(data stored in ACNUC7421 zone)

EMBL: CP000089

ID   CP000089; SV 1; circular; genomic DNA; STD; PRO; 4501104 BP.
XX
AC   CP000089; AADF01000000-AADF01000022;
XX
PR   Project:PRJNA9635;
XX
DT   06-AUG-2005 (Rel. 84, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
XX
DE   Dechloromonas aromatica RCB, complete genome.
XX
KW   .
XX
OS   Dechloromonas aromatica RCB
OC   Bacteria; Proteobacteria; Betaproteobacteria; Rhodocyclales; Azonexaceae;
OC   Dechloromonas.
XX
RN   [1]
RP   1-4501104
RA   Salinero K.K., Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina T., Hammon N., Israni S., Pitluck S., Di Bartolo G., Trong S.,
RA   Schmutz J., Larimer F., Land M., Ivanova N., Richardson P.;
RT   "Complete sequence of Dechloromonas aromatica RCB";
RL   Unpublished.
XX
RN   [2]
RP   1-4501104
RA   Salinero K.K., Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina T., Hammon N., Israni S., Pitluck S., Di Bartolo G., Trong S.,
RA   Schmutz J., Larimer F., Land M., Ivanova N., Richardson P.;
RT   ;
RL   Submitted (04-AUG-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 05937c47ccb84ff919af2dc50e3662a9.
DR   BioSample; SAMN02598546.
DR   EnsemblGenomes-Gn; Daro_R0001.
DR   EnsemblGenomes-Gn; Daro_R0002.
DR   EnsemblGenomes-Gn; Daro_R0003.
DR   EnsemblGenomes-Gn; Daro_R0004.
DR   EnsemblGenomes-Gn; Daro_R0005.
DR   EnsemblGenomes-Gn; Daro_R0006.
DR   EnsemblGenomes-Gn; Daro_R0007.
DR   EnsemblGenomes-Gn; Daro_R0008.
DR   EnsemblGenomes-Gn; Daro_R0009.
DR   EnsemblGenomes-Gn; Daro_R0010.
DR   EnsemblGenomes-Gn; Daro_R0011.
DR   EnsemblGenomes-Gn; Daro_R0012.
DR   EnsemblGenomes-Gn; Daro_R0013.
DR   EnsemblGenomes-Gn; Daro_R0014.
DR   EnsemblGenomes-Gn; Daro_R0015.
DR   EnsemblGenomes-Gn; Daro_R0017.
DR   EnsemblGenomes-Gn; Daro_R0018.
DR   EnsemblGenomes-Gn; Daro_R0019.
DR   EnsemblGenomes-Gn; Daro_R0020.
DR   EnsemblGenomes-Gn; Daro_R0021.
DR   EnsemblGenomes-Gn; Daro_R0022.
DR   EnsemblGenomes-Gn; Daro_R0023.
DR   EnsemblGenomes-Gn; Daro_R0024.
DR   EnsemblGenomes-Gn; Daro_R0025.
DR   EnsemblGenomes-Gn; Daro_R0026.
DR   EnsemblGenomes-Gn; Daro_R0027.
DR   EnsemblGenomes-Gn; Daro_R0028.
DR   EnsemblGenomes-Gn; Daro_R0029.
DR   EnsemblGenomes-Gn; Daro_R0030.
DR   EnsemblGenomes-Gn; Daro_R0031.
DR   EnsemblGenomes-Gn; Daro_R0033.
DR   EnsemblGenomes-Gn; Daro_R0034.
DR   EnsemblGenomes-Gn; Daro_R0035.
DR   EnsemblGenomes-Gn; Daro_R0036.
DR   EnsemblGenomes-Gn; Daro_R0037.
DR   EnsemblGenomes-Gn; Daro_R0038.
DR   EnsemblGenomes-Gn; Daro_R0039.
DR   EnsemblGenomes-Gn; Daro_R0040.
DR   EnsemblGenomes-Gn; Daro_R0041.
DR   EnsemblGenomes-Gn; Daro_R0042.
DR   EnsemblGenomes-Gn; Daro_R0043.
DR   EnsemblGenomes-Gn; Daro_R0044.
DR   EnsemblGenomes-Gn; Daro_R0045.
DR   EnsemblGenomes-Gn; Daro_R0046.
DR   EnsemblGenomes-Gn; Daro_R0047.
DR   EnsemblGenomes-Gn; Daro_R0048.
DR   EnsemblGenomes-Gn; Daro_R0049.
DR   EnsemblGenomes-Gn; Daro_R0050.
DR   EnsemblGenomes-Gn; Daro_R0051.
DR   EnsemblGenomes-Gn; Daro_R0052.
DR   EnsemblGenomes-Gn; Daro_R0053.
DR   EnsemblGenomes-Gn; Daro_R0054.
DR   EnsemblGenomes-Gn; Daro_R0055.
DR   EnsemblGenomes-Gn; Daro_R0056.
DR   EnsemblGenomes-Gn; Daro_R0057.
DR   EnsemblGenomes-Gn; Daro_R0058.
DR   EnsemblGenomes-Gn; Daro_R0059.
DR   EnsemblGenomes-Gn; Daro_R0060.
DR   EnsemblGenomes-Gn; Daro_R0061.
DR   EnsemblGenomes-Gn; Daro_R0062.
DR   EnsemblGenomes-Gn; Daro_R0063.
DR   EnsemblGenomes-Gn; Daro_R0064.
DR   EnsemblGenomes-Gn; Daro_R0065.
DR   EnsemblGenomes-Gn; Daro_R0066.
DR   EnsemblGenomes-Gn; Daro_R0067.
DR   EnsemblGenomes-Gn; Daro_R0068.
DR   EnsemblGenomes-Gn; Daro_R0069.
DR   EnsemblGenomes-Gn; Daro_R0070.
DR   EnsemblGenomes-Gn; Daro_R0071.
DR   EnsemblGenomes-Gn; Daro_R0072.
DR   EnsemblGenomes-Gn; Daro_R0073.
DR   EnsemblGenomes-Gn; Daro_R0074.
DR   EnsemblGenomes-Gn; Daro_R0075.
DR   EnsemblGenomes-Gn; Daro_R0076.
DR   EnsemblGenomes-Gn; Daro_R0077.
DR   EnsemblGenomes-Gn; Daro_R0078.
DR   EnsemblGenomes-Gn; Daro_R0079.
DR   EnsemblGenomes-Gn; EBG00001027112.
DR   EnsemblGenomes-Gn; EBG00001027115.
DR   EnsemblGenomes-Gn; EBG00001027119.
DR   EnsemblGenomes-Gn; EBG00001027121.
DR   EnsemblGenomes-Gn; EBG00001027124.
DR   EnsemblGenomes-Gn; EBG00001027127.
DR   EnsemblGenomes-Gn; EBG00001027131.
DR   EnsemblGenomes-Gn; EBG00001027134.
DR   EnsemblGenomes-Gn; EBG00001027139.
DR   EnsemblGenomes-Gn; EBG00001027142.
DR   EnsemblGenomes-Gn; EBG00001027145.
DR   EnsemblGenomes-Gn; EBG00001027148.
DR   EnsemblGenomes-Gn; EBG00001027150.
DR   EnsemblGenomes-Gn; EBG00001027153.
DR   EnsemblGenomes-Gn; EBG00001027156.
DR   EnsemblGenomes-Gn; EBG00001027159.
DR   EnsemblGenomes-Gn; EBG00001027162.
DR   EnsemblGenomes-Gn; EBG00001027165.
DR   EnsemblGenomes-Gn; EBG00001027168.
DR   EnsemblGenomes-Gn; EBG00001027171.
DR   EnsemblGenomes-Gn; EBG00001027173.
DR   EnsemblGenomes-Gn; EBG00001027176.
DR   EnsemblGenomes-Gn; EBG00001027179.
DR   EnsemblGenomes-Gn; EBG00001027182.
DR   EnsemblGenomes-Gn; EBG00001027185.
DR   EnsemblGenomes-Gn; EBG00001027188.
DR   EnsemblGenomes-Gn; EBG00001027191.
DR   EnsemblGenomes-Gn; EBG00001027194.
DR   EnsemblGenomes-Gn; EBG00001027197.
DR   EnsemblGenomes-Gn; EBG00001027200.
DR   EnsemblGenomes-Gn; EBG00001027203.
DR   EnsemblGenomes-Gn; EBG00001027206.
DR   EnsemblGenomes-Gn; EBG00001027209.
DR   EnsemblGenomes-Gn; EBG00001027212.
DR   EnsemblGenomes-Gn; EBG00001027215.
DR   EnsemblGenomes-Gn; EBG00001027218.
DR   EnsemblGenomes-Gn; EBG00001027221.
DR   EnsemblGenomes-Gn; EBG00001027224.
DR   EnsemblGenomes-Gn; EBG00001027227.
DR   EnsemblGenomes-Gn; EBG00001027230.
DR   EnsemblGenomes-Gn; EBG00001027233.
DR   EnsemblGenomes-Gn; EBG00001027236.
DR   EnsemblGenomes-Gn; EBG00001027239.
DR   EnsemblGenomes-Gn; EBG00001027242.
DR   EnsemblGenomes-Gn; EBG00001027244.
DR   EnsemblGenomes-Gn; EBG00001027247.
DR   EnsemblGenomes-Gn; EBG00001027250.
DR   EnsemblGenomes-Gn; EBG00001027253.
DR   EnsemblGenomes-Gn; EBG00001027256.
DR   EnsemblGenomes-Gn; EBG00001027259.
DR   EnsemblGenomes-Gn; EBG00001027263.
DR   EnsemblGenomes-Gn; EBG00001027265.
DR   EnsemblGenomes-Gn; EBG00001027268.
DR   EnsemblGenomes-Gn; EBG00001027272.
DR   EnsemblGenomes-Gn; EBG00001027275.
DR   EnsemblGenomes-Gn; EBG00001027280.
DR   EnsemblGenomes-Gn; EBG00001027283.
DR   EnsemblGenomes-Gn; EBG00001027288.
DR   EnsemblGenomes-Gn; EBG00001027290.
DR   EnsemblGenomes-Gn; EBG00001027292.
DR   EnsemblGenomes-Gn; EBG00001027295.
DR   EnsemblGenomes-Gn; EBG00001027298.
DR   EnsemblGenomes-Gn; EBG00001027301.
DR   EnsemblGenomes-Gn; EBG00001027305.
DR   EnsemblGenomes-Gn; EBG00001027308.
DR   EnsemblGenomes-Gn; EBG00001027311.
DR   EnsemblGenomes-Gn; EBG00001027314.
DR   EnsemblGenomes-Gn; EBG00001027317.
DR   EnsemblGenomes-Gn; EBG00001027320.
DR   EnsemblGenomes-Gn; EBG00001027323.
DR   EnsemblGenomes-Gn; EBG00001027326.
DR   EnsemblGenomes-Gn; EBG00001027329.
DR   EnsemblGenomes-Gn; EBG00001027333.
DR   EnsemblGenomes-Gn; EBG00001027336.
DR   EnsemblGenomes-Gn; EBG00001027339.
DR   EnsemblGenomes-Gn; EBG00001027341.
DR   EnsemblGenomes-Gn; EBG00001027343.
DR   EnsemblGenomes-Gn; EBG00001027346.
DR   EnsemblGenomes-Gn; EBG00001027350.
DR   EnsemblGenomes-Gn; EBG00001027353.
DR   EnsemblGenomes-Gn; EBG00001027356.
DR   EnsemblGenomes-Gn; EBG00001027361.
DR   EnsemblGenomes-Gn; EBG00001027363.
