAHVQFASAPNLVALANAASLAGITQVAADDGSGK
FT                   GLATYEIDLTQ"
FT   gene            415748..416962
FT                   /locus_tag="BTH_I0373"
FT   CDS_pept        415748..416962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0373"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02405;
FT                   match to protein family HMM TIGR00056"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38587"
FT                   /db_xref="GOA:Q2T1L8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L8"
FT                   /protein_id="ABC38587.1"
FT                   /translation="MPYRADGPNETSRGEAVRYNGLCHRFAKSPLNFQTPPGLSVDAGS
FT                   QGQTVRLSGQWTALALARDRGNVARRIARLAKEPVGEWDLSGVDRLDHVGGQALWRVWG
FT                   RRLPAGIALTDNQRTVFERIERLDAGREAPEPVVRIDPVTRFGQGLFTFGEHLYGGIAL
FT                   LGGLIVDLLSVLRRPRTMPWTEISANVYAAGTKALPITALVAFLIGIVLSYLSAQQLQL
FT                   FGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVMGIPH
FT                   GLRITLPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDLNFFVRSLPSVVPIANL
FT                   FIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAILFQ
FT                   NVGLG"
FT   gene            416959..417801
FT                   /locus_tag="BTH_I0374"
FT   CDS_pept        416959..417801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0374"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37185"
FT                   /db_xref="GOA:Q2T1L7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L7"
FT                   /protein_id="ABC37185.1"
FT                   /translation="MSARDDDFVIEVRDLTKRYGRNVVHEHLDFDVRSGEIVAIVGGSG
FT                   SGKTTLVRQILGLERPSAGTIKVFGEDTSTIDADAARVMRSRSGMLFQHGALFSSLSVF
FT                   DNVAQPLRELGRVPEDLLHDIVMLKLEMVGLPCKHASKMPAALSGGMVKRVGIARAIAL
FT                   EPELLFLDEPTAGLDPGASDEFVELIATLHRTLGLTVVMVTHDLDTMVALSTRVAVIAD
FT                   RKVLVAASVEEAAGVDHPFIREYFLGRRGRRALQALPPERRARLPKAALEPAPSDVEL"
FT   gene            417827..418756
FT                   /locus_tag="BTH_I0375"
FT   CDS_pept        417827..418756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0375"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36987"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L6"
FT                   /protein_id="ABC36987.1"
FT                   /translation="MENKSHAFWAGLFTIALLAAIVGAVYWFNVDRTVRVPYDLVSRSN
FT                   VTGLFPDAAVRYRGLDVGKVQSIDFDRGHPGQIVIRILVDTHAPITRSTFGSLGFQGVT
FT                   GIAFVQLDDTGADLAPLPTSAKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEML
FT                   SPDMRDQLKATAASMQHAADGVTHLSRQVEPALAQMPQTMEHVNHALSAANALVAPGGP
FT                   LVTNLNRAGQALASMNDTLAELSARVRYDTLPRFNALATNVGDASRTLKDVAGDVGRNP
FT                   RSLLFGAPAAEPGPGETGFAWPSAAPAQ"
FT   gene            418775..419407
FT                   /locus_tag="BTH_I0376"
FT   CDS_pept        418775..419407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0376"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38795"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L5"
FT                   /protein_id="ABC38795.1"
FT                   /translation="MHAHFMSGSLFRRGRAALALAVALAIASGCAGTPAALTNIRYDLG
FT                   PVRPAASSGTGPALKVLDVSAPDALNTDRFVYRLAYADAQRISVYRDSKWTAPPAQLLT
FT                   QRLRGALSGRGAVLEGDDGVRAPVLKVELSEFEQVFDGRSQSHAAVTARATLTQDGKVL
FT                   GQRTFVSRAPASTPDAAGGAQALATASDEFVAQLVAWLGVQTYAATP"
FT   gene            419457..420650
FT                   /locus_tag="BTH_I0377"
FT   CDS_pept        419457..420650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0377"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36964"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L4"
FT                   /protein_id="ABC36964.1"
FT                   /translation="MTPAARRQRRHSTLARQAFAVYAALVVYASLYPFAGWRSLGIGPF
FT                   DFLLAPLPRYLTAFDVVSNVIGYLPFGALAVLALYPLRGVPAALVATLLGALLSGAMEA
FT                   LQTYLPTRVSSNLDLAANALGALVGAAAAAPAATALIERGIVRRVRFAWFEREASTPLF
FT                   LSALWAGAILFPSPFLFGIGDWPSELWARADVSMRGALLAWAPSAWNVPAWPDRLDGLM
FT                   SDSAWETLLAALGLFAALAVASLAMRERAPRVRLVVGFTALALALKAAATFMQSYTGLV
FT                   FDWATPGALRGIAAGLVAAIVALRLPGAWRVALAAAALAVALALVNVLPVNPFFDFALS
FT                   GWRQGRYVHFNSIARWLAWFWPYAALVWLAGRAERAWLAKHGAGASRGASGKRRRSL"
FT   gene            420799..421116
FT                   /locus_tag="BTH_I0378"
FT   CDS_pept        420799..421116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0378"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37694"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L3"
FT                   /protein_id="ABC37694.1"
FT                   /translation="MDPYYRHHVFFCLNQREKDAERPSCANCGAQEMQEYAKKRVKELG
FT                   LAGAGKVRVNKAGCLDRCEEGPVVVVYPEGTWYTYVDKNDIDEIVESHLRDGQVVERLR
FT                   I"
FT   gene            421163..421807
FT                   /locus_tag="BTH_I0379"
FT   CDS_pept        421163..421807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39235"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L2"
FT                   /protein_id="ABC39235.1"
FT                   /translation="MNAHTQKSLIAGPVGNIEIAIDLPDAVRDGSAAPRGIALVAHPHP
FT                   LFGGTMDNKVAQTLARIFVQLNYAVIRSNFRGVGATEGEHDNGVGEADDLLAVLAHMRA
FT                   LPGHADLPIVLAGFSFGTFVLSHVGKRLRDAGQAIERMVFVGTAASRWQVADVPEDTIV
FT                   IHGEHDDTVPIAAVYDWARPQELPVVVIPGAEHFFHRKLHILKRVIVGAWR"
FT   gene            422220..423530
FT                   /locus_tag="BTH_I0380"
FT   CDS_pept        422220..423530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0380"
FT                   /product="D-alanyl-D-alanine carboxypeptidase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00768;
FT                   match to protein family HMM PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36692"
FT                   /db_xref="GOA:Q2T1L1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L1"
FT                   /protein_id="ABC36692.1"
FT                   /translation="MRLSSLGLTSLASSTAIAVAARNVALGIVLPAALVSTIAVAQAKP
FT                   AAKAKHAAAPAAAAPTGAPATYAPGAVPPPGVNARSWVLVDASSNQVLASGNADERVEP
FT                   ASLTKLMTAYLVFEALDAKKITMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLVYG
FT                   MIIQSGNDAAIALAELVGGSEAQFVNMMNAEAQRLGMKNTHFADVNGMPDPNHYTTAGD
FT                   LATLSTHLIRDYPDYYNIFSVKEFTYNNIKQPNRNRLLWLDPTVDGLKTGHTQAAGYCL
FT                   IASAKRSLPGAADATRRLVTVMMGETKESDRVQDSMKMLNYGYTAFDSVRLYKAGQPID
FT                   TPRVYKGKSNNVQVGVKKDQFITVPRGLADKVKPEVALNAPLIAPLADGQAVGSVKLVA
FT                   DGKTVAEFPVVALQPVPEAGLLGRIWDSILLMFSKKK"
FT   gene            423615..424526
FT                   /locus_tag="BTH_I0381"
FT   CDS_pept        423615..424526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0381"
FT                   /product="D-amino acid aminotransferase"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37383"
FT                   /db_xref="GOA:Q2T1L0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="PDB:4M0J"
FT                   /db_xref="PDB:4TM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1L0"
FT                   /protein_id="ABC37383.1"
FT                   /translation="MSQADIEPIVYLSVASREELVPLSEARVPVLDRGFIFGDGVYEVV
FT                   PIYAEGARRAPFRIAQHLARLARSLKKIGIADPHDEAGWRALVARLVDANAAALGDGQH
FT                   AIVYIQVTRGVAKRGHAFPANAVPTVFAMASPLALPTDAQRAQGVHCVTAEDRRWLHCD
FT                   IKSVSLLGNVLMAQHAAEHDAAETIQLRDGNVTEGSSSNVWIVKNGELIAPPRSNRILE
FT                   GIRYALVEELAEECGIRFVAREINEAELRAADEILLTSATKEILPVTRLDDLPVQGGRP
FT                   GPVFDALYAAYQRAKAHEMESV"
FT   gene            424560..424868
FT                   /locus_tag="BTH_I0382"
FT   CDS_pept        424560..424868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0382"
FT                   /product="Protein of unknown function (DUF493) superfamily"
FT                   /note="identified by match to protein family HMM PF04359"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38124"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1K9"
FT                   /protein_id="ABC38124.1"
FT                   /translation="MTEPNKTVELTGEIATPKETLLEFPCDFPIKVMGRAHPEFKDTIF
FT                   KVVSVHDNEIDLEKIEERASSGGNYTGLTITVRATSQEQLDNIYRALTGHPMVKVVL"
FT   gene            complement(424902..425864)
FT                   /locus_tag="BTH_I0383"
FT   CDS_pept        complement(424902..425864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0383"
FT                   /product="glycine cleavage system transcriptional
FT                   activator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36465"
FT                   /db_xref="GOA:Q2T1K8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1K8"
FT                   /protein_id="ABC36465.1"
FT                   /translation="MSIRQLPILNALRVFEAAARHESFSRAANELSVTHGAVSHQMRAL
FT                   EAELGVPLFVRHGKRLALTDAGGRYAQQVRAALALLADATREIRASDRDKRLAVSTLPS
FT                   FAARWITPRIGPFIEQHPEIDLELRASDTLVDFARDDVDVAIRFGYGVYPGLYVEPLLD
FT                   ETFFPVCAPTLNGGVLPETPADLVRYPLLRSDDELWRPWFDAAGLDTLTEPKRGVLYQD
FT                   SSNLLQAAIDGQGIALVRRSLAMPEVAAGRIVRLFDIAGPSPWHYFFVCPPSLAQTPRV
FT                   QAFRTWLLDEIARFKVLCATQETRHAAAYAAARALKTGD"
FT   gene            425967..426293
FT                   /locus_tag="BTH_I0384"
FT   CDS_pept        425967..426293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37832"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1K7"
FT                   /protein_id="ABC37832.1"
FT                   /translation="MREISLSMTFEIQPGETVPMKVARSTRLTVRGASVWATRSNDVAD
FT                   YFLLPGDTLKLRRGERLWLSVDGETSACVSFSAIVPPQQAAVSGIVRLAARFVALFRDG
FT                   WRTV"
FT   gene            426393..427160
FT                   /gene="lipB"
FT                   /locus_tag="BTH_I0385"
FT   CDS_pept        426393..427160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="BTH_I0385"
FT                   /product="lipoate-protein ligase B"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36911"
FT                   /db_xref="GOA:Q2T1K6"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1K6"
FT                   /protein_id="ABC36911.1"
FT                   /translation="MPPASDAHAAPDAAASTSASPQSCAAPPDTLPVTVRWLGETPYDA
FT                   CFDAMRAFTDARTPDTGDEIWVVEHPPVYTLGQAGNPAHLLVADSGVPLVKVDRGGQIT
FT                   YHGPGQIVAYLLIDLRRRKLMVRTLVTRIEQAVIETLAAYNLASVRKAGAPGIYVESGP
FT                   HHGAKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCGYAGLETVDMASLGATADWH
FT                   EVARTLVRRLIANLDGATAAAALPQQALEQSND"
FT   gene            427153..428142
FT                   /gene="lipA"
FT                   /locus_tag="BTH_I0386"
FT   CDS_pept        427153..428142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="BTH_I0386"
FT                   /product="lipoic acid synthetase"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38383"
FT                   /db_xref="GOA:Q2T1K5"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1K5"
FT                   /protein_id="ABC38383.1"
FT                   /translation="MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKK
FT                   PEWIRVKAATGSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTR
FT                   RCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIRE
FT                   VREQSPATRIEILTPDFRGRLDRALEILNAAPPDVMNHNLETVPRLYKEARPGSDYAHS
FT                   LKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHL
FT                   PVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV"
FT   gene            complement(428330..429319)
FT                   /locus_tag="BTH_I0387"
FT   CDS_pept        complement(428330..429319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0387"
FT                   /product="quinone oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36620"
FT                   /db_xref="GOA:Q2T1K4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1K4"
FT                   /protein_id="ABC36620.1"
FT                   /translation="MARIVRIHQTGGPDVLRLDEIDPAPPGPGEIALQVKALGLNRAES
FT                   MFRSGHYVEQPVFPARLGYEAAGVVSALGPGVTGFAIGDAVSIVPPLSISRWGTYGEVA
FT                   TVPADVAVKHPASLGWTEAAAVWMQYVTAWGALIDLAQIKRGDAVVITAASSSVGLAAI
FT                   QVARMAGAVAIATTRTDAKAQALREFGADHVIVTQREDLAARVREITGGAGARVAFDPV
FT                   AGPALPQLADALAFGGIVIEYGALAAEQAPFPLFAVLGKMLSVHGYQYKRVVGDPAKLD
FT                   AAKRFVLDGLASGALKPAIDRVFPLDRIADAHRYLESNEQFGKIVVTV"
FT   gene            429423..430337
FT                   /locus_tag="BTH_I0388"
FT   CDS_pept        429423..430337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0388"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38982"
FT                   /db_xref="GOA:Q2T1K3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1K3"
FT                   /protein_id="ABC38982.1"
FT                   /translation="MDRLTSMAVFVKAAETGSFAAAGASLGLSSQMVGKHVRFLETHYG
FT                   MRLINRTTRRQSLTEAGRAFYERSRAVLAEAQAVDALAANLMAAPRGTLRINAPISFGV
FT                   HCLMPMLASYMRAYPEVQIDLTLSDRIVDVVDEGYDAVIRIAPLADSGLIARPLAPYRL
FT                   VLCASPAYLAEHGAPAEPADLAAHECLGFSYSGQPAALEWPFESAQGQQHSVRVRSRLA
FT                   VNNGAALRMAALDGLGIILQPAELVRDDLAAGRLVRLLPGHEPPARPIHVLYSPDRQPT
FT                   PKLRSFIDAVIAAFGERAGDGRT"
FT   gene            complement(430438..432327)
FT                   /locus_tag="BTH_I0389"
FT   CDS_pept        complement(430438..432327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0389"
FT                   /product="gamma-glutamyltransferase"
FT                   /note="identified by match to protein family HMM PF01019;
FT                   match to protein family HMM TIGR00066"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37984"
FT                   /db_xref="GOA:Q2T1K2"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1K2"
FT                   /protein_id="ABC37984.1"
FT                   /translation="MTDRIRPRPSRSRAGAIAAAFFAVAAAGCANAPGPSAQNAAASAS
FT                   AASAASAASATPGASPSEPAELSSWVDKPGWTAQRDMIAAAHPLAAQAGQEMLKAGGTA
FT                   VDAAIAAQMVLMLVEPQASGIGGGAFLLHANGKTVEAYDGRETAPAAATDRLFYGADGK
FT                   PLPRAAPGARTVGVPGVLRMLELAHRAHGKLPWRRLFQPAIRLAEQGFPLGPRLAAALA
FT                   NDPSLASDPAARACFYDKNGAPKPAGATLRNPQLAATLKLVAAHGANAFYTGAIARDIV
FT                   AKVRQAPNPGVLSVQDLARYRAKVREPLCADYRKWIVCGMPPPSAGGLVVAQILGLLEA
FT                   QPDWRQIGAQKPVRNATGVEPTPFAAHQFSEAGRLAYADRAQYVADPDFVAPPGGSWTS
FT                   LVERRYVAERARLIGDASAGTASAGSPSGLPPASAADRGAEPPSGSQITVVDRYGNAVS
FT                   MTSTLDERFGSRLMVRGFLLNSQLLDFSPVSAEHGKPVANRVQPGKRARSTLAPELVFE
FT                   KGSQRLMMALGSAGGAFAANDVAKTLVGMIDWGMTMQQAIALPNFGSRNGPTELEKGRV
FT                   SDALAQALKERGHDVRVVELGSSLQGIQRINVEGQSVWFGGSDPRSDGVVSGD"
FT   gene            432110..432469
FT                   /locus_tag="BTH_I0390"
FT   CDS_pept        432110..432469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0390"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1K1"
FT                   /protein_id="ABC37948.1"
FT                   /translation="MSTQLDSSAGSDGDAPGVAEAAEAADAADADAAAFCALGPGAFAH
FT                   PAAATAKKAAAIAPARERDGRGRIRSVMNTSVRTKDDGRRRQTTARANANARAASRGRG
FT                   IVAAPQAACHPTINP"
FT   gene            432520..433380
FT                   /locus_tag="BTH_I0391"
FT   CDS_pept        432520..433380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37742"
FT                   /db_xref="GOA:Q2T1K0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1K0"
FT                   /protein_id="ABC37742.1"
FT                   /translation="MVRRRRRDGRGPLRAGRPRACATARAVCIGNRLRHRAARLYPVAA
FT                   PRTISPSLEGAGSGPRAIAFGIVALARAATRARSGIGRRARGCERSCAFPARWPSPAPA
FT                   ATIGEARSCCDGRTRVVAAPMPARRRSAGARHFPAHAPRRTETLDRRTFGHEHMQEPSD
FT                   ERSRRTRHAPAAGHPPPVRPRALVRAYGFALAAILVIALFPVLSAAAAGLVADAAGCEL
FT                   NEAAVHPCLIGGIDFGEALYAMGVLGWLMLGSLPIGGMLLTGWVVALLVHLRRLRAMRR
FT                   TGARR"
FT   gene            complement(433478..434380)
FT                   /locus_tag="BTH_I0392"
FT   CDS_pept        complement(433478..434380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0392"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36822"
FT                   /db_xref="GOA:Q2T1J9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1J9"
FT                   /protein_id="ABC36822.1"
FT                   /translation="MDLNALTLLVDILDAGNLSKAAQRLKMSRANVSYRLNQLEKSIGL
FT                   QLVRRTTRRIEPTEIGLRLYEHGRRIQNELLAAREAVTTLGQDLQGRVRLSVPSGYGQL
FT                   VMSNWLIAFKRLYPGIVLDVVFENRIEDLMRDEVDIAVRVMSEPPQNLVARDMGAVRYV
FT                   ACASPGFAATHGMPTELDQLFDAPVITSTVVGRQLRVAAYLGDERHEVLLEPTLISENF
FT                   LFLRQAILSGLGVGIVPDYVVHDDVRRGAVVTTLDAYRLSIFGTHMYMLYMPNRHHTRA
FT                   TSTFIDFVLDEARNAGRGG"
FT   gene            434539..436665
FT                   /locus_tag="BTH_I0393"
FT   CDS_pept        434539..436665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0393"
FT                   /product="fatty oxidation complex, alpha subunit, putative"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM PF00725; match to protein
FT                   family HMM PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39142"
FT                   /db_xref="GOA:Q2T1J8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1J8"
FT                   /protein_id="ABC39142.1"
FT                   /translation="MNQQASHATGTVTRERRDKVLVVTIDHPPVNALSADVRRGLVDAL
FT                   DAADADAAVGAVLIVGAGRNFIAGADIREFGKPPVPPLLPDVCNRIETSGKPVVVALHG
FT                   AALGGGLEIALAAHYRIAVPGAKLGLPEVQLGLLPGAGGTQRTPRLIGAKAALDLMLSG
FT                   RHASAEEALTLGLVDRLAHSDDTLAEGLAYVHELLAAGAPARRTRDAQGLADRAAAEAA
FT                   LEAARADVAKKSRGLFSPAKIVDAVAAALALPFDEGLRTERRLFVECLDSPQRAGLVHA
FT                   FFAEREAAKSPETRRGVPRAIERIGVVGGGTMGAGIAVAALDAGFPVTMIERDDASLER
FT                   GRAHVEKVYAGLVAKGRMTPAAQAARLARFKGGTSYDALAQADVVIEAVFEDMAVKKSV
FT                   FAELARACKPGAVLATNTSYLDIDEIAASVERTPDVIGLHFFSPANIMKLLEVVVPAKV
FT                   SADVVATAFELAKKLRKIPVRAGVCDGFIGNRVLAVYRTAADYMMEDGASPYQIDRAIR
FT                   EFGFPMGPYQVVDLAGGDIGWATRKRRAPTRDPRLRYVEIGDRLCERGWFGQKTGRGYY
FT                   LYPDGARAGAPDPEVEAIIAEARAKKGVSPRAFTDDEIVRRYLAAMINEGANVVHEKIA
FT                   LRPLDVDAVFLHGYGFPRYRGGPMHYADTVGLANVLADIRAFASEDPVFWKPSPLLVDL
FT                   VARGETFASLNRID"
FT   gene            436720..437931
FT                   /locus_tag="BTH_I0394"
FT   CDS_pept        436720..437931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0394"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39194"
FT                   /db_xref="GOA:Q2T1J7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1J7"
FT                   /protein_id="ABC39194.1"
FT                   /translation="MDLNFTAEEEAFRAQVQRFLADELPPRISRKVKGGLRLTRDDMRE
FT                   WHAILNARGWLASHWPREWGGPGWSVAQKFLFDNECAIAGAPRIVPFGVNMLGPVLIRY
FT                   GSEAQKRRWLPRILDGTDWWCQGYSEPGAGSDLAAVKTSAVRGVDAQGDHYVVNGQKTW
FT                   TTLGHYANMIFCLVRTATDVRKQEGISFLLVDMNAPGVEVRPIVTLDGEHEVNEVFFTD
FT                   VRVPAENLVGEENRGWTYAKYLLTYERTNIAGVGFSVAALDRLRAVAAKVKRNGRPLAD
FT                   DPLFAARLARVEIELDNMKTTNLRVLAAVAGGGAPGAESSMLKIRGTQIRQEISSLMRR
FT                   AMGPYAQPFVDEALDADYDGEPLGGLPEAASAATQYFNNRKLSIFGGSNEIQKNIISKT
FT                   MLGL"
FT   gene            437941..439071
FT                   /locus_tag="BTH_I0395"
FT   CDS_pept        437941..439071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0395"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36305"
FT                   /db_xref="GOA:Q2T1J6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1J6"
FT                   /protein_id="ABC36305.1"
FT                   /translation="MDFRYTEDRRMLADSLNRFIAEQYPFAARDRIALSEPGYSDDMWR
FT                   RFAELGAIGALFPEDCGGLGGAGFDIALVFECLGRGLVVEPFAGALMTGRALAQAGGDA
FT                   HRARLADLIEGRAIGAFAHAEPGTHYEPYTVRTRAAREGGRWVLDGAKAVVDCGEHATF
FT                   FVVSARTAGADDAAAGLSLFVVPKTAPGVTARGYRKIDGGRAADVRFERVALADDALVG
FT                   APGEAADAIERALGFGLLALAAEALGAMDVAKAYTLEYLRTRRQFGVPIGSFQALQHRM
FT                   AELLLEIEQARSAVINAAAQLDAPRVARERALSAAKYSVGRIGALVAEESIQLHGGIGM
FT                   TWELPLAHYAKRLVMIDHQLGDEDHHLARYVALSKQ"
FT   gene            439097..440302
FT                   /locus_tag="BTH_I0396"
FT   CDS_pept        439097..440302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0396"
FT                   /product="CAIB/BAIF family protein"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37793"
FT                   /db_xref="GOA:Q2T1J5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1J5"
FT                   /protein_id="ABC37793.1"
FT                   /translation="MRNEPGAQPLAGIKVLDFSRVLAGPWCAMVLADLGAEVIKVEHPR
FT                   RGDDTRDWGLRVGDTETTYFNSVNRSKRSICVDLQTEAGRRIARGLAAQADVVVHNFKA
FT                   GGAEKLGLGYDALAELNPRLVHCAISGYDRSGPEASRPGYDLVVQGEAGLMALNGEAGR
FT                   PPLKFGVAVADLFTGMYSAQAILAALYERHATGRGRRIEMALFDCGLMVTSYYGLEALL
FT                   MGEDPPRYGNAHPSIVPYGVFDAADGPIVITVGNNPQFARFCDVIGRPELAADARFATN
FT                   IARSANRAELLPEILRELGRRPRAALLAALADAGIPCGEVLGLREALMSERARSAGLVT
FT                   RQPHPVAGDVDVLAPPYRFDGERLPVRGAPPVLGADTERVLGDWLGMSGPEIAQLRSER
FT                   VV"
FT   gene            440441..440746
FT                   /locus_tag="BTH_I0397"
FT   CDS_pept        440441..440746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0397"
FT                   /product="Protein of unknown function, DUF485 superfamily"
FT                   /note="identified by match to protein family HMM PF04341"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36348"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1J4"
FT                   /protein_id="ABC36348.1"
FT                   /translation="METSVIETVVACRDYQQLVRARRRFSFMLTALMIATYYGFILLVA
FT                   LAPRTLAAPLYAGATISVGVVAGVAIIFVAVGLTAGYVLRANRSFDRSVDALFNRS"
FT   gene            440758..442473
FT                   /locus_tag="BTH_I0398"
FT   CDS_pept        440758..442473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0398"
FT                   /product="sodium:solute symporter family protein"
FT                   /note="identified by match to protein family HMM PF00474;
FT                   match to protein family HMM TIGR00813"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37250"
FT                   /db_xref="GOA:Q2T1J3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1J3"
FT                   /protein_id="ABC37250.1"
FT                   /translation="MLRQSIARAARLMPAALFACAALACAPAHAMGVAAAPMPDKVALN
FT                   PVAIGMFFVFVFATLALTRWAARRTRSARDFYTAGGGITGLQNGLAIAGDYMSAASFLG
FT                   LSGMVFMFGFDGLIYSIGFLVGWPFVMFLIAEPLRNLGKFTFVDVVAYRFAQRPIRLLT
FT                   SANALTIVVLYLVVQMVGAGKLIQLLFGLSYGTAELIVGALMVVYVFFGGMTATTWVQM
FT                   IKAVLLLAGATLLAALALGEFGFSVDEMFRRAVAVHPGALGIMGPGKLIRDPANALSLG
FT                   IALMFGTAGFPHILMRFFTVPNAKEARKSVLYATGFIGYFYLLTFVIGFSAIVLLAQHP
FT                   EFFRHDAAGAFNLTRDLVGGSNMVAVKLAQAVGGNWFYGFIAAVTFATILAVVAGLTLA
FT                   GATTISHDLYAQMWARGRPDERLEMRISRAATLALSAVAIGLSILFEHVNVAFMVGLVA
FT                   AVAASANFPVLATSIFWRGMTTRGAVLGGGLGLASAVALTLLSKSVWVDVLHHAHAPVF
FT                   LDNPALVSVPLAFAGIVIGSLTDRSERARRERDAFARQEFYAQTGVLAAQAATH"
FT   gene            442791..444125
FT                   /locus_tag="BTH_I0399"
FT   CDS_pept        442791..444125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0399"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38049"
FT                   /db_xref="GOA:Q2T1J2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1J2"
FT                   /protein_id="ABC38049.1"
FT                   /translation="MTPTCFDPPSLFSGTIVKKPFYKVLYVQVIFAIVVGVLLGHLYPS
FT                   LAVDMKPLGDGFIKLIKMVIGPIIFCTVVTGIAGMQDMKKVGRVGGKALLYFEIVSTFA
FT                   LVLGLAATHILRPGVGFNIDPATLNGKEVASYAAKAHGQSTVDFLMHIIPNTMIDAFAQ
FT                   GEILQILLIALLFGSVLAHLGERGRVVTDFIDGITRVLFGIVHIVTKLAPVGAFGAMAF
FT                   TIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLGAIARFTGFSIVRFVGYIKEELLIVLG
FT                   TSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATNIEL
FT                   TWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAVVPTIPLSGMVLILGIDRFMSECR
FT                   ALTNIVGNGVATVVVSAWEKELDRAKLHAALSGNGKAAAGEAARV"
FT   gene            444128..446161
FT                   /gene="dctB"
FT                   /locus_tag="BTH_I0400"
FT   CDS_pept        444128..446161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB"
FT                   /locus_tag="BTH_I0400"
FT                   /product="C4-dicarboxylate transport sensor protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39094"
FT                   /db_xref="GOA:Q2T1J1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1J1"
FT                   /protein_id="ABC39094.1"
FT                   /translation="MCAETAGRAAAPAPGGAGPGASKRASHGPAAFSGGGYATIDDPYS
FT                   PEAVTVKRRLLVVLALAAMLAAACALTWTVTWRRGIADLRDSAAARVDRTTNALKSTLD
FT                   RYESLPYLLGGHPFVQDVLAAPGNHRYVNRANVYLEDMNRHAHATATYVITANGLCVAA
FT                   SNWRGPDSFTGIGYQFRPYFIDAVKGGTGRFFGIGTISRDPGYYISQPVRRDGKIIGVA
FT                   VVKLNLEWFQGADASEPLVVADDHGVIFLSSVPAWKYHTLKPLPGPIATSIHETRQYAQ
FT                   YPVTPLPLRVERVLGPDAQIVRMGAGRRSPRYLATRRLLGEPDWQLVTLAPIEPVDVDA
FT                   RNATIVTAFGFVSLGLLAFYWRARRARVQEMLRSRVLLQSAYAELNRRVEERTADLSQA
FT                   NARLKKEVGERIRAEQELRAAHDELVQASKLAALGQMAAGITHELNQPLAALRSFSDNT
FT                   RVLLDRGEQAAARENLEAIAALTERMGKITNQLKLFVGRAKPRNERAHVARALRNALAL
FT                   LEERMRGVELAIVLRDETRDPVEAVRFDPSRDEPALVARCEDLRLEQVLINLLGNALDA
FT                   VAAAAAPRIDVTIDATAATLAIAVRDNGPGIAPESLARLFEPFFTTKEMGRGLGLGLAI
FT                   SSSIARDAGGSLTARNAPAGGAEFVLTLRRARTHHPDTSAAS"
FT   gene            446210..447565
FT                   /locus_tag="BTH_I0401"
FT   CDS_pept        446210..447565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0401"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954; match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39349"
FT                   /db_xref="GOA:Q2T1J0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1J0"
FT                   /protein_id="ABC39349.1"
FT                   /translation="MANRLQVIYIEDDELVRRASVQSLQLAGFDVVGFGSVEAAEKAIV
FT                   GDAAGVIVSDIRLPGASGLDLLAQCRARTPDVPVVLVTGHGDISMAVQAMRDGAYDFIE
FT                   KPFAAERLIETARRALERRALVLENHALRRELAGQGVVAPRIIGRSPAIEQVRRLIANV
FT                   APTDASVLINGDTGAGKELIARSLHELSPRRDKPFIAVNCGALPEPMFESEMFGYEPGA
FT                   FTGAAKRRIGKLEYASGGTLFLDEIESMPLALQVKLLRVLQDGVLERLGSNQPIRVNCR
FT                   VVAAAKGDMSEHVAAGTFRRDLLYRLNVVTIALPPLAERREDIVPLFEHFMLDAAVRYG
FT                   RPAPLLTDRQRASLMQRDWPGNVRELRNAADRFVLGVTEGFVGDAGGPTDESAEQSLKE
FT                   RVEQFERAVIAETLNRTGGAVATTADKLHVGKATLYEKMKRYGLSAKGETER"
FT   gene            complement(447647..448183)
FT                   /locus_tag="BTH_I0402"
FT   CDS_pept        complement(447647..448183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36420"
FT                   /db_xref="GOA:Q2T1I9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I9"
FT                   /protein_id="ABC36420.1"
FT                   /translation="MSPAPAPTGRRTGPLRYVAIAVAAVAIAVAGYFAFNGKSSAPEAT
FT                   FTLLSGQKISTAADLKGKVYLVNFWATSCATCMQEMPQMVDTYNRFKGQGLEFVAVAMN
FT                   YDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVIGKDGKILKRYVGAPQF
FT                   AELDQLLQKALDTSA"
FT   gene            448354..449067
FT                   /locus_tag="BTH_I0403"
FT   CDS_pept        448354..449067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37572"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I8"
FT                   /protein_id="ABC37572.1"
FT                   /translation="MIRAALRYARSLRFRSTGRPGVCAPSARLHPPGLTHGRVRRVWLS
FT                   ARARRAAVVLGALALLAACSPAYDWRTLHNDAGYTIDLPAKPTVEEHPVAIGGAPMKMR
FT                   MQAAHVGGAVFAVGTVMLPDDRDATRHAVLDYLRTGLARNLRAQPDERAVLVPLAAGGQ
FT                   TAGIELRMSGAPAGAPGASGADRQAQGASGARASKTVIARLVAHGRHVYEVIVISDAPL
FT                   ASEPLEQFFGSLKLD"
FT   gene            complement(449772..450551)
FT                   /locus_tag="BTH_I0404"
FT   CDS_pept        complement(449772..450551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0404"
FT                   /product="thioesterase domain protein"
FT                   /note="identified by match to protein family HMM PF00975"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38199"
FT                   /db_xref="GOA:Q2T1I7"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I7"
FT                   /protein_id="ABC38199.1"
FT                   /translation="MALLPGTLTIPDRREHARHRLLMFHHACGSATNYFRWAAAFPPHI
FT                   EVWLVELPGRGRSLKHSAFDTLPPLRDYLRELAPELPANYAIFGHSMGALVAYCFAHDM
FT                   AQLGRAPRWLGVSGADSPFAESRRRAFPVHQRPDAAIVEHLATLGGTPPEVFAHDELRT
FT                   MLLQLAKADFRIVEAFFPLASATPLPVPVTVFAGAQDAVLSEAGLQDWQRASTLPIERE
FT                   TFDGGHFYLLDTPSAIHRAIDAALTKHDLPASLPVVL"
FT   gene            complement(451026..452606)
FT                   /locus_tag="BTH_I0405"
FT   CDS_pept        complement(451026..452606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0405"
FT                   /product="Mg chelatase-related protein"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM TIGR00368"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37748"
FT                   /db_xref="GOA:Q2T1I6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I6"
FT                   /protein_id="ABC37748.1"
FT                   /translation="MSLAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRES
FT                   RERVRAALQNCGFEFPVRRITVNLAPADLPKESGRFDLPIALGILAASGQLPAGALDGR
FT                   EFAGELSLTGALRPMRGAFAMACGAARGQQADEDGSSADGGAPLAVMTAVAELYLPLPS
FT                   AAEAALVPGVTVYGAADLPALCAHLADAPDGRLAPVAAPRLDDLPAASAPDLADVIGQT
FT                   GAKRALEVAAAGGHHMLMIGPPGAGKSMLAARLPALLPPLTDDEALTSAAILSSSRAGF
FT                   SPAQWRRRPFRTPHHSSSSAALVGGRNPPQPGEITLAHLGVLFLDELPEFDRHVLETLR
FT                   EPLEAGRITISRAALQADFPAACQLIAAMNPCPCGWRGDPGGRCRCSPDIAARYLRKLS
FT                   GPLLDRIDIQIEIPALTPAELAERPATAGESSKTVAARVALARERQFARQRKTNHMLTG
FT                   RETDAFCRPDSTGETLLRDAGERFRWSARAYYRVLKVARTIADLAGDDAPSAAHIAEAI
FT                   RYRRVFSPV"
FT   gene            complement(452747..453352)
FT                   /locus_tag="BTH_I0406"
FT   CDS_pept        complement(452747..453352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0406"
FT                   /product="Protein of unknown function (DUF526) family"
FT                   /note="identified by match to protein family HMM PF04380"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38598"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I5"
FT                   /protein_id="ABC38598.1"
FT                   /translation="MVVVPSLLQCMAEHLQQLACHVGSRRSRQAFTQISGVGARLRERK
FT                   RALAERPTRARFAGVLKGRLLECTHVRRIANAASRDRMPGKRACGRTNFGHAHFVGTTA
FT                   TAIAQILCTWKGNTMKQPSDVFNGLQARIGDLLKNSPAKDVERNVKAMLTQGFSKLDLV
FT                   TREEFDTQTQVLARTRARLEELEKRVAELEQKLADVQS"
FT   gene            453367..453705
FT                   /locus_tag="BTH_I0407"
FT   CDS_pept        453367..453705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0407"
FT                   /product="Nitrogen regulatory protein P-II"