DR   EnsemblGenomes-Gn; EBG00001027366.
DR   EnsemblGenomes-Gn; EBG00001027369.
DR   EnsemblGenomes-Gn; EBG00001027372.
DR   EnsemblGenomes-Gn; EBG00001027375.
DR   EnsemblGenomes-Gn; EBG00001027378.
DR   EnsemblGenomes-Gn; EBG00001027381.
DR   EnsemblGenomes-Gn; EBG00001027383.
DR   EnsemblGenomes-Gn; EBG00001027386.
DR   EnsemblGenomes-Gn; EBG00001027388.
DR   EnsemblGenomes-Gn; EBG00001027391.
DR   EnsemblGenomes-Tr; Daro_R0001-1.
DR   EnsemblGenomes-Tr; Daro_R0002-1.
DR   EnsemblGenomes-Tr; Daro_R0003-1.
DR   EnsemblGenomes-Tr; Daro_R0004-1.
DR   EnsemblGenomes-Tr; Daro_R0005-1.
DR   EnsemblGenomes-Tr; Daro_R0006-1.
DR   EnsemblGenomes-Tr; Daro_R0007-1.
DR   EnsemblGenomes-Tr; Daro_R0008-1.
DR   EnsemblGenomes-Tr; Daro_R0009-1.
DR   EnsemblGenomes-Tr; Daro_R0010-1.
DR   EnsemblGenomes-Tr; Daro_R0011-1.
DR   EnsemblGenomes-Tr; Daro_R0012-1.
DR   EnsemblGenomes-Tr; Daro_R0013-1.
DR   EnsemblGenomes-Tr; Daro_R0014-1.
DR   EnsemblGenomes-Tr; Daro_R0015-1.
DR   EnsemblGenomes-Tr; Daro_R0017-1.
DR   EnsemblGenomes-Tr; Daro_R0018-1.
DR   EnsemblGenomes-Tr; Daro_R0019-1.
DR   EnsemblGenomes-Tr; Daro_R0020-1.
DR   EnsemblGenomes-Tr; Daro_R0021-1.
DR   EnsemblGenomes-Tr; Daro_R0022-1.
DR   EnsemblGenomes-Tr; Daro_R0023-1.
DR   EnsemblGenomes-Tr; Daro_R0024-1.
DR   EnsemblGenomes-Tr; Daro_R0025-1.
DR   EnsemblGenomes-Tr; Daro_R0026-1.
DR   EnsemblGenomes-Tr; Daro_R0027-1.
DR   EnsemblGenomes-Tr; Daro_R0028-1.
DR   EnsemblGenomes-Tr; Daro_R0029-1.
DR   EnsemblGenomes-Tr; Daro_R0030-1.
DR   EnsemblGenomes-Tr; Daro_R0031-1.
DR   EnsemblGenomes-Tr; Daro_R0033-1.
DR   EnsemblGenomes-Tr; Daro_R0034-1.
DR   EnsemblGenomes-Tr; Daro_R0035-1.
DR   EnsemblGenomes-Tr; Daro_R0036-1.
DR   EnsemblGenomes-Tr; Daro_R0037-1.
DR   EnsemblGenomes-Tr; Daro_R0038-1.
DR   EnsemblGenomes-Tr; Daro_R0039-1.
DR   EnsemblGenomes-Tr; Daro_R0040-1.
DR   EnsemblGenomes-Tr; Daro_R0041-1.
DR   EnsemblGenomes-Tr; Daro_R0042-1.
DR   EnsemblGenomes-Tr; Daro_R0043-1.
DR   EnsemblGenomes-Tr; Daro_R0044-1.
DR   EnsemblGenomes-Tr; Daro_R0045-1.
DR   EnsemblGenomes-Tr; Daro_R0046-1.
DR   EnsemblGenomes-Tr; Daro_R0047-1.
DR   EnsemblGenomes-Tr; Daro_R0048-1.
DR   EnsemblGenomes-Tr; Daro_R0049-1.
DR   EnsemblGenomes-Tr; Daro_R0050-1.
DR   EnsemblGenomes-Tr; Daro_R0051-1.
DR   EnsemblGenomes-Tr; Daro_R0052-1.
DR   EnsemblGenomes-Tr; Daro_R0053-1.
DR   EnsemblGenomes-Tr; Daro_R0054-1.
DR   EnsemblGenomes-Tr; Daro_R0055-1.
DR   EnsemblGenomes-Tr; Daro_R0056-1.
DR   EnsemblGenomes-Tr; Daro_R0057-1.
DR   EnsemblGenomes-Tr; Daro_R0058-1.
DR   EnsemblGenomes-Tr; Daro_R0059-1.
DR   EnsemblGenomes-Tr; Daro_R0060-1.
DR   EnsemblGenomes-Tr; Daro_R0061-1.
DR   EnsemblGenomes-Tr; Daro_R0062-1.
DR   EnsemblGenomes-Tr; Daro_R0063-1.
DR   EnsemblGenomes-Tr; Daro_R0064-1.
DR   EnsemblGenomes-Tr; Daro_R0065-1.
DR   EnsemblGenomes-Tr; Daro_R0066-1.
DR   EnsemblGenomes-Tr; Daro_R0067-1.
DR   EnsemblGenomes-Tr; Daro_R0068-1.
DR   EnsemblGenomes-Tr; Daro_R0069-1.
DR   EnsemblGenomes-Tr; Daro_R0070-1.
DR   EnsemblGenomes-Tr; Daro_R0071-1.
DR   EnsemblGenomes-Tr; Daro_R0072-1.
DR   EnsemblGenomes-Tr; Daro_R0073-1.
DR   EnsemblGenomes-Tr; Daro_R0074-1.
DR   EnsemblGenomes-Tr; Daro_R0075-1.
DR   EnsemblGenomes-Tr; Daro_R0076-1.
DR   EnsemblGenomes-Tr; Daro_R0077-1.
DR   EnsemblGenomes-Tr; Daro_R0078-1.
DR   EnsemblGenomes-Tr; Daro_R0079-1.
DR   EnsemblGenomes-Tr; EBT00001630371.
DR   EnsemblGenomes-Tr; EBT00001630372.
DR   EnsemblGenomes-Tr; EBT00001630373.
DR   EnsemblGenomes-Tr; EBT00001630374.
DR   EnsemblGenomes-Tr; EBT00001630375.
DR   EnsemblGenomes-Tr; EBT00001630376.
DR   EnsemblGenomes-Tr; EBT00001630377.
DR   EnsemblGenomes-Tr; EBT00001630378.
DR   EnsemblGenomes-Tr; EBT00001630379.
DR   EnsemblGenomes-Tr; EBT00001630380.
DR   EnsemblGenomes-Tr; EBT00001630381.
DR   EnsemblGenomes-Tr; EBT00001630382.
DR   EnsemblGenomes-Tr; EBT00001630383.
DR   EnsemblGenomes-Tr; EBT00001630384.
DR   EnsemblGenomes-Tr; EBT00001630385.
DR   EnsemblGenomes-Tr; EBT00001630386.
DR   EnsemblGenomes-Tr; EBT00001630387.
DR   EnsemblGenomes-Tr; EBT00001630388.
DR   EnsemblGenomes-Tr; EBT00001630389.
DR   EnsemblGenomes-Tr; EBT00001630390.
DR   EnsemblGenomes-Tr; EBT00001630391.
DR   EnsemblGenomes-Tr; EBT00001630392.
DR   EnsemblGenomes-Tr; EBT00001630393.
DR   EnsemblGenomes-Tr; EBT00001630394.
DR   EnsemblGenomes-Tr; EBT00001630395.
DR   EnsemblGenomes-Tr; EBT00001630396.
DR   EnsemblGenomes-Tr; EBT00001630397.
DR   EnsemblGenomes-Tr; EBT00001630398.
DR   EnsemblGenomes-Tr; EBT00001630399.
DR   EnsemblGenomes-Tr; EBT00001630400.
DR   EnsemblGenomes-Tr; EBT00001630401.
DR   EnsemblGenomes-Tr; EBT00001630402.
DR   EnsemblGenomes-Tr; EBT00001630403.
DR   EnsemblGenomes-Tr; EBT00001630404.
DR   EnsemblGenomes-Tr; EBT00001630405.
DR   EnsemblGenomes-Tr; EBT00001630406.
DR   EnsemblGenomes-Tr; EBT00001630407.
DR   EnsemblGenomes-Tr; EBT00001630408.
DR   EnsemblGenomes-Tr; EBT00001630409.
DR   EnsemblGenomes-Tr; EBT00001630410.
DR   EnsemblGenomes-Tr; EBT00001630411.
DR   EnsemblGenomes-Tr; EBT00001630412.
DR   EnsemblGenomes-Tr; EBT00001630413.
DR   EnsemblGenomes-Tr; EBT00001630414.
DR   EnsemblGenomes-Tr; EBT00001630415.
DR   EnsemblGenomes-Tr; EBT00001630416.
DR   EnsemblGenomes-Tr; EBT00001630417.
DR   EnsemblGenomes-Tr; EBT00001630418.
DR   EnsemblGenomes-Tr; EBT00001630419.
DR   EnsemblGenomes-Tr; EBT00001630420.
DR   EnsemblGenomes-Tr; EBT00001630421.
DR   EnsemblGenomes-Tr; EBT00001630422.
DR   EnsemblGenomes-Tr; EBT00001630423.
DR   EnsemblGenomes-Tr; EBT00001630424.
DR   EnsemblGenomes-Tr; EBT00001630425.
DR   EnsemblGenomes-Tr; EBT00001630426.
DR   EnsemblGenomes-Tr; EBT00001630427.
DR   EnsemblGenomes-Tr; EBT00001630428.
DR   EnsemblGenomes-Tr; EBT00001630429.
DR   EnsemblGenomes-Tr; EBT00001630430.
DR   EnsemblGenomes-Tr; EBT00001630431.
DR   EnsemblGenomes-Tr; EBT00001630432.
DR   EnsemblGenomes-Tr; EBT00001630433.
DR   EnsemblGenomes-Tr; EBT00001630434.
DR   EnsemblGenomes-Tr; EBT00001630435.
DR   EnsemblGenomes-Tr; EBT00001630436.
DR   EnsemblGenomes-Tr; EBT00001630437.
DR   EnsemblGenomes-Tr; EBT00001630438.
DR   EnsemblGenomes-Tr; EBT00001630439.
DR   EnsemblGenomes-Tr; EBT00001630440.
DR   EnsemblGenomes-Tr; EBT00001630441.
DR   EnsemblGenomes-Tr; EBT00001630442.
DR   EnsemblGenomes-Tr; EBT00001630443.
DR   EnsemblGenomes-Tr; EBT00001630444.
DR   EnsemblGenomes-Tr; EBT00001630445.
DR   EnsemblGenomes-Tr; EBT00001630446.
DR   EnsemblGenomes-Tr; EBT00001630447.
DR   EnsemblGenomes-Tr; EBT00001630448.
DR   EnsemblGenomes-Tr; EBT00001630449.
DR   EnsemblGenomes-Tr; EBT00001630450.
DR   EnsemblGenomes-Tr; EBT00001630451.
DR   EnsemblGenomes-Tr; EBT00001630452.
DR   EnsemblGenomes-Tr; EBT00001630453.
DR   EnsemblGenomes-Tr; EBT00001630454.
DR   EnsemblGenomes-Tr; EBT00001630455.
DR   EnsemblGenomes-Tr; EBT00001630456.
DR   EnsemblGenomes-Tr; EBT00001630457.
DR   EnsemblGenomes-Tr; EBT00001630458.
DR   EnsemblGenomes-Tr; EBT00001630459.