FT                   /note="identified by match to protein family HMM PF00543"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36501"
FT                   /db_xref="GOA:Q2T1I4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I4"
FT                   /protein_id="ABC36501.1"
FT                   /translation="MKLITAIIKPFKLDETREALSALGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKMKIEAAVSDDLVDQAVEAIERAARTGKIGDGKIFVTSIEQVIRIRT
FT                   GETGADAL"
FT   gene            453804..455213
FT                   /gene="amt"
FT                   /locus_tag="BTH_I0408"
FT   CDS_pept        453804..455213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt"
FT                   /locus_tag="BTH_I0408"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909;
FT                   match to protein family HMM TIGR00836"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37395"
FT                   /db_xref="GOA:Q2T1I3"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I3"
FT                   /protein_id="ABC37395.1"
FT                   /translation="MADDASSAPAAASAATASDTSASAAVASAPAAASAAASAAAPASA
FT                   AAAPAAPTAPTAPFSVDSSKINSGDTAWMLTSTALVLFMTIPGLALFYGGMVRKKNVLA
FT                   TVMQSFAITALITVLWTVVGYSLAFTPGNGFIGGFSRVFLSGMNYIHGDKATTLTVSHL
FT                   AQTIPESVYFVYQMTFAIITPALICGAFADRMKFSAMLVFMTLWSLIVYVPIAHMVWEP
FT                   TGWLSSDGVLDFAGGTVVHINAGIAGLVSCLMLGKRVGYGREAMAPHNLVLTLIGGSML
FT                   WVGWFGFNAGSAVAADGRAGFAMLTTQVATACAALGWMFAEWIAKGKPSVLGIVSGAVA
FT                   GLVAITPAAGFVGVAGALTIGVAAGVVCFWSATWLKHKLGYDDSLDAFGVHGVGGILGA
FT                   LLTGVFAVKDIGGVDGSLLLQAKGVAITLVYSGIVSFVLLKVIDLVIGLRVTEEEEREG
FT                   LDVILHGEHVE"
FT   gene            455543..456832
FT                   /gene="gshA-2"
FT                   /locus_tag="BTH_I0409"
FT   CDS_pept        455543..456832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA-2"
FT                   /locus_tag="BTH_I0409"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM TIGR02049"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39535"
FT                   /db_xref="GOA:Q2T1I2"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I2"
FT                   /protein_id="ABC39535.1"
FT                   /translation="MVPHLVTALNGPLLELERKILDATPAIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDANLFPGAFNNLPPEVLPLAVQAAMAAIEKICPDAKNLLVIPELPT
FT                   RNAFYLENVARLATIMRQAGLNVRFGSLDPGIVEVTPITLADGQKIVLEPLERTPRRLG
FT                   LKNFDPCSILLNNDLSAGIPSVLENLHEQYLLPPLHAGWAVRRKSTHFSCYDDVAKKFA
FT                   KMVGVDPWMLNPYFSHVEGVDWHANDGGEALAEAIDAVLKKIARKYREYGIGEKPYVVV
FT                   KADAGTAGRGVMTVHDASEIGRMTKHERAQMAESKAGVPVRDVIVQEGVYTFERIGDEV
FT                   AEPVVYMIDRYVVGGFYRTHGARERDQNLNAPGMHYVPLGFEHTALPDTHAKPGAAPPN
FT                   RFYMYGVVARLGLLASSVELEKTDPEAIQV"
FT   gene            456860..457816
FT                   /gene="gshB"
FT                   /locus_tag="BTH_I0410"
FT   CDS_pept        456860..457816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="BTH_I0410"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="identified by match to protein family HMM PF02951;
FT                   match to protein family HMM TIGR01380"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38825"
FT                   /db_xref="GOA:Q2T1I1"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I1"
FT                   /protein_id="ABC38825.1"
FT                   /translation="MDILFIADPLERFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWT
FT                   GAGVEADVRRVAIAGDTADLHRDRWYEAGPRESRALPSFGAILMRKDPPFDMEYVTSTW
FT                   LLELAERAGARVFNKPQTIRDHSEKLAIGEFAQFVAPSLVTRDAARLRAFHAEHGDVIL
FT                   KPLDGMGGMGVFRVKADGMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEP
FT                   VPYSLARIPQGNEVRGNLAAGGVGVAQPLTARDREIAATLGPVLAARGLLLVGLDVIGD
FT                   WLTEVNVTSPTCFREIMEQTGFDVAGMFVDALERAVG"
FT   gene            457941..458459
FT                   /locus_tag="BTH_I0411"
FT   CDS_pept        457941..458459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0411"
FT                   /product="PTS system, fructose-specific IIA component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38418"
FT                   /db_xref="GOA:Q2T1I0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1I0"
FT                   /protein_id="ABC38418.1"
FT                   /translation="MRQARRSGRTRCKADMAGILIIAHAPLATALRDCIAHIYGGVPAR
FT                   IGCIDVQADNDPAQVMAFAHAELARLKEENGALVLTDMYGATPANIAGQLAKVDGVRVL
FT                   AGVNLPMLVRAVCYRTTPLDTLVDKALAGSTKGIHEIAAGTPPPRPSALGCGECAPIPP
FT                   EPKAQTQPH"
FT   gene            458536..458805
FT                   /locus_tag="BTH_I0412"
FT   CDS_pept        458536..458805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0412"
FT                   /product="phosphocarrier protein HPr"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM TIGR01003"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36541"
FT                   /db_xref="GOA:Q2T1H9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1H9"
FT                   /protein_id="ABC36541.1"
FT                   /translation="MLQQETTIVNKLGLHARASAKLTQLAGNFQSEVWMTRNGRRINAK
FT                   SIMGVMMLAAGIGSMVTIETEGPDEQEAMDALLKLIADKFGEGQ"
FT   gene            459002..460774
FT                   /gene="ptsI"
FT                   /locus_tag="BTH_I0413"
FT   CDS_pept        459002..460774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="BTH_I0413"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF02896; match to protein
FT                   family HMM PF05524; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39236"
FT                   /db_xref="GOA:Q2T1H8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1H8"
FT                   /protein_id="ABC39236.1"
FT                   /translation="MSFTLHGIPVSRGIAIGRAYLIAPAALDVAHYLIEAERIEAEIER
FT                   FRAALDAVRRELDALRADLSDDTPTEVAAFIDVHAMILGDAMLVQETIDLIRTRRYNVE
FT                   WALTEQLDVLAGHFDDIEDEYLRERRADIEQVVERVLKALAGAPSAAQALDRAAGNGRD
FT                   EMIVVAHDIAPADMMQFKTQSFQAFVTDLGGRTSHTAIVARSLGIPAAVGVQHASALIR
FT                   QDDLIIVDGDQGIVIVDPAPIVLEEYSYRQSEKALEQRKLQRLKFSPAQTLCGTKIDLL
FT                   ANIELPDDAKAAVDAGAVGVGLFRTEFLFMSKERMPEEEEQFAAYKRAVELMHGMPVTI
FT                   RTIDVGADKPLDAHDEGYETAPNPALGLRAIRWSLSEPQMFLTQLRAILRASAFGQVKI
FT                   LVPMLAHAQEIDQTLDLINEAKRQLDAAGLAYDPNVRVGAMIEIPAAAIALPLFLKRID
FT                   FLSIGTNDLIQYTLAIDRADNAVAHLYDPLHPAVLHLIAFTLREAKRAGVPASVCGEMA
FT                   GDPALTRLLLGMGLTEFSMHPSQLLVVKQEILRAHLKALEKPTADVLAAFEPEEVQAAL
FT                   KRLASAEPKADVAA"
FT   gene            complement(460925..461749)
FT                   /locus_tag="BTH_I0414"
FT   CDS_pept        complement(460925..461749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0414"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38535"
FT                   /db_xref="GOA:Q2T1H7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1H7"
FT                   /protein_id="ABC38535.1"
FT                   /translation="MARFLCAPRIIFETVLPPCGPTMNDEQLLRYSRHILVDEIGIEAQ
FT                   QRFLDAHAIIVGAGGLGSPAAMYLAAAGVGTITLADADTVDLTNLQRQILHVSASVGRK
FT                   KVESGRDALAQLNPDVKVNALAERVDDAWLNAHVPHASVVLDCTDNFATRHAINRACVA
FT                   HRVPLVSGAALRFDGQISTFDFRDPGSPCYACVFPEDQPFEEVACSTMGVFAPTVGIIG
FT                   AMQAAEALRVIGGIGTTLVGRLMMLDSLRMEWSTMKIARQPDCPVCGSGGTH"
FT   gene            complement(461792..463357)
FT                   /locus_tag="BTH_I0415"
FT   CDS_pept        complement(461792..463357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0415"
FT                   /product="carboxy-terminal protease"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38444"
FT                   /db_xref="GOA:Q2T1H6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1H6"
FT                   /protein_id="ABC38444.1"
FT                   /translation="MRMKLKNIGLIAAGLATGVFATLQISASAQQAVTTAAAPLPLDQL
FT                   RLFAEVFGQIKREYVEPVDDKKLLTAAIKGMVSSLDPHSSYLDKTDYQELQEQTKGRFA
FT                   GLGIEISQEDGLVKVISPIEDTPAFRAGIRPGDLITRINDRPVRGMTLDKAVKQMRGEP
FT                   GTKVTLTIFRKSDDRTFPVTVTRAVIRVQSVKMKLLDPGYAYIRITSFQERTTPDLAAK
FT                   LQDIARQQPKLKGLILDLRNNGGGLLQSAVGVAGAFLPPDSVVVSTNGQIPDSKQVYRD
FT                   NYENYRLPSFDSDPLKNLPAVFKTVPMVVLTNAYSASASEIVAGALQDSHRALIMGKAT
FT                   FGKGSVQTVRPMTADSALRLTTAYYYTPSGRSIQNKGILPDIPVDQYADGDPDDVLVTR
FT                   EVDYTNHLANTQDPNEKKELEEREQRRMEQLRLLEEQNDKKTPEQRQKDRERKPVEFGS
FT                   ADDFMMQQALNKLEGKPVVQSKMIAADSTAKSPAAKASAAPAPKGAAAKPASAAKPASA
FT                   PQPQ"
FT   gene            complement(463539..464291)
FT                   /locus_tag="BTH_I0416"
FT   CDS_pept        complement(463539..464291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0416"
FT                   /product="phosphoglycerate mutase"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR01258"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37707"
FT                   /db_xref="GOA:Q2T1H5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1H5"
FT                   /protein_id="ABC37707.1"
FT                   /translation="MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNSEARQAGLLLKE
FT                   AGYTFDIAYTSVLKRAIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAK
FT                   YGDEQVLVWRRSYDTPPPALEPTDERAPYGDPRYAKVPREQLPLTECLKDTVARVLPLW
FT                   NESIAPAVKAGKQVLIAAHGNSIRALVKYLDGISDADIVGLNIPNGVPLVYELDANLTP
FT                   IRHYYLGDPEAIAKAQAAVAQQGKASAA"
FT   gene            464425..464832
FT                   /locus_tag="BTH_I0417"
FT   CDS_pept        464425..464832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0417"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38830"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1H4"
FT                   /protein_id="ABC38830.1"
FT                   /translation="MTFFTDYTNLALIAILVVSGGLLAWPALRRGGGGLSAAEATQLIN
FT                   RRNAVVVDLRPAAEYGAGHLPSARSVEFGELQAKAGQLSKNKATPVLLVCQNGQQSQKA
FT                   RKIVEEAGYQDVHVLQGGVAAWQQAGMPVVK"
FT   gene            464853..465104
FT                   /gene="grxC"
FT                   /locus_tag="BTH_I0418"
FT   CDS_pept        464853..465104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="BTH_I0418"
FT                   /product="Glutaredoxin, GrxC family"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02181"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38120"
FT                   /db_xref="GOA:Q2T1H3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1H3"
FT                   /protein_id="ABC38120.1"
FT                   /translation="MVMYSTQVCPYCMQAERLLKLRGVEHVEKVLIDKEPERRAEMMER
FT                   TGRRTVPQIYIGDTHVGGYDDLSKLDREGGLKPLLEAA"
FT   gene            465222..465695
FT                   /gene="secB"
FT                   /locus_tag="BTH_I0419"
FT   CDS_pept        465222..465695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="BTH_I0419"
FT                   /product="protein-export protein SecB"
FT                   /note="identified by match to protein family HMM PF02556;
FT                   match to protein family HMM TIGR00809"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36612"
FT                   /db_xref="GOA:Q2T1H2"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1H2"
FT                   /protein_id="ABC36612.1"
FT                   /translation="MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDV
FT                   KAERLADTVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTI
FT                   LFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEIAQQQGGAPNGTTLN"
FT   gene            465712..466719
FT                   /locus_tag="BTH_I0420"
FT   CDS_pept        465712..466719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0420"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39225"
FT                   /db_xref="GOA:Q2T1H1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1H1"
FT                   /protein_id="ABC39225.1"
FT                   /translation="MLSMKVAVLGAGAWGTALAAHLAARHDTLLWARDAALVAELAARR
FT                   ENVRYLDGVALPPALRYEADLTAALSHAQADDALCVIAAPVAGLRALCRAMRDAGRVPA
FT                   HFVWVCKGFEADTRLLPHQMVAEELPDHASYGVLSGPSFAREVAQGLPVALTVASASAA
FT                   CRGRTLAAFHHGAMRIYTGDDVVGVEVGGAVKNVLAIATGIADGLGLGLNARAALVTRG
FT                   LAEMSRLGVALGGRAETFTGLTGLGDLILTATGDLSRNRTVGLQLAAGRSLDDILAALG
FT                   HVAEGVRCARAVLSIARERGVDMPITEAVCAVLFDGVAPRDAVSGLLRRDAKAE"
FT   gene            466863..467396
FT                   /locus_tag="BTH_I0421"
FT   CDS_pept        466863..467396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0421"
FT                   /product="Appr-1-p processing enzyme family domain protein"
FT                   /note="identified by match to protein family HMM PF01661"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38518"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1H0"
FT                   /protein_id="ABC38518.1"
FT                   /translation="MPNIGSTSVEARVVDITTLALDAIVNAANASLLGGGGVDGAIHRA
FT                   AGPELVKECATLGGCATGDAKLTRGYRLPAKYVIHTVGPVWHGGKRGEAELLASCYRRS
FT                   LEVAAGAGCTSIAFPAISCGAYRFPPGDATAIAVRTVTGALAGELADARFERVVFACFS
FT                   DEMLDLYRAALARV"
FT   gene            complement(467409..467879)
FT                   /locus_tag="BTH_I0422"
FT   CDS_pept        complement(467409..467879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0422"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37476"
FT                   /db_xref="GOA:Q2T1G9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G9"
FT                   /protein_id="ABC37476.1"
FT                   /translation="MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMR
FT                   RAGLDYHEYAQMHVHRDWDAFVAAEAPDPARTFAFTTRGSGRFHDRAFEPGDWFVFGSE
FT                   TRGLTPALVERFAPEQRVRLPMRPGNRSLNLSNTVAVVVFEAWRQAGFEGGA"
FT   gene            complement(467931..468698)
FT                   /locus_tag="BTH_I0423"
FT   CDS_pept        complement(467931..468698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0423"
FT                   /product="ComF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39118"
FT                   /db_xref="GOA:Q2T1G8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G8"
FT                   /protein_id="ABC39118.1"
FT                   /translation="MTNPAILRRNIRAAAARVGIVLARFSAAALPNRCALCGNLSHRTI
FT                   CDCCDDAYWNEARLRCPRCALPLPGARGAMRYRCGACARMPPRFDATLALADYRAPLDS
FT                   LALDLKFRARLALGREFGERLARLATDALDGAPPLDVIAPVPLARRRLAERGYNQAWAI
FT                   ARPLARALKVRADATLIARVADTAPQSRLALDARRANVAAAFDVARPVAGWHIGVVDDV
FT                   MTSGATLDALARKLKDAGARRVTNFVALRTAKD"
FT   gene            468731..469747
FT                   /locus_tag="BTH_I0424"
FT   CDS_pept        468731..469747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37246"
FT                   /db_xref="GOA:Q2T1G7"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G7"
FT                   /protein_id="ABC37246.1"
FT                   /translation="MARSERVYFGLFASVPDMSPASAKTGRPAYDPRRLRRIFDRRAAA
FT                   FDAVSFLPREIAQRMRERLDYIKVNPSGVLDAGCGTGDDLPLLRARFPEAPVFGVDASG
FT                   GMLARAAARDTVETSWRRFLPATLTKALGHRGPRVAQADFSALPFASDAFDLLWSNFAL
FT                   HWHARPDLVFPEWHRVLRVDGLLMFSTLGPDTLRELRAACADAAAATGDTRAVARVIDF
FT                   VDMHDLGDMLVESGFEIPVMDQETLTVTYKSAGSLLADVRRLGAYPFEREASGHASRRL
FT                   HAALHDALEARRRDDGTIPLTYEVIYGHAWKAAPRMTAEGFSIVRVQDIGKGRPKRS"
FT   gene            469944..470459
FT                   /locus_tag="BTH_I0425"
FT   CDS_pept        469944..470459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36344"
FT                   /db_xref="GOA:Q2T1G6"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G6"
FT                   /protein_id="ABC36344.1"
FT                   /translation="MRASIKRHSREAAMEAANGLHDAEPVLADWLMKRNCSVSPRQFVA
FT                   FYVSLAAFSLLIAVLLLWRGAWLVLPFTGIELLAVGVAFAIYARHAVDYERIRLFPHRL
FT                   VIERMSAERLTQIELNPRWVRVEPGASPRDPIKLVSRGESVVVGQHLAQYRRAQFAREL
FT                   RASLSRCG"
FT   gene            470509..472086
FT                   /locus_tag="BTH_I0426"
FT   CDS_pept        470509..472086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0426"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="identified by match to protein family HMM PF00034;
FT                   match to protein family HMM PF00116; match to protein
FT                   family HMM PF00691; match to protein family HMM PF02790"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36605"
FT                   /db_xref="GOA:Q2T1G5"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G5"
FT                   /protein_id="ABC36605.1"
FT                   /translation="MEILGKEAMKTIKRALTGVLACSGLLLSGAALAVGDSPGGPRVNE
FT                   INLQQPVTKIAEELYDLHTMMLILCTVIFVGVFGVMFYSIFAHRKSKGHKAANFHESTT
FT                   VEIIWTIVPFIIVVLMALPATKAVVAMKDTTNADLTVKVTGYQWKWGYDYVKGPGEGIS
FT                   FLSTLSTPRAEVNGQQPISDTYLQEVDHPLVVPVNKKIRVITTANDVVHSWYVPAFGVK
FT                   QDAIPGFVRDTWFKADKVGTYRGFCTELCGKEHAYMPVVVEVLSDDDYAKWVSAQKAKL
FT                   AAGAVDPNKVYTRAELMAHGEEVYKANCAVCHQPNGKGVGAFPALDGGKIVNGPIAGHL
FT                   EQVLKGKGAMPSWASLSDLDIASVITYERNSWGNHKGDSLQPKQVADARNGKLPADAQQ
FT                   ADGGAAAPAADASGAAAQTQARTLPAAIYFETGKSELPADAKDAIAAAAEYVKAHPDAK
FT                   LALSGFTDKTGSADANAALAKRRAQIVRDALKTAGVAEDRIILKKPETITGGADAKEAR
FT                   RVEIGPAA"
FT   gene            472130..473737
FT                   /locus_tag="BTH_I0427"
FT   CDS_pept        472130..473737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0427"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /note="identified by match to protein family HMM PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37531"
FT                   /db_xref="GOA:Q2T1G4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G4"
FT                   /protein_id="ABC37531.1"
FT                   /translation="MSSIGHDVAAGHAHDDHAHETPHGWRRWLFATNHKDIGTLYLLFS
FT                   FIMFLSGGVMALAIRAELFEPGLQIMRPEFFNQLTTMHGLIMVFGAIMPAFVGFANWMI
FT                   PLQIGASDMAFARMNNFSFWLLPVAAVLLVGSFFAPGGATAAGWTLYAPLSTQMGPGMD
FT                   FAIFAVHIMGASSIMGGINIVVTILNMRAPGMTLMKMPMFAWTWLITAYLLIAVMPVLA
FT                   GAITMVLFDRHFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQVIPAFS
FT                   RKPLFGYSSMVYATASIAILSFMVWAHHMFVTGMPVTGQLFFMYATMLIAVPTGVKVFN
FT                   WLATMWRGSLTFETPMLFAIGFLFVFTMGGFTGLMLAMAPLDIQYHGTYFVVAHFHYVL
FT                   VAGSLFALFAGWYYWAPKWTGWMYNETRGKIHFWASMIFFNITFFPMHFVGLAGMPRRY
FT                   ADYPAQFTDFNQLATIGAFGFGLAQVYFLFAIVLPAYRGGGELERASDKPWDGATGLEW
FT                   TVPSPAPFHTFEHPPTVE"
FT   gene            473968..474573
FT                   /locus_tag="BTH_I0428"
FT   CDS_pept        473968..474573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0428"
FT                   /product="cytochrome c oxidase assembly protein ctaG,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF04442"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38448"
FT                   /db_xref="GOA:Q2T1G3"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G3"
FT                   /protein_id="ABC38448.1"
FT                   /translation="MSKSDANVDRAFNRSMLVKLIVVAGLMFGFGFALVPMYRAICQVT
FT                   GINNLLQRDVSEREAKNTQIDYTRTVSIELDANARGPLGFKPQRSSIDVHPGELTTVVY
FT                   EVTNGQGRTVVAQAIPSYAPKQATEFFKKIECFCFTQQTLAANETRDMPVVFVIDPKLP
FT                   KDVKTITLSYTFFELNTPAPAVKGAAGQAGGAAAKPAA"
FT   gene            474590..474793
FT                   /locus_tag="BTH_I0429"
FT   CDS_pept        474590..474793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39353"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G2"
FT                   /protein_id="ABC39353.1"
FT                   /translation="MVSGTGNKSTFVQTIKAVMWSFFGVRKRRDLEADATQLNPLHVLI
FT                   AALIGAAVFVGVLILIVHAVVG"
FT   gene            474927..475784
FT                   /locus_tag="BTH_I0430"
FT   CDS_pept        474927..475784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0430"
FT                   /product="Cytochrome c oxidase subunit III"
FT                   /note="identified by match to protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39351"
FT                   /db_xref="GOA:Q2T1G1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G1"
FT                   /protein_id="ABC39351.1"
FT                   /translation="MTGQNESPYYFVPHPSQHPISAAIGLLIMLGSFALWVNGEPWAPY
FT                   TALVGLLWLLFVLYHWFGDAIAESEGGMYGKRVDKSYRWSMSWFIFSEVMFFGAFFGAL
FT                   FYAREIAMHQLGSLDYKLIWPDFSAVWPNEGPGALVGHFKTMGPWPIPTLNTALLLSSG
FT                   ATLTVSHHALRDDHRKKAIAWLAATLVFGVCFLFLQGFEYFHAYNELNLTLGSGVYGST
FT                   FFLLTGFHGFHVFLGGTMLAVVLVRMIRGHFKPDHHFAFEGAAWYWHFVDVVWLGLYVV
FT                   VYWL"
FT   gene            complement(475946..476155)
FT                   /locus_tag="BTH_I0431"
FT   CDS_pept        complement(475946..476155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39102"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1G0"
FT                   /protein_id="ABC39102.1"
FT                   /translation="MHILVPIAFVLIIASMVSALYFMMHDRGHTKRMVWSLAMRVGLSI
FT                   SLFLFILFANWMGWIHSTGIPIGR"
FT   gene            476243..476956
FT                   /locus_tag="BTH_I0432"
FT   CDS_pept        476243..476956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38302"
FT                   /db_xref="GOA:Q2T1F9"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1F9"
FT                   /protein_id="ABC38302.1"
FT                   /translation="MRIRWLPALLILAVIAITVRLGFWQRDRAHQKEALDAQITRYERA
FT                   NPVDVPRESVALKDIEFHRVRATGRFMPELAVFLDNRPYNDQPGFYVVMPMKLANGGYV
FT                   LVNRGWLPRNYADRTAIEPFETPAGDVTVEGIARGNASRAFELGEGGSAARQKIRQNLD
FT                   AAAYAQETGLPLQPFVIQQTSDDGDKLVRDWPAPTTGVERNYGYMFQWWGMAAAAAGFG
FT                   LYAARRAAKKQSGDA"
FT   gene            476913..477662
FT                   /locus_tag="BTH_I0433"
FT   CDS_pept        476913..477662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36744"
FT                   /db_xref="GOA:Q2T1F8"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1F8"
FT                   /protein_id="ABC36744.1"
FT                   /translation="MPRGARRKSNPATRERGAGESRGAARRPSFQEVFLVMQSSRPTQP
FT                   QRGQQAAPAQRGSWKRGRWVLLALALVCAAPVIASYLTYYVIKPRGGTTNYGTLIEPQR
FT                   PIPSDLSVVDETGKTMPLASLRGVWLFVMEDSGACGDACAKKLYFMRQVRATQAGERHR
FT                   ITMVWLKSDAANVPAAIADAYPDTLKLRADPAAVAAWLPADAGTQVTDHLYLVDPNGNL
FT                   MMRFPKNPDPSKIKQDVTKLLKWSSIG"
FT   gene            477706..478815
FT                   /locus_tag="BTH_I0434"
FT   CDS_pept        477706..478815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0434"
FT                   /product="cytochrome c assembly family protein"
FT                   /note="identified by match to protein family HMM PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39326"
FT                   /db_xref="GOA:Q2T1F7"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1F7"
FT                   /protein_id="ABC39326.1"
FT                   /translation="MYLLQLGLIGLCIALLPLSYVWVKADDDKFRKLVWITTFLTLDLV
FT                   MFGGFTRLTDSGLGCPDWPGCYGTSSPFIAHAAITAAHQAMPTGPVSMTKAWIEMIHRY
FT                   FAMAIGVLIIAQTVIAWAARLRRKPLHVSPWWPTSLLLLILVQGAFGAWTVTMKLQPVI
FT                   VTIHLLLGLTLLGTLGWLAARQTPLPAHEPDAGRYRAAALAALVLLVAQIALGGWVSTN
FT                   YAVLACTDFPTCNGAWIPPMDFRNGFHLWRALGMTNDGEAITQDALVAIHWTHRTFAFV
FT                   VVAYLIAFALKMRRFASLRRPANGVLAVVVLQFVTGLTNIVLQWPLPVAVAHNGGAAIL
FT                   LLLVVMLNFRILSSRPGRVAQPAHDAAPA"
FT   gene            478828..479730
FT                   /gene="cyoE"
FT                   /locus_tag="BTH_I0435"
FT   CDS_pept        478828..479730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="BTH_I0435"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39449"
FT                   /db_xref="GOA:Q2T1F6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1F6"
FT                   /protein_id="ABC39449.1"
FT                   /translation="MDTTLSHTPGSRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVP
FT                   WKVLLGGTVGIGLLAGSAFAINCLVEQKIDAMMRRTAWRPSARGEITTLQILAFSTVLG
FT                   GLGAWTLYTFTNPLTMWLTIATFVGYAVIYTLLLKPMTPQNIVIGGASGAMPPALGWAA
FT                   VTGAVPGDAWILVLIIFVWTPPHFWVLALYRRKDYENAGLPMLPVTHGEQFTRLHILLY
FT                   TVILFAVTMMPFISGMSGAVYLTSAVLLGAIFLAYAWKIYRDYSDALARRAFRYSIVYL
FT                   SLLFAALLVDHYARPVIGM"
FT   gene            479822..480367
FT                   /locus_tag="BTH_I0436"
FT   CDS_pept        479822..480367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0436"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38718"
FT                   /db_xref="GOA:Q2T1F5"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1F5"
FT                   /protein_id="ABC38718.1"
FT                   /translation="MLIAGCNRQPAFQNLDITGNSQFASDFALPDTTGKIRTLGEFKGK
FT                   AVVVFFGYTHCPDVCPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAAILGQYVPA
FT                   FNPTFVGLRPADEAQLKKVTKDFRVYYAKVPGKTPGSYTMDHTAASYVFDPSGKLRLFV
FT                   RDGQGPGPWVHDLKLLLD"
FT   gene            complement(480449..480823)
FT                   /locus_tag="BTH_I0437"
FT   CDS_pept        complement(480449..480823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0437"
FT                   /product="YCII-related domain family"
FT                   /note="identified by match to protein family HMM PF03795"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37392"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1F4"
FT                   /protein_id="ABC37392.1"
FT                   /translation="METRRRRLCYKSGLAAARRRGPHSDEASMYVIDIRYTAPLERIDD
FT                   ALERHRAYLQRHFDAGVFVACGPKVPRDGGVILAVRIERDRLDAILETDPFVTEGLVTY
FT                   TVTEFKTTRIAPGVNLPALP"
FT   gene            481033..482571
FT                   /locus_tag="BTH_I0438"
FT   CDS_pept        481033..482571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0438"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36883"
FT                   /db_xref="GOA:Q2T1F3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1F3"
FT                   /protein_id="ABC36883.1"
FT                   /translation="MLAERKEGMANLVDSAAGVVKAYYALAQSGKMSDEDARREALERL
FT                   AAMRYGDSGYLFVMDSKPVVLMHPTLPKLVGTQVGDYLDPDGKRLFVTILNAAKESGHG
FT                   FAEYRGRLPHSETAVPKISYVTRFAPWDWNISSGVFLKDIDTVYYETLVSHLAVVFVIG
FT                   LVITAAMLVIIRNVRASLGGEPDEAASLAARIAAGDLTRPVAVRAGDRTSMMAAMRDMQ
FT                   GRLQSTIGGIRRAAESIAAASHEIASGNHDLSQRTEQQAASLEETAASMEELTATVKQN
FT                   AENARQASGLANNASEIALKGNDVVSRVIGTMGEINDSSQKIADIIGVIDGIAFQTNIL
FT                   ALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSATAAKEIKQLIDASVERVNNGSALVGQ
FT                   AGETMTEILQAVRRVTDIMGEIAAASEEQSSGISQVGRAVTQMDEMTQQNAALVEEAAA
FT                   AASSLQEQAARLRESVSAFQVGDGAADGGTAAGAAASGGPNAAASSGRVEPALA"
FT   gene            482721..483539
FT                   /locus_tag="BTH_I0439"
FT   CDS_pept        482721..483539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0439"
FT                   /product="D-methionine ABC transporter, periplasmic
FT                   D-methionine-binding protein"
FT                   /note="identified by match to protein family HMM PF03180;
FT                   match to protein family HMM TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36291"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1F2"
FT                   /protein_id="ABC36291.1"
FT                   /translation="MKRRTLLKVVSAVAAGAAALSVSVGAQAQDKVIKVGTVAGPDAQV
FT                   WQVVQKVAKEKQGLNVKVIEFNDYVQPNAALDAGDLDANSFQHQPYLDSQVKQRGYKIV
FT                   SAGLTYISPIGVYSKKFKSLKDLPAGAKVALPNDPSNENRALLLLQTQGVIKLKAGAGT
FT                   GGNNATVLDVAENPKKLKLTELDAAQLPRVLSDVDAAVINTNYALAANLQPTKDAIALE
FT                   SLTSPYANLIAVRAKDKDQPWVRKLVKAYQSPEVKEFIAKQFKGSMVASF"
FT   gene            483789..484760
FT                   /locus_tag="BTH_I0440"
FT   CDS_pept        483789..484760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0440"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, putative"
FT                   /note="identified by match to protein family HMM PF04392"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37938"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1F1"
FT                   /protein_id="ABC37938.1"
FT                   /translation="MKRFKIVAAHSIAAGVAAFAMLGAGAAYAQTVKVLSIVDHPALDA
FT                   IRDGVRAELKAEGYGDDKLKWEYQSAQGNTGTAAQIARKFIGDRPDVIVAIATPAAQAV
FT                   VASTKSVPVVYSGVTDPVAAQLVKGWGPTGTNVTGVSDKLPLDRQVALIKRVVPKAKTV
FT                   GMVYNPGEANSVVVVTALKEILAKQGMTLKEAAAPRTVDIAPAAKSLIGKVDVIYTNTD
FT                   NNVVSAYESLVKVANEAKIPLVAGDTDSVKRGGIAALGINYGDLGRQTGKIVARILKGE
FT                   KPGAIASQTSSNLELFVNTDAAAKQGVTLSPDLVKEAKTVIK"
FT   gene            484896..485915
FT                   /locus_tag="BTH_I0441"
FT   CDS_pept        484896..485915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0441"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37770"
FT                   /db_xref="GOA:Q2T1F0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1F0"
FT                   /protein_id="ABC37770.1"
FT                   /translation="MARQAPRAPGASQARPGRRARRATPLASVPRAVRCNRTSPTMSLF
FT                   SLLGALEIGLIFSLVALGVLISFRILNFPDLTVDGSFPLGGAVAATLIAAGYDPFTSTL
FT                   AAIAAGACAGFVTGWLNVRLKIMDLLASILMMIALYSVNLRIMGRPNVPLITEPTLFTV
FT                   LQPDWMPDYVLRPALLAVVVVIAKLGLDWFFSSQLGLAMRATGANPRMARAQGIATGRA
FT                   TLAGMALSNALVALAGALFAQTQGGSDISMGIGTIVIGLAAVIIGETLLPARRLFLTTL
FT                   AVVLGAILYRFFIALALNSDFIGLKAQDLNLVTAVLVTVALVLPATRKKLFGRKTGGA"
FT   gene            485916..486710
FT                   /locus_tag="BTH_I0442"
FT   CDS_pept        485916..486710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0442"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36559"
FT                   /db_xref="GOA:Q2T1E9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E9"
FT                   /protein_id="ABC36559.1"
FT                   /translation="MLSAQDLKLTFNPGTPIETRALRGLSLDIPDGQFVTVIGSNGAGK
FT                   STFLNSVSGDQPVDSGRIAIDGVDVTRKPAWDRAPLVARVFQDPMAGTCEALTIEENMS
FT                   LAMARGARRGFLPALNRASRELFRDKLRLLNLGLENRLADRIGLLSGGQRQAVSLLMAS
FT                   LRPSRILLLDEHTAALDPKTAAFVLELTARIVDEGKLTTMMVTHSMRQALDYGDRTVML
FT                   HQGQVVLDVSGDERRGLDVPDLLQLFEKTRHEKLDDDALLLG"
FT   gene            486800..487675
FT                   /locus_tag="BTH_I0443"
FT   CDS_pept        486800..487675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37949"
FT                   /db_xref="InterPro:IPR017166"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E8"
FT                   /protein_id="ABC37949.1"
FT                   /translation="MAEEAMRPRTHCRRSIPGSDPFSAYPLPKSRFHIGCCARRTRCHI
FT                   LYKRTVIGNAMSASSLSLESLHPSLWRGSQLARGGPRTVDTGYAALSVELPGGGWPVGG
FT                   LVELLVPHAGCGEMRVLAPALAAAGSARRPLAFVAPPQPPHACALAGLGVPLDALLWLR
FT                   AGSDANALWAAEQALKTGCCGALLLWHQSARADALRRLHLAAARAGDTLFVMFRPLAAA
FT                   QQPSPAVLRLALHPSPGGVSVEIVKRRGPARGEPLSLELPSPIVESRYARLARHPFAAP
FT                   AARRVRAAVA"
FT   gene            487608..489083
FT                   /locus_tag="BTH_I0444"
FT   CDS_pept        487608..489083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37405"
FT                   /db_xref="GOA:Q2T1E7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E7"
FT                   /protein_id="ABC37405.1"
FT                   /translation="MRVLLGIHLPRLPLDVCAPPSPDGGNGCAVLEQGVVLIADSAARA
FT                   CGVRAGMKRGGVLTLAPGTRLVERDPAREADALRAVALALLRFSPCVALDDEATLVIDV
FT                   GASLRLFGGLPSLCRQVRATLVALGYAARVAAAPTGRGSWLLARAPGGPGARRRIVQAA
FT                   SLARVLDALPCELLPDARPYAGWFDGLGCRTLADLRRLPRAGLTRRCGPALVAALDRAY
FT                   GDAVEPLAWMPVPPVFDARLELPERVEYAQAVLFVARRLVVQLCGWLAARQLSLSAMTF
FT                   AFEHERGRQAVPPTPLELAFAEPARDETHFMRVLGERLARVALPAAVIAVRLTATRVES
FT                   VAPPADDLFPEPGGTREARARLVELLSARLGADNVLRAAPVADHRPEAANRWLPFDAPA
FT                   GKPPAPGAAPPRPAWLLEEPQPLAMRENRPFYRTPLRFVSSIERIEAGWFDGQFVERDY
FT                   RIAQDDDGACYWVYQERGSRAAGRCWFLHGLFG"
FT   gene            489053..492307
FT                   /gene="dnaE"
FT                   /locus_tag="BTH_I0445"
FT   CDS_pept        489053..492307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="BTH_I0445"
FT                   /product="DNA polymerase III, alpha subunit superfamily"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF02231;
FT                   match to protein family HMM PF07733; match to protein
FT                   family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37882"
FT                   /db_xref="GOA:Q2T1E6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E6"
FT                   /protein_id="ABC37882.1"
FT                   /translation="MLVPARPVRVSGMDAASGILPDYAELFCRSNFSFLHGASSAEELV
FT                   ERAKKHGYRGIAITDECSLAGAPRMHVAAKGHELPLVVGAYFDVTPDDVAPGHDPGPGA
FT                   FGLVLLAQNREGYGNLSELISWRRMNAPKGTYRLTPRMLAAPPPEFIHLRGVPDCFAIL
FT                   VPTYPARADVLDAQLAWFGALFGERARLGLVQLQRALDGAHREQVRAAGERRGMRIVAL
FT                   GDVTMHTRSCKPLQDTMTAIRLGMPIGECGHALAPNAEQHLRTRQRIAQLFPADALAQT
FT                   CRMLDACHFSLDELRYEYPHEIVPAGHTPTSYLAQETWAGARRRYPDGVPEAVRQRIGF
FT                   ELALIADLKYEPYFLTVYDIVEYARSKDILCQGRGSAANSVVCYCLGVTEVNPQQSTLL
FT                   FERFISRERGEPPDIDVDFEHQRREEVIQYLYGKYGHDRAALAAAVSTYRPRGALRETG
FT                   KALGVDPMLVERVAKEHRWFDGSRALLARFASVGLDPDVPLIRTWAKLAARLLNFPRHL
FT                   SQHSGGFVVSRGKLTRLVPVENAAMEGRRVIQWDKDDLEALGLMKVDVLALGMLSALHR
FT                   AFDMITAWRGPPLPDGRPFRLEHIPQDDKATYDMICRADTVGVFQIESRAQMSMLPRLR
FT                   PRGYYDLVVQVSIVRPGPIQGGAVHPYLERRRIAAGEVEGEITYPSEALERVLERTLGI
FT                   PIFQEQVMQIAIVAAGFTPGEADALRRAMAAWKRKGDLGKYHRRIVDGMLERGYSREFA
FT                   EQIFEQIKGFGEYGFPESHAASFAKLAYASSWLKCHEPAIFLAALLNSQPMGFYPPAQL
FT                   VQDAKRHGVTVLPIDATKSDWEASLEARPGEAPPDGRPAVRLGLSLVRGMSEEAARRIE
FT                   AARAAGPFASVDELARRARLERRDLEALAAANAFATLAGNRRDALWQAVAAVPQRDLLA
FT                   GAPIDEAVKPALGAPTEADDVFADYHTIGLTLNRHPVALLRPALDARRLSSAAALRDRR
FT                   NGQLARACGLVTARQMPGTAKGVLFVTLEDETGCVNVIVRPELLERQRRETLDSRLLAV
FT                   SGVWQCESDVRHLVAQYLEDLTPLIAGLRTESREFH"
FT   gene            492603..493337
FT                   /locus_tag="BTH_I0446"
FT   CDS_pept        492603..493337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0446"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38868"
FT                   /db_xref="GOA:Q2T1E5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E5"
FT                   /protein_id="ABC38868.1"
FT                   /translation="MDIGWSALAPDARSDTPLYLQLARNLAGAIHGGAWRAGEALPSER
FT                   GLSAAAGVSRITARRALALLVEQGLIRRVRGAGSFITPRVADPLSRLVGFTAKMRQRGF
FT                   APDSVWLARSLRAASRDELARFSLSPGATVARLERLRRADGVVMAYERSTLPATCVPEP
FT                   QALEGSLYSYLQSRGLDVVRASQRFRATRASADVAQWLGLAPGAALLVITRIGYGADRR
FT                   AIEATETYCRDDYYDFVAELKR"
FT   gene            493437..494540
FT                   /gene="nagA"
FT                   /locus_tag="BTH_I0447"
FT   CDS_pept        493437..494540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="BTH_I0447"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR00221"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39327"
FT                   /db_xref="GOA:Q2T1E4"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E4"
FT                   /protein_id="ABC39327.1"
FT                   /translation="MLTGNILTADGWIHGTLEFENGRITALSGDATDPSKNDAPYILPG
FT                   FIDLHVHGAGGADVMEGGDAIETIARTHARYGTTSLLATTMTAPRDELMRVVSDLGGVA
FT                   RTRTPGGSRVLGVHLEGPYINPGKLGAQPDAAVSAVLDEVLKYLSIAPIRVVTLAPEIS
FT                   GHIEIISEMAARGVRVQLGHSLGTYDDAVAALKHGACGFTHLFNAMSPLHHRNPGIVGA
FT                   ALAHAEYAEIIPDLLHVHPGAIRAALRAIPRLYVVTDSTSATGMPDGEYRLGSQRVTKC
FT                   LGGVRLADGTLAGSTLTMDQALRNLVSLGLPIADVSNRMSRYAADYLGLADRGRIARGA
FT                   WADLAVFDRELNLTATFVEGESIVEYA"
FT   gene            494533..495540
FT                   /locus_tag="BTH_I0448"
FT   CDS_pept        494533..495540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0448"
FT                   /product="SIS domain protein"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38431"
FT                   /db_xref="GOA:Q2T1E3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E3"
FT                   /protein_id="ABC38431.1"
FT                   /translation="MLNEARESARVVAAQLADTRRVEALARHLAEHAPQVALTVARGSS
FT                   DHAASYFASLTMSRLGVPVASLPMSVATLQQAPLKVQGQLALAFSQSGKSPDLVNTMAA
FT                   LREAGALTVAAVNVLPSPLADACEHQLPLLAGPELSVAATKSYIAMLSLAAQLVAFWQR
FT                   DAALVSALRSLPDALEQAGRFDWSSAVDELRGVERMIVIGRGLGLAIAQEAALKLKETS
FT                   GIQAEAFSSAEVRHGPMELIDRDYPLLVFAPPGPEQEGLLQLARDMRARGARVLLAAPA
FT                   GTPDATLPLARTAHAALDPIAAILSFYVMAAGLARARGRDPDAPRHLHKVTETH"
FT   gene            495574..498174
FT                   /locus_tag="BTH_I0449"
FT   CDS_pept        495574..498174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0449"
FT                   /product="PTS system, glucose-specific
FT                   EIIA/HPr/phosphoenolpyruvate-protein phosphotransferase
FT                   components"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00381; match to protein
FT                   family HMM PF00391; match to protein family HMM PF02896;
FT                   match to protein family HMM PF05524; match to protein
FT                   family HMM TIGR00830; match to protein family HMM
FT                   TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37380"
FT                   /db_xref="GOA:Q2T1E2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E2"
FT                   /protein_id="ABC37380.1"
FT                   /translation="MRRAEESQLKQQASHDQIVLVAPLTGPVVPLADVPDPVFSGGMFG
FT                   DGIGIDPLEGRLLAPCGGVVSHVARTGHAVTIAADGGAEILLHIGIDTVELNGLGFSAK
FT                   IAEGARVAPGDLLIEFDQDTIARAAHSLVSVIAIANSDAFEVVERAGAGVAKAGETPLL
FT                   TLRARGAAAGAAASAGSAAGRADAGAEARKSITLTQPGGLHARPAARAREAARGLDAHV
FT                   DVHFGGRKAALQSVVGLLGLGAGEHATIEIVATGRDAAKAVELVAHELLREAHGEAEEK
FT                   PARVVSPAPVAAAVGRAPLDPNTLAGVCAAPGIAVGALVRWDETDIAPPELASGTPAAE
FT                   SRLLDRALAAVDAELETTVREASQRGAIGEAGIFAVHRVLLEDPSLVDAARDLISLGKS
FT                   AGYAWRETIRAQTAVLAGVDDALLAERAADLRDIDKRVLRALGYASATARELPAEAVLA
FT                   AEEFTPSDLASLDRERVTALVMARGGATSHAAIIARQLGIPSLVAVGDALYAIPQRTQV
FT                   VVDASAGRLEYAPTALDVERARHERQRLAGVREANRRMSGEAAVTRDGHKIEVAANIAT
FT                   LDDARVAVDNGADAVGLLRTELMFIHRQAAPTTSEHQQSYQSIVDALQGRTAIIRTLDV
FT                   GADKEVDYLTLPPEPNPALGLRGIRLAQVRPDLLDDQLQGLLSVKPYGSVRILLPMVTD
FT                   VGELVRIRERIDAFARALGRADPIEVGVMIEVPSAALLADQLAKHADFLSIGTNDLTQY
FT                   TLAMDRCQADLAAQADGLHPAVLRLVDATVRGAEKHGKWVGVCGALGGDPVAVPVLVGL
FT                   GVTELSVDPVSVPGIKAQVRRLDYQLCRQRAQDLLALESAQAVRAASREIWPAD"
FT   gene            498280..500049
FT                   /locus_tag="BTH_I0450"
FT   CDS_pept        498280..500049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0450"
FT                   /product="PTS system, N-acetylglucosamine-specific IIABC
FT                   component"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR01998"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39302"
FT                   /db_xref="GOA:Q2T1E1"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E1"
FT                   /protein_id="ABC39302.1"
FT                   /translation="MDGNPFLKIQSLGRALMLPIAVLPVAGILLRLGQQDVLNIKMIAD
FT                   AGGAIFDNLPLLFAIGVAVGFAKDNNGVAALAGAIGYLIEVAIMKDIDPKLNMGVLSGI
FT                   IAGVVAGLLYNRYKDIKLPDYLAFFGGKRFVPIITGLACVVLGIVFGYVWQPVQHAIDA
FT                   VGQWLLTAGAIGTFVYGFLNRLLLVTGLHHIINSLVWFVFGTFTPAAGGAAVTGDLHRF
FT                   FAGDPSAGSFMAGFFPIMMFGLPAACLAMFHEAPKERRAIVGGLLFSMALTSFLTGVTE
FT                   PIEFSFMFLAPLLYVIHAVLTGLSLAICQLLGVKLGFTFSAGAIDYVLNYGLSTKGWIA
FT                   IPLGLAYGLAYYGLFRFFIRKFNMATPGREPAGADAQAQSFASGGFVAPTAGASVPRAQ
FT                   RYIAALGGAANLSVVDACTTRLRLSVVDPEKVSEADLRTIGARGVLKRGGSSVQVIIGP
FT                   EADLIADEIRATLGSGAASSSATAAPAAPVAATATAAGAQAGPLDPEPTRWLAVFGGAT
FT                   NVASLDAVAATRLRVVVRDPSAVDRQRLATLDVAWVAGDTFHIVCGPSAPRYAQQLAAR
FT                   LPSPDGGAAAQPA"
FT   gene            complement(500405..502915)
FT                   /locus_tag="BTH_I0451"
FT   CDS_pept        complement(500405..502915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0451"
FT                   /product="beta-N-acetylhexosaminidase, putative"
FT                   /note="identified by match to protein family HMM PF00728;
FT                   match to protein family HMM PF03173"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36947"
FT                   /db_xref="GOA:Q2T1E0"
FT                   /db_xref="InterPro:IPR004866"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1E0"
FT                   /protein_id="ABC36947.1"
FT                   /translation="MNRISHSLCAALLAAAALLPATSRAQPPARATAGPAAPATAVPVR
FT                   PASAPATPTELAALLANGLAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQNRGH
FT                   PTLTDGGWKLYLHSIRRLLRIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELPFVA
FT                   EYWLRRYSDVIPRPYVVVDGAAPAVLRYDDTDDELRYVEKLPADAQNNSPGNAPPAAAQ
FT                   PVANRALPSVKRQRALSGALDLRGVELTLPELSFAQVAALRERASALGLDGARTPVWGI
FT                   VAPRRLPADIAVPGGYRLAIGPRGAFVEGYDRAGLYYGVQTLFSLVPAGGATVPAMLIE
FT                   DAPRFAHRGMHVDLARNFKPPATLRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPEL
FT                   TDVGARRCHDPSETRCLLPQLGSGPDNRSGGGYLTRDDYVALLRYAADRFVEVIPEIDM
FT                   PAHSRAAVVSMEARYRRLHAAGREREANAYRLLDPQDTSNLLTVQFYDRRSDLNPCMPG
FT                   ALNFASKVIREIAAMHADAQAPLRIWHFGGDEAKNILLGAGFQPLDGADPGKGRVDLAA
FT                   QDKPWARSPACTALLRRGEIKSIDELPTRFAKQVSAVVNANGIGTMAAWQDGIKHASGP
FT                   QEFSTRHVMVSLWDTIFWGASDSARDLSAKGYRTVLALPDYLYFDFPYTRNPRERGYYW
FT                   GSQATDEYKVFSLAPENLPQNAEVFGDRDGNPFEVASAGAAPRIEGIQGQAWGEVMRNG
FT                   QLLEYMVYPRLLALAERAWHKADWELPYAAGVRYKLGDTHHVDMAALERDWAGFATVLK
FT                   QRELPKLERAGIGYRQPTFTLTGE"
FT   gene            complement(504001..504099)
FT                   /locus_tag="BTH_I0452"
FT   CDS_pept        complement(504001..504099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0452"
FT                   /product="cyd operon protein YbgT"
FT                   /note="identified by match to protein family HMM PF08173;
FT                   match to protein family HMM TIGR02106"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37824"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D9"
FT                   /protein_id="ABC37824.1"
FT                   /translation="MWYFSWVLGIGVALAFGIINAMWLEARQKRDA"
FT   gene            complement(504180..505316)
FT                   /gene="cydB-1"
FT                   /locus_tag="BTH_I0453"
FT   CDS_pept        complement(504180..505316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB-1"
FT                   /locus_tag="BTH_I0453"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02322;
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37112"
FT                   /db_xref="GOA:Q2T1D8"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D8"
FT                   /protein_id="ABC37112.1"
FT                   /translation="MDYATLKVIWWLLVGILLIGFALTDGFDMGAAALLPFLGKTDDER
FT                   RIIVNTVGATWEGNQVWLITAGGAMFAAWPLVYAASFSGFYFAMLLVLFALFFRPVGFD
FT                   YRSKRDDPRWRTSWDWALFVGGFVPALVFGVAFGNLLQGVPFAFDTDLRVTYHGSFWAL
FT                   LNPFALLCGLVSLTMLVAHGAAFVKMKTDGAIAKRASIALRVSSLVAVVLFVLAGALIA
FT                   SFVGGFQITQAAPVDTVANPLLKQVSAAPGLWLVNYGLYPWMIAAPAVGIAGGVLAMLL
FT                   AGSKREKTAFICTGLMIIGVILTAGFSMFPFIMPSSLDPKSSLTVWDSTSSRLTLEVML
FT                   VAVIVFLPIILLYTSWVYRVLRGKVTPSVLEENRHSMY"
FT   gene            complement(505354..506949)
FT                   /locus_tag="BTH_I0454"
FT   CDS_pept        complement(505354..506949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0454"
FT                   /product="cytochrome d ubiquinol oxidase, subunit I"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38198"
FT                   /db_xref="GOA:Q2T1D7"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D7"
FT                   /protein_id="ABC38198.1"
FT                   /translation="MISSEVVDLSRLQFGITALYHFLFVPLTLGMSWLLVIMEAVYVMT
FT                   GKQVYKDMTQFWGKLFGINFAMGVTTGITLEFQFGTNWSYYSHYVGDIFGVPLAVEGLM
FT                   AFFLESTFVGLFFFGWNRLTKVQHLIVTFLVALGSNLSALWILVANGWMNNPVGAEFNY
FT                   QTMRMELSNLFDVLFNPVAQVKFVHTVSAGYVTASMFVLGVSAWYLLKKRDTDFALRSF
FT                   AVAAGFGLASTLCVIVLGDESGYTTGEVQKMKLAAIESEWETQPAPASFTLIGLPNQAE
FT                   ERTDYAIKIPYALGLIATRSISEPVIGLRELAKRSEAHIQSGMIAYGALQKLKAGDTSA
FT                   ETKATFDQHKQYLGYGLMLKQFTQNVTDATPDQIKAAAKQTIPPVAPVFFSFRIMVFLG
FT                   FLFLATFIAAFWLCARRQLLQDNRRWFLRYAVWAIPLPWLAAEFGWVVAEVGRQPWTIA
FT                   GILPTHLSASSLTATDLYLSLAGFIVFYTALFIIEITLMFKYARLGPSSLHTGRYHHEQ
FT                   AGRPLEKTVAGTVA"
FT   gene            complement(506939..507283)
FT                   /locus_tag="BTH_I0455"
FT   CDS_pept        complement(506939..507283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39101"
FT                   /db_xref="GOA:Q2T1D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D6"
FT                   /protein_id="ABC39101.1"
FT                   /translation="MRASDEAGAQFCAHRVIPDIMALTFINKKASPDGTPPARPAGWRD
FT                   RVAAWARGPTLARDISIVLAFKLVLLVALKYAFFNHPQAEHMSLPPAVVAAQLLSTTPS
FT                   APTQGDRHDK"
FT   gene            complement(507559..508494)
FT                   /locus_tag="BTH_I0456"
FT   CDS_pept        complement(507559..508494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0456"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM TIGR02392"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36784"
FT                   /db_xref="GOA:Q2T1D5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D5"
FT                   /protein_id="ABC36784.1"
FT                   /translation="MSNALTLPNTLRPASAKAASAGSLALASHSMLPGQLGNIDAYIQA
FT                   VNRIPLLTAEEERQYATEYREQNSLDAARRLVLSHLRLVVSIARNYLGYGLPHGDLIQE
FT                   GNIGLMKAVKRFDPAQNVRLVSYAIHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLR
FT                   SHKKGTQAFTPEEIDGLAQELNVKREEVAEMETRLSGGDIALEGQIDDGEESYAPIAYL
FT                   ADSHNEPTAVLAARQRDMLQTDGIARALDSLDARSRRIIEARWLNVDDDGSGGSTLHDL
FT                   AAEFGVSAERIRQIEASAMKKMRTALAAYA"
FT   gene            508858..509427
FT                   /locus_tag="BTH_I0457"
FT   CDS_pept        508858..509427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37575"
FT                   /db_xref="GOA:Q2T1D4"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D4"
FT                   /protein_id="ABC37575.1"
FT                   /translation="MNDKNGGRVGRAIAKTALALALVGASGSAFADRWGLQLGGGVADH
FT                   DMKKGDIAVAWDPGWTWWEIGGWHFAFVAEGHLSYWRYTGDRAINDSIWEVGATPIIRF
FT                   IKSAGYVRPFIEVGAGVRFLSHPTISENYSMSTSFQFADMVGVGAQFGNRQQYQAGLRF
FT                   QHVSNAGIKDPNPGINFSQLYVQYNF"
FT   gene            509448..509855
FT                   /locus_tag="BTH_I0458"
FT   CDS_pept        509448..509855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37284"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D3"
FT                   /protein_id="ABC37284.1"
FT                   /translation="MQSRSMAMVAKGIDAIRALERDRFRAMVDGDGEALDALLSDKVCY
FT                   VHTNGKRETKQQFIDAIAAGRRRYRQIEIQSQDVLPVGDATYVVAGRALIEMETNNGGL
FT                   VFQIAYTAVQTHESGRWRLLAWQATRCATES"
FT   gene            complement(510108..511748)
FT                   /gene="leuA-1"
FT                   /locus_tag="BTH_I0459"
FT   CDS_pept        complement(510108..511748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA-1"
FT                   /locus_tag="BTH_I0459"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM TIGR00970"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38714"
FT                   /db_xref="GOA:Q2T1D2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D2"
FT                   /protein_id="ABC38714.1"
FT                   /translation="MKRNPAEKYRPFEPVRINGRRWPSRTIERAPIWMSTDLRDGNQSL
FT                   IEPMTIEQKLEFFEMLVAIGFKEIEVGFPSASQTDFDFVRKLIVEKRIPDDVTIEVLVQ
FT                   SREDLIAHTFDALEGAPRAIVHLYNAICPSFRRIVFGMSKDDVKALAVDGTRIIKEHAQ
FT                   ARPGTHWTFQYSPETFSMTELPFAREVCDAVAQTWRPTRDHKMIVNLPATVEAATPNVF
FT                   ADQIEWMDRNLGYRDSIVLSVHPHNDRGTAVAAAELALLAGADRIEGCLFGNGERTGNV
FT                   DLVTLALNLYTQGIDPGLDFSDIDAVRRVVERCNRIPVHPRHPYAGDLVFTAFSGSHQD
FT                   AIRKGLAQQRPDAIWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGATYLLERGMGFSPP
FT                   RRVQIEFSHAVQALADASGEEVTADAICALFTREYLQTMGPAARAGASASWHDREVALA
FT                   HAEDAPSAARQAAAAFAAAAGVAIDVTSCEVERTANGDTVVFVGAKVGDAALRHGAGVH
FT                   RDPAAAATDAVASAINRSAWSRDKRRAAA"
FT   gene            complement(512169..513272)
FT                   /locus_tag="BTH_I0460"
FT   CDS_pept        complement(512169..513272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0460"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38020"
FT                   /db_xref="GOA:Q2T1D1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D1"
FT                   /protein_id="ABC38020.1"
FT                   /translation="MRRGVSRARPPDCARRPTPVNADARAMRVYFFAVGRPRRPTHPRR
FT                   TNPAHTAHGTRRRRSPPAAERAIREPPARRLPRHPSASNPDPMIPNQPRESMQQIAVLL
FT                   DGMIKKNAYLPRRIGGTMRVDEQPGYAIVDSGLPTDTFNLVIGTSGGAPDAASIARIAA
FT                   RFNDAGLPAAWWTCSELTDAAFARALGESGFVADETSVGMLAELDALPPVGYPRGFSVR
FT                   QINAQHDVARFGALIGALFDPPDAFVDAFYARVAALDLDAAEPLKLFVGELDGHAVSTT
FT                   ALYVDADTAHVFDVSTSAGKRKQGLASAIMHCALAHAKERLGATRAALQASPDGLNVYR
FT                   RLGFRAVCEFQVYSNRAAVSPRNEDGR"
FT   gene            complement(513546..514610)
FT                   /locus_tag="BTH_I0461"
FT   CDS_pept        complement(513546..514610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0461"
FT                   /product="Glycosyl transferase family, helical bundle
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00591;
FT                   match to protein family HMM PF02885"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37968"
FT                   /db_xref="GOA:Q2T1D0"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1D0"
FT                   /protein_id="ABC37968.1"
FT                   /translation="MRYSVWFLHTRAAPPDRRNRDGRGPFPSMTESDANAAQQPDRFSC
FT                   ARLIKEIGRGPNGARALPYDDAFALFRAMLDARVSDVELGAVLIAYRLKGETAAELAAM
FT                   LAAANASFEPLHVQDSMFRTVSIPSYNGARKQPNLVPLLALLLAREGVPVLVHGVAEDP
FT                   GRVTSAEIFTELALAPGETHDEIEDTLAERRVAFAPIDVLAPKLARLIALRRVLGVRNS
FT                   THTIVKLLQPFEPAGLRLVNYTHPPYRDSLVELFRDHPAAAAGGALLARGTEGEAVADT
FT                   RRQVQVDWLHDGRCETVVEPVRSSPDAPPVELPASRDAATTAAWTDAVMRGEIPIPDAI
FT                   AMQVDTIVRLARIV"
FT   gene            complement(514523..517378)
FT                   /locus_tag="BTH_I0462"
FT   CDS_pept        complement(514523..517378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0462"
FT                   /product="molybdopterin oxidoreductase family protein"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM PF04324; match to protein family HMM PF04879"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39385"
FT                   /db_xref="GOA:Q2T1C9"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1C9"
FT                   /protein_id="ABC39385.1"
FT                   /translation="MTLDTLAQPIAQPTPGAVRETRSTCCYCGVGCGVVIETRRDANGR
FT                   DAIVGVRGDSDHPANFGRLCSKGGTLHLTATPERYAQTRATHPELRASRDAARTRVSWD
FT                   DALDHVAQRLARIVERHGPDAVGFYISGQLLTEDYYVFNKLAKGLVGTNNIDSNSRLCM
FT                   SSAVVGYKKTLGADAPPCSYEDLDHAGTVLIAGANPAYAHPILYRRLEAARARNPRMKV
FT                   IVADPRRTDSASDATLHLALQPGTDTMLFNAMLHVLIWDGALDSAFIDAHTQGFDALRD
FT                   AVRDATPAAAAQVCGLRADDIVQAARWFGAGPSLSLYCQGLNQSASGTAKNVALINLHL
FT                   ATGQIGKPGAGPFSLTGQPNAMGGREVGGMATLASAHRDLANPAERAEIARLWGVPGLP
FT                   AQPGLTAVEMFEQLAAGALKAIWIVCTNPAHSIPNQALARAGLERAEFVVLQDAYAHTG
FT                   TAPYADVLLPAATWGEKDGTVTNSERRISRVRAATQPYGDARADWRIAADVGRRLEARL
FT                   APGRPTLFPYEDAEAIWKEHRATTVGRDCDIGGLSWPLLARDGPQQWPFPAGAAQGFAR
FT                   LYADGRFPTADGRARFVPTPYQPVAEAVDARYRFALTTGRLRDQWHGGSRTGTVAKLFA
FT                   HAPQPCVELDPGDCARLELGAHDFVHLTSRRGSALLPARADDAVAPGQAFAPMHWGDEY
FT                   VSGVAGNRAAMGINALTTPARDPYSQQPELKHAAIKLLKADLPWRWLIAARVPAGDVLA
FT                   RQRAARAFFARFPYASCVPFGTDAYAGLAWRVAAYEPAPAELQREIEALFELPAQAADV
FT                   MSYGDARRGTGRRVRIVDGALVAFSVAGAAGATEDSAAVLREYVDSGASVGALGRLLLF
FT                   AGRVPLQTAPARGRTICNCVGVSEREIGAVLAADAPSAAPGERLANLQERLKCGTQCGS
FT                   CIPELRRLIAETATAAAPSPR"
FT   gene            complement(517375..517770)
FT                   /locus_tag="BTH_I0463"
FT   CDS_pept        complement(517375..517770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0463"
FT                   /product="nitrite reductase [NAD(P)H], small subunit"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM TIGR02378"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36824"
FT                   /db_xref="GOA:Q2T1C8"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1C8"
FT                   /protein_id="ABC36824.1"
FT                   /translation="MSATQPEWIAVCRLDDIPPLGARVLTRAAGTPIALFRTASDAVFA
FT                   LLDRCPHKGGPLSQGIVHGEQVTCPLHGLNVAFSSGCALPPDEGCTSVFSVRREGDTVL
FT                   LERTELATLGVDDAPQPAPLASPGAAA"
FT   gene            complement(517846..520290)
FT                   /gene="nirB-1"
FT                   /locus_tag="BTH_I0464"
FT   CDS_pept        complement(517846..520290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB-1"
FT                   /locus_tag="BTH_I0464"
FT                   /product="nitrite reductase [NAD(P)H], large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01077; match to protein
FT                   family HMM PF03460; match to protein family HMM PF04324;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR02374"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37664"
FT                   /db_xref="GOA:Q2T1C7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1C7"
FT                   /protein_id="ABC37664.1"
FT                   /translation="MRKMKLVMVGNGMAGVRTLEELLKLAPDLYDVTVFGAEPHPNYNR
FT                   ILLSPVLAGEQTLEQIVLNDYAWYESHGITLHVGKKIVKIDRVKRVVIADDGTEAAYDR
FT                   LLLATGSNPFMLPIPGADLDGVLGYRDIADTQAMIDAAARHTHAVVIGGGLLGLEAANG
FT                   LKLRGMDVTVAHLAPTLLERQLDAKAGGLLRASLEARGLTFLMPKETQALVGDENGRVR
FT                   AVRFKDGDTCKADLVVMAVGIRPNTALAESAGLYCNRGIVVNDTMQTYDPRIYAVGECV
FT                   SHRGIAYGLVAPLFEQAKVAANHLAQFGIGRYAGSVTSTKLKVTGIDLFSAGDFLGGGD
FT                   TEDITLSDPIAGVYKKLVIKDDKIVGACLYGDTADGAWYFKLLREGRNIADIRETLMFG
FT                   ETSLGDTGHSGATRATAMADDAEVCGCNGVCKGTIVAAIKEKGLFTLDDVRKHTKASAS
FT                   CGSCTGLVEQILMSTVGGDYSASPKAKPICGCTDHTHAEVRMAIREHKLLSVPDAMRFL
FT                   EWRTPNGCASCRPALNYYCISTWPHDAKDDPQSRFINERAHANIQKDGTYSVVPRMWGG
FT                   VTSADELRRIADVVDKYAIPTVKVTGGQRIDLLGVKKEDLPGVWRDLGMPSGHAYAKAL
FT                   RTVKTCVGSEWCRFGTQDSTLMGQQLERALWRMYAPHKVKLAVSGCPRNCAESGIKDVG
FT                   VIGVDSGWELYVGGNGGIKTEVAQFFCKVKTHEEVLEYAGAFLQLYREEGWYLERTVHY
FT                   LERVGLDHVKARVLDDAENRRALWERLQFALKDEPDPWRDTQDAKVDLRQFIPIAVAPA
FT                   DA"
FT   gene            520683..521327
FT                   /gene="maiA"
FT                   /locus_tag="BTH_I0465"
FT   CDS_pept        520683..521327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maiA"
FT                   /locus_tag="BTH_I0465"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="identified by match to protein family HMM PF02798;
FT                   match to protein family HMM TIGR01262"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38991"
FT                   /db_xref="GOA:Q2T1C6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1C6"
FT                   /protein_id="ABC38991.1"
FT                   /translation="MKLYSYFRSSAAFRVRIALHLKKLPFDYVPVHLLRDGGQQLTDDY
FT                   RALNPDALVPTLIDGDSPLQQSLAIVEYLDEAYPAVPLLPKAPVDRAYVRAIALQIACE
FT                   IHPLNNLRVLKYLKHTLQVDDDAKDAWYRHWIEDGFKSLEARLSSDPRTGKLCFGDTPT
FT                   LADLCIVPQVFNAKRFSIGLERFPTIQRIHDHAMTIDAFKAAAPAAQPDAE"
FT   gene            complement(521485..522786)
FT                   /locus_tag="BTH_I0466"
FT   CDS_pept        complement(521485..522786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0466"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36607"
FT                   /db_xref="GOA:Q2T1C5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1C5"
FT                   /protein_id="ABC36607.1"
FT                   /translation="MFSFFKRFKKAPDAAPAEPQQAPDAPQDAAGESAAPEAASKAARV
FT                   DAPAAPVSRGEYSEAPATERPRSDAPAPVRATPPVSPAAATPESPAGQPSAAEAARAPS
FT                   VVMTVTPAANGRNGVVETVEIVPPPAPEPAAKKSWIARLKSGLAKTSSSITNVFVNTKI
FT                   DDALYEELETALLMSDAGVDATEHLLGALREKVRTGRLTDPQQVKDALRGLLVELLTPL
FT                   EQSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLA
FT                   IWGERNNVTVVQQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVK
FT                   RVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAI
FT                   ARQRPIPVYFIGVGEKVEDLQPFSAEEFADALLG"
FT   gene            522761..522964
FT                   /locus_tag="BTH_I0467"
FT   CDS_pept        522761..522964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1C4"
FT                   /protein_id="ABC37079.1"
FT                   /translation="MNRLKKLNMVSLAEEAGDGARRRMHRPRSVPEPGGVRAAGSRAAN
FT                   PAFYQALALRRAAAAWRALRLW"
FT   gene            522981..523670
FT                   /locus_tag="BTH_I0468"
FT   CDS_pept        522981..523670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0468"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38651"
FT                   /db_xref="GOA:Q2T1C3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1C3"
FT                   /protein_id="ABC38651.1"
FT                   /translation="MRRAVSAGSFRYQRFRIEFSRMSRSSPARPQAQRAPVAGRGKPHT
FT                   IRIIGGDWKRTPLPVLDLDGLRPTPDRVRETLFNWLGQDLEGRRCLDLFAGSGALGFEA
FT                   ASRGAASVVMVERHPRAAQQLRALKDKLAARAIEIAEADALRIAAGLAPRSFDVVFVDP
FT                   PFGDAAAFARALELAPNLVAPGGHLYVEAGAPLDPCGHASLAGWRVVRHGKAGAVHYHL
FT                   LQRENDE"
FT   gene            523779..524279
FT                   /gene="coaD"
FT                   /locus_tag="BTH_I0469"
FT   CDS_pept        523779..524279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="BTH_I0469"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39389"
FT                   /db_xref="GOA:Q2T1C2"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1C2"
FT                   /protein_id="ABC39389.1"
FT                   /translation="MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF
FT                   SLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQG
FT                   PSA"
FT   gene            524344..524607
FT                   /locus_tag="BTH_I0470"
FT   CDS_pept        524344..524607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0470"
FT                   /product="ferredoxin"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39270"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1C1"
FT                   /protein_id="ABC39270.1"
FT                   /translation="MALMITDECINCDVCEPECPNGAISMGPEIYVIDPNKCTECVGHF
FT                   DEPQCQQVCPVECIPQDPGRPETKDQLMAKYRALIAAEKDGA"
FT   gene            complement(524741..525808)
FT                   /gene="hisC-1"
FT                   /locus_tag="BTH_I0471"
FT   CDS_pept        complement(524741..525808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC-1"
FT                   /locus_tag="BTH_I0471"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01141"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37300"
FT                   /db_xref="GOA:Q2T1C0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1C0"
FT                   /protein_id="ABC37300.1"
FT                   /translation="MSRYWSDIVHQLEPYVPGEQPALAHPVKLNTNENPYPPSPRALDA
FT                   IRHELGATGEALRRYPDPVARKLRETVAAHHGIAPEQVFAGNGSDEVLAHAFQALLQHD
FT                   RPLRFPDITYSFYPTYARLYRVAYETVPLADDFSIVVDDYLDDAGCVLFPNPNAPTGRA
FT                   LPLADIERIVAANPSSVVVIDEAYVDFGAESAVSLISRYPNLLVVHTASKARSLAGMRV
FT                   GFAFGDAALIDALTRVKDSFNSYPLDRLAQVATQASYEDDAWFEATRKQVIASRERLVA
FT                   ALAALGFDVVPSAANFVFARHPRHDAATLAARLKLREIFVRHFKLPRIDQHLRITVGTD
FT                   AECDALVAALRELLA"
FT   gene            complement(525882..526487)
FT                   /gene="pth"
FT                   /locus_tag="BTH_I0472"
FT   CDS_pept        complement(525882..526487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="BTH_I0472"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37803"
FT                   /db_xref="GOA:Q2T1B9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="PDB:3V2I"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1B9"
FT                   /protein_id="ABC37803.1"
FT                   /translation="MIKLIVGLGNPGAEYTATRHNAGFWLVDQLAREAGATLRDERRFH
FT                   GFYAKARLYGEEVHLLEPQTYMNRSGQSVVALAHFFKILPNEILVAHDELDLPPGAVKL
FT                   KLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHPRDMIPESARAGAKPDVANFVLKPPR
FT                   KEEQDVIDAAIERALAVMPAVVKGETERAMMQLHRNGA"
FT   gene            complement(526601..527272)
FT                   /locus_tag="BTH_I0473"
FT   CDS_pept        complement(526601..527272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0473"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="identified by match to protein family HMM PF01386;
FT                   match to protein family HMM TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38525"
FT                   /db_xref="GOA:Q2T1B8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1B8"
FT                   /protein_id="ABC38525.1"
FT                   /translation="MLSRGPVLLPGRGQHMENHMKVVAFERQQQGTGASRRLRNAGKTT
FT                   GIVYGGEAAPQMIELDHNALWHALKKEAFHSSILDLEVAGKSQRVLLRDVQYHPFRQLV
FT                   LHVDFQRIDPKKKLHTKVPLHFLNAESSPAVKLSSAVVSHVVTEIEVECLPADLPEFLE