DR   EnsemblGenomes-Tr; EBT00001630460.
DR   EnsemblGenomes-Tr; EBT00001630461.
DR   EnsemblGenomes-Tr; EBT00001630462.
DR   EnsemblGenomes-Tr; EBT00001630463.
DR   EuropePMC; PMC2620714; 19011059.
DR   EuropePMC; PMC3081540; 21333531.
DR   EuropePMC; PMC3132874; 21750120.
DR   EuropePMC; PMC3692508; 23825601.
DR   EuropePMC; PMC3753938; 23811518.
DR   EuropePMC; PMC4907195; 27084012.
DR   EuropePMC; PMC6593283; 31275250.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02243; Xoo8.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000089.
DR   SILVA-SSU; CP000089.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from John Coates
CC   (jcoates@micro.siu.edu)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-PGF
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4501104
FT                   /organism="Dechloromonas aromatica RCB"
FT                   /strain="RCB"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:159087"
FT   gene            151..1548
FT                   /locus_tag="Daro_0001"
FT   CDS_pept        151..1548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0001"
FT                   /product="chromosomal replication initiator protein, DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44760"
FT                   /db_xref="GOA:Q47K71"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47K71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44760.1"
FT                   /translation="MSGFWESCLQRFEQELPAQQFNTWIKPLRLEGESTALEDGLRLIA
FT                   PNGFILKWVRDRYLTRIEDYSRTFFEGPVTIALVIGSGKATAARIQATTTDSGQNAPAN
FT                   PATTSEKRTAASEKARGKGSNYEKSRLFPSFTFDNLVVGKANDLARAAAVQVANNPGGA
FT                   YNPLFIYGGAGLGKTHLIHAIGNTIATENPEKIVRYVHAEDYYSDVVRAYQQKSFDSFK
FT                   RTYRSLDVLLLDDVQFFNGKNRSQEEFFFLFNALIEARKQIIITCDTYPKDINGLDDRL
FT                   VTRFDWGLTVQIEPPELEMRVAILKKKAEAEGIQLDDEVAFFIAKHLRSNVRELEGALK
FT                   KVLAYSSFHGRVIALDLAKEALKDVIGSVRNVGMDNIQKTVADYYKIKVAELFSKKRTR
FT                   AIARPRQVAMWLCREVTSHSFPEIGDAFGGRDHTTVIHAVKTIDSLRIKENELNHDLHV
FT                   LLQVLKG"
FT   gene            1758..2864
FT                   /locus_tag="Daro_0002"
FT   CDS_pept        1758..2864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44761"
FT                   /db_xref="GOA:Q47K70"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44761.1"
FT                   /translation="MILIKTQRDTLLAPLQSVSGIVERRHTLPILSNVLLEKKGDRLTL
FT                   LATDIEIQITTSTECAGGEGDGAVTVGARKMQEILRSLPDTSEVSLVLEDKRLQVRAGK
FT                   SRFSLQTLPADDFPRMTMSEGETKQFSISQKAFRQLISKTQYSMAAQDVRYYLNGLLLL
FT                   VEGKELRAVATDGHRLAYASVEIDTDLPRQEMILPRKTVLELNRLLVDTDDLLNITLTP
FT                   NQVRFSFGSVVLVSKLIDGKFPDYERVVPATLKNHMKVGRQTLMQAMQRAAILTNEKFR
FT                   GVRVVLGDNSLKLIAANAEQEEAVEEIEVDYTGDVIDVGFNVGYLLDVLNNIHADEIQW
FT                   SFNDANSSALITLPGNDRFKYVVMPMRI"
FT   gene            2938..5442
FT                   /locus_tag="Daro_0003"
FT   CDS_pept        2938..5442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44762"
FT                   /db_xref="GOA:Q47K69"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44762.1"
FT                   /translation="MSEENTPMSSPQDAGSPAYGESSIQILEGLEAVRKRPGMYIGDTS
FT                   DGTGLHHLVFEVVDNSIDEALAGHCNDIIVTIHTDNSISVIDNGRGIPTGVKMDDKHEP
FT                   KRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSKFLRLTIRRDGKKHFMEF
FT                   CRGVPVDRSIEVRNGLEVSPMKILGDTEKRGTEVHFLADEEIFGHVEFHYEILAKRLRE
FT                   LSFLNNGVSIKLVDQRTGKEELFAFAGGVQSFVEYINRTKSVLHPSIFYSAGEAKVGQG
FT                   AADTGIIIGVEVAMQWNDSYQEQVLCFTNNIPQSDGGTHLTGLRAAMTRVINKYIDENE
FT                   IAKKAKVDIAGDDMREGLACVLSVKMPDPKFASQTKMKLVSSEARAAVEEVVAQKLADF
FT                   LLERPVDAKMICGKIVEASRAREAARRAREMTRRKGVLDGVGLPGKLADCQEKDPALCE
FT                   IYIVEGDSAGGSAKQGRDRKFQAILPLRGKVLNVEKARFDKLISSEQIVTLITALGTGI
FT                   GKDDFNVEKLRYHRIIIMTDADVDGAHIRTLLLTLLYRQMPELIDRGYVYIAQPPLYKV
FT                   KHGKTERYLKDDQEYHQFLLNMALDEAVLTPRADAEGITGPALEGLARSWLATEAVIDR
FT                   LSHLINPEVLQSIVRHNIAIDLSSEENARASAERIAGFIPAGTRMVPKFDDIQERWILR
FT                   VERMHHGNLKVGLIDEDLLLSGDFTQLRRTAETLADMFGAGATMARGEKKQVVTNFADA
FT                   MKWLLNEVERGIAKQRYKGLGEMNPEQLWETTMDPKVRRLLRVQIDDAIAADEIFTTLM
FT                   GEDVEPRRAFIETNALSARVDI"
FT   gene            5514..5963
FT                   /locus_tag="Daro_0004"
FT   CDS_pept        5514..5963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0004"
FT                   /product="Histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44763"
FT                   /db_xref="GOA:Q47K68"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44763.1"
FT                   /translation="MPKFVDTSPPGQCIFCRLIAGEIPAAKVYEDEQTLAFMDLGQVNP
FT                   GHTLVTVKRHAATLLDLTPDEAAAAMRTAQRVAQAVKDSFDPPGLTLLQANGKEGDQTV
FT                   FHFHLHVVPRHGDDGIALSWPRKDPSRETLEGYALRLRQAMLTVG"
FT   gene            5976..6428
FT                   /locus_tag="Daro_0005"
FT   CDS_pept        5976..6428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0005"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44764"
FT                   /db_xref="GOA:Q47K67"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47K67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44764.1"
FT                   /translation="MRVVVQRVRAASVAVDGDIVGKIGTGLLVLAGFEEADSETDLDWM
FT                   AGKIVRLRLFADESGVMNRNVLDAGGEVLAVSQFTLYASVKKGNRPSWSRAARGEVSQP
FT                   LFERFVTKLSATLGKAVPTGVFGADMQVSLINDGPVTLTIDSKVPE"
FT   gene            complement(6432..7247)
FT                   /locus_tag="Daro_0006"
FT   CDS_pept        complement(6432..7247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0006"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44765"
FT                   /db_xref="GOA:Q47K66"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44765.1"
FT                   /translation="MTDPALEQAVAWLRAADALLVTAGAGMGIDSGLPDFRGPGGFWSV
FT                   YPALGRARIAFESIANPAAFECDPRLAWGFYGHRLDLYRHTTPHAGFRMLLDMAQGMQH
FT                   GIRAFTSNVDGQFQKASFAADQVCEIHGSIHHLQCTTACRERIWPANDFRPEVDAENCR
FT                   LLGDLPICPHCGALARPNILMFNDWGWLERRTTSQYQGLRQWLTTVERLVCIEIGAGTN
FT                   IPTVRHFSEDCGGKLIRINPGEPDVPNPAAGIGLALGGLAGLTLLSQAL"
FT   gene            complement(7338..8477)
FT                   /locus_tag="Daro_0007"
FT   CDS_pept        complement(7338..8477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0007"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44766"
FT                   /db_xref="GOA:Q47K65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44766.1"
FT                   /translation="MSPLLPKQSILVVDDSPENIDLLSEVLRDEYRIRVATSGEKALKI
FT                   VYSDEPPDLILLDIMMPGLSGLEICRRLKANPDRRRIPVIFVTAMSSMDDEKRGLETGA
FT                   VDYITKPISPPIVKARVRTHLALYDQSRELEHMVQQRTHELLTTRQQIIRRLGRAAEFK
FT                   DNETGNHVLRMSHYARLIAHAHGLGEEASNVIFNTAPMHDIGKIGIPDSILLKPAKLDA
FT                   EEWKVMYQHPIMGAEIIGKHDNELLETARIIALTHHEKWDGTGYPQGLKGEAIPLEGRI
FT                   VAIADVFDALVSVRPYKAAVPLNEAMQYLESQSGLHFDPSLMDAFRKALPEILRIKEIY
FT                   ADENGALTDLEFHIKEIYDHKDDPQGYPENLASTNGGFE"
FT   gene            complement(8504..12823)
FT                   /locus_tag="Daro_0008"
FT   CDS_pept        complement(8504..12823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0008"
FT                   /product="PAS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44767"
FT                   /db_xref="GOA:Q47K64"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44767.1"
FT                   /translation="MPRGISFRKPGFASSLVLRIGLLILLSLAAFTISLYYLIGRPTVD
FT                   RLAETQMLLAAEQLEARYTRLLKTVEITLRSSQGWGKNSDIDQTRLLHFNEFFFPIIAN
FT                   HGEITSVIFAHESGREILLLMTDDGRWINRISNPADWGNQTYWITWDKNRQIESVEMRE
FT                   RNYDARERPWFKGAMGLPDEQSVFWTEPYIFFTTKEPGITAAMRWQAEDGSSYVIGHDV
FT                   RLIDIAEFTTRMTVGSHGKAGLFLKEGKLIAPPRDPRFADRNAINQALLKTSEELELPE
FT                   FAEAFRLWQMDPHPLKRLHSFDRPDGRWISFFQPISGNTSGISLGVVAPESDFVPISSQ
FT                   DLILLGLITLSALALGMAVAIRIANRFGEPLIALAEDSSQIGSMNLDKPVTTDAPWREV
FT                   IQLAAALEEMRQHLQSSRRTLEDTNIELELKVAKRTLALRQNQEILQKREAFFRAIFDN
FT                   AAVGIISLDPERKPVLVNPAFAKFIDQPINTLLSHLENIALPKEVLGRINDLLGQTGSA
FT                   QQQSLRNEFEFIDKNGDTHWGDVQIAAVRDENGELDSLLITVLDVSDRREIEAELIRQF
FT                   SFLQALLDTIPNPIFYKGANTHFLGCNQAYEAFFGINRREFVGKRVVDLEYLPEDTRQA
FT                   YQTEDEQVIEAGSRISREVSLPGADGKLHDVLYSVSGFHSPDGRPDGLIGVIVDITALK
FT                   EAEREADRARATAESAAAAKADFLANMSHEIRTPMNAIIGMTHLALQTELNSRQKNYLT
FT                   KVDNAAKGLLGIINDILDLSKIEAGMMHFEHAPFSLDASLERLSDMCSLKARERGLELL
FT                   YDIAPEVPDQLIGDSLRLGQVLLNLVGNAIKFTEAGEITVTVKLLANRENEVDLGFEVI
FT                   DTGIGMNVEQQSQLFSAFTQADTSTTRKYGGTGLGLSICKRIVELQGGSIGVSSQPGIG
FT                   SRFTFQLQFGRATEQTGTPRRIGLPNNLRALIVDDSHGACEVFLHMLTVFGIDCHAVRS
FT                   APAALLELAAAAETGQAYGLLIIDWKMPDMDGVELVEKISQSNGPERTAAIVMATAYDH
FT                   EELLAALGKHPVGAILSKPATPSSLFDSIMVALHREPTTQMVPNITPTMLSEQFAGRHI
FT                   LLVEDNEVNRELAEEMLGNIGLLVDTAENGQQAIDRIRQNAYDLVLMDCHMPVMDGYTA