FT                   VDLSKIEAGQSLHAKDIVLPNGVALTPHVDAENPVVASATIPAGAVSEEAAAGEGETPA
FT                   A"
FT   gene            complement(527379..528335)
FT                   /locus_tag="BTH_I0474"
FT   CDS_pept        complement(527379..528335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0474"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38783"
FT                   /db_xref="GOA:Q2T1B7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1B7"
FT                   /protein_id="ABC38783.1"
FT                   /translation="MSSHDGLMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQV
FT                   EIQENVRGKDVFVLQSTCAPTNDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRP
FT                   RSARVAISAKVIANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPILLGDLRKQS
FT                   YPDLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMD
FT                   DMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAADRIAASALDELVVTDTIPLSA
FT                   ESLACAKIRALSSAGLLAETFSRIRRGDSVMSLFAES"
FT   gene            complement(528382..528458)
FT                   /locus_tag="BTH_I0475"
FT   tRNA            complement(528382..528458)
FT                   /locus_tag="BTH_I0475"
FT                   /product="tRNA-Gln"
FT   gene            complement(528512..529393)
FT                   /gene="ispE"
FT                   /locus_tag="BTH_I0476"
FT   CDS_pept        complement(528512..529393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BTH_I0476"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37014"
FT                   /db_xref="GOA:Q2T1B6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1B6"
FT                   /protein_id="ABC37014.1"
FT                   /translation="MTDTTRSLRDCLAPAKLNLFLHITGRRPDGYHELQSVFQLLDWGD
FT                   RLHFTLRDDGKVSRKTDVPGVPEETDLIVRAASLLKAHTGTAAGVDIEIDKRLPMGAGL
FT                   GGGSSDAATTLLALNRLWKLDLPRATLQSLAVKLGADVPFFVFGKNAFAEGIGEALQAV
FT                   ELPTRWFLVVTPRVHVPTAAIFSEKSLTRDSKPITITDFLAQQDCNTGWPDSFGRNDMQ
FT                   PVVTSKYAEVAKVVGWFYNLTPARMTGSGASVFAAFKSKAEAGAAQAQLPAGWDSAVAE
FT                   SLGEHPLFAFAS"
FT   gene            complement(529427..530056)
FT                   /gene="lolB"
FT                   /locus_tag="BTH_I0477"
FT   CDS_pept        complement(529427..530056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolB"
FT                   /locus_tag="BTH_I0477"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="identified by match to protein family HMM TIGR00548"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37448"
FT                   /db_xref="GOA:Q2T1B5"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1B5"
FT                   /protein_id="ABC37448.1"
FT                   /translation="MTMPRFAWPHARTARRVAFAAAAAAAVALAGCATQPQRAPIAAPS
FT                   ALQTEQNRAYTGRFAVQYHDQLGNPRNVYGNFDWQEQGTNVSLELRSPLGQTLAIVKSA
FT                   PDGASLELPNRQPQFAPDVGELMQRSLGFALPLDGLRYWLLPTPSPATPATTVRDPQDG
FT                   ARIKEIRQDGWTIDYVAYADAPAAAVKRVNLVRQTPPLDIKLVLDR"
FT   gene            complement(530056..531876)
FT                   /locus_tag="BTH_I0478"
FT   CDS_pept        complement(530056..531876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0478"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38219"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1B4"
FT                   /protein_id="ABC38219.1"
FT                   /translation="MTLPSKLSQKRLAAARGPRAVPVRRAIGAALVAAWALAAFPAHAQ
FT                   NDAGDDAPQTAFASMLPEEQKDLPNVALTSQIVYQVLAAEVALQRNLPAPAYQTYLALA
FT                   RDTRDPRMAQRATEIALAAQSPADALTAANLWREYSPDSQRAAQVDAALLVLGGKPAEA
FT                   QPMLAQELARATGDNRGQAIIALQALLARGPNRVGGLTVLQDLLKNDMNRPEARLAIAR
FT                   QQLATDDKDGATQSLKEALRIKPDYLPAALMLSQMGPGERAAGIASFEKFVQQNPKSRD
FT                   GRLALAQLYLADDRLDDAQKQFDAMRRNDSSDPTPLMAIALIKIQQKHLDDATTYLKQY
FT                   VKVAQKKPGADVGQAYVYLAQIALDQNNEALAAQWLDKVDESSQQYVPAQVTRAQLLQK
FT                   QGKTDEARKLLANLQVSDPHDAAVIARTDASILFASRRYKEAADRLAQAVEDFPDDPDL
FT                   RYDYAMACEKIGQYTTMEQQLRLLMRAQPDNPQAYNALGYSLADRNLRLQEASKLIEKA
FT                   NSLAPNDAFIMDSLGWVKYRLGDTAGAATILKRAYDLQPNAEIGAHLGEVLWKSGSRDE
FT                   ARAAWRAAQKLEPDNDTLVQTLKRFQVNGL"
FT   gene            531965..532795
FT                   /gene="mutM"
FT                   /locus_tag="BTH_I0479"
FT   CDS_pept        531965..532795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="BTH_I0479"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF06831; match to protein family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38459"
FT                   /db_xref="GOA:Q2T1B3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1B3"
FT                   /protein_id="ABC38459.1"
FT                   /translation="MPELPEVEVTRRGIEPFVAGRRVERVDVRTAMLRWPVPADFAEML
FT                   RSREVLGVERRGKYLLFEVDAGWFIVHLGMTGTLRVLPNDAPPPAPAKHDHVDWVFDEF
FT                   VLRFRDPRRFGAVLWHPRDAGDVRAHPLLASLGVEPFSAAFSGALLFKRTRGRTVSVKQ
FT                   ALLAGDIVVGVGNIYASESLFRAGIRPTTAAGRVSLPRYERLADAVRATLADAIERGGS
FT                   TLRDFVGSNGESGYFQLDCFVYDRAGEPCRVCGAPIRQIVQGQRSTYYCPNCQR"
FT   gene            532800..533906
FT                   /locus_tag="BTH_I0480"
FT   CDS_pept        532800..533906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0480"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM PF00633; match to protein
FT                   family HMM PF00730; match to protein family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39160"
FT                   /db_xref="GOA:Q2T1B2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1B2"
FT                   /protein_id="ABC39160.1"
FT                   /translation="MKPPRIPSAPPVITPLHAAFAPTLIAWQRKHGRHDLPWQNTRDPY
FT                   RIWLSEIMLQQTQVSTVVPYYVRFLERYPDVAALAAAPIDDVMALWAGLGYYSRARNLH
FT                   RCAQAVVERHGGAFPAAPEALAELPGIGRSTAAAIASFAFGARATILDGNVKRVLARVF
FT                   GVEGFPGEKRVENEMWALAEALLPDAAGQADVTAYTQGLMDLGATLCVRGKPDCARCPF
FT                   AGDCVAERSGRQRELPAARPKKAVPTRRTWMLVLRDGDAVLLQRRPPAGIWGGLWSLPE
FT                   ADGDMALARRAREFGGVSLVPLASLTHTFTHFKLEIEPRLADLDGAAGGVSPAADDETA
FT                   WVSLDKLDAYGVPAPVRKLLDGLSGALL"
FT   gene            complement(534265..534897)
FT                   /locus_tag="BTH_I0481"
FT   CDS_pept        complement(534265..534897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0481"
FT                   /product="ATP-dependent protease La domain protein"
FT                   /note="identified by match to protein family HMM PF02190"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36595"
FT                   /db_xref="GOA:Q2T1B1"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1B1"
FT                   /protein_id="ABC36595.1"
FT                   /translation="MSSLSTTLIDLPLFPLHTVLFPGGLLPLKVFEARYLDMARSCMRD
FT                   EAPFGVCLLKSGPEVAQEGEVSVPETIGCMARIVECDTGEFGMLFLRTIGTQRFELLSH
FT                   RVEANGLLVGIAEPMQDDIPLEGDDALAQFGACAEALERIVEVLRKSDAELPFAEPFRF
FT                   DDPTWVSNRLAEVLPLDLRARQKLMEFPDVGARIDAVHRELNRHGWL"
FT   gene            complement(534924..535817)
FT                   /locus_tag="BTH_I0482"
FT   CDS_pept        complement(534924..535817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0482"
FT                   /product="Uncharacterised P-loop ATPase protein family
FT                   (UPF0042) superfamily"
FT                   /note="identified by match to protein family HMM PF03668"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37286"
FT                   /db_xref="GOA:Q2T1B0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1B0"
FT                   /protein_id="ABC37286.1"
FT                   /translation="MRIVLITGISGSGKSVALNALEDAGYYCVDNLPPHVLPELARHLA
FT                   NEGQNRLAVAIDARSSASLDEMPGLIRALSREHDVRVLFLNASTQSLIQRFSETRRRHP
FT                   LSGSPSHDADVGLLVSLEEAIERERDLVAPLAEFGHQIDTSNLRANVLRTWVKRFIEQK
FT                   NDDLVLMFESFGFKRGVPLDADFMFDVRALPNPYYDHELRPLTGLDQPVVAFLDALPVV
FT                   HQMLGDIESFLIKWLPHFREDNRSYLTVAIGCTGGQHRSVFLAETLAARLSRQANVIVR
FT                   HRDAPVAVDASSRLVT"
FT   gene            complement(535894..536862)
FT                   /locus_tag="BTH_I0483"
FT   CDS_pept        complement(535894..536862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0483"
FT                   /product="HPr"
FT                   /note="identified by match to protein family HMM PF07475"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38667"
FT                   /db_xref="GOA:Q2T1A9"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T1A9"
FT                   /protein_id="ABC38667.1"
FT                   /translation="MDTSSINAQSIFDDNAAMLKLSWLTGHEGWERGFSADTVANATSS
FT                   ADLVGHLNLIHPNRIQVLGEAEIDYYQRQTDEDRSRHMAELIALEPPFLVVAGGAAAPP
FT                   ELVLRCTRSSTPLFTTPMSAAAVIDSLRLYMSRILAPRATLHGVFLDILGMGVLLTGDS
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFVEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKLKLIVQLVRRPDGEFQRLPLESQTVDVLGLPISKVTIQVAAGRNLAVL
FT                   VEAAVRNTILQLRGIDTLRDFMDRQRLAMQDPDSQFPGKLV"
FT   gene            complement(536991..537446)
FT                   /gene="ptsN"
FT                   /locus_tag="BTH_I0484"
FT   CDS_pept        complement(536991..537446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="BTH_I0484"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM TIGR01419"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39321"
FT                   /db_xref="GOA:Q2T1A8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="PDB:3URR"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1A8"
FT                   /protein_id="ABC39321.1"
FT                   /translation="MNRLAKILPLENVVIGLSVTSKKRVFEQAGLIFENQNGIARSTVT
FT                   DNLFARERLGSTGLGEGVAIPHGRIKGLKHPLAAFVRLAEPIPFEAPDGQPVSLLIFLL
FT                   VPEQATQAHLEILSEIAQLLSDRDTRERLHTEPDRDELHRLLTQWQP"
FT   gene            complement(537733..538092)
FT                   /gene="yfiA"
FT                   /locus_tag="BTH_I0485"
FT   CDS_pept        complement(537733..538092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiA"
FT                   /locus_tag="BTH_I0485"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="identified by match to protein family HMM PF02482;
FT                   match to protein family HMM TIGR00741"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38935"
FT                   /db_xref="GOA:Q2T1A7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1A7"
FT                   /protein_id="ABC38935.1"
FT                   /translation="MNLKISGHHLEVTPAIREYVITKLDRVLRHSDQVIDGAVILTVDN
FT                   HKEKDKRQKAEITLHLKGKDIFVESANGDLYAAIDLLIDKLDRQVVKHMERLQTHAHEP
FT                   IKHQQTAEQIELPPQ"
FT   gene            complement(538242..539783)
FT                   /locus_tag="BTH_I0486"
FT   CDS_pept        complement(538242..539783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0486"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="identified by match to protein family HMM PF00309;
FT                   match to protein family HMM PF04552; match to protein
FT                   family HMM PF04963; match to protein family HMM TIGR02395"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36391"
FT                   /db_xref="GOA:Q2T1A6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1A6"
FT                   /protein_id="ABC36391.1"
FT                   /translation="MANFRYDFPFAMKASLQLRLSQHLALTPQLQQSIRLLQLSTLELQ
FT                   QEVATAIAQNPLLENDDDWIASPLRVAADGSVIAQTPASSSPEPMSGASNGTTATNERT
FT                   ERDETAGVDEYDGYSADGGDASQWNLDDFGRSPAASDDDDLPPMQIHETSTSLRDHLMA
FT                   QLRVTQASPRDRALVTFLIESLDDDGYLSASLDEVLADLPAELEVDVDELNAALALVHS
FT                   FDPAGVGARSASECLKLQLLRLDPSPTRTLALDIVSQHLELLAARDFTRLRKQLKATDD
FT                   ELRDAHALIRSLEPFPGAAYGKAEADYVVPDIIVKKAGQSWQAELNPEVVPKLRINHLY
FT                   ANILRNSRGDPSAGSLKQQLQEARWLIKNIQQRFETILRVAQAIVERQKNFFAHGEIAM
FT                   RPLVLREIADTLGLHESTVSRVTTGKYMLTPFGTLEFKYFFGSHVSTDTGGAASSTAIR
FT                   ALIKQLIGAEDPKSPLSDSRIAELLAEQGFVVARRTVAKYREALKIPAVNLRKSL"
FT   gene            complement(539921..540697)
FT                   /locus_tag="BTH_I0487"
FT   CDS_pept        complement(539921..540697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0487"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38691"
FT                   /db_xref="GOA:Q2T1A5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1A5"
FT                   /protein_id="ABC38691.1"
FT                   /translation="MNALPNRQPAGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVG
FT                   LLGPNGAGKTTSFYMIVGLVPLDAGDISLNGSPISLMPIHKRASLGLSYLPQEASVFRK
FT                   LTVEQNVRAVLELQHDDNGKRLAKSEIGARTEALLEELQIAHLRENPALSLSGGERRRV
FT                   EIARALASNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVRETLGICD
FT                   HAYIISDGSVLASGAPKEIIENESVRRVYLGEHFRM"
FT   gene            complement(540694..541359)
FT                   /locus_tag="BTH_I0488"
FT   CDS_pept        complement(540694..541359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0488"
FT                   /product="OstA-like protein"
FT                   /note="identified by match to protein family HMM PF03968"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39440"
FT                   /db_xref="GOA:Q2T1A4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1A4"
FT                   /protein_id="ABC39440.1"
FT                   /translation="MNESFPCLFPSGARRAVRAMVAAALVAAPLAGVAPAAHAEKADRD
FT                   KPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGYQYATATASGKK
FT                   HASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGQSTVADTVHGSVITY
FT                   DGQRDFYTARGGKDVAGPGNPGGRVRAMLTPKNGGPAPLSGSPAQLAPSNNIQGAPNP"
FT   gene            complement(541378..541992)
FT                   /locus_tag="BTH_I0489"
FT   CDS_pept        complement(541378..541992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0489"
FT                   /product="Protein of unknown function (DUF1239)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06835"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39261"
FT                   /db_xref="GOA:Q2T1A3"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1A3"
FT                   /protein_id="ABC39261.1"
FT                   /translation="MDGKFRLTSMIPLAAMAALAGGTYWLLQATLPPPGEALVRPKSHT
FT                   PDYFADNFSVTELDQTGSTQYRLTAAGLVHYEDDETSDLTQPALRAFQPGKPTVTATAK
FT                   RGTVNGDVSIVDLYDDARILRAAGAGDPPMQADSQHFRVLVNDDVIETEKPVKLQRGLS
FT                   IANAAAGMKYNNVTRVIELYGNVRGTIAASDTSGGAAGQPK"
FT   gene            complement(541997..542536)
FT                   /locus_tag="BTH_I0490"
FT   CDS_pept        complement(541997..542536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0490"
FT                   /product="phosphatase, YrbI family"
FT                   /note="identified by match to protein family HMM TIGR01662;
FT                   match to protein family HMM TIGR01670"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36894"
FT                   /db_xref="GOA:Q2T1A2"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1A2"
FT                   /protein_id="ABC36894.1"
FT                   /translation="MSASPVTAAERASRVKLMIFDVDGVLTDGGLHFTAAGDAMKSFNT
FT                   LDGHGVKLLGEAGIATAIITGRRSEAVAARAKEMRVAHLHQGAENKLAVFGELLRTLGL
FT                   EPGECGYMGDDWPDLAVMLRCGFAAAPANAHPDVIARAHWVAEARGGQGAVREVCDAIL
FT                   RAQRRYDALLAAACGA"
FT   gene            complement(542536..543519)
FT                   /locus_tag="BTH_I0491"
FT   CDS_pept        complement(542536..543519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0491"
FT                   /product="carbohydrate isomerase, KpsF/GutQ family"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR00393"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38758"
FT                   /db_xref="GOA:Q2T1A1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1A1"
FT                   /protein_id="ABC38758.1"
FT                   /translation="MIAKINDDRALALARDVLDIEASAVRALADQLDGEFVAAVGLLLE
FT                   CRGRVVVSGIGKSGHIARKIAATLASTGTPAFFVHPAEASHGDLGMVTKDDVFVAISNS
FT                   GESEELVAILPLIKRLGAKLIAMTGRPASSLATLSDVHLNAGVAKEACPLNLAPTASTT
FT                   AALALGDALAVAVLDARGFGSDDFARSHPGGALGRRLLTYVRDVMRTGDEVPAVPLGAT
FT                   LSDALFQITAKRMGMTAVVDDAGRVAGIFTDGDLRRVLERDGDFRRLPIVDVMTRNPRT
FT                   IAPDHLAVEAVELMERHRINQMLVVDEHGALIGALNMHDLFSKKVI"
FT   gene            543665..545656
FT                   /locus_tag="BTH_I0492"
FT   CDS_pept        543665..545656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0492"
FT                   /product="potassium efflux system protein"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38201"
FT                   /db_xref="GOA:Q2T1A0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T1A0"
FT                   /protein_id="ABC38201.1"
FT                   /translation="MTLLLLLASVAGVVVFRSLNLPPMLGYLTVGIVVGPHALGFAADL
FT                   ERAEHLAEFGVVFLMFSIGLEFSLSKLRAMRRLVFGLGLAQVLGTIAIALVLGALFERW
FT                   MHITWEGSVALGGALAMSSTAIVSKMLAERLEIETEHGRNIFGVLLFQDLAVVPLLIVI
FT                   AAFGGESSRDLALSLGFAAVKIVVALALLLIVGQRFMTRWLNVVARRRSQELFVLNLLL
FT                   VTLGAAFITDRFGLSLALGAFIAGMLISETPYRHQVEEDIKPFRDVLLGLFFVTTGMLL
FT                   DPSVIWRHPFLVLAFFVGQVLLKSVMITGLARAFGATPGVAMRTGLGLAQAGEFGFVLL
FT                   NLILDRHLVDATLLQSILASMLLSMLAAPFLIQNADRIVMRLSAAEWMQQSLQMTRIAT
FT                   QSIKQKGHVIVCGYGRAGQNLARMLEQEGIAYVALDLDPDRVTAAAAAGESVVFGDAAR
FT                   RESLLAAGIHRAAAVAVTYANTPSALRVLHNVHELEPTLPAIVRTVDDADLEKLLAAGA
FT                   TEVIPEIVEGSLMLASHTLVLMGVPMRRVVRRVEEMRDERYSLLRGYFRGADDADDDDH
FT                   EQVRLQSVPVDARADAVGRSLAELGLFALGIEVTAIRRHGIRGVEPDPETKLRASDIVV
FT                   LRGLPEALAEAEERLSRHRREGGSTAAA"
FT   gene            545741..546307
FT                   /gene="apt"
FT                   /locus_tag="BTH_I0493"
FT   CDS_pept        545741..546307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="BTH_I0493"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37724"
FT                   /db_xref="GOA:Q2T199"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T199"
FT                   /protein_id="ABC37724.1"
FT                   /translation="MMSTSSDAQLDPVEFIHSRIRTVPNWPQPGVMFRDITPLLQSAKA
FT                   MRVLVDLFVERYVDAKLDYIAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTQRES
FT                   YALEYGTATVEIHEDACKPGDRVVIVDDLIATGGTMMAGKNLLDRLGAVVVEGAAIVDL
FT                   PDLGGSALLRGAGLSLYTVTEFAGH"
FT   gene            546419..547033
FT                   /locus_tag="BTH_I0494"
FT   CDS_pept        546419..547033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0494"
FT                   /product="LysE family protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36963"
FT                   /db_xref="GOA:Q2T198"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T198"
FT                   /protein_id="ABC36963.1"
FT                   /translation="MPNFMLFLATSIAITVAPGPDNLQVLARGISQGRAAGIVAALGFA
FT                   SGVLFHTTLAAFGVAALLRSSPVAFHLLKLAGGAYLIWIGIKALRSKGLATAHERAPQP
FT                   LSTIFRQSVIGNLLNPKVTLFFVVFLPQFVDPHGAQPVALQMLELGALFMAQTALVFSV
FT                   FGVGAGAIGVWLKRRPRAGVWLDRLAGATFVALGLRVALKD"
FT   gene            547044..547895
FT                   /locus_tag="BTH_I0495"
FT   CDS_pept        547044..547895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0495"
FT                   /product="thiamin pyrophosphokinase-related protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39183"
FT                   /db_xref="GOA:Q2T197"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T197"
FT                   /protein_id="ABC39183.1"
FT                   /translation="MTFACIAAARRFEPAAHVPFWIAGRQVGWLRRGDVARLARWPDVF
FT                   EFPAGRVELAARYDSVDARSMALASPIGALAAEGAIVGWRDEIYAIRNRFDDPPLAYIE
FT                   RAASRFFGTMTYAVHLNGVVEYAPAAPLAMWLGRRSATKATDPGMLDNVVAGGIGWGLG
FT                   IEDTIAKECWEEAGIPAELAARAIPGRVAHVLCSLPEGTQAEQIFVYDLPLPRDFAPHN
FT                   QDGEVAEHLLAGVDEIVAWLRAGEATVDASLAMLDSLLRHRAISPDDARGIDALFVPPP
FT                   LG"
FT   gene            547950..548831
FT                   /gene="purU-1"
FT                   /locus_tag="BTH_I0496"
FT   CDS_pept        547950..548831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU-1"
FT                   /locus_tag="BTH_I0496"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00655"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38451"
FT                   /db_xref="GOA:Q2T196"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T196"
FT                   /protein_id="ABC38451.1"
FT                   /translation="MSADHSFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRT
FT                   GEFFMRVHFEQAGAADAAAALDGLRAEFAPLAEQFAMRWELHDASVKPRVVILVSKIGH
FT                   CLNDLLFRYRTGQLPIEIPAIVSNHKDFYQLAASYDIPFHHFPLAAGASADAKAAQEAR
FT                   VLEVIDEHAADLVVLARYMQILSPNMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGV
FT                   KLIGATAHYVTTDLDEGPIIEQEVERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHR
FT                   IVLNGTKTVVFR"
FT   gene            complement(549071..550105)
FT                   /locus_tag="BTH_I0497"
FT   CDS_pept        complement(549071..550105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0497"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36688"
FT                   /db_xref="GOA:Q2T195"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T195"
FT                   /protein_id="ABC36688.1"
FT                   /translation="MRSVRLTSDFSLPKLSAIEIGSYLLALFGLWLVLHLKLLGGLLAG
FT                   LLVYQLVHMIAPAIERHMSSQRARWVAVVLLSAAIVGGLAGLTIAVIEHFEHTVPNAQN
FT                   LLGQVMQIVDQARTRTPEWISNLLPVDAEQMRAKATGLMNKHMDQLQQGGKSVARGFGH
FT                   VLFGMIIGAMIAIGVDRHKLRQPLSTALVARISRFSDSFRRIVFAQIKISALNAFFTAL
FT                   YLLVALPIFHQRLPLSKTLVLVTFIAGLLPVVGNLISNTLIVAVSLSVSMGTAIASLVF
FT                   LVVIHKLEYFLNAKIIGGQIESRAWELLLAMLVMEAAFGVPGVIAAPIFYAYVKRELIY
FT                   LRLI"
FT   gene            complement(550335..553280)
FT                   /gene="uvrA"
FT                   /locus_tag="BTH_I0498"
FT   CDS_pept        complement(550335..553280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="BTH_I0498"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38074"
FT                   /db_xref="GOA:Q2T194"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T194"
FT                   /protein_id="ABC38074.1"
FT                   /translation="MVGSLKRRTRKVVIVAGLVLSSSAGFMEQIRIRGARTHNLKNVNL
FT                   DLPRHKLIVITGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLQLMEKPDVDLIEG
FT                   LSPAISIEQKATSHNPRSTVGTVTEIHDYLRLLYARVGTPYCPDHEIPLEAQSVSQMVD
FT                   AALALPEETKLMILAPVVANRKGEHAELFDEMQAQGFVRFRVRSGGGAANEGVAKIYEV
FT                   DSLPKLKKNDKHTIDVVVDRLKVRADMKQRLAESFETALRLADGRAIALEMDTDREHLF
FT                   SSKFACPVCSYSLQELEPRLFSFNNPMGACPECDGLGQITFFDPKRVVAHPSLSLAAGA
FT                   VKGWDRRNQFYFQMLQSLAAFYDFDIDTAFEDLPEKIRKILLYGSGKQTIPFSYINERG
FT                   RTTIREHVFEGIIPNLERRYRETDSAAVREELAKYQNNQPCPSCDGTRLRREARFVRVG
FT                   QGDYARAIYEVSGWPLRDALGYFDGLTLDGAKREIADKVIKEIVARLTFLNNVGLDYLS
FT                   LERSAETLSGGEAQRIRLASQIGSGLTGVMYVLDEPSIGLHQRDNDRLIGTLKHLRDLG
FT                   NSVIVVEHDEDMIRTADYVVDMGPGAGEHGGVVVAEGTPKQVQANGDSLTGQYLVGKRT
FT                   IEYPDERISPDAQRMLRIVDAHGNNLKHVDLDLPVGLLTCITGVSGSGKSTLINDTLYN
FT                   AVARHLYGSATEPAPHESIEGLEHFDKVINVDQSPIGRTPRSNPATYTGLFTPIRELFA
FT                   GVPASKERGYDPGRFSFNVKGGRCESCQGDGVLKVEMHFLPDVYVPCDVCHGKRYNRET
FT                   LEVQYKGKNISEVLDMTVEHAYEFFNAVPVVARKLKTLLDVGLGYIRLGQSATTLSGGE
FT                   AQRVKLSLELSKRDTGRTLYILDEPTTGLHFHDIALLLEVIHRLRDQGNTVVIIEHNLD
FT                   VIKTADWVIDLGPEGGAGGGQIIAQGTPEQVAKTKASFTGKYLAPLLKRKK"
FT   gene            553165..554601
FT                   /locus_tag="BTH_I0499"
FT   CDS_pept        553165..554601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0499"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37747"
FT                   /db_xref="GOA:Q2T193"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T193"
FT                   /protein_id="ABC37747.1"
FT                   /translation="MWVRAPRIRICSMNPAEDERTKPATITTFRVRRFRLPTNSRAPGS
FT                   GLSRRPGRSRAARGGRRPARIIRRPAAGGPPIHSNTRPMSNPSATSTRMSAPELRATTS
FT                   LAAIFALRMLGLFMIMPVFSVYAKTIPGGDNVVLVGIALGAYGVTQSLLYIFYGWASDK
FT                   FGRKPVIAAGLLIFALGSFVAAFAHDITWIIVGRVIQGMGAVSSAVLAFIADLTSEHNR
FT                   TKAMAMVGGSIGVSFAVAIVGAPIVFHWVGMSGLFAIVGALSVVAIGVVLWVVPDAPRP
FT                   VHVPAPFAEVLHNVELLRLNFGVLVLHATQTALFLVVPRLLVDGGLPVASHWQVYLPVM
FT                   GLAFVMMVPAIIVAEKQGKMKPVLLGGIAAILIGQLLLGMATHTILIVAAILFIYFLGF
FT                   NILEASQPSLVSKLAPGSRKGAATGVYNTTQSIGLALGGVVGGVLLKHGGPDTVFFACS
FT                   ALVAVWLIIAAGMKQPPRKA"
FT   gene            554715..555275
FT                   /locus_tag="BTH_I0500"
FT   CDS_pept        554715..555275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0500"
FT                   /product="single-strand binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36515"
FT                   /db_xref="GOA:Q2T192"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T192"
FT                   /protein_id="ABC36515.1"
FT                   /translation="MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASG
FT                   EFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQDGQDRYSTEIVADQ
FT                   MQMLGGRGGSGGGGGGDDGGYGGGGGYGGGRDMERGGGGGGRASGGGGAGARSGGGGGG
FT                   GGASRPSAPAGGGFDEMDDDIPF"
FT   gene            complement(555387..556115)
FT                   /locus_tag="BTH_I0501"
FT   CDS_pept        complement(555387..556115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0501"
FT                   /product="dienelactone hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01738"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39345"
FT                   /db_xref="GOA:Q2T191"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T191"
FT                   /protein_id="ABC39345.1"
FT                   /translation="METRAIAYDCEGAKLTGYFADGAPNTKKPAILVAHEAFGINEHIR
FT                   ARTRRLAELGYAALALDMYGAEGFSMQEAISRHIELMSAPGLMHARASAALSALMEQPG
FT                   VDRERIAAIGFCQGGISALELARGGAPVRCAVGFHPGLMRPAGSQDQPIRAKVLMMIGD
FT                   QDPDVPADDRAAFAAEMQRKRVDWQLHLFGGVGHAYTNPDADGWNKPGYGYSPAADRRA
FT                   WTMMLALFDEVFGAAAVGKA"
FT   gene            556428..558008
FT                   /locus_tag="BTH_I0502"
FT   CDS_pept        556428..558008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T190"
FT                   /protein_id="ABC39108.1"
FT                   /translation="MNPFFGTQREWQEVPVPARAYARLDNIHLPHADAPDRQAALRFDL
FT                   IDADWLDDQARADNPLFDLGRRHRMHAAWKRWFAAARDGEADDPFRAAPLYVLEVSVPF
FT                   DAREWRKRLGLTREAMANDAHGEILAAFRRRWYELTVLREADARAGAMFGLLHRGIADE
FT                   GLRVCCFAALAPAARAAGLTALGTLAGSPALTSASLKPLVRDVRATYLGVYDVGQANAN
FT                   ALLGGIRGRDLHGVVRHGVFPTLYFDLGMPLQSQRHTAPTNVRFCFTDEPVIVLSHWHD
FT                   DHLGGVSLPTAPGCPSAEQMDWIVPDYSLATRHKALVTAIWAAGGSVHVFSASPAGRRL
FT                   QATTASGHLLTLTRGTARDPNNGGIIMQVSSVQPKARRSADRPRSWLLPGDCEYKHFPS
FT                   TFKPTNVIALVAPHHGADLKKGSVPVPPAASGYLRLVYSFGRDNKYEHPRQGFVDAHHA
FT                   AGWTHPVAAATGAIECVSGNCVRTTNEHSPLPAKPTGVLVGWSKAPLSVPACTLSGGAA
FT                   SCTLPLAKV"
FT   gene            complement(558171..558422)
FT                   /locus_tag="BTH_I0503"
FT   CDS_pept        complement(558171..558422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38132"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T189"
FT                   /protein_id="ABC38132.1"
FT                   /translation="MRLIEPNEHDGYLAALHGRGLSGSDFTLRETDTTDPKGDENIGQT
FT                   GFVTITRRSTHATREYPLGDASDWLQHFRKDLEAGAFD"
FT   gene            complement(558595..558912)
FT                   /locus_tag="BTH_I0504"
FT   CDS_pept        complement(558595..558912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37298"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T188"
FT                   /protein_id="ABC37298.1"
FT                   /translation="MIAPDPESTFRGLPLTPEQNAEVMHYIKVRTQRGLPWDTPELEAM
FT                   IRDMMLPPEDEAADSDFLSDEARAVAERAMSSVEDEMDPIEAREEWRAAMEAENMKGLR
FT                   R"
FT   gene            complement(559553..561472)
FT                   /locus_tag="BTH_I0505"
FT   CDS_pept        complement(559553..561472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0505"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36691"
FT                   /db_xref="GOA:Q2T187"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T187"
FT                   /protein_id="ABC36691.1"
FT                   /translation="MDRLEYADPSLGRLIVPDLIDQLADNPEIDAVMLEKVASVLLRAM
FT                   PFTADGFHKTIASRVTDTHDPVSAGYYLLILFGLEGDTAVDALRATMIRLDPPGKAALC
FT                   RTLLPRLVGSRFNREVTSPTTLSVTRLEQLLIMAFEGVRPSEVVERANGVVYSPDLRDK
FT                   AQDARDMIFDRLLKIPGEATHAALKRLEQIPEFPIRPKWMRVHALRRTEADAVLPPWAP
FT                   EDVMTFERTSDRPPTTTSDLQLLARRRIEVIQHDLIHGKFAQGDTLKLLPHENSVQRWI
FT                   ATQLEARQKEAYNHRNGTSAKTVLTPNGELKLDIPRDRQATFEPQLVGKYQRRLPGFDD
FT                   HVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMYPIVY
FT                   FDALRLKIRDEGTVKNKAVYLALGIRADGRKEVLGLWIEQTEGAKFWLKVFNELKNRGL
FT                   HDILIAVVDGLRGFPEAIEAVYPAAQIQTCIVHLIRNSLNLASWKDRKPLAAAIKPIYQ
FT                   AATAEAAAAALDAFAQSEWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIES
FT                   MHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILFGERFT
FT                   SAIN"
FT   gene            complement(562366..562977)
FT                   /locus_tag="BTH_I0506"
FT   CDS_pept        complement(562366..562977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0506"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02627;
FT                   match to protein family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37292"
FT                   /db_xref="GOA:Q2T186"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T186"
FT                   /protein_id="ABC37292.1"
FT                   /translation="MRQIKSSPTGFLMLEGECDPLAVNAFRSRAALRGLTRKIGRNVRA
FT                   GVGACGQRRCRFNAPMRLRVERDGWARANGVASFKVRNRRNTMALPQSYRELTGEVATQ
FT                   MRALRKTQPDLMSAFAALAAAGTKEGALGKKTRELVALGIAIASRCDDCIGFHVQTLVK
FT                   LGTTRAEFEDLLATAVYMGGGPSMMYAAHALKAFEEFGGE"
FT   gene            complement(562981..569079)
FT                   /locus_tag="BTH_I0507"
FT   CDS_pept        complement(562981..569079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0507"
FT                   /product="FG-GAP/YD repeat domain protein"
FT                   /note="identified by match to protein family HMM PF01839;
FT                   match to protein family HMM PF05593; match to protein
FT                   family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36603"
FT                   /db_xref="GOA:Q2T185"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T185"
FT                   /protein_id="ABC36603.1"
FT                   /translation="MAKTSGTADEILNLPSGGGSVGGDGGDFSVDLNTGTATLKFDLTV
FT                   PAGPNGITPPHTLQYSAGAGDGAFGLGWSLGLMTIRRRITPATGAAEPAPPGACTLVGV
FT                   GELVDMGARRFRPIVDATGLLIEFTGASWTATDKTDTQYTLGTSANAQIGDGGALPAAW
FT                   LVDRCADSAGNAIAYTWLAVGGARVPQTIAWGTHRLVFAYEDRPDTIVDGSYGAPVTLD
FT                   KRCSRIELHATTETPSLVRSWTLLYDDDNGRGRSLLATIREQGHAADGSVLAAPDRTFA
FT                   YSRPGAPALVPVTGWTTPLSDPDTDLVDLNGDGLPDIVHLGNGMPTMHPNLGGGQFGAP
FT                   RPLARTAAPLRLSAPSVAFADMSGNGSVDVLVLDEPFSGYYPLSAPGGSAPAGFGRPIV
FT                   FERAPAVSPSDVRLRFVDLNGDGVTDILLDTGRGWLIYLRDGPATWSDAPRVLPPARTP
FT                   PVSLADPHVHLADMTGDGLMDIVRVTGGGLTYWPARADGGWDAAIAMTPSPAFARDFDP
FT                   HRLALYDVDGDGCADLVYVGLQSVTVWRNVGATRLAAPVAIPGTPIALPGSYRVVDLLG
FT                   SGTAGVHFQLPSIAGASRQTYLDLGGGVKPYLLTDLAHGDAQSTHIGYRTSTEYARDDA
FT                   QAGAPWRTYHPFPIQCVARTDQTDHGTGATTSTRYAYHDARYDPATRTFLGFGRVDSEQ
FT                   LGDASCPTLRVETTFHLGLDPADPARPLAGDEALKLGALRRKPLVTATYGLDGSPLERH
FT                   PYSITRHAYDALLVASAAGNGKRIAVPYCTTSTEERWERQSAAVSTRTVDYLAITSEGD
FT                   VTSQRTRAQRAGVAAPDQDVTTTTTLATGGKNLRLPARITQSAPDGSIVSESVCFYDGD
FT                   AFAGLPEGQAARGLVTRIEDRVFDDAFAASIWGENLPDLTRYGYHRLPGDAAGWWKTRR
FT                   AHERGSNATGPTLATKGPLGALQTLQYDASGQRVVKVIDALGNAVSATTDARVFQTASL
FT                   TDANGHLTTDAFDALGRVVATIGPLDTPALPTIAFTYATGAISTVTSATRSAHGGNDTV
FT                   CAVTWIDGTGNVLGKGTPAAGPGEWTVTNAVRRNARGLVAASFLPYAATGGNWQPPSAG
FT                   TGATTSTYDALGRLVQLTRPDGLVVTSRREGGTVITSETWPGGAAVDIERQEYDAAGQL
FT                   VSVSRNAGDHWVEQRYAYAPSGKVRDVTLPGGAHVAFALDLLGRVFAQQSPDTGRTVFL
FT                   LDASDNQRARTNAAGQIVRTEVDAMNRVTNVYHDAEPTPRVRYEYADANGAPPADGIVA
FT                   NRFTRVWRITDELGAIVFEYDEAGRRTATTRTVASTAQSFVTRRAYDALGRLASATLPA
FT                   TAPGGAGRTVVYGYAADGRLVSASGVVKRAAYDLFGRLTSIDYANGASTLIDYAANAGG
FT                   IARVRVLDASRNVLRDTTLTRGDGLVTTLASANAADDSVDFGYDALRRLTSANYRQGAS
FT                   PADAHGWTFDDAFNATAVTDAGALTYEPGTHRLASVGGAATAFDAAGRMTTGRFGAATF
FT                   DAADHLSGVTLPDATQIAHTYDYQGRRVRSTQNGAQTYFSPTEDVEFQGGTAIVWITFG
FT                   RQRIAADIGGALTFVHPNALGVMDLITDSGGAYGTRVRQTPFGYARPADGAAPAGGVAA
FT                   VALALGAADATGLVCHGLRWYDPRVGQFISPDPVVTSVYTVGAWNPYVYCLGNPILLAD
FT                   PNGCSFLSVLEIIGVAILAAACVVGAIFTGGATLVALGVLSANIGGWLLAGVALGSLGG
FT                   AIAGELAAQKAGGNLWAGAFLGAFLGGATSLIGGALGGAAAAGIDTLIGGTKTFLSFVA
FT                   AGAIQGTLAGAGTGLAIGYAGGKGNAESMLIAMAKGAAWGAVLGTLLGAGIGAIAGTGI
FT                   SGAAKPDNFLNIGAFGQKFADFTSTSTAINSADNAAGVTESLTQLSMPNGFNAGNMLGL
FT                   LPNLVTTNEQAAGWFSIPIGWLGPGVLNDAGFAGLVDTSMALDQAGFSYAHQISLLLGA
FT                   APYFIDYAATMAQIVDASGVNNFEMAFNNAFGSGSPSNTG"
FT   gene            complement(569101..572766)
FT                   /locus_tag="BTH_I0508"
FT   CDS_pept        complement(569101..572766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38706"
FT                   /db_xref="InterPro:IPR040840"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T184"
FT                   /protein_id="ABC38706.1"
FT                   /translation="MLAARGIRRDGDLHASAPERDTSRSDRRRFVFSDKSGHFDDRIDL
FT                   TIRYRDSESLKATTCAPIRGHGVLLSRHAGFRFRIASAEAARTARCRHRCSRERSCNSE
FT                   PGAWPADRHPALARGRTPLPGGATMLSLTQRVLTYSFIDRPPVNPRAIGTSSADAALLT
FT                   QIDALLASAAASFKARAYDAALDDYFACESLIYSQLDPQWDPDLGGRLRSRLPRDAALF
FT                   DSLLSATSQWLNVLSVPAPASPVRPATPPPAQALAGVAALHGAGLTPVSANPAATAQAL
FT                   SDMQLASLYTAQGNSAASSAAAARAKTLDASVAGAFSPPQMPNPTMLPGANPTVAASAS
FT                   PGAAQAFHPAAIGMMPPRGIDLAPAALTPIKILPIPKLPITLLAQKQVGLLTGSGAQTA
FT                   VRTIQWAASGTPDIASIKTILYAPHASATALPDALTNANSLWERAVLLPHDYFYTIPLA
FT                   IAQCYQALGDYANAETSYLQAAGYAYINTTTEGPYVWAALAGLYRAWGDSLYLQGDRAG
FT                   ATSAYGKVVTPGSPAAPATALYQTAGLAVAAKRATALLPQLATLAQTGTGGVSADDVAI
FT                   ATVLLEVYAKLVQIGAGLDYWGNYAAAVPIWSFSYLQQVAINFAQLAQQAENQVINFWN
FT                   QADQATLTRTELANQVSQANGQIDAAQQQLAVAQAQAHAYQAGVTVAQTRATNAAKNAQ
FT                   EYGALNSQVIVIQATGQQVSGGDDGDYNGVSAMANQYLSGQRISGDSATVAAATNLAAN
FT                   RLSQQFQIDSMNRTTAEMQQALAQAQAQLAAANAQVSAAGANLAVAQLNAQAAAQTLGV
FT                   FDADTFTPQVWKAMGNFIQQIYERYMNMALRAAKLMQQAYNFENDVSVSFIKASYQGVV
FT                   NGLLAADALMADIQSFTDDLVNAKRGKKQYLKQSISLASRYGYLFETQLRKTGTMTFET
FT                   TLDDFDSAYPGTYQGRIRRVLVSVQGIVPPTGISGTLGNEGISFYRLPADVATPAAPSK
FT                   VRVQSAETQVISDYDPVQDAVLAPPPDNQTGIFEGAGVASSWTLSLPPALNDINYGTLT
FT                   DVVLTFIYEARFDPRLVQPVLAQLASRPGFYNRERSIPLAWLYPDLFYGFVSTGELTLN
FT                   LSAADFPIDQTGPSVTAVSLLVAMKPGASASNVTIALAAPGKGALSGTTDATGAISSQG
FT                   AASAWAGAIGGSALGDWTLALSAAANPSLAPGGKLDLSSLINLVLVIDYAFKPRG"
FT   gene            complement(573372..573773)
FT                   /locus_tag="BTH_I0509"
FT   CDS_pept        complement(573372..573773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0509"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37835"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T183"
FT                   /protein_id="ABC37835.1"
FT                   /translation="MSARAPPVRSDFPTTTPRTGMNQELLTHIRADQLDGSIFDASCHA
FT                   VTIGPVTVEFRTSAEPPSATAELYISRQLVGGCTVNAAHPSGKCGGSVGKLKAEVDLTL
FT                   DVPGGKLDYKLTVCAPIIGGTSKSGTLSL"
FT   gene            complement(573770..574147)
FT                   /locus_tag="BTH_I0510"
FT   CDS_pept        complement(573770..574147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38903"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T182"
FT                   /protein_id="ABC38903.1"
FT                   /translation="MSSSDIIQPRLVLVSIASATAAYTALSPHVPGFLHIVAEGEAPLH
FT                   VGNIHLAHDPGFIGGMLLEVVGIAGRPSPTVKKYRTPACSFESRYHKEIFIRGANGIIP
FT                   VKVGLFRHEATHTAEAALDAE"
FT   gene            complement(574438..574812)
FT                   /locus_tag="BTH_I0511"
FT   CDS_pept        complement(574438..574812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38594"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T181"
FT                   /protein_id="ABC38594.1"
FT                   /translation="MSSDIVESRIVLVPVTRAYATYTSFSLHLLGTFHVYAEGEKPLNI
FT                   RNPHLTPQMWYPPGGLSVVGVVGRPRLGPITPYRTPVYSYQGQYQDTIYVQGANGIVTV
FT                   KVRLLKDEEAETFLDTLDAA"
FT   gene            complement(575282..575635)
FT                   /locus_tag="BTH_I0512"
FT   CDS_pept        complement(575282..575635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T180"
FT                   /protein_id="ABC37873.1"
FT                   /translation="MGFYGPEPFEKATATYVWLGLRVPGALIVEVEGNAPRFTTGIQLV
FT                   RDPRFVGGLKIDVMGWTGPLSSGTQPYRVRHTFQGVFHPTIVVHGSNKTEVVEVKQIPH
FT                   EEADAFLQALDAA"
FT   gene            575895..576902
FT                   /locus_tag="BTH_I0513"
FT   CDS_pept        575895..576902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0513"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36755"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T179"
FT                   /protein_id="ABC36755.1"
FT                   /translation="MALLENGFSGETSLLRARHVLGRDPQRCDTVISDPYVSRIHASIC
FT                   WTAGRWELHDHGRNGTFVSGRFVGEGECVVLRDGDLLQFGSAGSVRWRARELGEPVDML
FT                   WPLRSPAQPIALDRAQALPGAAFTVSRSAQGDWLCDDTTPARVLHDGDAVTCGEFAWQL
FT                   VLAHRNVTAALPRAAQAATLPQRVDFTVSRDEEHVTATLHTRGGAVDLGARAHHYCLVT
FT                   LARARFADAQAGYDAASRGWIELDVLARMLGLDESHVNVQIHRARTQFLPLLSPGSAEL
FT                   VERRRGGVRFGALAFRVVRGDRLECESAEAGASAPLPDPLARGAATFVSPVALG"
FT   gene            576913..580974
FT                   /locus_tag="BTH_I0514"
FT   CDS_pept        576913..580974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0514"
FT                   /product="protein kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF06498; match to protein
FT                   family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36819"
FT                   /db_xref="GOA:Q2T178"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023889"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T178"
FT                   /protein_id="ABC36819.1"
FT                   /translation="MSAPVLDERARAGHRRSPRGLVPPLPGEGDELQGEHRYRLGGVIG
FT                   EGGAGRVHEAIRLDTSQRVAIKLLLEDAPRGARERTRLRARFRREMALCARLSHPHVVA
FT                   LLDSGETPDGLLFAVFEHVAGRTLRARLAADGALPAEATGALMAQVLDGLAHAHANGVV
FT                   HRDLKPQNVMVTTLDGEPCAKILDFGIGALLPDARAADELTLTATTEVLGSPQYCAPEQ
FT                   LRGEPPTAKSDFYAWGLMVIECLTGHPVMQGASVADVLYQHLSPVDVALPPAIAAHPLG
FT                   DVLRDALNKDPRLRAESAQALANRFRAIHFPALVGGLRYGRRAQAEPGVAYREPGRTIA
FT                   PDAPVGRRQVTALCCRVTVVATGAQPDDAAAAEEALDAFHAQWLTRCSDIAVRYGGHVA
FT                   GALGDTLLVYFGYPEGIDRPAQRACRAALEMTRHAGQPADAPCSPGAGASAPAWRIEIA
FT                   GAIHVGTALANARGASGGAIASAAVGLQRIAPPGGILLSDEAARALERHVDAAATPLVF
FT                   AAPGAAPQPVRELLGERYERGPFESLELGDAAPIVGRDREQAALARAWRDAVRAAAGGT
FT                   RAQRRATLVVGEPGIGKSRLVHALRETVRAQRGACAACVCLPEQTNHALFPILRFVRAR
FT                   WQLDAGDPHALDRMLEAFDGDRASARATLAAWLGLPGGAHTLRWSGARQQQALFDVLCQ
FT                   LLGSLGGRAPVLLIVDDVQWCDSATGDFLDALVRHPACAAVCVVLTSRPEQLERWRRGT
FT                   ERLMLRRLSAAATRNLIVSLMPGAVADRAALDFLVKRTGGVPLYVEETIRALAEGGVAP
FT                   TASGRLPDLAEAGRCPLPGSLRETLELALERADGALDTVQLAATIGLEVDARLLAEASP
FT                   HAGAELDDRLRRLLEGRVLYAQHRIGGATYVFRHALLREAAYESMPAAMRREHHRRVAR
FT                   ALLARGADGDPAALSASIADHFARAHAFADAVPHGIEAARHALARALHDDAIRYAGAVR
FT                   GWLLHCDYPGQQEDAVSVDLTLAHAQMARDGWGDPRVREHTDRVLSRVGELSDAKAAVS
FT                   ALWTVAVYHHVAGDREAVRRTGAQLSALAHASAREDLRVAADTLRGMALWIDGHYTLAL
FT                   DAFDAALAAYDPRRDGDHRRTFGLDTRAWALSARASVLWGIDDDVPGTLALARDAVHLA
FT                   TCSDHLPTIGVTMMYLARMQQCAGDRDGARATADAALGLSRCYGLNAVERYAAVVRAWC
FT                   DGDRDAARANVDALRESGCLLGLTYYASVVADIDAERGDAHAAIATLDECVALAEAMDE
FT                   RYYVAELLLKKAHCVRDAYGRRAADEIDALCARAAAVARQGGMARIAKKAQTELRELHR
FT                   GLRSTIGEER"
FT   gene            580971..581333
FT                   /locus_tag="BTH_I0515"
FT   CDS_pept        580971..581333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38267"
FT                   /db_xref="GOA:Q2T177"
FT                   /db_xref="InterPro:IPR022261"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T177"
FT                   /protein_id="ABC38267.1"
FT                   /translation="MTDRSPSMPTYDQFLEYRAVIVQAIAVAWHDKAFLDDLVEHPVET
FT                   LHKRFDYRFPMKMHLKVHKQSATWTPLVNGGWTTNEINGLELVLPPAPKPEQCAAALAA
FT                   YNAKHISLFGPDRKEI"
FT   gene            581335..581697
FT                   /locus_tag="BTH_I0516"
FT   CDS_pept        581335..581697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37086"
FT                   /db_xref="GOA:Q2T176"
FT                   /db_xref="InterPro:IPR022261"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T176"
FT                   /protein_id="ABC37086.1"
FT                   /translation="MADNNAVPTQQSLLEFQEIYLRAIALAWENEEFKRKLLADPHDAL
FT                   ERYLDYRCPWILNLKIVEAPANEPAYGWNAEKQRWYLPVNSLSVGIPAQPANLAEEAIA
FT                   LAAYNDAGPAYLFTCC"
FT   gene            581786..584056
FT                   /locus_tag="BTH_I0517"
FT   CDS_pept        581786..584056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0517"
FT                   /product="uncharacterized domain protein"
FT                   /note="identified by match to protein family HMM PF02624;
FT                   match to protein family HMM TIGR00702"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36436"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR022291"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T175"
FT                   /protein_id="ABC36436.1"
FT                   /translation="MLDDFSRVLRFKPHLLVRDTGSGALYVVDEFRRSVLPGDVFPALA
FT                   ACMRDRLTIAQTFAALAARFSQWEVLAALDHLVRRGYVRADAPGERDAAIGFYERTGVD
FT                   GDAASDIASRLAVAVDAFGVDPRAQLDAFAACGIGVAPDAPLTVALADGYERAELIDAA
FT                   ERAAARGDALLVVVPDRVEPLLGPLLGPPAGARSASASTEEAGADAPPCIECVRYWTAL
FT                   NRPVETLLARLHGSDAARLPGAHSRASEAAVAAVVASFVEQIAVNAQRRRHASAHIVSL
FT                   RVDTLATAAHRVVRRPQCPRCGNARWMREQAERPVTLASADAGARREGGYRTLAAAELV
FT                   KRYGHLISPVSGPIAYLHPMPGRNAGLRHVYVAGYLVCPPSAPRENRFDKLCSGKGASD
FT                   AQARASALAEALERFSGVHQGDEATLRGSLAELSAHAPPGGGPIDVNALQQYSDRQFER
FT                   RERHNATTDDPRKQVPQRFTRDSVIDWTPAWSIATGARRLVPLAYCYAETPAASGAAYC
FT                   VHNPNGCAAGACIEEAILQGLLELVERDAVAIWWYNMLRRPAVDIESFGDPYFDALVAD
FT                   YASLGWRLWALDITHDLRMPVFVALARETATGRFSIGFGCHLDSRIALQRALTEVNQLL
FT                   DVGASAPPPWDADKLPDDAFLHPDPALPPTRGPSRASHGACDLKGDIENGVARLSAAGI
FT                   DTLVVDKTRPDIGLPVVQVIAPGLCHFWPRFGAPRLYSVPVAERWCERPRDEDELNRAL
FT                   LFL"
FT   gene            584140..584916
FT                   /locus_tag="BTH_I0518"
FT   CDS_pept        584140..584916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0518"
FT                   /product="aldolase, class II"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36491"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T174"
FT                   /protein_id="ABC36491.1"
FT                   /translation="MTIQAPNQPFARPPRFADAEWQARVRLAAAYRIFDHLGWSELIYN
FT                   HISLRVPGEDTHFLINPFGLHYREVCASNLVKVDVEGRPVGHSDWPINPAGFTFHAAIH
FT                   LALPDAHCVMHVHTTPTMAVCASRRGLSYSNFYAAQLHGRVAHHDFEGITVRPDEGRRI
FT                   VDSAAGRPVLLLRNHGPVAIGRTLAHAFSLMWLLHRACEVQVATQALGEPLEIDAPILE
FT                   ACARDSLNLDPRYGAGQDAFDALQRIVDRVDPGYRS"
FT   gene            585303..587639
FT                   /locus_tag="BTH_I0519"
FT   CDS_pept        585303..587639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0519"
FT                   /product="EAL/GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39422"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T173"
FT                   /protein_id="ABC39422.1"
FT                   /translation="MNATCRFRRCIDGFRPQSTVSRTERAVRPVRAPGRRDRADGGLAR
FT                   RGAAVRRAARRRARPRADAIERVFGAIGMRERRAHDATCTAGANASDAPRAWRFEPARA
FT                   YTAAAAHPARGEARGPGVDVAPNPMPRSPEAGAAALPQSQPYLDMIDSTFREPAAIALA
FT                   LSLLGMLALALLPVFRIRRLALRLGEAEGALAMSEARARAALVAVGDGVIFTGRAGRVE
FT                   CLNPAAEQLIGMLADDCRGRPLVSTLRLARAGAEAGGPSDVFDWSDACASSGSAASCDA
FT                   PLGGLEDGGSCDATLYRADGGAIAVRATASSIAPPSGHARRACGSGRVLVLKSLAAEHD
FT                   LVRRLARQTTHDPLTGLPNRAEFERRVDFALAANVRGPVALLFIDLDCFRIVNDTCGYA
FT                   AGDAMLAALAARLVACAASTDVVARLGGDEFCVLLDAGDEASAACAAERLRASVDGFVF
FT                   VWEGQPFSVTASVGVALLGAPDRVPRVEDAVRLAGIACDFAKARGRNRVQLADPHDHEL
FT                   AHHINDVSWCARVRQALECDDFCLYVQPIVDTATQGASRPPRARRGELLLRMGALGERE
FT                   GVAPPGHFIRAAERYGLVTDIDRWVVRTVFDALARARSRRFSEYAINLSGISIGDERFL
FT                   DYVLEQFARTRVAPALICFEITETAAIANLAGALRFMHELKALGCRFALDDFGSGMASL
FT                   SYLKQLPVEYLKIDGSFVTGIANDAASLDIVASINDIGHAMNCKTIAEYVDSAATLQKL
FT                   AALGVDYAQGYYIGRPVPWREAARS"
FT   gene            complement(587724..588992)
FT                   /locus_tag="BTH_I0520"
FT   CDS_pept        complement(587724..588992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0520"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38977"
FT                   /db_xref="GOA:Q2T172"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T172"
FT                   /protein_id="ABC38977.1"
FT                   /translation="MTTVRKNFLLLMTLQISTYVVPLVTLPLLTRVLGPEAYGQLSFVL
FT                   AVITYFINFTNYSFDLTATPRVALAHDDLAARSRIFWATFAAQAAITVAGFAILLALTF
FT                   AIDRFAIDRTLLVIGFGMTVGAALTPGWYFQGIQKLRIYSMTLFACRALSVPAMYLFVR
FT                   SPADLIDAVAINAAVPLVCGVLVFGYLIVRREVAFVRIGAADVASSLKGGWQVFLASTS
FT                   VAFYASTNTVLLGFVSGNVAAGYFAAGDKLIRSAISLLQPLKAAAYPHVSYLMHHARED
FT                   AMSFLRKLLVVQGAMVLTISLAIFALAPLAVHILYGPTYEPTVGVLRCMAFIPFMAGMT
FT                   DLFGVQTMLPLGMKSAFSRVLISSGVLNVALLPLLAKFFAEQGAAAAVLIAETAVAATL
FT                   AYVLYRKRVSIFARPAARPAPRG"
FT   gene            complement(589069..590265)
FT                   /locus_tag="BTH_I0521"
FT   CDS_pept        complement(589069..590265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0521"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38235"
FT                   /db_xref="GOA:Q2T171"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T171"
FT                   /protein_id="ABC38235.1"
FT                   /translation="MKVLVINDFARKGGAEEVYRTSVDVLRAQPGVEVATFDESAFEGA
FT                   SSGAARAWNAPAARALAAVLEREAPQRVLVHNYHNLLSPSVVPAIARYKRRTGCRAYLT
FT                   CHDYHLVFYNPNLLTYPRGRATPLPLDALARGARLFQRSSPRGALHDAIKKLHWHAVDA
FT                   LVQPADAFDLLLCPSPYMRDALARRGIARTALLHNPVSTALAPREPKCAERERLDLAFV
FT                   GRIDPEKGLDEFLELARASRFERIASVTVYGDGGQRAMLERKYADLIAAGQLRFAGRLD
FT                   HAQLFVALREHDALVLPSVWAENAPLVIVEAAMIGLPVLVHDVGSLSSFGDEIGNKIRY
FT                   ARNEASLARALDALRAHLRDPRRRYDWSLYTRRHYAERLAALLQLNAGKARELAPQCD"
FT   gene            complement(590299..591891)
FT                   /locus_tag="BTH_I0522"
FT   CDS_pept        complement(590299..591891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0522"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM PF01050; match to protein
FT                   family HMM PF07883; match to protein family HMM TIGR01479"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38076"
FT                   /db_xref="GOA:Q2T170"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T170"
FT                   /protein_id="ABC38076.1"
FT                   /translation="MIDLATNTPSAAPRDAVPRILPVILAGGSGTRLWPLSREHHPKQL
FT                   IDLIADESPLSATARRLTGISNAELADTLLLVCGEQHRFTSAAQVSARGLRARILLEPA
FT                   ARNTAPALTLAALEALAHHGDPVLAAMPADHAVSDTRAFQDTVAQAARYAQDGAIVTLG
FT                   VLPRRAETGYGYIKVGAPLADSNGVEGGHAIDSFVEKPHQELAQQYLQSGDYWWNSGIF
FT                   VVRASTWLAAIRALQPDMYAACEAAWRDGTDEGQFFKADAQRFAACPCDSIDYAVMERL
FT                   TGARALGIPGVIVPLAAGWSDVGSWDAIWELLPKDEAGNVARGEVLFEGTEDSFARSEG
FT                   RLVACVGLKDVVVVETPDAVLVANKHRVQDVKTVVARLKSGQREQVRDHRKVQRPWGYY
FT                   DSIDRGERFQVKRIVVDPGKQLSLQMHYHRAEHWIVVRGTAKVTRGDETFLLSENESTY
FT                   IAVGAVHRLENPGKIPLEIIEVQSGDYLGEDDIVRFDDRYGRASAQPAPDAAKPADAEP
FT                   APSAEPARALGGH"
FT   gene            complement(591888..592769)
FT                   /locus_tag="BTH_I0523"
FT   CDS_pept        complement(591888..592769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0523"
FT                   /product="ElaA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37749"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T169"
FT                   /protein_id="ABC37749.1"
FT                   /translation="MCASAHYARIDFAARVRCTHRWCAARRASLVTRTVRFRTERRGVR
FT                   SYLCDHWPHRTHLSCRGAQNSRRTTRRAARKRGISIMDWTCCEFRHLSSNELYMILRAR
FT                   NAVLVVEEAHTHLDIDGKDECAIHVFATDKRGEQPAIAAYARLLPGDDIDPETMIDKIL
FT                   TSAAHRDDRTIDALIEHVLAAAHARWPDAPVRVQAPAQREDFYNRFGFRKVDGPYLEHG
FT                   APYVGMLRAASSPSKAVRDLLDRVGTATSASVSAVASAAARKTRKANAESTTEDERYAF
FT                   AGRLPADSGMNR"
FT   gene            592905..594149
FT                   /locus_tag="BTH_I0524"
FT   CDS_pept        592905..594149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0524"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36993"
FT                   /db_xref="GOA:Q2T168"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T168"
FT                   /protein_id="ABC36993.1"
FT                   /translation="MKVAIVHDWLVVHGGAERVLAQMIDCFPQADIYSLVDFLDDRSCL
FT                   RGRPVHTSFIQKLPFARSKYRSYLPLFPLAIEQFDLSGYDLILSSSYAVAKGVLNGPDQ
FT                   LHASYVHSPVRYAWDLQHQYLNEAGLARGLKSALARALLHYIRNWDARSANGVDLLAAN
FT                   SRFVARRIRKTYRRDATVIYPPVDVDHLALRDTKDDFYLTASRLVPYKRIDLIVEAFSH
FT                   MPSRRLVVIGDGPEAAKIRALAGPNVTLLGYQPFDVLHDHLQRAKAFVFAAEEDFGISP
FT                   VEAQACGTPVIAYGKGGVCESVRAAGAAPTGLFYAKQTCDALIDAIERFEAMPAGTFDP
FT                   HACRANAERFSAARFRSAFSRFVLEGYAALQAELSETMQGGPLASRVAAGAASVERDSA
FT                   ASPLDASRNGTLARI"
FT   gene            594177..594890
FT                   /locus_tag="BTH_I0525"
FT   CDS_pept        594177..594890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0525"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39147"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T167"
FT                   /protein_id="ABC39147.1"
FT                   /translation="MRLLFLLTNFGDPILTAPLAFAVLSWLAATGRRRAALVLAFGFAC
FT                   AVGVVAMTKFVYAGWGIGIAAWRFTGVSGHTMLGAAVYPLVAAICVRDAHVRRAISAGL
FT                   AFAFAIGLSRVLLGFHSWSEIVSGWLLGAAVAVSTARWARGIAGVHAGGTHAARNIPTP
FT                   LREHGIDVVYRHAGADAVAARRTARVSRSTVMFVAVACTIAVSCYGRSVPVSAWISHAA
FT                   PKIAEWSRVWLEDAR"
FT   gene            595648..597036
FT                   /locus_tag="BTH_I0526"
FT   CDS_pept        595648..597036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0526"
FT                   /product="sigma-54 dependent transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37627"
FT                   /db_xref="GOA:Q2T166"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T166"
FT                   /protein_id="ABC37627.1"
FT                   /translation="MTTSAIIGGLSRGSIRQRPLIYWTHQPSTLLRKELARRDWKICVV
FT                   TSANQVRTTAGEVTGGILDLSAVSIDEMNAVAAVCASLRNVAWVALVEAHQANVPNVRA
FT                   LLRDYCFDYITLPASHQRIADAVGHAYGMECLFAPSTAPIASADQGMIGTCDAMLQLFD
FT                   AVRRIARTDAPVLVSGETGTGKELTAAAIHQHSARRAGPFVAVNCGAIPPHLLQSELFG
FT                   YERGAFTGASARKIGHVESANGGTLLLDEIGDLPLESQASLLRFLQERTIHRLGSSDPV
FT                   PVDVRIVSATHVDLRGAMNEGRFRADLYHRLCVLRVDQPPLRARGKDIELLARHMLERF
FT                   RADARHRVRGFSTDAISALYKHDWPGNVRELINRVRRALVMAEGRLITAHDLELGHCIE
FT                   VAPLSVAAIRKSIEREVIELALLRNRGRLAGTARELGISRATLYRWMEAYGIERPRSVA
FT                   SSTN"
FT   gene            complement(597086..599209)
FT                   /locus_tag="BTH_I0527"
FT   CDS_pept        complement(597086..599209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36716"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T165"
FT                   /protein_id="ABC36716.1"
FT                   /translation="MRPRLAARHRLVSSRAGCRRAHRARRRSSFPRLRQQPARRVRASP
FT                   SAARDRSARTQFQQDHSPEDRKLRPVRFDDCLGWLHEGRTRRGVVICEALGHEALWTHK
FT                   VVRTLAERLAGDGMWVLRFHYPCAGDSAGDDLAPGRLPASVASVRRATLALREHAPVDS
FT                   VTLVGLRAGAAFAMLALAGEDAPEVDAFVALAPVVRGRAYLRELSIVQKRWLDTTPPAI
FT                   REQHHEEPWLNILGHRYPGDFVADLKKVDLSDAVANAATPPCAALLVDTDYGDSPALHD
FT                   ALTARGVPTDIEPFPEWPNALQEGARSRVPLAAIESVARWIGRRERKAAAEPIAVDRGA
FT                   HSAVARAAGEAIPPARASAGNRAARVPQAPPPVAFAFDGITETLVHVGAKRLVGTLCEP
FT                   VVPARAGTPCLLIANTAANPRSADGRIGVRLARTLARRGVASLRIDIEGIGDSGARAPD
FT                   DQADVLYSDPAIADVAAAADWLGAHCRRPVVAFGVCSGAFAALHAAARAHAAAGVIAVN
FT                   LPRFIWPRGLTIDEARKQQTNSARGYLASMRDWSKWRRLLREGRDLRPVLSALRRQLTS
FT                   RLSEPAARLAERLGHRPKPDTPRGLIRTLAERNVRTMLVYGEFDPGVDELSRYFGSPRR
FT                   AFRRSPLVSVAMIRLLDHSVYGASAADMIIELCIDTLTRWNDKTRGSQPRQRPAGARRG
FT                   TAHAASADAAASS"
FT   gene            complement(599005..601524)
FT                   /locus_tag="BTH_I0528"
FT   CDS_pept        complement(599005..601524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0528"
FT                   /product="beta-mannosidase-related protein"
FT                   /note="identified by match to protein family HMM PF00703"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36653"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T164"
FT                   /protein_id="ABC36653.1"
FT                   /translation="MKSALDRVARGAAQWTLIATPAGAIARPSELGDAGWCAASVPGTV
FT                   AQALAAARRFDPSHPYPLGDSDYWYRTTLHGAGPRIVRLNGLATIAEVWLDDTLLLCSD
FT                   NMYVSHDVAVTLRGANRLAICFRSLDRHLAAHPPRGRARWRTRLVDTPALRGVRATFLG
FT                   RMPGWFPAIEPIGPWRPIDLVNPAGAPTIVRDTLRATLDGGDGVLDATLEFAAPLPSAT
FT                   RARLVCGAHAATLEATGPRTARATLRVPNVTPWWPHTHGEPALYDVGVEVGGATIPLAK
FT                   TGFRTLAVERGDDGRGFALSINGTPFFARGACWTSADPVGLNAEPAAYRRALSLARDAG
FT                   CNMIRVGGTMTYEADAFYALCDELGLLVWQDFMLANFDYPSGDPRFAESLKREAEQFLG
FT                   LHAARPSIAVLCGGSEIAQQAAMVGLAPDERRVPATEQLLAELCAAHRPDAVYVSDSPH
FT                   GGVLPFAPREGLTHYYGVGAYLRPPEDARRAGVRFASECLAFANVPCDETLASIGSPAA
FT                   HEPAWKRAVPRDPGAPWDFDDVRDHYLRTLYGVEPARLRGFDPARYLTLSRAIVADLVG
FT                   ETLAEWRRVGSTCAGALVWQFQDVMPGAGWGLVDAHGRPKSAWHAFRRVSQPRQILLTD
FT                   EGLNGLDVHVLNDTPAPLDARIELVALRDGKTPIARASRALRVGAHAGECVNSADLLGR
FT                   FFDFTYAYRFGPREHDVVIASLYAADGTLLSQAFHFPERTAPTVFERGDIGLEASAAYR
FT                   DGRWHLDVQTRTFARYVHVCAPGLLPDIDWFHLAPGAAARIVLAAAPHSPAYDNSPPDA
FT                   CAPRPAPPAIEVRALNSNKTIRPRIEN"
FT   gene            complement(601521..602609)
FT                   /locus_tag="BTH_I0529"
FT   CDS_pept        complement(601521..602609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38995"
FT                   /db_xref="InterPro:IPR014989"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T163"
FT                   /protein_id="ABC38995.1"
FT                   /translation="MSSILLDAPANGASLEEIFTDIRHRARHYRPHALHGPQMVWKQTN
FT                   CYVDLWIEVLGWWGLNPYAALPFTITLDFEGDQFSFFKFPFEDLETLYGIVVQEHAIFE
FT                   PVDMHVEHQVARGNLMLVEVDAWYLPDTRGNSYQSEHTKTTIGIDAIDRERRRVGYFHN
FT                   SGYYLAEGVDYDGLFGKHAPAHLAPYVECAKRRFKPLEERELCDASLALLARHLKRRPA
FT                   SNPIAAFREQLARDAKRIASQPISYFHAYSFNTLRQLGANFELFGRYLRWLEASGCGGQ
FT                   IDALVAACDTIASESMVLEFRLARASARGKEERGESSLDILERAYASLVDGVARITPPG
FT                   NAEPNPPFGTLYAPPRPVAAAR"
FT   gene            complement(602606..603580)
FT                   /locus_tag="BTH_I0530"
FT   CDS_pept        complement(602606..603580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36991"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T162"
FT                   /protein_id="ABC36991.1"
FT                   /translation="MNDMTHPSVRAADAAHAPLDRDGVNKLRDELVEAGLLISTGIQGL
FT                   FGRSEKFERVVDALDAYITRLGADQHAEVLRFPPAMSRPEFERSEYLKSFPQLAGTVHS
FT                   FCGNEHDHQRVLQCLDRGDDWTESQKPTYVVMTPAACYPVYPVVAQRGALPVDGRIVDA
FT                   FSYCFRHEPSLDPTRMQLFRMREYIRIGTPEQILAFRQDWIERGTRMIDALHLPNSIDL
FT                   ANDPFFGRGGKIVASSQRDQNLKFELLIPIEYDGRLTACLSFNYHMDHFGLLWGIKTAN
FT                   AAVAHTGCVGFGLERLTLGLFRHHGLDPDTWPQAVRDVLWGHR"
FT   gene            complement(603577..604800)
FT                   /locus_tag="BTH_I0531"
FT   CDS_pept        complement(603577..604800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0531"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF02771;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37737"
FT                   /db_xref="GOA:Q2T161"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T161"
FT                   /protein_id="ABC37737.1"
FT                   /translation="MKRFDAETGNARVTAVESVFADDHVLNEAARRVAQVAARFADAVD
FT                   RDARFPTEAVDAMREERLLGALVPLELGGRGASLAAVASACGIIGQACSSAAMIYAMHQ
FT                   TQVASIVDHALSSDWHRRFAEQLAEREWLLASATSEEEVGGNLRNSRCAIEADGNMFTL
FT                   AKLAPTISYGAQADAILVTARRDREAPAAEQVLVTLLKENATLTRRSGWDTFGMRGTCS
FT                   EGFALDARGSCDQIFPVPFAQIAERTMVPTSHILWAAVWTGIANDAFLRAHQFFRAQMQ
FT                   KQGGALPPSGRRIADALALLQAMQARIDGALRLHEHGASRSWSAAMAQAAEINTLKTYV
FT                   STTALEVVKHATMICGMASYKNGTPYTLGRHIRDLHSAPLMISNDRIEANTANLLLALR
FT                   PATLEREI"
FT   gene            complement(604797..605048)
FT                   /locus_tag="BTH_I0532"
FT   CDS_pept        complement(604797..605048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0532"
FT                   /product="acyl carrier protein, putative"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38944"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T160"
FT                   /protein_id="ABC38944.1"
FT                   /translation="MKNELRTIIKDVAHLEASIDHIADSDDLYEAGLSSLNTIQLMLAI
FT                   EKRFNIEIPDEMLTRQLFQSIDSLAGAVTQLQRAEQSA"
FT   gene            complement(605279..606118)
FT                   /locus_tag="BTH_I0533"
FT   CDS_pept        complement(605279..606118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0533"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38540"
FT                   /db_xref="GOA:Q2T159"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T159"
FT                   /protein_id="ABC38540.1"
FT                   /translation="MRRRCSGSPIREGQAVTYREYKEPATRAGGIIELPHRTDANRFLA
FT                   SLGIAERATLASHLQLVHVKSGQVLCEPGMPLEHVYLPVTTVISIQYASSDGMTLEIAE
FT                   IGNEGIVSPQLVGTDGATPCRVITCRDGFSYRLSARVLSNLLEESAQMRQAIFRCTHLL
FT                   MAQAKQISFCSRHHVLKNQLCRWFLLAYDRSRSVEIQVTHSMLAQMLGVRRETVTDAAG
FT                   DIQKMGLIRQYRSSIILVDLPGLDAQSCGCHTIIREEMKKILSAPTSASGALTELRS"
FT   gene            606769..607803
FT                   /locus_tag="BTH_I0534"
FT   CDS_pept        606769..607803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39234"
FT                   /db_xref="GOA:Q2T158"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T158"
FT                   /protein_id="ABC39234.1"
FT                   /translation="MSGQCLYILRNRTNWHVNRLRVFTPSQEGGASVCKRTTRRAADTI
FT                   PRNIDSCCDRVLRNGILRRSRAAPTNRDTNMLHQNNGFHANALLGSLADDSLRALAPHL
FT                   ELVKIKSAQLLCETDEPMRHLYFPTTAMMSVLYLMEDGAMVEVAAVGNEGVVGVSTLAD
FT                   YGCGGASGRIEVRSGGYAYRVSTQVFRREFDRSLDTFQLMLRYWQAAMTQIARGALCNR
FT                   HHSVSEQLSRWLLLAHDRVEGDELAVTQQTIANMLGVRREGITEAAGKLQEAGLIRQRR
FT                   GHITVLDREGLEARACECYGVIRGEFNRLILEARRDAHAPQPIPAEGRPLRVAGYHGAV
FT                   RSAA"
FT   gene            607836..609221
FT                   /locus_tag="BTH_I0535"
FT   CDS_pept        607836..609221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0535"
FT                   /product="polysaccharide biosynthesis glycosyltransferase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37030"
FT                   /db_xref="GOA:Q2T157"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T157"
FT                   /protein_id="ABC37030.1"
FT                   /translation="MLGLLNKLLDVVLVAAGALLAQMLYDGGILDVSDEQRTVIALLCA
FT                   LTLLVFPAIGVYDGAREQMSYRTLSRVLLGWLGVAAIAAAFMLLLQGDADVSLAWLGRT
FT                   MLMSGAVLLLGKASIHGVLNGLRRTGAKPRAVAIVGSEVYGRAVLEQLRASPSHGYEVA
FT                   CVFDDSVSSADAAERRVGGVPVVADLRELKRRVRARAINEIWLALPLSHERQIQRIVRE
FT                   FRHDFVNLRFLPDVRGITFFNRSVTQVVGMPAINLATSPLSIPQLWPKFIFDRLFALAV
FT                   LIPLSPILAALALAVKFSSPGPVLFRQKRKGVDGREFEILKFRTMRVHAEEAGVVRQAS
FT                   RNDSRITKVGAFLRRTSLDELPQFFNVLFGQMSVVGPRPHAIEHDDIYKELVDGYMYRY
FT                   RVRPGITGWAQVNGYRGETRKVEKMAARVKFDLFYMQNWTFWFDIKIILITLVKGFVGR
FT                   NAF"
FT   gene            609293..610582
FT                   /locus_tag="BTH_I0536"
FT   CDS_pept        609293..610582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0536"
FT                   /product="capsular polysaccharide biosynthesis/export
FT                   periplasmic protein"
FT                   /note="identified by match to protein family HMM PF02563"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37666"
FT                   /db_xref="GOA:Q2T156"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T156"