FT                   TEYIRHELKLPQLPIIAMTANALHSDREHCLAVGMDDHIPKPIDVAVLHATLLRWLSQA
FT                   GERTSPSPLPAASRDLTLPAGEIDTATALARLGGNRSLYDRLLLRFQENQGSAIECLAA
FT                   DRTRGDSAAMILRAHTLRGLAGNIGATGLSRLAGDLEERLKQNASVKEAGIENLLGSLA
FT                   ENLPKVLAAAEKLRQETPQITPAPLQEAQQGTLSELQHLLDNDDAAAVRYFEQISAWLK
FT                   QEFEPRLVDQLARQINQYEFDVAMETLQQMTINRQQV"
FT   sig_peptide     complement(12725..12823)
FT                   /locus_tag="Daro_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.909) with cleavage site probability 0.485 at
FT                   residue 33"
FT   gene            complement(12950..13990)
FT                   /locus_tag="Daro_0009"
FT   CDS_pept        complement(12950..13990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0009"
FT                   /product="ApbE-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44768"
FT                   /db_xref="GOA:Q47K63"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44768.1"
FT                   /translation="MRAVLNLFLSGVCVLLLASCGRTQLQEQQAYVFGTRVEVLVVSED
FT                   PEQGRKAIAAVLREFDRLHRAYHAWQDSELMALNTAFAQGKTRQVSPELAAFVQEAQAL
FT                   SQQGDTLFDPGIGQLIKLWGFQADEFKAELPAAADIKAWLASKPSIADVVIDGTNIRSR
FT                   NRNVALDFGGYLKGVALDRASAILHAQGIHNALINIGGNVMALGSKEGKKWRVGIQHPR
FT                   QPGPMATVTLDDGEAIGTSGDYQRFFEVDGRRYAHLLDPRTGYPVEHTQAVTVLIPKGP
FT                   KAGTLSDAASKPIFIAGPDGWRDMARKMGTSLVLRVDHSNQIFVTEALRQRLEFIGAPP
FT                   KLNVVQ"
FT   sig_peptide     complement(13913..13990)
FT                   /locus_tag="Daro_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.931) with cleavage site probability 0.757 at
FT                   residue 26"
FT   gene            complement(13975..14994)
FT                   /locus_tag="Daro_0010"
FT   CDS_pept        complement(13975..14994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0010"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44769"
FT                   /db_xref="GOA:Q47K62"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44769.1"
FT                   /translation="MAQQLHFEKHLLGGSSQSLKLAFVLDPLDHLKAWKDSSVAMMRAA
FT                   EKHGHEVFAIDAATLGWRKPDDAHAGGISGEALHLHLRPDDHDWYRETGREWMPLTAFD
FT                   AVIMRKDPPFDFEYLTATWLLERAEADGVRVFNRPRALRDHSEKLAIMEFAHFAPATAI
FT                   SRDMAQIHHFIDEQRDVILKPLDGMGGSQIFRVHRNDPNRNVIVETLTHEGARTIMAQR
FT                   YVPEISQGDKRILLIAGKPVPWCLARIPKAGETRGNLAVGGTGVAQELSARDLEIAETL
FT                   GPILFKRGLMLVGIDVIGNFLTEINVTSPTCMVEIRQQSGFDAAGAFITAIEHACGLS"
FT   gene            complement(15001..16287)
FT                   /locus_tag="Daro_0011"
FT   CDS_pept        complement(15001..16287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0011"
FT                   /product="Glutamate--cysteine ligase GshA"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44770"
FT                   /db_xref="GOA:Q47K61"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44770.1"
FT                   /translation="MVPHLTTALTGPLLELERRFIAASPQIEHWLRGQWLEHTPPFYSS
FT                   CDLRNSGFKLAPVDTNLFPGGFNNLNPAFLPLCVQAAMSAIEKFCPEARSLLLIPENHT
FT                   RNQFYLQNVAQIAAILKQTGLNVRLGSLNPEVTQPTTIELPNGQSLLLEPLVRTKNRLG
FT                   LDGFDPCAILLNNDLSAGIPAILQGLHEQVVLPPVHAGWAVRRKSNHFAAYDQVANDFA
FT                   KAIGIDPWRINPAFSVCRSVNFHERQGEECLAANVSAVLDIVKEKYREYDIEETPYVVV
FT                   KADAGTYGMGVMTVRNVDEVIALNRKQRNKMSVVKEGLEVSEVLIQEGVHSFETLNDAV
FT                   AEPVIYMIDRYVVGGFYRVHTGRGKDENLNAPGMHFEPLAFETGCNMPDYGCGNPDAPP
FT                   NRFYAYGVVGRLACLAAAIELERTAPEDV"
FT   gene            complement(16355..17488)
FT                   /locus_tag="Daro_0012"
FT   CDS_pept        complement(16355..17488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0012"
FT                   /product="Response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44771"
FT                   /db_xref="GOA:Q47K60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44771.1"
FT                   /translation="MPHRFRVAIVEDNPPQRMILTRLLEKDYQIESFESGPIFLASDGL
FT                   FDAVLLDIEMPELSGYDTCRRFREQTRGADVPVIFVSAHDTTPERVASYDAGGDDFLTK
FT                   PIAAHELRHKLGNAIELREKVRTLSSQTTDAQRVAFTAMTSMGDLGVVIEFLRKSAQAT
FT                   TYSAIAARLVAAMKAWGLQGAVQVRGRHEQVALNAEGPMTAMQAAVLEKLRDIGRIFEM
FT                   GSRAVINFDHVSLLVENLPVDDPNKVGRLRDHLAVLAESADMRMAALDSAIERDLQKQG
FT                   IEAALDELRAAMQQATHHSATSHPRQQATMLESIEQLGRTTHTLGLTAVQVEYLDDLIR
FT                   HILEESQHYFDDVAQSESDFADVFSRLERLAQADYRL"
FT   gene            17619..19241
FT                   /locus_tag="Daro_0013"
FT   CDS_pept        17619..19241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0013"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44772"
FT                   /db_xref="GOA:Q47K59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44772.1"
FT                   /translation="MLVAANITMQFGVKPLFENVNVKFGEGYRYGLIGANGAGKSTFMK
FT                   ILCGALEPSAGNVSKDKHERMAYLKQDQFAYEDMRVLDVVLMGHEEMWACMSERDAIYA
FT                   NPEATEDDYMKAADLEHQFGELDGYTAESRAGELLLGVGIPTEQHNGPMSEVAPGWKLR
FT                   VLLCQALFANPDILLLDEPTNNLDINTIRWLEDVLNNRDSTMIIISHDRHFLNQVCTHM
FT                   ADLDYGKITTYAGNYDDFMEAAQQARERLSNANAKAKERIAELQTFVRRFSANASKAKQ
FT                   ATSRMKLIDKLKPEDVKPSSRQYPWIRFDYDEKAKLHRQAVEIENVSFTYEGGERKIFN
FT                   NLTLTINAGEKIAVIGENGVGKTTLLKLLMGEVTPQFGTIKWAEKAYPGYYAQDHSAQF
FT                   AGTESLTDWIAGYARATIEDGGDLETLIRGTLGRLLFSGDEVKKPVNVISGGEQGRMLF
FT                   GKLMLSKHNVLLMDEPTNHLDMESIEALNSGLEKFPGTLVFVSHDREFVSSLSTRVLEV
FT                   KSDGRIVDYLGGYEDYLASQGVE"
FT   gene            complement(19334..19825)
FT                   /locus_tag="Daro_0014"
FT   CDS_pept        complement(19334..19825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44773"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44773.1"
FT                   /translation="MKRILTVAAIVAASLTATAHAADVGVSVSIGQPGFYGQIDIGGYP
FT                   RPPVIYGQPILVEPVPYSRPPIYLRVPPGHAKHWRKHCHEYRACGERVYFVQDQWYERE
FT                   YAPRYQQRGRGDRDRWDDGRRDGYRDNYRDDRQDRRGDDRRGDDRERGHDHGHGHGRDR
FT                   "
FT   sig_peptide     complement(19760..19825)
FT                   /locus_tag="Daro_0014"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 22"
FT   gene            complement(19904..20374)
FT                   /locus_tag="Daro_0015"
FT   CDS_pept        complement(19904..20374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44774"
FT                   /db_xref="InterPro:IPR015075"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44774.1"
FT                   /translation="MNFEHLIQINDPENPLVESLTRDQLWLGLLHRVENPVPFLPGLES
FT                   CTILERTADALLRELDFGPAVIQDRVTMTERHWVRFDIQPSEAHPGGSLTITIEEPEPS
FT                   FLFLRFAYETTLANNPNSEDRAYIDYVKSAYHQSDVDCVRLIRSLAAGVPLQ"
FT   gene            20514..21221
FT                   /locus_tag="Daro_0016"
FT   CDS_pept        20514..21221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0016"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44775"
FT                   /db_xref="GOA:Q47K56"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44775.1"
FT                   /translation="MQLERILQKHGFGSRRECRGLIRRDRVAVNGQVCDDPFVELDTEG
FT                   LVFTVDGVDWPYAEFATLMLHKPAGYECSRKPKHHAGVLELLPIPLRERDVQPIGRLDE
FT                   DTTGLLLITNDGQLNHQLSSAKRKVPKVYLATTKHPLDQAQIDQLVAGVLLADEYEPIS
FT                   AAAAEIVGEKLLRLTLTEGKYHQVKRMVAAVSNRVEALHREAVGELTLPPDLKPGEWRW
FT                   LSAADLQKLGYSK"
FT   gene            21218..22132
FT                   /locus_tag="Daro_0017"
FT   CDS_pept        21218..22132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0017"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44776"
FT                   /db_xref="GOA:Q47K55"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44776.1"
FT                   /translation="MTLTEMRYIVALARERHFGKAADACHVSQPTLSVALKKVEGQIGA
FT                   PLFERGTNDVRITPLGERIVAQATRVLDEAVKLEEIAEATGDPMTGQLRVGIIYTIAPY
FT                   LLPQLIPALNREAPKMPLFLKEDFTGNLIPALKAGELDVIVIALPFSEPGLVAQPVYDE
FT                   PFRVVVPATHPWSSRTDVNGDELDGQNLLLLGQGNCFRDQVLESCPRLNAPDALEHSLE
FT                   GSSLETIRYMVASGAGVAVMPSTAADPLITKEPLVKVLPFAGTQPKRTVGLVWRITFPR
FT                   PQAIDAVRAALLSCQLPGALAVR"
FT   gene            complement(22231..24777)
FT                   /locus_tag="Daro_0018"
FT   CDS_pept        complement(22231..24777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0018"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44777"
FT                   /db_xref="GOA:Q47K54"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44777.1"
FT                   /translation="MPRHPTGQTMSKKLIIAEKPSVAADIARALGGFTKHDDYFESEEL
FT                   VLSSAVGHLLELACPEEFEVKRGKWSFAHLPVIPPHFALKPIEKTESRLKVLNKLIKRK
FT                   DVTGLINACDAGREGELIFNYIAQNAKSGKPVQRLWLQSMTQGAIRDGFSRLRPGQEME
FT                   GLGDAAVCRSESDWLVGINGTRAMTAFNSKTGGFHLTTVGRVQTPTLAIVVERERKIRD
FT                   FKSRDYWEVEADFTAKAGSYKGKWFDEAFKGKNDDEHARADRLWEVARAEAIRAATEGK
FT                   PGEVTEEAKPETRLSPALFDLTTLQREANARFGFSAKTTLSLAQALYEKHKVLTYPRTD
FT                   SRCLPEDYLPTVKETLTILTGEGAGKGHDEVLLARYSPFAHQILARNWVLPNKRIFNNA
FT                   KISDHFAIIPTPQAPKSLNEMEQKLYDFVVRRFLSVFFPAAEYMVTTRITRVEGHPFKT
FT                   EGKVLVNPGWLAVYGKEGQDGDEGNLVAVDAKEKVKTDEVTVKANATKPPPRYSEATLL
FT                   SAMEGAGKMVDDEELKAAMAGRGLGTPATRAQIIENLIGEQYMHREGRELIPTAKAFTL
FT                   MTLLNGLGIKELTQPELTGDWEWKLGRIEKGEFTRDEFMREIAEMTRHMVERAKQYEAD
FT                   TIPGDFGVLTAPCPKCGGQIRETYKKFQCGSCDYALWKIVAGRQYEPAEIEQLLTEKQV
FT                   GPLTGFRNKMGRSFSAAIKLNDELQPEFDFGQDKADAADAEPVDFSAQESLGKCPKCAA
FT                   NVFEHGTSYVCEKSVGPAKTCDFRSGKIILQQPIDAAQMKKLLADGKTDLLKEFVSNRT
FT                   RRKFSAYLVNQGGKVGFEFEKKVAKPKAPAKKKTEA"
FT   gene            complement(24827..25903)
FT                   /locus_tag="Daro_0019"
FT   CDS_pept        complement(24827..25903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0019"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44778"
FT                   /db_xref="GOA:Q47K53"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44778.1"
FT                   /translation="MSHNDSLAAWLRLTLIPGIGGETQRKLLAAFGLPEAIFSAGRLEA
FT                   RGVIGNRADLLFDFDPTEAVAHSLEWARQPGQHIISLADEAYPKALLEIADPPSLLYVR
FT                   GNLALLQKRGLAMVGSRNATPQGVQTAENFAKTLAAKGLTIISGLALGIDAAAHRGALA
FT                   AKGETIAVIGTGPDRIYPARNKELALAIVESGAIVSEFPLGTPAIASNFPRRNRIISGL
FT                   SCGVLVVEAAPESGSLITARLAAEQGREVFAIPGSIHSPVARGCHKLIKQGAKLVETAT
FT                   DILEELGSFNAAPAADIPSDKADEGPILTALGHDPCSLDDLVERTTMSADQLLPELLTL
FT                   ELCGLIATLPGNRYQRLN"
FT   gene            complement(25900..26931)
FT                   /locus_tag="Daro_0020"
FT   CDS_pept        complement(25900..26931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0020"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44779"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44779.1"
FT                   /translation="MVRIISALILAVTAVCASAAEPLQLVDNPPDRHIVVKGDTLWGIS
FT                   GKFLKQPWRWPEIWQMNKEQIKNPHWIYPGDVIMLDMSSGTPRLKIGKPVTGQSGKVQP
FT                   TVYSTPVQQVIPSIPPNAIEPFLSKPLIIETTDQNATVSIVATQEDRMLVGTGDSFYAQ
FT                   GIPDSSIEKWNVFRKGKPLKDPDTGETIAYEAVFLGNARLVKPGEPATLRVTLAKEEMN
FT                   RGDNLLPAPPPEILTYVPHRPEQEVSAKVLGIYGGVQEGGANSVISISRGKNSGLELGH
FT                   VVALYRNRVSVSIDEDGRRTSTPVPEERYGLAFVFRVFDRVAYALVVESSKAVIIGDSA
FT                   LNP"
FT   sig_peptide     complement(26872..26931)
FT                   /locus_tag="Daro_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.948 at
FT                   residue 20"
FT   gene            27075..27578
FT                   /locus_tag="Daro_0021"
FT   CDS_pept        27075..27578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0021"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44780"
FT                   /db_xref="GOA:Q47K51"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44780.1"
FT                   /translation="MALLPILRFPDPRLKKVALPVAKVDDSIRKLVADMAETMYEAPGI
FT                   GLAATQVDVHKRVVVIDVSEDKSELQAFINPVLSRCEGSQTGEEGCLSVPGIYDKVERA
FT                   ESVVVTYLDLDGNQQTLAADGLLAVCLQHELDHLNGTVFVDHLSLLKQTRIRNKLAKQA
FT                   RVTA"
FT   gene            27575..28498
FT                   /locus_tag="Daro_0022"
FT   CDS_pept        27575..28498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0022"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44781"
FT                   /db_xref="GOA:Q47K50"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47K50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44781.1"
FT                   /translation="MKLIFAGTPEFAAQALQGIVNAGHEVALVLTQPDRPAGRGMALQP
FT                   SAVKKVALTHGIEVFQPLTLKDAEAQARIAAVGAEIMVVAAYGLILPQVVLDMPRFGCI
FT                   NIHGSLLPRWRGAAPIQRALLAGDAETGVCIMQMEAGLDTGPVLLRGAFPIAATDTTAT
FT                   LHDRLAELGARLVVEALGKLPLPAEPQPADGVTYAQKIEKAEAMIDWSKSAAELDRHIR
FT                   AFNPFPGAQALFRGQTVKLWQASPVAGRGETGAILAVDKNSIIIACGEGALAVTELQKA
FT                   GGKRLPVQQFLAGHPLAVGDRFDIPA"
FT   gene            28557..29399
FT                   /locus_tag="Daro_0023"
FT   CDS_pept        28557..29399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0023"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44782"
FT                   /db_xref="GOA:Q47K49"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44782.1"
FT                   /translation="MFNWMKTAILMAAIMALFGIVGGMIGGKSGMLMALVFGGAMNLFS
FT                   YWFSDTMVLKMYNAQPVDETSAPQFYAMVRELAQRAGLPMPKVYIINEAQPNAFATGRN
FT                   PEHAAVAATTGIIQLLSARELRGVMAHELAHVKHRDILISTISATMAGAISALANFAMF
FT                   FGGRDENGRSVNPLVGILVAILAPLAASLIQMAISRAREFEADQGGAEISGTPNALADA
FT                   LGKIQMYAEGRIPMAPAEAHPETAQMMILNPLSAGGIRGLFSTHPPTEERIARLRAMS"
FT   sig_peptide     28557..28628
FT                   /locus_tag="Daro_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.392 at
FT                   residue 24"
FT   gene            complement(29409..29759)
FT                   /locus_tag="Daro_0024"
FT   CDS_pept        complement(29409..29759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0024"
FT                   /product="Uncharacterized protein"
FT                   /note="related to arylsulfate sulfotransferase involved in
FT                   siderophore biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44783"
FT                   /db_xref="InterPro:IPR027373"
FT                   /db_xref="InterPro:IPR038268"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44783.1"
FT                   /translation="MCEIYVKADPMLYESRARSIRIHGFVTKIRLENLFWDILAELAGN
FT                   EGMTTNQLIAKLYDEIEAYRGEVENFASFLRVTCLRYLTLRHQKTGERPSLAVVSSLPP
FT                   AIRELPRSVGNA"
FT   gene            complement(29810..30391)
FT                   /locus_tag="Daro_0025"
FT   CDS_pept        complement(29810..30391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0025"
FT                   /product="Peptidase C56, PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44784"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44784.1"
FT                   /translation="MAAKKILMLTGDYTEDYETMVPFQALLMVGHTVHAVCPGKKAGDF
FT                   VRTAIHDFEGDQTYSEKPGHNFTLNATFSDISVESYDALVIPGGRAPEYLRLNPQVLAM
FT                   VQHFANTGKPIAAICHGAQLLSAAGVLSGRSCSAYPACAPEVRAAGGQYADIPVDQAHV
FT                   DGNLVTAPAWPAHPAWLAKFLPLLGTQITL"
FT   gene            complement(30494..30889)
FT                   /locus_tag="Daro_0026"
FT   CDS_pept        complement(30494..30889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0026"
FT                   /product="S-adenosylmethionine decarboxylase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44785"
FT                   /db_xref="GOA:Q47K46"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44785.1"
FT                   /translation="MNGLHLIADLHDCHCPSGLLLDAPRLERYCVDACQRHGLTVVGRL
FT                   FHAFRDIADQPAGVTGTVVLAESHLALHTWPEISAVTLDVYVCNFSGDNSQQAKALFAE
FT                   VIATFQPDRVEQSAVHRGQLGSSKDKL"
FT   gene            complement(30899..31804)
FT                   /locus_tag="Daro_0027"
FT   CDS_pept        complement(30899..31804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44786"
FT                   /db_xref="GOA:Q47K45"
FT                   /db_xref="InterPro:IPR003154"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44786.1"
FT                   /translation="MRQIFSALLFFSLALPAYAWNAAGHRLVAVIAWQQLSPATRDAIS
FT                   AALAHHPDHERWVEKARSREGIAVFAEASTWPDDIRNDPRLYDEDREPPTPAVPGLPET
FT                   ARHKRWHYVDLDATGKVRDGELDRQIERLSQLLQAKGSSPGTRKSEQIAYALPWLLHLV
FT                   ADIHQPLHVGQHGDEGGNKVEIENPFNKRLPFSSLHLYWDDLPGPPWLRGNRLEKNAGR
FT                   LLDSYPKPVQGNVALWRDESHQLLAAAYPKVSGSLLPIISEDFQDNARQIANRRIVEAG
FT                   YRLGHLLESIFRERVSRETQ"
FT   gene            31839..33098
FT                   /locus_tag="Daro_0028"
FT   CDS_pept        31839..33098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0028"
FT                   /product="Fmu, rRNA SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44787"
FT                   /db_xref="GOA:Q47K44"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44787.1"
FT                   /translation="MSRLPFNSLAFALLQAARIDAAVFAGQSLADGLLARVDPAARPAV
FT                   QDLVYGSLRAYGRGDFFLGRLLDKPLDVEEVRALLLVSIYRLETRPDAAHTVVDQAVSA
FT                   AGELANGRFRGLVNAVLRNFLRQQEALVAALADDAVAVSQHPDWWLAQLQAAYPDDWQR
FT                   IVAAGNAPPPMGLRVNVRRASRDDYLARLTDAGISATAVGESGLALAKPVPVESLLGFA
FT                   AGLLSVQDPGAQMAASLLDPEPGSRVLDACAAPGGKTAHLLERSDLDLLALDLKPSRCR
FT                   RIEENLSRLGLTASVKAADCVKLDTWWDGRPFDAVLADVPCTASGVVRRNPDTKWLRRE
FT                   ADIFSFAKTQARILDALWQVVRPGGKLLYVTCSVFPTENGVQIARFLERQPEARRCHEE
FT                   QLLPTADHDGFYYCLLEKHA"
FT   sig_peptide     31839..31931
FT                   /locus_tag="Daro_0028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.772) with cleavage site probability 0.465 at
FT                   residue 31"
FT   gene            33061..33672
FT                   /locus_tag="Daro_0029"
FT   CDS_pept        33061..33672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0029"