FT                   /protein_id="ABC37666.1"
FT                   /translation="MFKPLAWASAAALALSGCALAPGPALDSSRMNDNLSAPTDSTVYD
FT                   VKLITPQLVYTLKQADEADTRAKEAGIAQSLPAAPADYRVGPDDVLGIIVWDHPELTRG
FT                   AGNGTGADTSPLADIGTLQASGGLGGVLPQQVSAFGTNGQGEVDSPGQRVAANGTIFFP
FT                   TLGRVRVEGMSPVRIAALLARRLDKQIRNPQIDVRVMQYRSQRVQVTGDVKNPGQLSLT
FT                   GSHLRVVDAINRAGGGNPDADLQRVLVTRGDQVMTIDVNRILNRGDLRQNIVLQANDIV
FT                   HVPDRTQNRVFVMGEVPKPQTVYMNKGQLSLADALSAAGSIDPMGANPRQVIVIRHPDP
FT                   PLAQAPGVQSGLQEGLKKVNYAPEHNRPEVFRLDMTQVDALMLATEFDMKPLDVVYVGT
FT                   APAARFNRMLAQILPTAESFYLIWSVSRGR"
FT   gene            610909..612003
FT                   /locus_tag="BTH_I0537"
FT   CDS_pept        610909..612003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0537"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37144"
FT                   /db_xref="GOA:Q2T155"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T155"
FT                   /protein_id="ABC37144.1"
FT                   /translation="MAALPKPVAINGKFTSQRLTGVQRVAHEFTSALARLLPGERNPTL
FT                   VVPRDHASDALPPAVARRVVPRLRGALWEQLALPFATRGQTLVSLCNVGPLFKRDQVVM
FT                   IHDVAVLDFPQGYSLRFRLWYRFAFWVLKRRARHILTVSRFSKERIVARLGVAPTDVST
FT                   IVSGVDHFGRIASESSVLERLGLAYDGYVLIVGSLAPGKNLVRTLDAIARLERMRPELR
FT                   FVIAGGSNVKIFGASALGERASARNVTWAGYVSDGELKALYENAGCFVFPSLYEGFGLP
FT                   PLEAMYCGCPVIASREASLPEACGDAALYCDAHDANDIAATIARLMGDAELRREMREKG
FT                   RKHASRYRWDVAAKQLIGVLRALD"
FT   gene            613019..613453
FT                   /locus_tag="BTH_I0538"
FT   CDS_pept        613019..613453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0538"
FT                   /product="CHRD domain superfamily"
FT                   /note="identified by match to protein family HMM PF07452"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38730"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T154"
FT                   /protein_id="ABC38730.1"
FT                   /translation="MLTLRKVGIGVLACVLAAGVARAETVKLVANLQPSSEVPPTTSKG
FT                   SGALDATYDTATRMLRWHATYRDLTGPATAAHFHGPAPVGQNAGVQVPIPKDALASPIT
FT                   GEKALTDEQVGDLMAGKWYFNVHTKAHPAGEIRGQVRPAN"
FT   gene            613544..614509
FT                   /locus_tag="BTH_I0539"
FT   CDS_pept        613544..614509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0539"
FT                   /product="esterase, putative"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37564"
FT                   /db_xref="GOA:Q2T153"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T153"
FT                   /protein_id="ABC37564.1"
FT                   /translation="MSWQSKVACWLLRRQFRPETLRPVIDPARARRLTKLRMRVPRRPP
FT                   AGWRLRERYGAGDAPLRGEWLERTDAVPVRAKHGRMLLYFHGGGYYFCSPQTHRPLVFA
FT                   LTRHAGVRSFSLDYRLAPEHPFPAALDDALAAYRQLVSAGTPPESIVFGGDSAGGGLAL
FT                   AALVALRDAGDPLPAGAVLFSPWTDLAATGDTLRTHDGLDPMFAGAALGRAARLYLGDT
FT                   PGTHPHASPLYADFTGLPPLFIQAGSTEVLLDDSRRVADKARAAGVHVELEIWPQMPHV
FT                   WQIYVPFVPESARALERAAAFVRRIAVERATQRTADASIA"
FT   gene            complement(614479..615417)
FT                   /locus_tag="BTH_I0540"
FT   CDS_pept        complement(614479..615417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38109"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T152"
FT                   /protein_id="ABC38109.1"
FT                   /translation="MEPLTLVAGPTLSADDLDTLRRAKLALESPSLTIKLTSVVGAPVE
FT                   KMIGKLPGFATDKINDATQLALRKCLHIALRTLGKSGGVASEGETPSKPSNLLHKLAVA
FT                   TTGAAGGAFGLFALPVELPVTTTLMFRSICDIARSEGEDLSSAEAQLQCLAVLGMGGGF
FT                   GPLPGAGTRGKPSGKADGEPRGREPHGERDKVEEDADIGYFVLRGALAQAVSKASSEIA
FT                   SKGFATHGSTALLRLVQSIASRFSVQVTEQIAAKSIPAIGAVLGAMVNTLFIDHFQQAA
FT                   HGHFAVRRLERKYGQTAVKAAYQAIDASAVR"
FT   gene            615470..617119
FT                   /locus_tag="BTH_I0541"
FT   CDS_pept        615470..617119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0541"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36680"
FT                   /db_xref="GOA:Q2T151"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T151"
FT                   /protein_id="ABC36680.1"
FT                   /translation="MRDRIFDSLTHQKLREQKMAVHTAAHHSSGQVLPFRESLLAMLGI
FT                   SFVTMLVALDQTVVGTALPTIVAELRGFDLYAWVATSYLLASVITVPIFGRLGDYYGRK
FT                   PFVIASLIVFTGASVLCGMAHDMLSLVLARGLQGIGGGMLVGTAFACIPDLFPDSVVRL
FT                   RWQVLMSSAFGIANAVGPSLGGVLTQNYGWRSVFYVNLPVGLLSLVFVWRYLPHMRHVE
FT                   HTAKMRLDWPGALLIAATLGAMQLFVEWLPKYGIGGWSTLLLVVALASGVALWRWEQRC
FT                   AQPILPFDMFSNRALSTLFILAILAGFAMFSLLFYAPLLFQGGFGMSPQQAGVVITPLV
FT                   VFITIGSIMNGRVITRIRHPNAMLYAGFLLFALACAGVVASTHATPGWALMALMVAGGV
FT                   GLGFVLPNLTVFAQQTAGREHLGIATALLQSLRMVGGMAGAALTGTLINQRYASGVRDA
FT                   LAADGALRWQARLADPQVLIDRAAQSRVVDELVRAGHHGAHLLEAARESLVGAIHIGIA
FT                   LGTLVALAAVWQCRRVPPVELRRKLEPSVVAE"
FT   gene            617169..617603
FT                   /locus_tag="BTH_I0542"
FT   CDS_pept        617169..617603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0542"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39489"
FT                   /db_xref="GOA:Q2T150"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T150"
FT                   /protein_id="ABC39489.1"
FT                   /translation="MEEQDRIAILQQFGRTYRAFMSAFEAHVGQPLPRWRIMVALEQHG
FT                   GASSQKRLVELLRVDPGALTRQLKTLETLGWIDREADARDNRVTNVRLTQAGRAAFEAC
FT                   LPRRNAFLHDTMASLPDDVLSALSGALTMLEARVAEVGAK"
FT   gene            complement(617689..618270)
FT                   /locus_tag="BTH_I0543"
FT   CDS_pept        complement(617689..618270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0543"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01382"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38516"
FT                   /db_xref="GOA:Q2T149"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T149"
FT                   /protein_id="ABC38516.1"
FT                   /translation="MAARKILFLTGDFAEDYETMVPFQALLAIGHHVDAVCPGKRAGDK
FT                   VKTAIHDFEGDQTYTEKPGHQFTLNATFDDVDATGYDALAIAGGRAPEYLRLDPKVIAL
FT                   VRAFAEAKKPIAAICHAAQLLAAADVIRGKRISAYPACAPEVRLAGGEYADIPVDAAVT
FT                   DAPFVTAPAWPAHPAWLSQFLALLGTRIEL"
FT   gene            complement(618707..619987)
FT                   /locus_tag="BTH_I0544"
FT   CDS_pept        complement(618707..619987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0544"
FT                   /product="D-serine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38595"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T148"
FT                   /protein_id="ABC38595.1"
FT                   /translation="MKVTNYQEATIDPFGKGLGNVPSASVPLSDAGRLEWNLLAEDVSL
FT                   PAAVLYADRIEHNLKWMQAFVAEYGVKLAPHGKTTMAPQLFRRQLETGAWGITLATAHQ
FT                   TRAAYHGGVRRVLLANQLVGRHNMAMIAELLTDPDFEFFCLVDSVDGVEQLARFFGAAG
FT                   KPLNVLLELGVPGGRTGVRDDAQRDAVLAAIAHHPDVLKLAGIELYEGVLKEEGEIRAF
FT                   LRRAVKLVHELASAGRFARAPALLSGAGSAWYDVVADEFAQAAAAGVIDVVLRPGCYLT
FT                   HDVGIYKKAQTDIFARNPIARKMGEGLLPALQLWAYVQSIPEPERAIIALGKRDSAFDA
FT                   GLPEPARHFRPGAGGLPRDIAPGEGWEVTGLMDQHAYLKIPAGADLKVGDMVSFDISHP
FT                   CLTFDKWRQLLVVDPQYRVTEVIETYF"
FT   gene            620125..621018
FT                   /locus_tag="BTH_I0545"
FT   CDS_pept        620125..621018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0545"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37283"
FT                   /db_xref="GOA:Q2T147"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T147"
FT                   /protein_id="ABC37283.1"
FT                   /translation="MTPSAEQPAFDIVARIAECAPELRDAERKVAALILGDLTQAAHAS
FT                   IGALAAHADVSVATVTRFAKAVGCRDVRELKLRLAQAAAVGQRFLTPAAADAQCDETPV
FT                   SRVYGDVQVALEHNHRLLRQTSFDAPAAALAAANMIYVYGQGGGSTALADELRFRLVRF
FT                   GRPVATYQDALLQRMVATTAAPGCVVVALSVSGRIPEQLESCALAKRYGATLVALTAPA
FT                   SPLAQLADHLIPVVAFETDFIFKPSASRYAMLMALDVLVTEVALRLGDDCRELLRRMKH
FT                   ALDMHRGGGDRQPLGD"
FT   gene            621020..622501
FT                   /locus_tag="BTH_I0546"
FT   CDS_pept        621020..622501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0546"
FT                   /product="N-acyl-D-amino-acid deacylase family protein"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07908; match to protein
FT                   family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37452"
FT                   /db_xref="GOA:Q2T146"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T146"
FT                   /protein_id="ABC37452.1"
FT                   /translation="MHSHPEAADTLIVGAQLYDGTGAPSVERDVAIRGDRIVAIGNLTN
FT                   WLAEQVVEADGRALAPGFVDVHTHDDTHVIDAPQMLPKISQGVTTVIVGNCGISASPVA
FT                   LNGDPPDPMNLLGTRAAFRYPTFAAYVDALGAAKPAVNVAALVGHTALRNNQMDRLDRA
FT                   ATDTEIAAMRAQLEEALAHGALGLSSGLAYGSAFAAPTEEVMALAEPLAKAGAVYTTHM
FT                   RTEFDAILDAMDEAYRVGRHARVPVVISHLKCAGPSNWGRSGEVLASLERARRIQPVGC
FT                   DCYPYSRSSSTLDIKQATGDIDITITWSDPHPEMAGKLLKTIAAEWRVSEQEAARRLQP
FT                   AGAVYHNMSEDDVRRILSHPATMVGSDGLPNDPLPHPRLWGAFPRVLGYYARDEQLISL
FT                   EEAVRKMTSLSARRFGLAQRGEVRVGYHADLVLFDADRVRDAATFEQPQQPAHGIEAVW
FT                   VNGVLSYCNGVPTGERAGRFVARGERAAATAHDAF"
FT   gene            622620..623006
FT                   /locus_tag="BTH_I0547"
FT   CDS_pept        622620..623006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0547"
FT                   /product="endoribonuclease L-PSP, putative"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36426"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T145"
FT                   /protein_id="ABC36426.1"
FT                   /translation="MKRYGVGEAKGTGGQVMPFARAVEADGWLYVSGQTPMVNGEVVEG
FT                   GIVTQSKQAIENVIAILKEAGYGLEHVVRCGVWLDDARDFASFNKVFISYFGEHPPARA
FT                   CVQSSMVIDCKVEVDCIAYKAPAK"
FT   gene            complement(623202..624026)
FT                   /locus_tag="BTH_I0548"
FT   CDS_pept        complement(623202..624026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0548"
FT                   /product="GTP cyclohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01227"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38829"
FT                   /db_xref="GOA:Q2T144"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T144"
FT                   /protein_id="ABC38829.1"
FT                   /translation="MNPEHSPLGKTTVYANQYDASLLFPIPRAGAREQIGIGAPLPFFG
FT                   TDIWNAYELSWLNARGKPQVAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESIDAVR
FT                   DALKRDVSAACGASVTVRLATPAEFRKLQMDELDGLSLDRLDLDADVYETDPSFLTASH
FT                   DEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGAPIDHAGLLRYIISFRNHTGFHEQ
FT                   CVERIFIDILRACKPVKLAVYARYTRRGGLDINPFRTNYNQPMPDNARTARQ"
FT   gene            complement(624046..625569)
FT                   /gene="ilvA-1"
FT                   /locus_tag="BTH_I0549"
FT   CDS_pept        complement(624046..625569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA-1"
FT                   /locus_tag="BTH_I0549"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR01124"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38707"
FT                   /db_xref="GOA:Q2T143"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T143"
FT                   /protein_id="ABC38707.1"
FT                   /translation="MASHDYLKKILTARVYDVALETELERARNLSARLDNAVYLKREDN
FT                   QPVFSFKLRGAYNKMAHIPADALARGVITASAGNHAQGVAFSAARMNVKAVIVVPVTTP
FT                   QLKVDAVRAHGGPTVEVIQAGESYSDAYAHAVKVQAERGLTFVHPFDDPYVIAGQGTVA
FT                   MEILRQHQGPIHAIFVPIGGGGLAAGVAAYVKAVRPEIKVIGVQTDDSCAMKQSLAAGK
FT                   RVELAEVGLFSDGTAVKLVGEETFRLCAAYLDDVVTVDTDALCAAIKDVFQDTRSVLEP
FT                   AGSLAVAGAKRYAERAGIEGETLVAITSGANMNFDRMRFVAERAEVGEAREAVFAVTIP
FT                   EERGSFRRFCSLVGERNVTEFNYRIADAQSAHIFVGVQIRRRDETDEIARNFAAHGFTT
FT                   VDLSGDELSKQHIRYMVGGRSPLAHDERLFRFEFPERPGALMKFLSSMAPDWNISLFHY
FT                   RNQGADYSSILVGLQVPQADHAAFDRFLAALGYPFWEESVNPAYRLFLS"
FT   gene            626025..630104
FT                   /locus_tag="BTH_I0550"
FT   CDS_pept        626025..630104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0550"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02754; match to protein
FT                   family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37714"
FT                   /db_xref="GOA:Q2T142"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T142"
FT                   /protein_id="ABC37714.1"
FT                   /translation="MPVPRPFAARRPPNRPNMNAPQVFDPHGAAAAVAADPAPRLREIP
FT                   YNYTSFSDREIVIRLLGDEAWAALDELRGERRTGRSARMLYEVLGDVWVVRRNPYLQDD
FT                   LLDNPKRRALLIEALNHRLSEIEKRRRADLSEHGDTAGRERAARVEMLAAAAQRAVDAF
FT                   AQEFEKMAELRRRATKVLGRCTQKDNIRFDGLARVSHVTDATDWRVEYPFVVLTPDTEA
FT                   EIASLVKACFELGLTVIPRGGGTGYTGGAVPLTPFSAVINTEKLEQLGAVELTELPGVA
FT                   HKVPTIFSGAGVVTRRVTEAAEAAGYVFAVDPTSLDASCIGGNIAMNAGGKKAVLWGTA
FT                   LDNLAWWRMVDPEGNWLEVTRVEHNLGKIHDIPVARFELKWFDGARAPGERLLRTETLD
FT                   IEGRRFRKEGLGKDVTDKFLAGLPGVQKEGCDGLITSARWVLHKMPAHTRTVCLEFFGQ
FT                   AREAIPSIVEIKDYLFETSKRGGAILAGLEHLDERYLRAVGYATKSKRQAFPKMVLIGD
FT                   VVGDDADAVAHATSEVVRMANGKSGEGFVAVSAEARKRFWLDRSRTAAIAKHTNAFKIN
FT                   EDVVIPLNRMGEYTDGIERINIELSIKNKLQLVDALEAFFTAGDLPLGKSDDASEIPSA
FT                   ELLEDRVQQALDLLKRVRARWEFLREKLDMPLREAQHYLVTLGYEALAEKFADRVDAQP
FT                   DAAVFHVTQDRTVRVSWKQEIRAQLRQIFNGGAFKPILDEAQAIHKRVLRGRVFVALHM
FT                   HAGDGNVHTNIPVNSDNYAMLQDAHAAVARIMKLARSLDGVISGEHGIGITKLEFLTDE
FT                   EIAEFRAYKQCVDPQGRFNKGKLLEGADLRNAYTPSFGLMGYESLIMQQSDIGAIAESV
FT                   KDCLRCGKCKPVCATHVPRANLLYSPRNKILATSLLVEAFLYEEQTRRGVSIKHWDEFN
FT                   DVADHCTVCHKCATPCPVKIDFGDVTMNMRNLLRKMGKKKFNPGSAAGMFFLNATNPQT
FT                   INATRAVMMGLGYKAQRFANDMLKKVAQKQTAHPPSTTGKRPAVEQVIHFVNKKMPGNL
FT                   PKKTARALLDIEDNKIVPIIRNPKTTTVDSEAVFYFPGCGSERLFSQVGLATQAMLWEA
FT                   GVQTVLPPGYLCCGYPQRGSGQYDRAEQIVTDNRVLFHRVANTLNYLDIKTVVVSCGTC
FT                   YDQLAGYEFDKIFPGCRIIDIHEFLLEKGLKLDGVTGTRYMYHDPCHTPIKTMDPVKLV
FT                   NDLMGAHNDGYKIEKNDRCCGESGTLAVARPDISTQVRFRKEEEIKKGAAKLRNIPVVS
FT                   GNGASGSDGAAAGASDVKILTSCPACLQGLSRYNEDAGIEADYIVVEIARHMLGENWMA
FT                   DYVARANNGGIERVLV"
FT   gene            630124..630582
FT                   /locus_tag="BTH_I0551"
FT   CDS_pept        630124..630582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0551"
FT                   /product="HIT domain protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36790"
FT                   /db_xref="GOA:Q2T141"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T141"
FT                   /protein_id="ABC36790.1"
FT                   /translation="MKELTMDCVFCREDGGEVLWKDDAVRVVLATTETDYPGFCRVIWH
FT                   AHVAEFSDLDEAERAHLMRIVYAVEKAVRRVMQPAKVNLASLGNQVPHVHWHVIPRFSN
FT                   DAHFPQPIWAPRQRSVSDALLRLRAAQATLLHNAVHEEIELAVSGGRA"
FT   gene            630579..630992
FT                   /locus_tag="BTH_I0552"
FT   CDS_pept        630579..630992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0552"
FT                   /product="Protein of unknown function (DUF971) family"
FT                   /note="identified by match to protein family HMM PF06155"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39242"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T140"
FT                   /protein_id="ABC39242.1"
FT                   /translation="MSGQAAAAPVPSGIVVHAVSRVLELQYPSGESYRVPFELMRVYSP
FT                   SAEVRGHGPGQETLQTGKRDVTITALEPVGNYALKPTFSDGHSTGIYSWELLHELATRQ
FT                   DALWREYFDKLKAAGVERDAPMPADSLPRGHHH"
FT   gene            631041..631772
FT                   /locus_tag="BTH_I0553"
FT   CDS_pept        631041..631772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0553"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39053"
FT                   /db_xref="GOA:Q2T139"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T139"
FT                   /protein_id="ABC39053.1"
FT                   /translation="MSKTHFGFETVEENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRA
FT                   WKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGPTGEVWHTDINESMLRVGRDRLL
FT                   DKGVVTPSLLCDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMRRVAKPGGRVMVLE
FT                   FSKVWEPLKKAYDVYSFKVLPWLGDKFAKDADSYRYLAESIRMHPDQETLKTMMEQAGL
FT                   DAVKYYNLSGGVVALHVGTKY"
FT   gene            631815..632837
FT                   /locus_tag="BTH_I0554"
FT   CDS_pept        631815..632837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0554"
FT                   /product="Tim44-like domain family"
FT                   /note="identified by match to protein family HMM PF04280"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36739"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T138"
FT                   /protein_id="ABC36739.1"
FT                   /translation="MFASRSSFNRSREPKSLARRIGTFMMVGLLAAGTFASLDAEAKRM
FT                   GGGRSVGRQSQTLQQRQATPPAQQPMQQAAPAQAPRQQPAPAAQPNRSRWLGPIAGLAA
FT                   GLGIAALLSHLGLGGAFASMMANVIVIALLAMAGIWLVRKFMNRRGAQQQPAYAGGQPS
FT                   LNRDHGGYNQDAGAWRQAAPNDAFAGSGSTYAGEAQRVFGGAATAAAPAAAPMVPAGFD
FT                   TEAFLRNAKVYFVRLQAAWDEGNLADIREFTTPEMFAEVKIDLDGRGAGENQTDVVRLD
FT                   AELLAVEDRGGEHFASVRFHGMIRETQGAAAEPFDEVWNLSKSGSQGWLLAGIQQVSTH
FT                   "
FT   gene            632945..633592
FT                   /locus_tag="BTH_I0555"
FT   CDS_pept        632945..633592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0555"
FT                   /product="Protein of unknown function (DUF1243)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06843"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39204"
FT                   /db_xref="GOA:Q2T137"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T137"
FT                   /protein_id="ABC39204.1"
FT                   /translation="MTLAAKPFAAAVNHLLARESWARDRLIPYAGKTARLEVQPVTLVL
FT                   LVQPDGYLAAVEAHDARQFDVSIALSSGGDGGAFDAAAAFLQGGQAAVMKHVKIDGDAE
FT                   FATQIAKLAEHLRWEPEEDLAKIVGDAAAHRIATVVRSAGAHARRTGRNVLDSIAEYWL
FT                   DENPQVVRKSVVADFDAELARARDALARVEKRIERLEQKIDARAGGSSRRVQ"
FT   gene            633605..635182
FT                   /gene="ubiB"
FT                   /locus_tag="BTH_I0556"
FT   CDS_pept        633605..635182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="BTH_I0556"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF03109;
FT                   match to protein family HMM TIGR01982"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36476"
FT                   /db_xref="GOA:Q2T136"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T136"
FT                   /protein_id="ABC36476.1"
FT                   /translation="MRIFRFVKIVFTVIRFGLDEVMLSRIENPRVKFLLRITTIGRRFA
FT                   DPPAVRLRRALESLGPIFVKFGQVLSTRRDLLPVDFANELAKLQDQVPPFDSAVAIAIV
FT                   EKSLGARIDELFDEFEREPVASASIAQVHFAKLKQGEHKGKAVAVKVLRPNMLPVIDSD
FT                   LALMRDIATWAERLWADGRRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDL
FT                   LLVPEMFWDYSTPSVLVMERMTGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGF
FT                   FHADMHPGNIQVSLDPKHFGRYIALDFGIVGALSDFDKNYLAQNFLAFFKRDYHRVATL
FT                   HLESGWVPPDTRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQL
FT                   VLLQKTMLNVEGLGRSLDPELDLWKTAKPYLERWMAEQIGLRGWYERFKVEAPQWSKTL
FT                   PQLPRLVHQALLSHHEAPRAISDDLIRQILVEQRRTNRLLQALLVFGLAVGAGAVIARV
FT                   LIVIAYGG"
FT   gene            635323..636060
FT                   /locus_tag="BTH_I0557"
FT   CDS_pept        635323..636060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0557"
FT                   /product="thiopurine S-methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF05724"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37140"
FT                   /db_xref="GOA:Q2T135"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T135"
FT                   /protein_id="ABC37140.1"
FT                   /translation="MTSEANKGDAAVQAAGDAQPASPASPPSADVQPARAALAPSSVPP
FT                   APSAANFASRDPGDASFWDERFERGVTPWDSARVPDAFAAFAARHPRCPVLIPGCGSAY
FT                   EARWLARAGWPVRAIDFSAQAVAAARRESGADAALVEQADFFAYVPPFVPQWIYERAFL
FT                   CAIPTSRRADYARRVAELLPAGGFLAGFFFIGATPKGPPFGIERAELDALLSPNFELVE
FT                   DEPVADSLPVFAGRERWLAWRRS"
FT   gene            636151..636489
FT                   /locus_tag="BTH_I0558"
FT   CDS_pept        636151..636489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02605"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36404"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T134"
FT                   /protein_id="ABC36404.1"
FT                   /translation="MPIYAYRCEACGYAKDVLQKMSDAPLSQCPECGKDAFRKQVTAAG
FT                   FQLKGSGWYVTDFRGGSGGASAPAASGEKASAEKASGEKAATPAAADSTASAPAASTPA
FT                   AAAPASST"
FT   gene            636557..637207
FT                   /locus_tag="BTH_I0559"
FT   CDS_pept        636557..637207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0559"
FT                   /product="Protein of unknown function (DUF502) family"
FT                   /note="identified by match to protein family HMM PF04367"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37116"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T133"
FT                   /protein_id="ABC37116.1"
FT                   /translation="MMKKTTLKSVFLTGLLVLVPLAITLWVLGLIIGTMDQTLLLLPAS
FT                   WQPEKLFGFRLPGIGAVLTLAFIFVVGLATQNFIGQKLVTWWNVVVRHIPVVGPIYTSV
FT                   KQVSDTLLSSSGNAFRKALLIEYPRRGSYTIAFLTGTPGGDVVNHLKEEHVSVYVPTTP
FT                   NPTSGFFLMVPKREVVELDMSVDAALKYIVSMGVVAPPAPVAAPARRPVEPPM"
FT   gene            637264..639066
FT                   /gene="aspS"
FT                   /locus_tag="BTH_I0560"
FT   CDS_pept        637264..639066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="BTH_I0560"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM PF02938; match to protein family HMM TIGR00459"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38257"
FT                   /db_xref="GOA:Q2T132"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T132"
FT                   /protein_id="ABC38257.1"
FT                   /translation="MSMRTEYCGLVTEHLLGQTVSLCGWVQRRRDHGGVIFIDLRDREG
FT                   LVQVVCDPDRAEMFATAEGVRNEFCVQVKGLVRNRPEGTVNAGLKSGKIEVLCHELTVL
FT                   NASVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQHNLRLRYRVAIEARKYLDEQGFIDI
FT                   ETPMLTKSTPEGARDYLVPSRVNAGQFFALPQSPQLFKQLLMVANFDRYYQITKCFRDE
FT                   DLRADRQPEFTQIDCETSFLGEQEIRDLFEDMIRHIFKTTIDVELDAKFPVMPYSEAMA
FT                   RFGSDKPDLRVKLEFTELTDAMKDVDFKVFSTPANTKDGRVAALRVPKGAELTRGDIDG
FT                   YTEFVRIYGAKGLAWIKVNERAKGRDGLQSPIVKNLHDASIAAILERTGAQDGDIVFFA
FT                   ADRAKVVNDSLGALRLKIGHSEFGKANGLVESGWKPLWVVDFPMFEYDDEEARYVAAHH
FT                   PFTSPKDEHLEYLETDPGRCLAKAYDMVLNGWEIGGGSVRIHREEVQSKVFRALKIGPE
FT                   EAQAKFGFLLDALQYGAPPHGGIAFGLDRIVTMMAGADSIRDVIAFPKTQRAQCLLTQA
FT                   PSPVDERQLRELHIRLRQPEQPKA"
FT   gene            639275..639751
FT                   /locus_tag="BTH_I0561"
FT   CDS_pept        639275..639751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0561"
FT                   /product="dATP pyrophosphohydrolase"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39002"
FT                   /db_xref="GOA:Q2T131"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T131"
FT                   /protein_id="ABC39002.1"
FT                   /translation="MTKPPKIPESVLVVIHTPALDVLVIKRADQPDFWQSVTGSKDALD
FT                   EPIAQVAAREVAEETGIVVGSPGIPPAALVDWHHAIEYAIYPQYLHRYAPGVTRNTEHW
FT                   FSLEVPARVDVTLSPREHTAYQWLPYREAAARCYSPSNAEAILQLPERLASRAA"
FT   gene            639748..641022
FT                   /locus_tag="BTH_I0562"
FT   CDS_pept        639748..641022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0562"
FT                   /product="cardiolipin synthetase II"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37688"
FT                   /db_xref="GOA:Q2T130"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T130"
FT                   /protein_id="ABC37688.1"
FT                   /translation="MSGKARHRLAQLRQMFLQERGSASRLAFTSGNAVRLCDGGAAFFP
FT                   ALIERIDAARERVALETYIFCDDAVGRAVSDALVRAAARGVHVRVITDGIGTERLLLFG
FT                   TWPDAGVEHRIYNPYLFGRFGFSRTHRKLAVIDDAYAFCGGINIVDDFEQNGERLPYPR
FT                   WDFALELQGPAVADVRAAFEVQWHRIAAGHKRYAEYVPHGADGTAFAGRFRRWMRSHRW
FT                   VKAGALRVVTEPSVAFVARDNVVNRRAIEKAYLAAIGRARQSILLANPYFMPGRKLRRA
FT                   LAGAARRGVDVRILLGRNEFASLDMAVPFLYHALLRSGVRVAEYDKTILHGKVAVIDDH
FT                   WATVGSSNLDALSLMLNNEANVVLVRHREETAALRDAIAVAFADGREIDPALYAARPAV
FT                   ERFLNWFAYNAYRGAMKLLTVGGYD"
FT   gene            641211..641810
FT                   /locus_tag="BTH_I0563"
FT   CDS_pept        641211..641810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0563"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38676"
FT                   /db_xref="GOA:Q2T129"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T129"
FT                   /protein_id="ABC38676.1"
FT                   /translation="MRKGEQTRAAILEAALDLASRDGLEGLTIGLLAERMQMSKSGVFA
FT                   HFGSRDDLQVEVVREYHHRFENEVFFPSLREPRGLPRLRAMLARWIEKRIQEVTTGCIY
FT                   ISGAVEYDDRPDSAVREQLIASVKAWRAALLRAISQAKEEGHLRPDTDPNLMLFELYSF
FT                   TLGLHHDARFLHQPDAVRLTWAALEKTIVSYQSESR"
FT   gene            641868..643655
FT                   /locus_tag="BTH_I0564"
FT   CDS_pept        641868..643655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0564"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39366"
FT                   /db_xref="GOA:Q2T128"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T128"
FT                   /protein_id="ABC39366.1"
FT                   /translation="MGQYAAPLRDMQFVLHELLNVEAEVKQMPKHADLDADTINQVLEE
FT                   AGKFCSEVLFPLNQVGDREGCTYVGDGVVKTPTGFKEAYQQYIDAGWPALGCDPDYGGQ
FT                   GLPAFVNNALYEMLNSANQAWTMYPGLSHGAYECLHAHGAPELQKLYLPKLVSGEWTGT
FT                   MCLTEPHCGTDLGILRTKAEPNGDGSYSISGTKIFISSGEHDFSKNIVHLVLARLPDAP
FT                   KGTKGISLFIVPKFVPDASGEPGERNGVKCGSIEHKMGIHGNATCVMNLDNAKGWMIGE
FT                   PNKGLNAMFVMMNAARLGVGMQGLGLTEVAYQNSLTYAKERLQMRSLTGPKAPDKPADP
FT                   IIVHPDVRRMLLTQKAYAEGARAFTYWSALQIDKALSHADEAVRKEAEDLVALLTPIIK
FT                   AFLTDNAFECTNHAMQIYGGHGFISEWGMEQYVRDARINMIYEGTNSVQALDLLGRKVL
FT                   GDMGAKLKKFGKIVAEFAEAEGVKPEMSEFITPLADIGEKVQKLTMEIGMKAMQNPDEV
FT                   GAAAVPYLRTVGHLVFSYFWARMARIALDNEASGDPFYKSKLATARFYFARLLPETAAS
FT                   IRLARAGAKTMMEVDEALF"
FT   gene            643769..646204
FT                   /locus_tag="BTH_I0565"
FT   CDS_pept        643769..646204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0565"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA
FT                   hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM PF00725; match to protein
FT                   family HMM PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36434"
FT                   /db_xref="GOA:Q2T127"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T127"
FT                   /protein_id="ABC36434.1"
FT                   /translation="MSNFNIRKVAVLGAGVMGAQIAAHLINARVPVLLFDLPAKEGPKN
FT                   GIALKAIENLKKLSPAPFGVKDDAKYLEAANYEDDIAKLAECDLVIEAIAERMDWKHDL
FT                   YKKVAPHIAPNAIFATNTSGLSITALSEGFSDELKARFCGVHFFNPPRYMHLVELIPTA
FT                   HTQPQILDQLETFLTSVVGKGVVRAKDTPNFIANRVGIFSILAVIVEAEKFGLRFDEVD
FT                   DLTGSRLGRAKSATFRTADVVGLDTMAHVIKTMQDNLADDPFFAVYKTPAVLAKLVEQG
FT                   ALGQKTGGGFYKKEGKAIKVLDAKTGAYVDSGAKADETVGRILKRPLAERVKLLRETQH
FT                   PHAQFLWSVFRDVFHYIAIHLESIADNAREVDLAIRWGFGWSQGPFEDWQAAGWKQVAE
FT                   WVQEDIAAGKSLATVPLPAWVLEGAVAEQGGVHAAEGSWSPAAKRFVPRSALSVYDKQV
FT                   FRAPVFGEAGRDPKAFGKTLFETDSVRAWVDDRAGEDDVVIVSFKSKMNTIGPGVIDGL
FT                   AQAIELAERDYKAVVIWQPSSLKLGNPGGPFSAGANLEEAMPAFMMGGAKGIEPFVKKF
FT                   QQGMLRVKYANVPVVAAVSGLALGGGCELMLHSAKRVVHVESYIGLVEVGVGLVPAGGG
FT                   LKEAALRAAEAATAAGMTSELLKFLTKPFENAAMAKVSMSAYEARAMGYVKPSDTIVFN
FT                   VFELLDVAKKEARGLAAAGYRAPLKAKEIPVAGRSAIATIKAQLVNMRDGRFISDHDFL
FT                   IASRIAEAVCGGDVEAGSTVDEEWLLALERRAFVDLLGTQKTQERIMGMLQTGKPVRN"
FT   gene            646332..647531
FT                   /locus_tag="BTH_I0566"
FT   CDS_pept        646332..647531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0566"
FT                   /product="thiolase family protein"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39401"
FT                   /db_xref="GOA:Q2T126"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T126"
FT                   /protein_id="ABC39401.1"
FT                   /translation="MSKQLQDAYIVAASRTPIGKAPRGAFKNTRPDELLVHAIKSAIAQ
FT                   VPGFDTKLIEDAIVGCAIPEAEQGLNVARMGALLAGLPNTVGGVTVNRFCASGVTALAM
FT                   AADRIRVGESDAILAAGVESMSMVPMMGNKPSMSPHIFDRSEDFGIAYGMGLTAERVAE
FT                   QWKVSREDQDAFSVESHRKAIAAQQAGEFNDEIAPYTLVERFPNLATGEIETRTREIAL
FT                   DEGPRAETSLEGLAKLKTVFANKGSVTAGNSSQTSDGSGALLVVSEKVLKQFNLTPLAR
FT                   FVSFAVRGVPPEIMGIGPKEAIPAALKAAGLKQDDIDWIELNEAFAAQSLAVIRDLGLD
FT                   PSKINPLGGAIALGHPLGATGAIRAATVVHGLRRRNLKYGMVTMCVGTGMGAAGIIERL
FT                   "
FT   gene            647610..648389
FT                   /locus_tag="BTH_I0567"
FT   CDS_pept        647610..648389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0567"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37232"
FT                   /db_xref="GOA:Q2T125"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T125"
FT                   /protein_id="ABC37232.1"
FT                   /translation="METAQMDIQVDNAGGVLTITLARPSKKNAITAAMYQTMADALAAA
FT                   QDDKSVRAILIRGSDGNFSAGNDLDDFMKAPPKDENAPVFQFLRQIASAQKPIVAAVAG
FT                   VAVGIGVTMLLHCDLVYAADTAQLSLPFAQLGLCPEAASSLLLPRVAGHQVAAEKLLLG
FT                   EPFDALEAHRIGLVNRVLPAADLDAFAAGQAAKLVALPASSLRATKAFLKKGAGTEIAA
FT                   RMSEEGDQFGRMLRSPEVREAITAFFEKRKPDFRQFD"
FT   gene            648396..648521
FT                   /locus_tag="BTH_I0568"
FT   CDS_pept        648396..648521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38619"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T124"
FT                   /protein_id="ABC38619.1"
FT                   /translation="MRRCDAARRLVPAASRARMPARRHAARRLRACRDAARYAVP"
FT   gene            complement(648506..649330)
FT                   /gene="fdhD"
FT                   /locus_tag="BTH_I0569"
FT   CDS_pept        complement(648506..649330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="BTH_I0569"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="identified by match to protein family HMM PF02634;
FT                   match to protein family HMM TIGR00129"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37578"