FT                   /product="probable proline rich signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44788"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44788.1"
FT                   /translation="MAFTTAYLKSMLKRLRLWLALFVFVPLVVWAAEIDITNPQLVAGD
FT                   DSYVLSADFKFDLTPRLEEAVTKGVVLYFVADFELTRARWYWLDEKLASRSQTYRLSYH
FT                   ALTRQYRLSTGGLHQSFATLSDAVQVLSRLRNWGVIERGEKGIRAGEPYEAALRLRLDV
FT                   TQLPRPFQISALGNKDWSLASDWKTWQATLPAIAPPTEAK"
FT   sig_peptide     33061..33156
FT                   /locus_tag="Daro_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            33669..35825
FT                   /locus_tag="Daro_0030"
FT   CDS_pept        33669..35825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0030"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44789"
FT                   /db_xref="GOA:Q47K42"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44789.1"
FT                   /translation="MKRFVAAGGAFAAAIGGILWFLLLMSTAADTVIFSRNYPLLIALN
FT                   VVLALGMVGLVGWQLRTLWRDYQAQVFGARLKLRLMLMFGFIAVLPGALVYGVSVQFVT
FT                   RSIESWFDVRVEKALESGLQLGRSALDSLLADLVDKGRSMASELSDIQEVSRRSALLRL
FT                   REEKGVQTAALFSVGGQLLSSATSELSSLLPDLPNQSQLKQARSTRAVGTVEGDGGKLY
FT                   LRVLVPVSARDMFEEPRILQLTQPVPSSLAHDADAVQDVYRDYQELQLARDGLTRIYAL
FT                   TLTLTVLVALFGAFALAYLMARRLVAPLYILAEGTQAVAQGDFSPRQAIYSGDELGVLT
FT                   QSFNRMTRQLDDARRETERHRAELESARGYLESILANLSTGVLVFDRRFVLRTVNEGAL
FT                   TILNDDFIGLIGALVDEWPRQQALGTFIRENFAATEEIEWQAQLEMERPNGMPQVLLLR
FT                   GSRLPEASGGGDVVVFDDVTRLIAAQRSAAWGEVARRLAHEIKNPLTPIQLSAERLQFK
FT                   LASKLTNGDADMLARGTQTIINQVQAMKRMVDDFRDYARLPAPEVAPLDLNALIGEVLG
FT                   LYESSSAVIENRLDSALPPILGDATQLRQIIHNLLRNAEDALENHEGARILIQTEPLGR
FT                   YARLLIADNGPGFPVELLSRIFEPYVTTKARGTGLGLPIVKKIVEEHLGSIEISNAPEG
FT                   GARIDIRLPLVKEEEAKHGHSSGR"
FT   sig_peptide     33669..33755
FT                   /locus_tag="Daro_0030"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.806 at
FT                   residue 29"
FT   gene            35803..37068
FT                   /locus_tag="Daro_0031"
FT   CDS_pept        35803..37068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0031"
FT                   /product="Helix-turn-helix, Fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44790"
FT                   /db_xref="GOA:Q47K41"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44790.1"
FT                   /translation="MAIVLVVDDEVGIRELLSEILIDEGYDVRLAENATAARLVREELR
FT                   PDLVLLDIWMPDTDGISLLKEWHAAGHLNMPVVMMSGHGTIDTAVEATRFGAFDFLEKP
FT                   IALQKLLSTVQKALKHDKPPARPALTLEAFSRSAFVKEFKRRLEQAAAKSPVLLLKGAN
FT                   GGMAEICARTLQPPRAPWLDLSGISSALTQDMLEKVTGGILFVPDLAVLGKMQQMNLAF
FT                   AIERLEKLNLQLIAASVSSITALNEAGWDSKLLTRLSEIWVAMPSLAGHGDELPEIASL
FT                   LLSNFVERGEVPLRRFSTAALNALRTLSWKRQPESSWSDLYALVRNLAVTSLDEEISAD
FT                   DVARVMPHDGGESPEVLSLLPLFDQPLREARDAFEKMYFEHHLRLEGGNMTKLAERSGL
FT                   ERTHLYRKLKQLDVKLGKRGEE"
FT   gene            37182..38249
FT                   /locus_tag="Daro_0032"
FT   CDS_pept        37182..38249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0032"
FT                   /product="Uroporphyrinogen decarboxylase HemE"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44791"
FT                   /db_xref="GOA:Q47K40"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47K40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44791.1"
FT                   /translation="MSRPKNDTFLRALLKEPTEYTPLWLMRQAGRYLPEYCETRKRAGN
FT                   FLNLCKSPTMACEVTLQPLARYDLDAAILFSDILTVPDAMGLGLYFAEGEGPKFERPLR
FT                   EEWAINNLTVTDPYEHLGYVMDAVSEIRRALDNSVPLIGFSGSPYTLACYMVEGEGSSD
FT                   FRNIKAMLYNRPDLLHRILSVTADSVIAYLNAQIDSGAQAVMIFDTWGGSLSNAAYEEF
FT                   SLQYMRRIVAGLKKEKDGQRIPSIVFTKNGGLWLEKIADIGCDAVGLDWTIDIGEARRR
FT                   VGDKVALQGNLDPNVLFAQPEIVAAEAKKVLDSFGPANTGHVFNLGHGISQFTPPESVT
FT                   ALVEAVHSHSRLSRK"
FT   gene            38532..40532
FT                   /locus_tag="Daro_0033"
FT   CDS_pept        38532..40532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0033"
FT                   /product="replication restart DNA helicase PriA"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44792"
FT                   /db_xref="GOA:Q47K39"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44792.1"
FT                   /translation="MSAAKSMQVLRVALDLPLHRLFDYVVESASTEDIGLRVRVPFGRG
FT                   EKLGVIVEVLAESDWPLEQLKPAIEVLRDLPPLPGDFFRLCRFASAYYQAALGEVIMQA
FT                   LPIGLKRLDPPTRRNARASRSSVAIAPPALTEEQTIAVAAVDPAAGFSAHLLHGVTGSG
FT                   KTEVYLRLIERAQADGKQVLLLVPEINLTPQLEGRVRSRFPEAGVVSLHSELAEAARER
FT                   NWRAAFSGEASIVLGTRLSIFTPMPRLGLIVVDEEHDASFKQQDGMRYSARDVAVFRAH
FT                   QLGIPVLLGSATPSLETWANAQSKRYNLITLLERANPEASLPAIHILDTRKMVLQEGVG
FT                   EPLIAAIKERLARGEQSLVFLNRRGYSPVLACPACGWVSRCTRCAANMVLHLADKRLRC
FT                   HHCGCEHRIPKACPTCGNQDIHPFGRGTQRLEGWLQEAFPEARVLRVDRDSVKSRKQWE
FT                   VMLDRIHGGEADILVGTQMLAKGHDFPKLTLVGVLGADSALFAADWRAPERLFAQLMQV
FT                   AGRAGRAELKGEVQIQTQYPDHPLFASLVKHDYPGFAALQLKEREQAGFPPYAFQAVLR
FT                   AEAPEMADAIAFLKTAAAMPLIGEHENIMIYDPVPMKLARLANLERGQLLAESYSRPAL
FT                   QVFLPLWREAIEGIKAPSKLRWHIEVDPLEF"
FT   gene            40584..41567
FT                   /locus_tag="Daro_0034"
FT   CDS_pept        40584..41567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44793"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44793.1"
FT                   /translation="MKILDSTVQLSASHEASTSRSMEITGSMGFRQMFDTLATSAPDEQ
FT                   IAVRQRVQKLLQSLIDAILAAVDGKKCEENIAAGDTLPQELPPAARGRAMTWSRHVTEK
FT                   LSETEKTSVCGKGCVKTSDGRDIAFDFSLNLARDYHQSSTRDESGTVELRDPLIINFDG
FT                   KSSELTTERIAFDLNADGLPEEIPGLGAGRGFLVFDRNGNGKADNGSELFGAVSGNGFA
FT                   DLAKLDGDHNGWIDEGDAAFKQLAIWSGDSYTSLSQGGVGALYTGAVEAPFALKTEDNE
FT                   LLGQIRAAGVYLTEAGEVGHLQQVDLAVSVAPGGQQKPAEGQSLAA"
FT   gene            complement(41511..42728)
FT                   /locus_tag="Daro_0035"
FT   CDS_pept        complement(41511..42728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0035"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44794"
FT                   /db_xref="GOA:Q47K37"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44794.1"
FT                   /translation="MTHPDTRSLWIRLFLPFAAGYFLSYLFRTVNAIIGPVLARELGLG
FT                   DNALGLLTSTYFLAFGLAQLPLGMLLDRFGPRRVEAGLLVIAASGAAVFSISDGLGGLA
FT                   IGRALIGLGVSACLMASFKAFSQWFPPERQASLTGWVMASGGLGALAATKPLEMLLGFT
FT                   GWREIAFALAVVTLIVAGILWLKVPDKATEQKGAGLAEQLAGVRTIFASRHFWRYAPMG
FT                   FFFTGGFLAVQGLWVSRWMTVLEGMEHTAIATRLTWISGAMLAGFLFMGFFATTLVRHG
FT                   LKLERIYLGAMSIALACFALISSLPTVAGNLFWPILGICFSLSNISYSLVSQAFPPAVS
FT                   GRANTALNLLVFAGAFGLQWGIGSSVDALQANGWAGDTAYRSAFFALLGGQTLALGWLL
FT                   LSARRN"
FT   gene            complement(42725..43429)
FT                   /locus_tag="Daro_0036"
FT   CDS_pept        complement(42725..43429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0036"
FT                   /product="MOSC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44795"
FT                   /db_xref="GOA:Q47K36"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44795.1"
FT                   /translation="MANVSLFIGGIRPLPESGRPTGMYKQAVTTELVLGPEGFIGDQQA
FT                   DRRVHGGPDKAVHLYPARHYAKLAARFPEAAAQLVIGSLGENISTADIDENDVRIGDIW
FT                   RLGTARLQLCQPRNPCWKIDERFASEGMAEFIARERLTGWYWRVLTPGNVALGDTLEIE
FT                   RAASAAFTLAEAMQCWQAHRPALADLERLAATPGIAENWKQKITTRLEWLRKNPQVLPP
FT                   QSPAFHVKPENP"
FT   gene            complement(43448..44341)
FT                   /locus_tag="Daro_0037"
FT   CDS_pept        complement(43448..44341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0037"
FT                   /product="N-acetylglucosamine kinase"
FT                   /EC_number="2.7.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44796"
FT                   /db_xref="GOA:Q47K35"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44796.1"
FT                   /translation="MRLGIDLGGTKIEIIALASDGHELLRQRIATPQGDYLATLMAVAG
FT                   LVEASESKLGQRGSVGVGIPGAESLATGLIKNANSTCLIGKPLKRDLQALLRREVRLAN
FT                   DANCFALSEAIDGSGRDANIVFGIILGTGVGGGIVVNQQVLAGANAIAGEWGHNPLPLA
FT                   AADDLPLPTCYCGRSGCIETYLCGPALTTDHYRHTGETLAAAEIEKRAIAGDTACEATL
FT                   QRYEDRLGRALAGVINILDPQVIVIGGGLSNLQRLYRNLPERCTPYVFSDVIYTKFLPP
FT                   SHGDSSGVRGAAWLWN"
FT   gene            complement(44341..44991)
FT                   /locus_tag="Daro_0038"
FT   CDS_pept        complement(44341..44991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44797"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44797.1"
FT                   /translation="MTMNITANPLETGADELERFALEECVKRQRVDRRVSVLIMSDTRC
FT                   EMALKFARLGAQVVVADDASLQTDIEGRILAAGLNEEISFSPCALSRLPEEIPGEPFDI