FT                   /db_xref="GOA:Q2T123"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T123"
FT                   /protein_id="ABC37578.1"
FT                   /translation="MSLSETVEPSGIVELAVRRRRGDALEPAVDRVGQEWPVALVFNGI
FT                   SHAVMMCTPRDLEAFAVGFAVSEGIVGRGSDVKDIEVALHGDAPLPYAEVQLTVVQQAF
FT                   AALKEKRRALAGRTGCGVCGIESIDLLDLVPERVPDAGFLARIAPDAIARAARELPAHQ
FT                   ALTRQTGGLHAAAWCDASGAIVHAFEDIGRHNALDKLIGTLTLTRADMTNGFVFLSSRA
FT                   SYELVRKSARVGIPMVATISAPSSLAIEIARQAGLRLVSFCREAGYVDYGTA"
FT   gene            649426..649935
FT                   /locus_tag="BTH_I0570"
FT   CDS_pept        649426..649935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02664"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38443"
FT                   /db_xref="InterPro:IPR013481"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T122"
FT                   /protein_id="ABC38443.1"
FT                   /translation="MPAIVKVSANMGLSDAPLLFNFEIESSEDLTYIPMIVRFNLDRFG
FT                   LRISLEQWQLLPIEDRRLLARFPADEDVVIEPNFDHALFEMLRTHANVEPAWFQPDEHP
FT                   AWRSAEAVPDALVAQSGLAGLPAPSGAQWAKLTPFQRYVLAKLSRKPKLNHDFVPAMRE
FT                   FGLAAH"
FT   gene            complement(650014..650700)
FT                   /locus_tag="BTH_I0571"
FT   CDS_pept        complement(650014..650700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0571"
FT                   /product="thioesterase domain protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37759"
FT                   /db_xref="GOA:Q2T121"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T121"
FT                   /protein_id="ABC37759.1"
FT                   /translation="MRIGPAWPAADAARIARYAVAARAATRRRPYGSAHAGAPHLRRGL
FT                   RGPAPIHTFSYNFRTLHCLRSRFAPLPAASPATAAESARAGCLSFKMEASTMTDSPMQL
FT                   PQKPPALRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATVAVNSFLFKQ
FT                   PVFVGDLLSFYASIVKTGNTSVTVDVEVYAQRMSLMSEIVKVTEATLTYVATDADRRPR
FT                   ALPPLE"
FT   gene            650652..652607
FT                   /locus_tag="BTH_I0572"
FT   CDS_pept        650652..652607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0572"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39124"
FT                   /db_xref="GOA:Q2T120"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T120"
FT                   /protein_id="ABC39124.1"
FT                   /translation="MRCAPRRRPAKQARYAHLHRRSEPTNSPMRRYPASSEPAPIATGP
FT                   RNDWQTIRSLLPYLSAYKLRVAFALACLIGAKVANLGVPVVMKRIVDSLASVQHLTALG
FT                   RAEQSAAVVLAGGVGLLVIAYALVRLSTSLFTELREILFSKVTESAVRRLALQVFQHLH
FT                   GLSLRFHLERQTGGMSRDIERGTRGIQQLISYSLYSILPTLVEVGLVLGFFVVKYEAYY
FT                   AYVTFAALVAYIAFTVKVTEWRTHFRRTMNELDSRANSRAIDSLINYETVKYFGNEEWE
FT                   AQRYDENLKRYRKAAIRSQNSLSFLNFGQQAIIGAGLVFILWRATQGVLAGKLTLGDLV
FT                   LINTFMLQLYIPLNFLGVVYRELKQSLTDMDRMFGLLSAAREVDDAPGASALKVNGARV
FT                   RFERVNFSYEPSRQILHDVDFTIEAGSTTAVVGHSGSGKSTLSRLLFRFYDLDRAAGGA
FT                   ITIDGQDIRDVKQETLRASIGIVPQDTVLFNDSIYYNIAYGRPSATRDEVIAAARAAHI
FT                   HSFIESLPKGYDTPVGERGLKLSGGEKQRVAIARTILKNPPILVFDEATSALDSRSERA
FT                   IQHELEQIARHRTTLVIAHRLSTVVHADQIIVMDHGRIVERGTHAELLRADGLYAQMWA
FT                   LQQQRAAADGAAAEEV"
FT   gene            complement(652857..653576)
FT                   /locus_tag="BTH_I0573"
FT   CDS_pept        complement(652857..653576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0573"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39230"
FT                   /db_xref="GOA:Q2T119"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T119"
FT                   /protein_id="ABC39230.1"
FT                   /translation="MTHTLDTAMIFAAGRGERMRPLTDTTPKPLLAAGGKPLIVWQIER
FT                   LAAAGIRTIVVNHAWLGAQIEAALGDGSRWGVRLLYSAEREALETAGGIAQALPLIEGG
FT                   GGPKVFVGVSGDIYTGFDYAALSARASALAGAPEPSMHLVMVPNPPFHPAGDFTLGDDG
FT                   LLSLDGAPRATFGNIGLYDTRMFRDLPAGTRRALTPYYRETIAARRATGELYSGAWENV
FT                   GTPAQLGELDAALKAAR"
FT   gene            complement(653586..654791)
FT                   /locus_tag="BTH_I0574"
FT   CDS_pept        complement(653586..654791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37154"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T118"
FT                   /protein_id="ABC37154.1"
FT                   /translation="MPRPRNRTVTAASRIPGEAGKRTAWRAAGPRRRELTRDASKKSWG
FT                   IIWQDVPPPRLSMTQPPADSRLARLAAWLATFADRYALDLASLAPASADASFRRYFRVA
FT                   SAASPGGTAIAVDAPPPEKCREFAQIAQLLDAAGVHVPRVLEHDFDAGFMLVTDLGTRS
FT                   YLSALDPAAPAAARPLMRDALDALIRWQLASREGVLPPFDEAFLRREMELMPEWYVGRH
FT                   LGKTLPADARGALERTFALLIASAKAQPQGYMLRDFMPRNLMLAEPNPGVLDFQDAVYG
FT                   PLTYDVVSLMRDAFISWDEEFELDCFAYYWEKAKKAGLPVEADFGEFYRQLEWMGLQRH
FT                   IKVLGLFARINYRDHKPHYLADLPRFLGYARRVALRYRPLAPFARLLDDLEDKTAEVGY
FT                   TF"
FT   gene            654833..657196
FT                   /locus_tag="BTH_I0575"
FT   CDS_pept        654833..657196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0575"
FT                   /product="organic solvent tolerance protein, putative"
FT                   /note="identified by match to protein family HMM PF04453"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38923"
FT                   /db_xref="GOA:Q2T117"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T117"
FT                   /protein_id="ABC38923.1"
FT                   /translation="MPRKTLLPLVPACDAAPRRKRLAAALLAVPGLVPAVSQAQLSGAA
FT                   AEPQTFGSPWDLRLAPQLDEHPQKQGGKPATFVLADHTGGTADQDLAAKGSAEIRRGNA
FT                   VVKADAIHYDQDTDMADAYGKVTVANGGTTFSGPEAHLKVEANQGFMTTPKYHFTATGG
FT                   SGSAERVQLLDSERSVFTNGTYTGCQCSTNPAWYIRGSEFDFDTGADEGVARNGVLFFQ
FT                   GVPLFGSPWLTFPLSGERRSGFLPPTFSPFSSTNGIEVSLPYYFNIAPNRDLTITPHII
FT                   SKRGIFTQATFRYLSTNYSGALTGEYLPDDRIAHRNRYAIFWQHQQNFGNGFGGYIYYN
FT                   KVSDNLYPEELGSTNQFVNGIQTVYQQEAGLTYNDGPWSVLGRYQHWQTLPPAVAPYGR
FT                   EPQLNVKYAKYNVGGFDFGAEADYSRFRITTADQPEGDRVMFNPYVSYGLYGPGYFFVP
FT                   KAQLHIASYDLTTTTGGVPDQAKRFTYSIPTLSLDTGLVFDRSVRLFGQDYIQTLEPRL
FT                   FYVYTPYRNQSNAPLFDTAVSDFGLAEIFTPNTFVGNDRIADANRLTAALTTRFINPAT
FT                   GDERARFVIAQQYYFTDQRVTLLPTEAPATARHSDLILGASVKLGAGFASETAFQYNVD
FT                   NNQLVKSSVGFGYSPGERRVINVGYRYTRQNPTLSNEPINQILMSAQWPLTRRLYAVGR
FT                   LNYDLASSRVVDGLVGFQYDADCWAFGVGVQRYANGLNTSGQQNSSTRVLAQLVLKGLT
FT                   SIDNGLVTAFRAGVQGYTPLPPAPAPLSRFSNYD"
FT   gene            657263..658609
FT                   /locus_tag="BTH_I0576"
FT   CDS_pept        657263..658609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0576"
FT                   /product="survival protein SurA, putative"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38226"
FT                   /db_xref="GOA:Q2T116"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T116"
FT                   /protein_id="ABC38226.1"
FT                   /translation="MKKTLRFAAVAAGLVASLITVAPSASAQALRAQGASLADEVVAVV
FT                   NNDVITGRELDQRVGLIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVV
FT                   DNATVQATLGRLAQANGMPLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKI
FT                   TVSDAEVASYIASQRGPNAGAQQDLRLEHIFVKAPTNAPQADIDAAQKKAEGLLQQALA
FT                   SGTNFERLAKSQSEADDAKKGGDLGFKAPSSLPSDVVDAVSKLRPGEVNPTLIRVPDGF
FT                   EIVRLVDRRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIEAGGDFE
FT                   KFARTYSQDGSASQGGDLGWISPGETVPEFERAMNALQDGQVSNPVRTEYGYHLIQVLG
FT                   RRDAEGSVQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQIKLPVGQ"
FT   gene            658632..659681
FT                   /gene="pdxA"
FT                   /locus_tag="BTH_I0577"
FT   CDS_pept        658632..659681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="BTH_I0577"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37845"
FT                   /db_xref="GOA:Q2T115"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T115"
FT                   /protein_id="ABC37845.1"
FT                   /translation="MSARPQPLRIAITTGEPAGVGPELTARALADAATRWPDAHFTVLG
FT                   DAGLIAGRAAAAGVDWGRVTAGGETGHVADAHVADAHVANAHVAVAHRALAAPAEAGKL
FT                   NPANGRYVLALLDAAIDGALAGKYDAIVTAPLQKSTINDAGVPFTGHTEYLAERTHTPR
FT                   VVMMLAGTGERPLRVALATTHLPLKDVAAALTIDGLVGTLSIIDRDLRERFGLAAPRIL
FT                   VTGLNPHAGENGYLGREEIDVIEPALERARAAGIDARGPYPADTLFQPRHLEHADCVLA
FT                   MFHDQGLPVLKYATFGEGINVTLGLPIIRTSVDHGTALDLAGTGRADPGSLVAAIDTAV
FT                   TMARHQRAG"
FT   gene            659713..660540
FT                   /gene="ksgA"
FT                   /locus_tag="BTH_I0578"
FT   CDS_pept        659713..660540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BTH_I0578"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37091"
FT                   /db_xref="GOA:Q2T114"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T114"
FT                   /protein_id="ABC37091.1"
FT                   /translation="MSNSRQHQGHFARKRFGQNFLVDHGVIDAIVAAIRPERGERMVEI
FT                   GPGLGALTGPVIARLATPDSPLHAVELDRDLIGRLKQRFGELLELHEGDALAFDFGSLA
FT                   LPGEKPSLRIIGNLPYNISSPLLFHLMSFAPVVIDQHFMLQNEVVERMVAEPGTKAFSR
FT                   LSVMLQYRYVMDKLIDVPPESFQPPPKVDSAIVRMIPHAPHELPAVDPAVLGEVVTAAF
FT                   SQRRKMLRNTLGGYRDLVDFDALGFDLARRAEDVGVDEYVRVAQAACAARAGR"
FT   gene            complement(660796..662076)
FT                   /locus_tag="BTH_I0579"
FT   CDS_pept        complement(660796..662076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0579"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39168"
FT                   /db_xref="GOA:Q2T113"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T113"
FT                   /protein_id="ABC39168.1"
FT                   /translation="MGTCLNVRMYQTRAILAGRRIAHPRSRDDARRACRSVKIGASGAA
FT                   ATRARVARYARDESAERAPPTNRTTLSDGQVRRPANRANLLPDLSRAELVRRAPGRLPV
FT                   RGSRRLRERPMSAVAGAPARPSLDLRAIGVMVLLCAIWGFQQVAIKSATHAIPPMLQAG
FT                   LRSAIAALGVWAWASARGTPLFRADGTFAAGIVAGILFAGEFVCLFFGLTLTSAARMAI
FT                   FLYTAPCFTALGLHLFAPGEKMRRPQWAGVAIAFAGIAVAFADGFARPAAGHASALVGL
FT                   AGDALGVLGGVMWAATTVVVRSTSLAHARASQTLFYQLTVSSAVLLGLAVVTRQTAFAN
FT                   VTPLAVASLAYQGVIVAFASYLAWYWLLTRYSAARLSVFTFLAPLFGVSFGVLLLGDAI
FT                   GPRFVAAAALVLAGIALVNAPPRGARK"
FT   gene            662089..662478
FT                   /gene="gloA"
FT                   /locus_tag="BTH_I0580"
FT   CDS_pept        662089..662478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="BTH_I0580"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM TIGR00068"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38437"
FT                   /db_xref="GOA:Q2T112"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T112"
FT                   /protein_id="ABC38437.1"
FT                   /translation="MRLLHTMLRVGDLDRSIKFYTELLGMKLLRRQDYPDGKFTLAFVG
FT                   YGDEQDHTVIELTHNWDTKSYELGTGFGHLAVEVEDAYKACEQIKAQGGKVTREAGPMK
FT                   HGTTVIAFVEDPDGYKIEFIQRKTH"
FT   gene            complement(662648..663535)
FT                   /locus_tag="BTH_I0581"
FT   CDS_pept        complement(662648..663535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0581"
FT                   /product="Protein of unknown function family"
FT                   /note="identified by match to protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36778"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T111"
FT                   /protein_id="ABC36778.1"
FT                   /translation="MPKRPRPRPAVVALDHRQLDLPLFDGPAASPSPASPSAAPPAAPI
FT                   PPATPPEADRSRRRTLALDGRVLEYKLKRSARRTIGFAIDGSGLTITAPRWVTLADIEA
FT                   AIAEKRRWIFNKLAEWQTRAEQRALPQIDWKDGAQIPYLGKPVSIALASTKGALSFDAA
FT                   AATLELGLPAHASDQQIKDRVQGWLQGEAKRIFGERLAVYAEKLGVTYSMYALSSAATR
FT                   WGSCSSDGKIRLNWRLVHFPMSIVDYVVAHELSHLREMNHSPAFWQTVESIFPEFREAR
FT                   HTLKHHPPELLPAL"
FT   gene            complement(663583..664362)
FT                   /locus_tag="BTH_I0582"
FT   CDS_pept        complement(663583..664362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0582"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39472"
FT                   /db_xref="GOA:Q2T110"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T110"
FT                   /protein_id="ABC39472.1"
FT                   /translation="MRFVRSLLLLVYFVVYTVPYATACFIAFPFMRPNARYWMAVGWCK
FT                   STLFVARWLNGIRYRIEGYENLPDGPAVLLPKHQSAWETIALPALMPKPLCYVFKRELL
FT                   YVPFFGWALGMLHMVHINRKDGKNAFDSVIRQGRKRMAEGAWVIMFPEGTRTPVGGQGK
FT                   YKTGGARFAVGAGAPVVPIAHNAGRVWPRNSFTKYPGTVTVSIGKPIDTQGLTPDQLNE
FT                   RVENWIEAEMRRIDPDAYRHERDGARGAVRASDAARS"
FT   gene            complement(664405..664968)
FT                   /locus_tag="BTH_I0583"
FT   CDS_pept        complement(664405..664968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0583"
FT                   /product="HAD-superfamily hydrolase"
FT                   /note="identified by match to protein family HMM TIGR01656;
FT                   match to protein family HMM TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38211"
FT                   /db_xref="GOA:Q2T109"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PDB:4PNH"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T109"
FT                   /protein_id="ABC38211.1"
FT                   /translation="MPTSPSKKLVVLDRDGVINVDSDAFVKSPDEWVALPGSLEAIARL
FT                   NHAGYRVVVATNQSGIGRGLFDMATLNAMHLKMHRAAAAVGGRIDAVFFCPHTADDHCD
FT                   CRKPMPGMMKLIAERFEIDPADTPVVGDSLRDLQAGAALGFRPHLVLTGKGKKTLAAGG
FT                   LPEGTRVHDDLRAFALDFLSKEHE"
FT   gene            complement(664986..667085)
FT                   /gene="glyS"
FT                   /locus_tag="BTH_I0584"
FT   CDS_pept        complement(664986..667085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="BTH_I0584"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37632"
FT                   /db_xref="GOA:Q2T108"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T108"
FT                   /protein_id="ABC37632.1"
FT                   /translation="MTQNHSASLLVELLTEELPPKALARLSDAFAEGIAQRLAARDLIE
FT                   GELAFERYATPRRLAVVVQNVRAVAPERQVREKVLPVSVALDAQGKPTAPLAKKLAALG
FT                   HPNLSIADLERAHDGKAEAFFVNYASPGATLAEGLQAALDETLAKLPIPKVMTYQRPDG
FT                   TDVQFVRPVHRLSALHDDRIVPVCAFGIDAGDTTLGHRFLSDGLVAIQHANAYADTLRD
FT                   KGRVLAHFAGRKEAIRAQLEANAGGDQVVMPEALLDEVTSLVEWPVVYPCRFEDEFLQV
FT                   PQECLILTMQTNQKYFALTDAAGKLRSRFLIVSNIETKTPDEIVEGNERVVRPRLADAK
FT                   FFFEQDKKKPLADRVPLLANVVYHNKLGSQLARIERLETLAGEIAPAIGADATVAIRAA
FT                   RLAKADLLTDMVGEFPELQGTMGTYYARHDGEAEDVAIACSEHYQPRFSGDALPTTPVS
FT                   TAVALADKLETIVGIWGIGLAPTGEKDPFALRRHALGVLRLLLEKQLPLDLVWLLRTTY
FT                   ERFAAVPDVAESTDAIHAFFVERLRGLLRERGYTAGEVDAVLSLNPTRLDDIVARLDAV
FT                   REFTRLAEAEALAAANKRISNILKKSESGANGAVQPALFVEAAEKALAEQLAEVTPRVQ
FT                   SQLEARAYTGALSALAALRAPVDAFFDGVMVNAEDPALRANRLALLSALHQQMNCVADI
FT                   SKLAA"
FT   gene            complement(667102..668274)
FT                   /locus_tag="BTH_I0585"
FT   CDS_pept        complement(667102..668274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0585"
FT                   /product="glycyl-tRNA synthetase, alpha chain"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37565"
FT                   /db_xref="GOA:Q2T107"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T107"
FT                   /protein_id="ABC37565.1"
FT                   /translation="MEACPTPLRPHPPADPVKLHVSAQTQAARRASCRRGAHRPRRLPE
FT                   AERPAPRRPLMLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPW
FT                   RAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGFDLKQND
FT                   VRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAM
FT                   YLQKVENVYDLIWTEWEEQGPNGPEIRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFF
FT                   NSYEAEAKRMIEAQLALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVA
FT                   QAYYDSREKLGFPMIGNPVPGVPGLTTDAQEAAQPAWAPPLKAERKIDQD"
FT   gene            complement(668405..670120)
FT                   /locus_tag="BTH_I0586"
FT   CDS_pept        complement(668405..670120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0586"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="identified by match to protein family HMM PF00795;
FT                   match to protein family HMM TIGR00546"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36821"
FT                   /db_xref="GOA:Q2T106"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T106"
FT                   /protein_id="ABC36821.1"
FT                   /translation="MAEPISTRSQSSVSPTAAGRALPIWHYPSALLAGAANTLTFAPTP
FT                   HGGWLQLAVFAWLFAQLTRTTSWKHAAATGGAFGFGNFISGIWWLYISMHVYGEMAAPL
FT                   AGGALVLFCLYLSIYPAFSAGLWSFCAGHARNGKAADPRPFSPTWHGAFAFASAWAVGE
FT                   WLRGTVLTGFPWLASGYAQVDGPLAGYASIVGVYGIGWVLALIAALGVQAIARAREGSN
FT                   GLGGDRNNGGGNGRTDAPAGAVPLALRSPRVAAPALTAAALVALGPLLALVPWTVPANA
FT                   PLTVRLLQGNVKQDIKFEEAGIQAAIAMYQKMITEKPADLVVTPETAIAVLIQELPEPF
FT                   ARAVRNFSDATDTAVLFGAVGGTVTNDGRIVDYTNSLYGVTPHSRDIYRYDKHHLVPFG
FT                   EFIPWGFHWFVDLMKMPLGDFARGAPVQQPFIVRNQPVMADVCYEDIFGEEIAATIRDN
FT                   PVSPGVLVNVTNLAWFGDTIALDQHLQIARMRSLETGRPMLRATNTGMTAAIDAHGRVI
FT                   GRLKPFTIGSLDVRIEGTAGRTPYVTSGNATVLAMSLLLLAFGFAFGPRLRRRS"
FT   gene            complement(670162..671049)
FT                   /locus_tag="BTH_I0587"
FT   CDS_pept        complement(670162..671049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0587"
FT                   /product="magnesium and cobalt efflux protein CorC"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39360"
FT                   /db_xref="GOA:Q2T105"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T105"
FT                   /protein_id="ABC39360.1"
FT                   /translation="MNDSYPSRKSSDKPHEKRSLLERLTDFISPEPDSRAELLEILQDA
FT                   HERNLIDADSLSMIEGVFQVSDLCARDIMVPRAQMDALNIADKPEDFIPFVLEKAHSRY
FT                   PVYEDNRDNVIGVLLAKDLLRFYAEEEFDVRGMLRPAVFIPESKRLNVLLHDFRVNRNH
FT                   LAIVVDEYGGVAGLITIEDVLEQIVGDIEDEYDFDEEAGNIIAAPDGRYRVRALTEIEQ
FT                   FNETFGTDFSDEEVDTIGGLITHHFGRVPHRGEKVRLGDLLFEIQRGDARQIHVLLVRR
FT                   APLAGRRSGSAGED"
FT   gene            complement(671490..672122)
FT                   /locus_tag="BTH_I0588"
FT   CDS_pept        complement(671490..672122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0588"
FT                   /product="ChaC-related protein"
FT                   /note="identified by match to protein family HMM PF04752"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36413"
FT                   /db_xref="GOA:Q2T104"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T104"
FT                   /protein_id="ABC36413.1"
FT                   /translation="MSRPAPARCPYPPSLGEARYLSDDELAASLDATLAGWDRTSDLWL
FT                   FGYGSLIWNPGMPAVEALRGKVHGYHRGLYLWSRVNRGTPEQPGLVLALDRGGSCTGLA
FT                   FRLAGGTAMPHLEALWRREMAMGSYRPAWLPCALAGGERVSALAFVMRRDVPTYTGKLT
FT                   DDVVKAVFGCASGRYGTTLDYVSRTVAALRDSGMPDRALEALLARCR"
FT   gene            complement(672161..673474)
FT                   /locus_tag="BTH_I0589"
FT   CDS_pept        complement(672161..673474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0589"
FT                   /product="conserved hypothetical protein TIGR00043,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF02130;
FT                   match to protein family HMM TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39120"
FT                   /db_xref="GOA:Q2T103"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T103"
FT                   /protein_id="ABC39120.1"
FT                   /translation="MRATGRARGARRPLRVVRRPGCPVTRPNRPVHQSIGPTSRLARVD
FT                   VHPSACAVSIEIAPLAARGRRNTDPAGTPLADSAPLRQPLRSVRAHRFGIRAMTRGRAI
FT                   TRTSNEPSSHAGHASPKPPANHRPGRRPTSTPNRRAPAPPPSATPRETPSGRSSVWCIL
FT                   NRVQTDVNVMKSSRSSKSARAEAAQPEFPRLSLFDAKGKVKTVEAQALRVDFADGRSLM
FT                   FDLSGSSGDAAVAIVAQHTDPSLRATIALRPEHYDSVTVEAGADENPDFAHDATDDAGE
FT                   DAPNREPELDLAVQYGDEIGDAQRRSLPKRKVIAEWLEPAIFSDAQFTVRFVGADEGRT
FT                   LNHSYRHKDYATNVLTFAYGEEPDGVTVADLVLCCPVVEKEAREQGKTLVAHYAHLLVH
FT                   GALHAQGYDHERGEEDAAEMEALEIDILAKLGFPNPYR"
FT   gene            complement(673540..674616)
FT                   /locus_tag="BTH_I0590"
FT   CDS_pept        complement(673540..674616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0590"
FT                   /product="PhoH family protein"
FT                   /note="identified by match to protein family HMM PF02562"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38290"
FT                   /db_xref="GOA:Q2T102"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T102"
FT                   /protein_id="ABC38290.1"
FT                   /translation="MKTAQALEFTAPRDDNARLANLCGPLDENLRQIEQALDVTLSRRG
FT                   HRIAIRGRGARIALAALEDFYNRARDPLSVDDIQLALVEARHPGNPRRNGNGNGDGSGQ
FT                   PEVDVRFRGDPDHPFDEPVVRIGDEPHADEAAPKLYTRRADLRGRTPAQREYLKQILSH
FT                   DVTFGVGPAGTGKTYLAVACAVDALERDQVKRIVLTRPAVEAGERLGFLPGDLAQKVDP
FT                   YLRPLYDALYDLLGFDKTAKMFERQMIEIAPLAYMRGRTLNHAFIILDEAQNTTPEQMK
FT                   MFLTRIGFGSKAVVTGDTSQVDLPRGHKSGLVEAQQVLGGVRGIALTRFTSADVVRHPL
FT                   VARIVEAYDEFHAQHKDE"
FT   gene            complement(674640..676013)
FT                   /gene="miaB"
FT                   /locus_tag="BTH_I0591"
FT   CDS_pept        complement(674640..676013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="BTH_I0591"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF01938; match to protein
FT                   family HMM PF04055; match to protein family HMM TIGR00089;
FT                   match to protein family HMM TIGR01574"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37512"
FT                   /db_xref="GOA:Q2T101"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T101"
FT                   /protein_id="ABC37512.1"
FT                   /translation="MTKKVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDSPEDADIIL
FT                   FNTCSVREKAQEKVFSDLGRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFG
FT                   PQTLHRLPQMIDARRESGRAQVDITFPEIEKFDHLPPARVEGPSAFVSIMEGCSKYCSY
FT                   CVVPYTRGDEVSRPLDDVLTEIAGLADQGVREVTLLGQNVNAYRGALTAGAHEIADFAT
FT                   LIEYVADIPGIERIRYTTSHPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKR
FT                   GYTVLEYKSLIRKLRAIRPNLSLSTDIIVGFPGETEADFDKTMALVHEMSYDTSFSFIY
FT                   SPRPGTPAANLADDTPREVKLERLQHLQATIEENVARISQSMLGKVERILVEGPSRKDP
FT                   NELAGRTENNRVVNFPAPLTAHARLIGQMIDVKINHAYPHSLRGELVLAHDDASAATH"
FT   gene            complement(676191..677123)
FT                   /locus_tag="BTH_I0592"
FT   CDS_pept        complement(676191..677123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0592"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36804"
FT                   /db_xref="GOA:Q2T100"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T100"
FT                   /protein_id="ABC36804.1"
FT                   /translation="MDRLGDIRLFVEAAELGSLSAAGRKLNLTPAAASARLAKLEAQVS
FT                   TRLFERSTRRLRLTDEGRLYLNCCRQALQALDDADAMLQEGRNVVSGKVRLSSTADFGR
FT                   NQLLDWLDEFNARYPDVTFSVTASDSSSNLWQDEIDLAIRFAAPPDGALIARPLAANRR
FT                   VLCASPAFVDKYGTPKDPHDLARFPCNVITVASGPINVWRFTRGGDTQTYTVPLANAHE
FT                   TNDGGFTREWTIRGHGIALKSIWDVARDVRAGRLKVLLPEWRHQDAPLHAIHHSKRYMA
FT                   PRVRVLLDFLVERFAQEEKALEDLLNACR"
FT   gene            677269..678441
FT                   /locus_tag="BTH_I0593"
FT   CDS_pept        677269..678441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0593"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39382"
FT                   /db_xref="GOA:Q2T0Z9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Z9"
FT                   /protein_id="ABC39382.1"
FT                   /translation="MPLPLLALAISAFAIGTTEFVIMGLLPDVARDLAVTLPSAGLLVS
FT                   GYALGVAAGAPLLAVLTSRMPRKAALQLLMAIFIAGNVLCALAQSYGMLMFARVVTSFA
FT                   HGSFFGIGAVVAASLVSVDKRASAIALMFTGLTLANVLGVPFGTFVGQTLGWRATFWIV
FT                   AALGVASLAGVAALVPKPRDAGRAALGRELRVLKEPQVWLALAMTVLGFGGVFVVFTYI
FT                   APILEDVTGFSPHAVSLVLVLFGVGLTIGNAIGGRLADRALMPSLLAILVALIAVMAVF
FT                   AKTSHLPAAAAITVFVWGIAAFATVPPLQSRVVEKAAHAPNLASTLNIGAFNVGNAGGA
FT                   WLGGVALSHGAPLDALPWVAAVVTLAALAVTVLAARLDTRVSPGAAAAAQ"
FT   gene            678575..679234
FT                   /locus_tag="BTH_I0594"
FT   CDS_pept        678575..679234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0594"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38806"
FT                   /db_xref="GOA:Q2T0Z8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Z8"
FT                   /protein_id="ABC38806.1"
FT                   /translation="MHSPLALVRDVSSQDAAAAADADMSLDALERLVGVNLARLRAERQ
FT                   LSLDALARLSGVSRAMLAQIESARSVPSIKVLCKVAAALKVSVAAFLRRHAVNGFEHLS
FT                   AERAVRVVSSNGRFSARALYPEGEPAVAEFHELRIAPLHTEPGAPRAPGTSVNLVVSEG
FT                   TLEVSIHDRRQLLATGDAIVFDADQPYTLRNPGDTEARAFRVTVNAEVPPRWHVPA"
FT   gene            679358..680365
FT                   /locus_tag="BTH_I0595"
FT   CDS_pept        679358..680365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0595"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="identified by match to protein family HMM PF00926;
FT                   match to protein family HMM TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36355"
FT                   /db_xref="GOA:Q2T0Z7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Z7"
FT                   /protein_id="ABC36355.1"
FT                   /translation="MRLQGGAKFPTGGRPACCRRARERPRDARGQQIWSDARADGHSPD
FT                   ERRCADGHVRPVSPAARGVVRAARKRRRAVCLLCPETFFAPFFPRGAFHIMSFPLPSKS
FT                   APADAFSDLPLLDVEPVPPRIAAALAALREGRAVVLQDDHDRENEADLIVAAERLTDET
FT                   MALLIRECSGIVCLCLTDEKVRALALPPMAQLNESKNGTAFTVSIEARAGVTTGVSAAD
FT                   RVTTIRAAIADDAQPHDIVRPGHVFPLRAAPGGVLARRGHTEGTVDLAILAGLKPAGVL
FT                   CELMNPDGTMTRGADVERFAAQHGLPMLTIAELVEFRERLASLRERDACCEGVA"
FT   gene            complement(680436..681158)
FT                   /locus_tag="BTH_I0596"
FT   CDS_pept        complement(680436..681158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0596"
FT                   /product="HAD-superfamily hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38327"
FT                   /db_xref="GOA:Q2T0Z6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Z6"
FT                   /protein_id="ABC38327.1"
FT                   /translation="MALRRPTLFVVLMLDHLICDCDGVLVDSEVIADRVLFDTLSAAFP
FT                   AIDFTADAKAAFGQQTSRFLADLEARHGIAMPEDFLDTIEHNIETGLAQWLAPIAGVRD
FT                   ALTKIALPAAVVSNSRLARVRNSLKRAALTDVFGERVFSAEQVARPKPYPDVYLHAART
FT                   LGVEPARCIVVEDSVSGLNAARAAGMKTIAFVGASHIPGGYEDALRKMGIMRIMRSMDE
FT                   LPALVSAGMRGEFGDVQS"
FT   gene            complement(681203..681427)
FT                   /locus_tag="BTH_I0597"
FT   CDS_pept        complement(681203..681427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39231"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Z5"
FT                   /protein_id="ABC39231.1"
FT                   /translation="MRVAIASPRFDKAAMRGPALRERRRSLGARHAAFAFRAEITRRVA
FT                   PVGVSPPMRPTVHSHRHAHGIRPHPATRR"
FT   gene            complement(681551..682267)
FT                   /locus_tag="BTH_I0598"
FT   CDS_pept        complement(681551..682267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0598"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="identified by match to protein family HMM PF00230;
FT                   match to protein family HMM TIGR00861"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37043"
FT                   /db_xref="GOA:Q2T0Z4"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Z4"
FT                   /protein_id="ABC37043.1"
FT                   /translation="MSPYIAEFIGTALLVLLGNGAVANVLLAKTKGKGADLIVIVMGWA
FT                   MAVFVAVYVTASFSGAHLNPIVTISLALAGKFAWAKVGGYIAAQMLGGMAGALLVWLAY
FT                   RQHFAKETDPDLKLAVFCTAPAIRSVTHNVLTEAICTFVLILGVLYLASPQVGLGALDA
FT                   LPVGLLVLGIGISLGGPTGYAMSPARDLSPRIMHALLPIPGKRDSDWRYAWVPVLGPLV
FT                   GGVLAANLYLYLHTAH"
FT   gene            complement(682381..683883)
FT                   /gene="glpK"
FT                   /locus_tag="BTH_I0599"
FT   CDS_pept        complement(682381..683883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="BTH_I0599"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37809"
FT                   /db_xref="GOA:Q2T0Z3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T0Z3"
FT                   /protein_id="ABC37809.1"
FT                   /translation="MQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPRPGWV
FT                   EHDPQEIWSTQAGVAAEAVTRVGLNGTSIAAIGITNQRETTIVWDRETGHPIYNAIVWQ
FT                   DRRTADFCDQLKAQGLSEKVRAKTGLPIDSYFSATKIRWILDNVEGAREKARQGKLAFG
FT                   TVDSWLVWNFTKHELHVTDVTNASRTMLFNIHTLDWDDELLDALEIPRSMLPQVRASSE
FT                   IYGPTKTTVFASKIPLAGIAGDQQAALFGQMCTSSGMVKNTYGTGCFLMMNTGETPIES
FT                   QNNLVTTIAWQVDGKVNYALEGSIFIAGAVVQWLRDGLGIIKSASEIEALAAGVPHTDG
FT                   VYLVPAFAGLGAPHWNARARGSLFGVTRGTTSAHLARAALDSIAYQSLDVLKAMEADSG
FT                   IRIGELRVDGGASANNLLMQFQADLLGVDAVRPRVTETTALGAAYLAGLAIGYWKNVDE
FT                   LHSQWQLERRFAPSMQREQVSSCLCGWQRAVRAAKAWADDTQ"
FT   gene            complement(683989..685521)
FT                   /locus_tag="BTH_I0600"
FT   CDS_pept        complement(683989..685521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0600"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38027"
FT                   /db_xref="GOA:Q2T0Z2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Z2"
FT                   /protein_id="ABC38027.1"
FT                   /translation="MTQQNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTS
FT                   SSSTKLIHGGLRYLEYKEFGLVRKALQERETLLRAAPHIIWPLRFVMPHMPNLRPAWLI
FT                   RIGLFLYDHLAKRELLPGSRGIDMRRHPAGAPLVDSIKRGFVYSDGWVDDARLVVLNAL
FT                   DAQERGARILTRTKLVSAERRDGQWHARLQRADGSTLDVCARAVANAAGPWVGDVLHGA
FT                   LGRGAQHSVRLVKGSHIVTRRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYR
FT                   DDPSRVAIDRDETRYLCESINRYFKRKISPADVCWTYSGVRPLLEDENADNPSAVTRDY
FT                   RLELDGGDGAPLLSVFGGKITTFRKLAEEATDMLGGALGASRGAWTAGVPLPGGDIADA
FT                   RFAPFAEAFAKRHPWLPAALARRYARAYGTRAERVIGGAKSLAELGAELAPGLYEAELR
FT                   YLRDAEWASCADDVLWRRSKLGLHVAPGTLDAVTAALDAWFGAAREAASAAH"
FT   gene            685689..686060
FT                   /locus_tag="BTH_I0601"
FT   CDS_pept        685689..686060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0601"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39450"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Z1"
FT                   /protein_id="ABC39450.1"
FT                   /translation="MRTMIAAGALALLAGCAGGPAMFGGWGGPSFADLQRSCGDVRDYG