FT                   IIIRRGMCSMPYEQARQVVRQLLLKLKIGGKFYLSVLGLHSELSEGYTAGEATIDQRFA
FT                   ELSPVLAEKYDIRQPVCLYTERNLFMLLLEAGASVLRTLTTTYGNVKGIAVRV"
FT   gene            45075..45404
FT                   /locus_tag="Daro_0039"
FT   CDS_pept        45075..45404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44798"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44798.1"
FT                   /translation="MLVRFISSETGEILMFAEAARPLLQAIGKETTARGAFTQAEMAAA
FT                   AQVLREAVQRAEAPPQDDEFDETGKKKEPVVALGQRAWPLIDMLDRTSRGGARANIVWE
FT                   ASAAF"
FT   gene            complement(45412..48993)
FT                   /locus_tag="Daro_0040"
FT   CDS_pept        complement(45412..48993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0040"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44799"
FT                   /db_xref="GOA:Q47K32"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44799.1"
FT                   /translation="MAPSSQIPAEALEEALMIAGVGCWSWHTETRQFRISRNFHSLLGY
FT                   SPDALPETPEAWLALAHADERPQLSTLFARLSANTARGYPPFTLRLKHTNGLWHWFEVR
FT                   TPCTGTGDGAAPLVITFNEITQQKQAEAALRDSQLRFRALYNTSPLAFILWDRQGHITE
FT                   WNRRAEQMFGWKAAEVIGKQVHHLLLSTEHHEAFADTVRAVMHGTGTGKFTGPAHGKDG
FT                   VLLVCNWYNVALRTAQGKLVGILSLLLDITEERLTHQRIEKSEKIYRTLVETSPDAILL
FT                   LGLDGGLKTANQQAHRLFGLDEMLDLDSTNVRDLLPDNASTEHFLDDPEDFNGFIVTRQ
FT                   LSMQRLDGGRFDADTAFTTIMDSTGQPTGIVLFARDVTGKLQAERELEAHREDLERLVQ
FT                   ERTYDLENAHDTLAKIIDGSPVPTLVLDADHKITHWNEACEQIIGVKAGDIVGTSNQWK
FT                   AFYPSQRPIMADLVLNGEMAQIQALYSDKYRRSRLVQGGYEAEDFFPMFKRWLFFTAAP
FT                   LYDKQGRIVGAIETLQDITERKQAEIALTEAKHAAEAAAEAKAAFLANMSHEIRTPMNA
FT                   VIGLAHLLLKGDLSGKQRDYISRIHGSGQMLLGLINDILDFSKIEAGRMVLEETEFALD
FT                   DVLDNVTSVLLHRAQEKGLIMQYVVEPDVPTNLLGDPLRLAQILINLLGNALKFTASGS
FT                   ITVFVRRLPGNTARAELEIDVQDTGVGMSQEQQQVLFQAFSQADSSITRKYGGTGLGLT
FT                   ICKRLAQLMRGDIWVTSQSGVGSTFTFTVNLGLSTLEANPPLSAMRRALVVDDSPLARA
FT                   ILIRLLEKHGYSAIPAESGAEALGLLADTRTAPFEFVTIDFNMPGMDGLELSEAIRNQI
FT                   SPCPRLVMVTASDTAALGSDERLHCVDAVLSKPVTAAQIGKLVRDRELQNHAKPNAPAP
FT                   LAGLRILLVDDMPTNLLIAGEMLESFGITVDTADNGVLALKKVIDEGNDYDIVLMDIQM
FT                   PEMDGLEATRRLRAVERSQSLPIIAMTANAQDSERQRCLAAGMNDFLTKPIDPGLLQDT
FT                   LFRWRPRQDTTAPTRKQETIPMTPADGLPDLPGINTAEGLRRMMNKPSLYEKVLRDFHA
FT                   RFTDEAKAIRAAISAGDFSTAERRAHSTKGLAGTIGAVGLQNAALNLEQALHNGEAALE
FT                   SIFDQFENELSIVIGSIARAFGIDLAG"
FT   gene            complement(49018..49587)
FT                   /locus_tag="Daro_0041"
FT   CDS_pept        complement(49018..49587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44800"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44800.1"
FT                   /translation="MTVEINQPRGTSAHMPDLNWSQVRETVLMLELSAVQIEAAMKDSN
FT                   ASVEVLTDSFTTMAGYMRMISDTVQTLPDQGEVGVAKQNLTGVSEHVSGMVHQAIIAFQ
FT                   FYDKLVQRLAHVGLSLGDLSDLVADSRRLFNPAEWVGLQDKIKTKYSTREEIAMFDAVM
FT                   NGMPVQEAVDKYMAEMKEKSDDIELF"
FT   gene            complement(49624..49986)
FT                   /locus_tag="Daro_0042"
FT   CDS_pept        complement(49624..49986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0042"
FT                   /product="Protein of unknown function DUF861"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44801"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44801.1"
FT                   /translation="MPKLTAFSTTTPPPSYDRPRPDRLVKGNPLRTTWEHFLTENGDLS
FT                   AGIWSCEPGAWNIAFAPGKDEFFCIIEGRLRITDSDQQASEFGPGDACIIPAGFTGTFE
FT                   VLEAVRKHYVLIERRT"
FT   gene            50052..50768
FT                   /locus_tag="Daro_0043"
FT   CDS_pept        50052..50768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0043"
FT                   /product="Cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44802"
FT                   /db_xref="GOA:Q47K29"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44802.1"
FT                   /translation="MSFVRFLISPFFLMATAVIAAPPLVAVDVGHGGKDTGAISARGRT
FT                   EFEFNRDFAGRLAATLREHELGVLEVNFDGKIGSLAARPAAAIGSDFFIAIHHDSVGEP
FT                   WLLNWEWNGQPLRYTEVKRGFGLFVSAQNPDLETSLRCASTIGAMMRRAGFVPSDWHAR
FT                   KHVPADAENGVWYYDNLVVLYRTTLPAVLFEAGVIKHRDEELELLDPERQARMADAVAT
FT                   GIAACLFVKASDTPAE"
FT   sig_peptide     50052..50132
FT                   /locus_tag="Daro_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.631 at
FT                   residue 27"
FT   gene            complement(50775..51788)
FT                   /locus_tag="Daro_0044"
FT   CDS_pept        complement(50775..51788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0044"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44803"
FT                   /db_xref="GOA:Q47K28"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47K28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44803.1"
FT                   /translation="MNPSTNVDLTPFNTLALPGRAARYQKVTAPEALTAPELVKEKRFI
FT                   LGGGSNLVLTGDFDGLLLHMAIPGKRLVKEDAEAWFIEAGAGENWHDFVQWTLTRGWPG
FT                   LENLSLIPGTVGAAPIQNIGAYGLEVADCLHSVTGWDFEKKALLTIDRDDCRFAYRDSL
FT                   FKQQGWHLNGRIAITSVIFRLAKAWQPNMRYADIAQELATRKIAAPSAQDIATAVIAVR
FT                   QRKLPDPAVTPNAGSFFHNPVVEAIQAEALADAYPTLPRYPQPDGRVKLAAGWLIEQAG
FT                   WKGKALGPVGMYEKQALVLVNRGGATGQDVQRTMAAVQAAVREKFAVELTPEPIFL"
FT   gene            51862..53673
FT                   /locus_tag="Daro_0045"
FT   CDS_pept        51862..53673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0045"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44804"
FT                   /db_xref="GOA:Q47K27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44804.1"
FT                   /translation="MLDPGSGRGVKHDHYVATDFRLPGQLHGDTIMKPADRHLWQRFWA
FT                   IASPYWRQDERLKAWGLLALLILLLLGQTKFAVLFNEQTGEFTSALAARDEERFWNSIK
FT                   FCLGLLVAAVPIYTLYYFVRDTLGIHWRRWLTHHFLESYFSHRHFYELNANAGIDNPDQ
FT                   RVAEDINTFTQRSLYFLLIFIGSILQLAAFSRVLWSISHELVYFLVFYAIGGTLITILV
FT                   FGNRLMNLNFHQLRREADFRFSLVRVRENAESIALYRGEAQELQQVRQRFAAAFKNFKR
FT                   LIRSQMGLNFFQHAYGLMTIVLPSAIIASRVLSGELEVGRAIQAAGAFAAILSAFSLIV
FT                   ENFESLSRFAAGIERLDALARFLPGHPAGHVGRGSTILSVDASHLTLENLTLQTPNYER
FT                   TLIRDLSLAVKPGEGLMIVGESGSGKSSLLRAIAGIWYAGSGTIYRPQPNDILFLPQQP
FT                   YMLLGTLRSQLLYPHKERSIADAQLLKVLERVNLPDLANRFGGLDVEMDWQKVLSVGEQ
FT                   QRLAFARILISKPRFAILDEATSALDNANEDALYRLLQEMKTTLVSVTHRPAILKYHKQ
FT                   VLELTGDSRWQAYPAEEYGFREDRDAP"
FT   gene            complement(53692..57354)
FT                   /locus_tag="Daro_0046"
FT   CDS_pept        complement(53692..57354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0046"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44805"
FT                   /db_xref="GOA:Q47K26"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44805.1"
FT                   /translation="MQPNRTAELSSLLQQRLLVLDGAMGTMIQRHGLQEADYRGERFKD
FT                   HPHDLKGNNDLLVLTRPDIIGGIHREYLEAGADILETCTFNSTAVSQADYNLSELVYEL
FT                   NFEGAKLARQLCDEFTAANPAKPRFVAGVLGPTSRTASISPDVNDPGYRNVTFDELVAN
FT                   YVEAITGLVEGGADILLVETVFDTLNAKAALFAIEKFFDIAQRRWPVMISGTITDASGR
FT                   TLSGQTAEAFWNSLRHVQPVSFGLNCALGAKELRQYVEELSRVCDCYVSAHPNAGLPNA
FT                   FGGYDETADMLADEIESWAKAGIVNIVGGCCGTSPEHIAAIAQRVATVSPRQRPAIEPA
FT                   LRLSGLEAFNVTPGSLYVNVGERTNVTGSKAFARMILEGRFDDALAVARQQVENGAQII
FT                   DINMDEAMLDSLAAMDKFLKLIASEPDISRVPIMIDSSKWEVIEAGLKCIQGKGIVNSI
FT                   SMKEGEAKFIEQAKLARRYGAAVIVMAFDEKGQADTFARKTEISKRAYDLLLSIGFPAE
FT                   DIIFDPNIFAIATGIPEHDNYAVDFIESVRWIKQNLPHAHISGGVSNVSFSFRGNDPVR
FT                   EAIHTVFLYHAIKNGMTMGIVNAGMLGIYDDLEPELRQKVEDVVLNRNPNAGEALVDFA
FT                   QTVKEGKAKDTGPDLSWREQSVEKRLEHALIKGITDFVVADTEEVRAQLEAEGKPPLAV
FT                   IEGPLMAGMNHVGDLFGAGKMFLPQVVKSARVMKQAVAHLLPYIEAEKTRTGLGSKGKI
FT                   LMATVKGDVHDIGKNIVGVVLGCNGYDVIDLGVMVSCDNILKAALEHRVDIIGLSGLIT
FT                   PSLEEMAHVASEMQRQGMKQPLLIGGATTSRAHTAIKIAPNTEGAVVYVPDASRAVGVA
FT                   TKLLSTEQRDGYMAEIVAEYEAVRAEHSGRKGATMVTLAEARANRFTWNEPFTPAKPKQ
FT                   LGLQTLNPSLSDLALLIDWTPFFQSWDLAGRYPAILDNETVGETARQLFTDAKEMLGKI
FT                   ISENWLSARAVFGLYPAKAENEDIIIYSDESRTTELTRWVGLRQQHKQPKGRFNMALAD
FT                   FIGENDYVGAFAVTAGHRIEERVAAFEAAHDDYSAIMLKSLADRLAEAAAEWLHLQVRT
FT                   QYWGYAHDETFTNAELIAEQYKGIRPAPGYPACPDHTAKRELFALLDAPANAGMQLTES
FT                   CAMTPAAAVSGFYIAHPAAAYFAIPKIGRDQLEDWAARKGMSLKDAEYWLAPLL"
FT   gene            complement(57555..58049)
FT                   /locus_tag="Daro_0047"
FT   CDS_pept        complement(57555..58049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44806"
FT                   /db_xref="GOA:Q47K25"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44806.1"
FT                   /translation="MKLPAWITSAATAIVAAALPACDYFNLQEIKPGVTTQAEVRSRMG
FT                   EPGFIHWNDDGTATWEYARQPNGSSCYMITFGLDHVVAKVEQVLNDANYAKVRVGMSKD