FT                   EDAQAVYSAVFDAWVAKRHGKLTDARFCAFENELAQHRAALGTSTDPAERGRWVSYLND
FT                   ARARALSWRAAVDPSLRGG"
FT   gene            complement(686127..686336)
FT                   /locus_tag="BTH_I0602"
FT   CDS_pept        complement(686127..686336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36649"
FT                   /db_xref="InterPro:IPR019056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Z0"
FT                   /protein_id="ABC36649.1"
FT                   /translation="MERTMLSPHEFATLLLVKDAPDQADMDRDELDALLERQLVKLEAL
FT                   GSGRKYCVTEIGDAALRSIKLRYS"
FT   gene            complement(686644..687480)
FT                   /locus_tag="BTH_I0603"
FT   CDS_pept        complement(686644..687480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0603"
FT                   /product="glycerol-3-phosphate regulon repressor"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37231"
FT                   /db_xref="GOA:Q2T0Y9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y9"
FT                   /protein_id="ABC37231.1"
FT                   /translation="MRICRPRFPSHRAESTPANMTRDPRLTLNARQQELLEWVQRDGFV
FT                   TVDDLAAHFNVTPQTIRRDVNWLADLNLLRRYHGGASLPTSSENVSYTARQRMFHDEKR
FT                   RIAALAASHIPDQASLFINLGTTTEEVARALNRHRGLRVITNNLNVASMMSGYPECEVL
FT                   ITGGIVRPWDKGIVGELAIDFIRQFRVDYAIIGTSSIESDGTLRDFDTREVRVAEAIIQ
FT                   HARTVYLVTDHSKFGRPALVRQGHLNQIHALFTDKPLPDEMAETIAQAGTQVYVAD"
FT   gene            687422..689326
FT                   /locus_tag="BTH_I0604"
FT   CDS_pept        687422..689326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0604"
FT                   /product="gamma-glutamyltransferase"
FT                   /note="identified by match to protein family HMM PF01019"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36678"
FT                   /db_xref="GOA:Q2T0Y8"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y8"
FT                   /protein_id="ABC36678.1"
FT                   /translation="MFAGVDSARWDGKRGRQIRIVRAVRAESPGTRRASPRTRADLGLD
FT                   SIHVVHASIHVTNEFAGGAQSRWNVCFDPVYHVPAMTLHSNISGVPFSWRNPYLTTRVP
FT                   VFARNVVSTSHPLAAQAGLRMLWKGGNAVDAAIAAAAAITVVEPVSCGLGGDAFALVWD
FT                   GAKLHGLNASGVAPAAWSVDYFRRRHGDAGNGLARQPTRGWDTVTVPGVIAGWEALHAK
FT                   FGSLPFADLLEPAIELAERGHAVAAVVAHKWAAAVPELNGQPGFAETFMPRGRAPEVSE
FT                   LVRLPGHAKTLRTIAAEGARAFYEGSIAESIAGFFRDGGGALTADDLRAYRPEWVEPIG
FT                   KDFRGYTVHEIPPNGQGIAALIALGIVERFGLDDLPLDSAEAQHVQIEAMKLAFADVYR
FT                   YVADPRAMALTPAQMLDDAYLDARAKLIDVTRATHFSFGMPRAGGTIYLSAADERGMMV
FT                   SFIQSNYMGFGSGLVVPGMGIALQNRGCGFSMDPTSPNVVEGGKRPFHTIIPAFVTQQA
FT                   GGARHAVMSFGVMGGDMQPQGHLQTIVRMLGYGQQPQAACDAPRWKVSRSFTLDVEAAL
FT                   GASVVDALAARGHTIQAIDDPYMDFGSGQFIWRLDRDEPDRGYVAASDSRRDGLAAGF"
FT   gene            689632..690465
FT                   /locus_tag="BTH_I0605"
FT   CDS_pept        689632..690465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37255"
FT                   /db_xref="GOA:Q2T0Y7"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y7"
FT                   /protein_id="ABC37255.1"
FT                   /translation="MLADSDTTHEMPWRIEDIDLTRIDRQRAAANEDLLLLLCAASFIE
FT                   SGSDLYTSNLSQFFDDDPEVSAWLNTEWEHEELQHGRALKAYIAHVWPEFDWDLAFADF
FT                   FDEYSKTCSLEAFEKTRALEMVARCVVETGTATLYRAINECSDEPVLKEITDNIRTDEV
FT                   RHYKHFFRYFKKYNKVEGNGRLAVLGALMRRVLEIRNEDSEIALRHVFAIRYPDRAGDS
FT                   AYCRERTARVNALVRRNLSADMCVKMLLKPLDLPAKIQPGVHYPLTKLTQHVFFR"
FT   gene            690535..691035
FT                   /locus_tag="BTH_I0606"
FT   CDS_pept        690535..691035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39260"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y6"
FT                   /protein_id="ABC39260.1"
FT                   /translation="MTHPDRRSLERTTYDAWPRAALALFDGDDLARKAGFTASLVVVDR
FT                   GVEPPQPRTTLLSAGELYAPDSRSLRFSLWPQSRAARALAVHPDATLAFVADDAFHQAR
FT                   LHVDSSDSTDDGLARFTATLVDGEAQRVGYARLTAGIVFELAEADAPAVLARWARQIAQ
FT                   LRR"
FT   gene            complement(691140..692588)
FT                   /locus_tag="BTH_I0607"
FT   CDS_pept        complement(691140..692588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0607"
FT                   /product="ATP-dependent RNA helicase RhlE"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37059"
FT                   /db_xref="GOA:Q2T0Y5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y5"
FT                   /protein_id="ABC37059.1"
FT                   /translation="MSFASLGLAEPLVRAVNELGYTQPTPIQAQAIPAVLGGGDLLAGA
FT                   QTGTGKTAGFTLPILQRLHAFYAENRGARRAVRALILTPTRELAAQVEESVRAYSKYVK
FT                   LRSTVMFGGVSINPQIDALKRGVDIVVATPGRLLDHMQQKTIDVSSLDILVLDEADRML
FT                   DMGFIHDIKRVLAKLPAKRQNLLFSATFSDEIKSLADSLLDSPALIEVARRNTTAETIA
FT                   QKIHPVDRDRKRELLTHLIREHNWFQVLVFTRTKHGANRLAEQLTKDGISAMAIHGNKS
FT                   QSARTRALSEFKNCTLQVLVATDIAARGIDIDQLPHVVNFDLPNVPEDYVHRIGRTGRA
FT                   GANGEAVSLVCVDEKQLLRDIERLIKREISQEVIPGFEPDPNAKPEPIQRRGQRGGNGG
FT                   GANGGNGGGSAGNAGRGNRAPRAASQPQAQQGQPAARRDGGTQAKAAKPQARGGGRPAG
FT                   NGASNGGGAHANRNRSSRSGQRGR"
FT   gene            complement(692715..694013)
FT                   /locus_tag="BTH_I0608"
FT   CDS_pept        complement(692715..694013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0608"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36624"
FT                   /db_xref="GOA:Q2T0Y4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y4"
FT                   /protein_id="ABC36624.1"
FT                   /translation="MKRKSLFALSAVAIVAAAALVPVLWPGNDTLHGNAAVAATPADQA
FT                   ALVKKGEYLARVGDCIACHTVRGGKPFAGGLPMATPFGTMYTPNITPDDQAGIGKWTSD
FT                   DFYRAMHTGRSKDGSLLYPGFPFASYTKVTRADSDAIYAYLRSVAPVSTPSRPHELRFP
FT                   FNNRNLLIGWRTLFFKEGEYKPDPTKSVEWNRGAYLVEGLGHCSMCHTSINMMGGPVSS
FT                   AAFAGGLIPLQNWYAPSLTNDKELGLGDWHVQELSDLLQAGVSHKGAVFGPMADVVHNS
FT                   LQYMTDEDTRAMSTYLKSIPQKAEAPKNMQYEPSPQFGNALLGQGQKIYKDNCATCHGA
FT                   QGEGKPTAYPPLAQNRSIMMESAVNPIRMVLNGGYPPSTFKNPRPYGMPPFAQSLSNQE
FT                   VAAVVTYIRMSWGNNGSPVSPQQVSDLRSAPLD"
FT   gene            complement(694033..694794)
FT                   /locus_tag="BTH_I0609"
FT   CDS_pept        complement(694033..694794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0609"
FT                   /product="cytochrome c4, putative"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37671"
FT                   /db_xref="GOA:Q2T0Y3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y3"
FT                   /protein_id="ABC37671.1"
FT                   /translation="MESRVSSRRLFRPLLAVLLMGAAGLLSTAHAQNKPTEPAAAKAPL
FT                   KAPDTMAERVRGCTACHGTHGQGTDNDYFPRLAGKPAEYLYNQLVNFRDGRRKYPPMNY
FT                   LLTYLSDDYLREIAQHFSDERPPYPTPTTTTVPAAVVERGKQLALHGDPARKLPACVAC
FT                   HGTALTGMQPAIPGLVGLHSDYLSAQIGAWRSGTRHAKAPDCMHEVASKLSDEDVTAVT
FT                   AWLAAQPAPANPVPAPARSMKTPLACGSEPQ"
FT   gene            695218..696144
FT                   /locus_tag="BTH_I0610"
FT   CDS_pept        695218..696144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0610"
FT                   /product="copper resistance protein, putative"
FT                   /note="identified by match to protein family HMM PF05425"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38037"
FT                   /db_xref="GOA:Q2T0Y2"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y2"
FT                   /protein_id="ABC38037.1"
FT                   /translation="MKLDSLWFGQAALAALGDVAFAVAVGSALIGAWLANDGAKSVIAP
FT                   SHPAWRQSLRSLAVAAAVLVLADAGWLVYQAAAMSGAGLRGAFGAIPLVLEQTHVGHAW
FT                   AVACGGALLLFAVALARPSGPLAGALLALATLVVAAGKASLGHAADSGAFSAAVGVQTV
FT                   HVAATATWGGLVIAGGMAVLPALGSSIARGAMIRIAQRLSGASIAALAFVVVTGALNTL
FT                   RGTGGDFVALDGSTWGRVLLLKLALVTLALVLAALNRFSALPRLRRTASTEDAHTFRNV
FT                   LHLEALAMIGVFIAAAVLSFTAPIAAG"
FT   gene            complement(696474..697982)
FT                   /locus_tag="BTH_I0611"
FT   CDS_pept        complement(696474..697982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0611"
FT                   /product="DgoA protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38983"
FT                   /db_xref="GOA:Q2T0Y1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y1"
FT                   /protein_id="ABC38983.1"
FT                   /translation="MDRFRRGGAAAPRSDDRPVAYGNARPGESQPPGRRAASDGRQIAP
FT                   DPTRAPPRSLCAQRRDRYYFRATPLYDSRVIQADSPPTVSQKAQAVPRQPTGSAAGAAR
FT                   SPPRSEANRRYKETPAMKITRLETFIVPPRWLFLKIETDAGIVGWGEPIVEGRAHTVEA
FT                   AVHELADYLVGQDPLRIEDHWQVMYRAGFYRGGPIAMSAIAGIDQALWDIKGKHHGAPV
FT                   HTLLGGPVRDRIKVYSWIGGDRPSDVANNARAVVERGFQAVKMNGSEELQIVDTFDKVD
FT                   KVIANVAAVRDAVGPYVGIGVDFHGRVHKPMAKVLAKELDPYKLMFIEEPVLSENAEAL
FT                   RDIANQTSTPIALGERLYSRWDFKYILEGGYVDIVQPDASHAGGITECRKIATLAESYD
FT                   VALALHCPLGPIALAACLQLDAVSYNAFIQEQSLGIHYNQGSDLLDYLRNPEVFRYADG
FT                   FVAIPQEPGLGIDVDEEKVREMAKTGHRWRNPVWRHADGSVAEW"
FT   gene            697993..698307
FT                   /locus_tag="BTH_I0612"
FT   CDS_pept        697993..698307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0612"
FT                   /product="Protein of unknown function (DUF636) family"
FT                   /note="identified by match to protein family HMM PF04828"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39494"
FT                   /db_xref="GOA:Q2T0Y0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0Y0"
FT                   /protein_id="ABC39494.1"
FT                   /translation="MLYTGGCHCGKVRFEVEGEIDAACACNCSMCVRKGSLLWFVPRDA
FT                   FRLKTPDEDAATYLFNKHVIRHRFCPTCGIHPFAEGTDPKATRWRPSTFAASTASISTR
FT                   "
FT   gene            698467..700149
FT                   /locus_tag="BTH_I0613"
FT   CDS_pept        698467..700149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0613"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36316"
FT                   /db_xref="GOA:Q2T0X9"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X9"
FT                   /protein_id="ABC36316.1"
FT                   /translation="MSNKPAPDAPPTEQPCAVSRRGFLKFAGVSGLATAASGLAAARAA
FT                   AAAPDGTPEQIHLTWGDADANEVVVSWASLAAATNPRVRFAGPNEAWRTAHGVQRTYTD
FT                   GLNGEVVFTYHARLRGLKPGARYRYEVTADNDGNAAQPFAAHFETAPRGRAAFRWTSYG
FT                   DLATPNTGWVLSSPQSRFAVQAVERFQPLFHLLNGDLCYANLNPAHQPAVWRDFGNNNQ
FT                   TSAANRPWMPCPGNHEIEFHNGAQGLDSYLARYTLPENGTRFPGRWYSFRVGAVLFVSL
FT                   DADDVVYQDAAAFVAGPNPLVPAASTGNETIAPGTSLYVRGYSHGEQTRWLEQTLRRAS
FT                   NDRDIDWIVVQMHQDALSSSKTGNGSDKGIREAWLPLFDRYGVDLVLCGHDHDYERSFP
FT                   VRGCNHRAGVDAATGEVVDTLQPRPVVTTDPADGKFDTSRGTIHMILGGGGTSAPLDVY
FT                   GENPATGLPQARVFTKPNRPVPGPAPNTFVRRGADAVEDAIWSARRDTGTGYGIAVFDY
FT                   EPGEHGGHSTITVNYYHAPGADQKPTAEYELFETIVLSKPRRA"
FT   gene            complement(700127..702007)
FT                   /locus_tag="BTH_I0614"
FT   CDS_pept        complement(700127..702007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0614"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF03707"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36770"
FT                   /db_xref="GOA:Q2T0X8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X8"
FT                   /protein_id="ABC36770.1"
FT                   /translation="MHGTFDLPLVTLSLAIATLASYTALDLSALIALLDQPRMRRAWLA
FT                   GGAAAMGTGIWAMHFVGMLAFSLPIPLGYDFGYTFASLAIAVIVSYFALDALTRAALTR
FT                   ERLAMGGVLMGIGIAGMHYTGMSALRMQPAIDYDFTLFVASIAIAIGASTTALWIAHRL
FT                   SNENEPRVLSKRIAAAGVMGIAITGMHYTGMAAAHFAANSVCGAAGEISGAWLGATIAL
FT                   FTVTILSATLVVSRFDARTAFLRGMTDALEELVAKRTSELEGALRQYERTTHVLQRTRR
FT                   KMEQEIDERKAAQARLEHEKEEQRRLIRRLEETYVQLLQSEKLASIGQLAAGVAHEINN
FT                   PIGFVNANLNTLKSWVAGLLDVIAVQEALTSTLGPDARAPLAAVARDVDLDYVRGDIIA
FT                   LIDESIDGAMRVRRIVCDLRDFSRPSGDAWAFADLHASLESTLNVVHNELKYKADVVRE
FT                   YGRLPLVECNAAQLSQVFMNLLVNAAQSIGTHGTITIRTTCDADTVSISIADTGAGIPD
FT                   DVIGKIFDPFFTTKPVGQGTGLGLSISHGIVEHHGGRIDVESRIGRGSTFTVTLPIRRK
FT                   SGPAARTQTSDEASDETSDEASRASAVRAAARAIGRAAAPAAPLTRGAAC"
FT   gene            complement(702036..703490)
FT                   /locus_tag="BTH_I0615"
FT   CDS_pept        complement(702036..703490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0615"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38694"
FT                   /db_xref="GOA:Q2T0X7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X7"
FT                   /protein_id="ABC38694.1"
FT                   /translation="MNGPEESTTPIAPDAPPPRAADDARCDGAAPAVAAGADGDAPAVP
FT                   VILIVDDEPSILSALKRLLRTARYQVVTAESGAAALDVLAAGEADLIISDMRMPGMTGA
FT                   EFLARAQALHPDTMRILLTGYSEIDAVVSAINEGGVYRYLNKPWDDHDLLLTVKQALEQ
FT                   RRLRQQTARLFALTQQQNAELLAFSTELEAQVHARTEEIRQTVMFLEDAQRDLKRNFMT
FT                   MIQVGANMIELRCGVMGGESRRIGELAKRLALASDMSELQAQDLHFAGLLHGIGKLSLP
FT                   DELLRKSIDRMSAEESRQFHQHPLRAQMVLTPVAQLNHVSHIIRHQYERFNGRGTPDGL
FT                   AGDDIPLGSRILAIARDYEGLQRGGVVNQRMQPEQAIALIKSQAGLRYDPEIVDRFAAL
FT                   VKDLATLGCNTPYARITGGQLLEGMRLADDLRTSRGVLLMTKGSVVSAHQVALVRRYEA
FT                   QESTPFTILIQTMPLAEAAAAAGHEC"
FT   gene            complement(703583..703720)
FT                   /locus_tag="BTH_I0616"
FT   CDS_pept        complement(703583..703720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0616"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X6"
FT                   /protein_id="ABC39429.1"
FT                   /translation="MRASRPRPCIDHARIDARFRNSLADSFGAHTPFARIAGAAGTRAR
FT                   "
FT   gene            704005..704598
FT                   /locus_tag="BTH_I0617"
FT   CDS_pept        704005..704598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36873"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X5"
FT                   /protein_id="ABC36873.1"
FT                   /translation="MTRRSTFSLAGACAAALFAFSAAASAQSAPAPAPAQQRPEAAADA
FT                   GTRLHEADQAFVTDATKAVSTQRDAARIANSRSNDRAVKTFAERVAGDNEKLSQALRAA
FT                   SPRGVDVPHNDPDPAVLDSIKNLRGDAFDKAYIEQVALEGNRKTLSVFQAEIASGRNEQ
FT                   LKNAARKGLPMIQAHYQLAQALASRKHLAGDAAK"
FT   gene            complement(704767..706518)
FT                   /locus_tag="BTH_I0618"
FT   CDS_pept        complement(704767..706518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0618"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF00785; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36613"
FT                   /db_xref="GOA:Q2T0X4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X4"
FT                   /protein_id="ABC36613.1"
FT                   /translation="MRANLPVTQREFDFPDDATLMSTTDPQSYVTYANAAFIQVSGFER
FT                   DEIIGEPHNFVRHPDMPAEAFADMWATLKSGRSWTAVIKNRRKNGDHYWVRANATPVIR
FT                   NGQLVGYMSVRTKPSREEIAQADALYRDLREHRARGRKFHQGLIVRTGLLGWMSLPQTI
FT                   SARWRVRAALLTLLAGSAWTAFLCGLHGVMLDGFAATETVLLLLAEFWLAAQITGPLQR
FT                   VLKQSLAVAAGQAGDNVHLNRVDEIGMIMRAVNQAGLNLRSLVDDVSEQLSGLQSASGR
FT                   ITAGNDDLSGRSEQAAASLEETAASMEQMTATVRNNADTATQASQLAGSTSEAAEKGDA
FT                   VVGKVVATMGEISASSRKISEIIGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVAA
FT                   EVRTLAQRSANAAKEIAALIHDSAQKTAAGSALVDQAGEAMNDIRSQVARVAGLIGEIS
FT                   SATREQSDGIGQVNVAVTQLDKMTQQNAALVQESATTADELKRRTQRLVDAVAVFRLNG
FT                   RAHARRDDARAPRAAPEHAMRERASVARNQPAMRAAPAPSPALASASTANAPARTTAHA
FT                   DMDWQTF"
FT   gene            complement(707132..709069)
FT                   /locus_tag="BTH_I0619"
FT   CDS_pept        complement(707132..709069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0619"
FT                   /product="cholesterol oxidase"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36409"
FT                   /db_xref="GOA:Q2T0X3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR015213"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016170"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X3"
FT                   /protein_id="ABC36409.1"
FT                   /translation="MTHARCHLSSNDFRSAGHNLLQNNHALRTTSTRLKRETHFDSLKS
FT                   FTPTLRNPSTFEKPMKKILGDPASRVRRRAFLGDIARLAGAGVVAGWTPIRPIPAHAQP
FT                   AGAAPPNFPADIPLHKQAFRNWSGEIAVADLWTAVPATPADVVAIVNWAASNGYRARPL
FT                   GHMHNWSPLTVAGNGASERTILVDTTTHLTAVSVDASATPARVVAQAGVSLDTLLATLE
FT                   QHGLGMAAAPAPGDITLGGALAIGAHGTALPAADETRTPGHTYGSLSNAVLALTAVVHD
FT                   ASSGRYALRTFDRTDPDIGPFLAHVGRAFVVEATLQVGANQRLQCESFVDIPASELFAP
FT                   AGSRGRTVESFVRRSGRIEAIWFPFTDYPWLKVWTVRPTRPSGARVVDQPYNYPFSDSI
FT                   SQHVSDLVSRIVLNGEIQLAPLFGKTQYTITYLGLTNIFGPRTNLWGWSRSVLHYVRPT
FT                   TLRVTANGYAVLTRRENVQRAINEFVGAYRQRIADYRAAGRYPVNGPVEIRVTGVDTPA
FT                   DVGPGAVPPSLSAIRPRPDHPDWNAAIWFDILTIPGTPDANRFYREIEQWMLSNYSGDY
FT                   ATVRPEWSKGWGYADTAAWSDGAMLGTTIPDLFRLGLSPADNWDAALRTLERYDPRRVF
FT                   SSPLLDRLMG"
FT   gene            709442..710521
FT                   /locus_tag="BTH_I0620"
FT   CDS_pept        709442..710521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0620"
FT                   /product="YbbB"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38727"
FT                   /db_xref="GOA:Q2T0X2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X2"
FT                   /protein_id="ABC38727.1"
FT                   /translation="MNLQPVSLDQIDDFDEIVDVRTPLEYAEDHIPGALNAPVLSNEER
FT                   VIVGTMYKQVSPFEATRIGAAMVARNIAAHLDTTFADRPRNWRPLIYCWRGGKRSGSMT
FT                   VWFNMIGWRARQLDGGYKTYRRSVVDALGQLPAAFRYVVLAGHTGSGKTRLLHALAQAG
FT                   AQTLDLEALAAHRGSLLGALPSGEQPSQKAFDTALVGALRGFDRERPVFIEAESRRIGA
FT                   ITLPLALLTGMHAADCVNVETAREERVELLLQDYGHLFDQTAFFKVQLEKLVPLHGHAR
FT                   IRKWHEMLDEGRRSELFEELVDVHYDPAYTRSSGAHFTRLPQAERFPFRPTARDVVEQA
FT                   RALLAHLDAAGASACGKRA"
FT   gene            complement(711405..712769)
FT                   /locus_tag="BTH_I0621"
FT   CDS_pept        complement(711405..712769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0621"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37794"
FT                   /db_xref="GOA:Q2T0X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X1"
FT                   /protein_id="ABC37794.1"
FT                   /translation="MSTPTRPASAQPPAFDSDARDARAPVVALHGVSMSFAKPSGAALP
FT                   VLADIDLTVREGEILGLLGRSGSGKSTLLRIAAGLVKPSSGRVEYRGAPLEGPAAGIGV
FT                   VFQTFALYPWLTVSENVELGLDAIRVPPDEARARVMSAIALIGLDGFESAYPRELSGGM
FT                   RQRVGFARALVGDPSLLLMDEPFSALDVLTADTLRTDFLDLWHARQLPIDAVLMVTHNI
FT                   EEAVLMCDRILVLGAHPGHILAEVPIPLGHPRNRLDPELQRIVDDIYAALTSRIADAVA
FT                   ARNGKPGVPAQRLPNVSSHRLDGFVDAFVRHARDGCAELPRLASALAMPINDLLPLAAA
FT                   LHVLEFAELRDGALRLTAAGRVYAQGDAGERKRLFREHLEHFVPLAAHIRQVLDERAGH
FT                   QAPRERFELELLDRLNPLDAANTLRVAIDWGRFAGLYDYDDDARVFRRDEDDAHG"
FT   gene            complement(712778..714511)
FT                   /locus_tag="BTH_I0622"
FT   CDS_pept        complement(712778..714511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0622"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABC39163"
FT                   /db_xref="GOA:Q2T0X0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0X0"
FT                   /protein_id="ABC39163.1"
FT                   /translation="MEHHADLLTSGRWRLRTLGWRDAVALLLVLALIVVLGSGARQMAL
FT                   PLGAARPEAISLSPLALPGYTLRTVLRMLAALGASFVFTFAYASLAAKSRAAEAVLIPL
FT                   LDVLQSVPILGYLSFTVVFFLSIAPGSTFGAELAAIFAIFTSQAWNMAFSFYQSLRTVP
FT                   RDLDEASRSLRHTGWQRFWRLEVPFAMPGLVWNAMMSMSGGWFFVVASEAISVGDLRIA
FT                   LPGVGAYVARAIAERNLAAIGFAIAAMTIAIVLYDQLLFRPMVAWAHKFRCDQTVSGPA
FT                   PRSWLLDLLHRASLPQRVGAPLGAMLHRAARARLSLGVRLSARERSLSRRAGRVVWFSL
FT                   CAAGALYAGAALLRIAAPALSWSDVADVARNGALTLARVLVLIGIATAVWVPAGVLIGL
FT                   RPRATALVQPVAQFLAAFPANLLFPLAVFAIVRFRLAPAIWLSPLMILGTQWYILFNVI
FT                   AGASAFPDDLKEAAASLRVRTPTWWREIVLPGILPYYVTGAITASGGAWNASIVSELVG
FT                   WGPTTLDASGLGAYVARTTAAGDYPRIALGVAAMSLLVIAMNRLMWRPLYAFAERRSRL
FT                   D"
FT   gene            714884..716212
FT                   /locus_tag="BTH_I0623"
FT   CDS_pept        714884..716212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0623"
FT                   /product="Erythromycin esterase family"
FT                   /note="identified by match to protein family HMM PF05139"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38404"
FT                   /db_xref="GOA:Q2T0W9"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W9"
FT                   /protein_id="ABC38404.1"
FT                   /translation="MHPAKTPFLAVRDLARRLRGDAADFDALIDMADDADVVLLGESTH
FT                   GTDEFYRMRARITARLVDECGFDTIAIEGDWPDAWRVNRYVQGDAAIADADAALADFTR
FT                   FPAWMWRNRPMREFVGWLRERNATLPRQSRSGVYGLDLYSLYRCADAVIRYLDDVDPGQ
FT                   AELARQRYAALDHVREPSAYGYAVASGARPAATAGALEQLRQLREREAAYLAHDGIDAL
FT                   DVLDAQFFAEHNAQVVVNAEAYYRAMFGSRANTWNLRDAHMRDTLFALRRHRVRGGGAG
FT                   RAVVWAHNSHVGDARATEMHLRGEWTLGQLVREALGERALSIGFTAYTGHVSAASHWDG
FT                   DVEQKWMRPALPGSYEHLFHATGLDRFFLPLRETVAQPLGEALLERAIGVIYLPQTERG
FT                   SHYFVSSITGQFDALFHLDETSPLEPLAPPGAWHPREEPVSAP"
FT   gene            716238..716915
FT                   /locus_tag="BTH_I0624"
FT   CDS_pept        716238..716915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37492"
FT                   /db_xref="GOA:Q2T0W8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W8"
FT                   /protein_id="ABC37492.1"
FT                   /translation="MQIQEVRIPIGKVELNGLLAVPERASGIVVFAHGSGSSRLSPRNQ
FT                   EVAAVLQRAGLATLLFDLLTIEEQRRDAVTAEYRFAIAFLARRLVSALDWLRERPDVGG
FT                   LPVGLFGASTGAAAALIAANARGRAVRAVVSRGGRPDLAGDALPRVRVPTLLIVGERDD
FT                   EVLRLNRVAAGWLIGESKLVVVPGATHLFEEPGTLDEVARVAADWFVAHLGDGRRPPEG
FT                   TRR"
FT   gene            716912..718273
FT                   /locus_tag="BTH_I0625"
FT   CDS_pept        716912..718273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0625"
FT                   /product="nicotinate phosphoribosyltransferase, putative"
FT                   /EC_number="6.3.4.21"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37474"
FT                   /db_xref="GOA:Q2T0W7"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W7"
FT                   /protein_id="ABC37474.1"
FT                   /translation="MTKPVRDGALLADLYEFTMLQSYFDCGMNDTATFELFVRKLPAHR
FT                   NFLMAAGLEQALDYLAALALEPDEIEALASTGLFSDGFLASLESLRFTGSVRAMREGTV
FT                   FFADEPILQVTAPMREAQLIESRVMNLLHYESIVASKAARAVLAAPGRTLVDFGLRRAH
FT                   GAEAALLSARASYVAGFAGTATLLAGLRYGIPTYGTMAHSYVQAHDDESLAFEHFARSF
FT                   PRNAMLLVDTYDTEAAVGKVIDVARKLAREGVEVKGVRLDSGDLAQHAMRVRAMFDRAG
FT                   LDRVTIFASGNLDEYRLAELIGKGAPIDGFGVGTRMNTSADAPYADCAYKLTEYAGVPR
FT                   RKRSEGKATWPGRKQVYRRYRDDGLLDGDCLALHDDVRPGVALLAPVMIAGERVAPSPS
FT                   LADVRAHARAQLDALPAALRDLARAAEYPVAVTGTLTALAQRLDSPAAGDASRA"
FT   gene            718400..719098
FT                   /locus_tag="BTH_I0626"
FT   CDS_pept        718400..719098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0626"
FT                   /product="phosphoribosyl transferase domain protein"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36568"
FT                   /db_xref="GOA:Q2T0W6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W6"
FT                   /protein_id="ABC36568.1"
FT                   /translation="MDDYFRDRVDAGRQLAAHLADYAHRDDVVVLALPRGGVPVAFEVA
FT                   KALRAPLDVLIVRKLGAPGNPELAMGAIAAGGIVLLEQSVLHAMRVTDRELADTIERER
FT                   GELARREAAYRDGRAPPAVEGRTVIVVDDGIATGSTMLAALEAVRARKPAKLVAAVPVA
FT                   SPSSAQKVKAAADAIVCVMRPDWLMGIGQFYRNFDQTSDDEVCALLERAREWAQAGGKN
FT                   APPAQAGAED"
FT   gene            complement(719153..722245)
FT                   /locus_tag="BTH_I0627"
FT   CDS_pept        complement(719153..722245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38761"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W5"
FT                   /protein_id="ABC38761.1"
FT                   /translation="MNRPLIRIPFRPTGTQSFWKGFKWSLIVIVVIALAIVARLVQIEI
FT                   ETSRLQARFLSELTRDVGYSVDEGASTRIRFPDSGPYDLRLGYALLPSFQARLLSRGFV
FT                   VESQARVSDRMLSLADEHLFLPYDEKDQAGLSIVDSSGSPLFDVRYPHHAYGGFETIPP
FT                   LVVQSLLFIEDRYLLDPNQPNRNPAIDWGRFSRALVDQGLRYVNRHQATPGGSTLATQL
FT                   EKFRHSPDGRTATPPEKLRQIASASVRAYLNGPQTMAARREIVVHYLNSVPLAARARVG
FT                   EVTGIGDGLTAWYGRDFDEVNRLLAAPTTPENVAAQGVAFRQVLSLMIAQRAPSFFLNR
FT                   GYPMLLRLTDSYLRLLATGGVITPALRDAALAAHIERSPAPAAADARSFVARKAVTSSR
FT                   SHLLAALGIDNVYQLDRLDLRATDTLNNKVQQAVAAGLARAATPDGAREAGLYGFEMLR
FT                   SGDDPSKIQYSFTLYERRDGANLLRVQTDSVDQPFDINQGARLNLGSTAKLRTIVTYLQ
FT                   IVSELHARYANLSAAELARVKPDPTDALTRWALDYLAHTRDRSLQPMLAAAVERKYSAS
FT                   PGETFYTGGGAQSFTNFDKSDNGKILTVHVAFQNSVNLVFVRLMRDIVHYEMIRTSGPS
FT                   SSWLDDPALRQRYLLRFVDSESRVYVKRFYTQYAGKPGDDALAAMLGNVRKSPPRVATV
FT                   LRSVAPEQPRAWFDAKMRATLRGTPAAAKLSDDALDKLYTKYAIERFNLNDRGYIAGVH
FT                   PLALWTLAYLRKHPDASLDDVQKASRDARIASYSWLFKTRYHATQDRRIRHMVELRAYD
FT                   AIGASWRALGYPFEHLTPSYAAAIGASGDQPDALAKLVGLIANGGAKVPNERISSLDFA
FT                   HGTPYETRFVRAAVQPQPLLSPEIANQVHVLLGDVVQKGTGRRLAQGMTFPDGTTLPVY
FT                   GKTGTGDQRFNVYARGARLIESRKVNRSATFAFSLGDRFFGVLTAYAHEPYAARYDFTS
FT                   AMAVQLLKSLAPALQPLMIAPGAPGANTDTNGASAQAAANG"
FT   gene            complement(722822..724762)
FT                   /locus_tag="BTH_I0628"
FT   CDS_pept        complement(722822..724762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0628"
FT                   /product="Bacterial protein of unknown function (DUF879)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF05947"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37890"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W4"
FT                   /protein_id="ABC37890.1"
FT                   /translation="MPDMPPRTVARAMPPAAARTRSADDRAPHDRANRLPRDRLFPMND
FT                   LLPYYEREIAMLRHSMREFAIRHPKIATRFGIADGQTDDMHVERMLQSFALLGAQIGEA
FT                   LDDEYPEFTEALVETACPDYLRPFPACSIAQFDAASLFSQLTEGVTIGRGTMLESRIGA
FT                   NRFRTAYDVALAPVSIVDARFRPASAAPPAARMPPSSTGIVSITFDALTAKPTLAALRA
FT                   RGLRAHLHGDAPLVAALADTLAMRAPAAFIELDGDGRWKPLSKAPLAPVGFAAEDALLD
FT                   PPHGAPPFRLLMEYFAFPAKFDFVDIDVARIARAAGPCRRLSLHLPVVGVAPDSQQARA
FT                   LGTLAASNLRLFCTPIVNLFSQDAMPISLRDAAAAYPVVPQALKSNGIEVRSIDAVRIA
FT                   REGEPRANVDVTPYRSMLHGQHGRKEPVYWLAERDRFAHGAQPAALRLVDAGGAPVRPR
FT                   ADQLNVELSCTNGDYPQTLPIGDADGDLLNETDNLPGRITMLRKPTQTRRFARDHGALW
FT                   RMIAAMTPHALLLQPSGLGALKALLVQYATRSSSAMPQIDAIANLDHKVAVRWMAVKPM
FT                   PTFVRGIEVALTLNEAAFATCSLKAFIDVMDGFFALHAPPNGFIQLVAYARDTGRELHR
FT                   CEPRSAIAQLV"
FT   gene            complement(724793..724918)
FT                   /locus_tag="BTH_I0629"
FT   CDS_pept        complement(724793..724918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0629"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABC37902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W3"
FT                   /protein_id="ABC37902.1"
FT                   /translation="MTVTIFSFDGPRCFDTMRAVRILYRRAADYLGGDSAAPHAR"
FT   gene            725423..725572
FT                   /locus_tag="BTH_I0630"
FT   CDS_pept        725423..725572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0630"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABC36975"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W2"
FT                   /protein_id="ABC36975.1"
FT                   /translation="MTDAPPLPNIRGRVAQTIREAISRFETADAHEPSGARRRTCRRIA
FT                   ARRQ"
FT   gene            725619..728012
FT                   /locus_tag="BTH_I0631"
FT   CDS_pept        725619..728012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0631"
FT                   /product="penicillin amidase, putative"
FT                   /note="identified by match to protein family HMM PF01804"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38952"
FT                   /db_xref="GOA:Q2T0W1"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W1"
FT                   /protein_id="ABC38952.1"
FT                   /translation="MASTRNRMRRSLKILSALTLLGLLIAIAGAAAYLRASLPQLDGDV
FT                   RAPMLGAPMTAERDALGVPTITARDRFDAAYGIGYLHAQDRFFQMDMLRRSGAGELSEL
FT                   FGPVALDVDRDHRLYRFRALAAAVVAHLPPDDLLVLQRYAQGVNDGLAALRARPFEYAL
FT                   LRMRPRRWQPEDSLLVIWAMYFDLQGKLASRAFARRWLQAHSTPGQLAFLLPPSSRFDA
FT                   PLDAPGIAAPGAPVSATAPAWLRDARPAAPIDSVSIDAQSSVGSNNWALAGNRTASGAA
FT                   IVGNDMHLSLGLPNIWYRAMFKLGGGGAGPAVRVVGMTLPGLPVVVVGSNGRIAWGFTN
FT                   GYADCLELLPLERDARDPNRFKLGGAWQTARATVETIRVHGAAPVALTVLDTTAGPVLD
FT                   IGGKVYASHWIAQASGAANLSFAKMIDATGVGDALGVAAAAGLPAQNIVIGDSAGRIGW
FT                   TVAGALPDRRKRVEADAPGKGAPSWQAELPPDAHPRIVDPAGGQLWSANNRQLAGDAYR
FT                   LIGDGGADLGARARQLRDGLTALGRTDERAAYGLDLDDRALFMSLWRDRALRVLDEAAL
FT                   AGHPARAEFRRLLASGWTGRASVDSVGYTLVRGYLYRLYDVLFGSLDARLKQQRHDADY
FT                   ALANSRWPAVIARLLDEQPAAWLPADAASWRDVQLAAIDRTIEALTADGASLADATWGE
FT                   RNTLRIAHPFARSVPFVGRWLSAPADQVPGDANMPRVAAPKFGQSERIVVAPGREAQGR
FT                   FNMPGGQSGHPLSPFFLAGHRAWVKGEPLPLLPGPTEHTLRFVR"
FT   gene            728287..729261
FT                   /locus_tag="BTH_I0632"
FT   CDS_pept        728287..729261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0632"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38522"
FT                   /db_xref="GOA:Q2T0W0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0W0"
FT                   /protein_id="ABC38522.1"
FT                   /translation="MDRIQAMEVFTRVVEANSFTRAAETLGMPRASVTTIIQNLEALLG
FT                   ARLMHRTTRRLSLTPEGAAYYEHCIKIITEIAETDASFQVGKRKPSGALRVHMPSSLGR
FT                   RLVIPALPIFRQRYPDVVLDLGLSDRPVDPVEEGIDCMIRIGPLEDSSMVARRIGMLKR
FT                   VTCASPDYLKRFGEPMEIAELAAHHAVNFRASHGSRPVPWVFVIDGKPVEVRMEGGVTV
FT                   NDSDAYVTCGVEGFGMIQPTLFMVLPHLLDGTLKEVLPGLNPKPKPISIVYPNNRHLSA
FT                   KVRVFADWIAELFDSTPALEGGEDWRGGVAAREKPARRGQVAA"
FT   gene            complement(729378..731186)
FT                   /locus_tag="BTH_I0633"
FT   CDS_pept        complement(729378..731186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BTH_I0633"
FT                   /product="MmoS, putative"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BTH_I0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABC38722"
FT                   /db_xref="GOA:Q2T0V9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2T0V9"
FT                   /protein_id="ABC38722.1"
FT                   /translation="MSRVKWRNEKIIVALGSLWILGFAAWAFLLFDLLGTSVKEGILEG
FT                   PREGVFWTAAQYRNSFSRFERQLILYATRQDRDFDNVLLQLDSLEASFGFLERPSEVSA
FT                   YW