FT                   DIRRLLGAPGSKQTFNNLREEIWEWRIEGMPPMDETYFMVHFDTNSGGVKKTSKRVAVK
FT                   G"
FT   sig_peptide     complement(57996..58049)
FT                   /locus_tag="Daro_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.820) with cleavage site probability 0.562 at
FT                   residue 18"
FT   gene            58133..58531
FT                   /locus_tag="Daro_0048"
FT   CDS_pept        58133..58531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0048"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44807"
FT                   /db_xref="GOA:Q47K24"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44807.1"
FT                   /translation="MPMQHLDPLAAHAFLQHQPLAVLVDCRTEIEHMYVGHPAGAEHVA
FT                   WQEGPDWEIDPKFADKVKRLVRGDLSRPLLLICRSGRRSVDAGLALEAAGFTNVINVLE
FT                   GFEGPLDEDYHRGKLGGWRCRGLPWYQS"
FT   gene            complement(58511..59713)
FT                   /locus_tag="Daro_0049"
FT   CDS_pept        complement(58511..59713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0049"
FT                   /product="Drug resistance transporter Bcr/CflA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44808"
FT                   /db_xref="GOA:Q47K23"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44808.1"
FT                   /translation="MAEVSRRETRGIAILLASMSAIGPFSIDTYLPSFHEIGEKLHATP
FT                   LEVQQTLSIYLFSFALMTLWHGAIADRFGRRKVILIALGLFAIASAGCTLATRIEHLWF
FT                   WRAMQGITAGAGIVLSRAIVRDLFDGAEAQRLMSQITMMFALAPAIAPVIGGWLQTLFG
FT                   WRSVFAFLVLSTTALWLACWKLLPETLPPEKRQSLRPAYLASTYWKVLTSPPFLLACAA
FT                   LSMNFGGFFLYILSAPVFLMRHLGVAETGFLWLFGPAMSGLVCGSWLSGRLAGRVSLPR
FT                   TIGLGYAVMGTAAAINLTVNVALPPGLPWSVAPIFVYTMGMSLAMPCLTIFALDPFPAQ
FT                   RGLAASCQTFFQSSFNGLVAALIAPALWGSTLTLALGMAGLMLTGGLAALLHQRLRLVP
FT                   R"
FT   gene            complement(59706..61202)
FT                   /locus_tag="Daro_0050"
FT   CDS_pept        complement(59706..61202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0050"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44809"
FT                   /db_xref="GOA:Q47K22"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44809.1"
FT                   /translation="MALAIAYSRGLDGLNAPPVIVEAHLASGLPSFTLVGLPDTEVKEA
FT                   RDRVRAAIVNSGFEFPSKRITVNLAPADLPKESGRFDLPIALGILAASGQIPTPALADY
FT                   EFAGELSLSGELRPIRGALAMALQSSDNGKTFILPEASAQEAALTGSTHILAARSLLDV
FT                   CAHLADRELLPPAVATANTENWPKFPDISEVRGQSQAKRALEIAAAGNHSLLMVGPPGS
FT                   GKSMLAARLPGLMPRLEGEAAKASAAVLSLVGQFQPEAFGVRPYRQPHHTASAVALVGG
FT                   GNPPRPGEISLAHQGILFLDELPEFDRKVLETLREPLESGRIHIARAARHAEFPAEFQL
FT                   IAAMNPCPCGFLGHGNNKCRCTPDQIARYRGKLSGPFLDRIDLIIEVPALPSDALSGKA
FT                   DGESSETVRTRVEQAQVRQQTRQSKPNARLNTKEVDACCQPDETGSKLLQQATTQLDLS
FT                   ARAWHRILKVARTIADLAGNDDIRATHIAEAIQYRRFGRG"
FT   gene            complement(61209..61451)
FT                   /locus_tag="Daro_0051"
FT   CDS_pept        complement(61209..61451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0051"
FT                   /product="Protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44810"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44810.1"
FT                   /translation="MLDPKTLEEFGAKMSALFANSPAKDIEKNAKAMMGGFFAKLDLVT
FT                   REEFDVQAQVLARTREKLQALEARVDALEKARSGQ"
FT   gene            61690..62463
FT                   /locus_tag="Daro_0052"
FT   CDS_pept        61690..62463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0052"
FT                   /product="Conserved hypothetical protein 2001"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44811"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44811.1"
FT                   /translation="MKKSLLTLAIVAAFVAPAFAEEAAAPAPAPALTGNIGVVSDYIFR
FT                   GISQTQGHPALQGGFDYNHSSGLYVGVWGSNVSWVQVNHYKDNSSLETDFYGGFKGGFA
FT                   DDFTYDLGVIKYYYPGTSLGGVTPDTMEVYGAIGWKFITLKYNQTISQYMVGWTGTQME
FT                   NTRGSGYIDLSANYDLGEGWGVNAHVGHQKIKHYSDASYTDWKLGVTKDVGFGVFGLAY
FT                   TDTNANTCGDAVPAYCWNNKNVAKGTALLSFTKTF"
FT   sig_peptide     61690..61752
FT                   /locus_tag="Daro_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            62549..62887
FT                   /locus_tag="Daro_0053"
FT   CDS_pept        62549..62887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0053"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44812"
FT                   /db_xref="GOA:Q47K19"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44812.1"
FT                   /translation="MKFVTAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVRDDQLDQVIEAIEKSASTGKIGDGKIFVFDVEQVIRIRT
FT                   GETGTDAL"
FT   gene            62898..64397
FT                   /locus_tag="Daro_0054"
FT   CDS_pept        62898..64397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0054"
FT                   /product="ammonium transporter"
FT                   /note="TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44813"
FT                   /db_xref="GOA:Q47K18"
FT                   /db_xref="InterPro:IPR001859"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44813.1"
FT                   /translation="MKRLLALLALVGAVGFGAPAWAEEKAAAPEAVAATAPAAAPAAAA
FT                   PAAAPAAAAPAAAPAAAPIPPNKGDNAWVMISAALVILMSIPGLALFYGGLVRTKNMLS
FT                   VLMQVFVTFSLISVLWVVYGYSAAFTEGNEFFGVLDKLFLKGVTVDSVAATFSKGVNIS
FT                   EFAYVIFQGAFAAITCGLIVGAFAERAKFAAILVFMVIWFTLSYIPMAHMVWYWAGPDA
FT                   YIDAAAGELAGKTAGFLFQKGALDFAGGTVVHINAAIAGLVGAYMVGKRSGLGNVSMAP
FT                   HSLTLTMIGASLLWFGWFGFNAGSALEASGGAALAMVNTWVATACAALSWMFAEWILKG
FT                   KPSMLGAASGAVAGLVAITPAAGFVGVMGSIIIGLLAGVVCLWGVNGLKKLLGADDSLD
FT                   VFGVHGVGGILGAMLTGVFADPALGGTGVYDYVANAVGPYDMTAQLISQAWGVGTVIVW
FT                   SGVVSIVAYKLVDIVIGLRVPEEEEREGLDLTSHGETAYHH"
FT   sig_peptide     62898..62966
FT                   /locus_tag="Daro_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(64513..65055)
FT                   /locus_tag="Daro_0055"
FT   CDS_pept        complement(64513..65055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0055"
FT                   /product="Isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44814"
FT                   /db_xref="GOA:Q47K17"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44814.1"
FT                   /translation="MLIRRDDSLLLIVDIQEKLAPAIHDNERVTANSARLLEGARLLDI
FT                   PAFVSEQYVKGLGSSVQAIRDAAGSARFFEKTHFSCAAEPGIVDLLLAAKRPQVILTGT
FT                   ETHVCVLQTAFGLQAAGFEVYLVADAASSRTPENRSAAIERMRAGGIRIVTTEMVLFEW
FT                   LHQAGTSEFRTLLPLIK"
FT   gene            complement(65055..65924)
FT                   /locus_tag="Daro_0056"
FT   CDS_pept        complement(65055..65924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0056"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44815"
FT                   /db_xref="GOA:Q47K16"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44815.1"
FT                   /translation="MTMHRDRFYTLSASCPDQVGIIARVSGFIAGNGGWILESSFHSDV
FT                   LTGRYFMRIEIKADSLPFLLAEFRERFRIEVAEPLSMTWQINDSAVKKRVVVLVSKQEH
FT                   CLYDLLARWQAKELDIEIPCVISNHDTFRGFVEWHGIPFHHVPVTADNKAAAYAEIQRI
FT                   FEDVRGDSMVLARYMQVLSPELCDALTGKIINIHHSFLPSFAGAKPYHQAYTRGVKLIG
FT                   ATCHYVTSELDAGPIIEQDVIRIDHSDSPEDMVRYGKDIEKTVLARGLRYHLEDRVLVH
FT                   GNKTVVFR"
FT   gene            complement(65930..66541)
FT                   /locus_tag="Daro_0057"
FT   CDS_pept        complement(65930..66541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0057"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44816"
FT                   /db_xref="GOA:Q47K15"
FT                   /db_xref="InterPro:IPR011863"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44816.1"
FT                   /translation="MQIVCLDLEGVLVPEIWIEFSKRTGIPELMRTTREEPDYDKLMTY
FT                   RLNILREHKLGLPDIQKVIAEMGPMPGARAFLDKLREDYQVVILSDTFYEFAHPLMRQL
FT                   GWPTLFCHSLEDDAEGMLVNYHLRMPDQKREAVKRFKELNFKIVAAGDSYNDTAMLGEA
FT                   HGGILFHPPENVIREFPQYPVVLNYDDLRSEIDKAFAKAA"
FT   gene            complement(66585..68936)
FT                   /locus_tag="Daro_0058"
FT   CDS_pept        complement(66585..68936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0058"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44817"
FT                   /db_xref="GOA:Q47K14"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44817.1"
FT                   /translation="MTLMKLPRSLRTRLITLSIIVEIVMISAIVWNSQRLIEAHLVRQF
FT                   ELRRAEISLLLQAALGAAMVQRDYAAVSETLTSAQQMQGMVYLIMFDERGQRIAAANAE
FT                   HDIKPAGVRDFRVPVSVEKRPYGELQVGIDLRFLEEARQEILFQNIALALVGILTSSVV
FT                   LGGIALWLTRRLGRLVKASHDLADGRGFKPMPASSNDDIGQVISAFNGMAKTLDRRVRD
FT                   LQEAEARQRALLETVDAERSRLDALLSAMRLGLVFVDQDERICYLNPAFASLWSVSLDG
FT                   HLANLPLADLRRWLDAVLTNGGQSQLFRGDGTSVELALHEGRVITQQGIAVTSASGSEL
FT                   GRLWIFEDVTNERQLAEHLLFMAERDPLTGLANRARFAAELDRLVSRFQRDATQSGAVL
FT                   YFDIDEFKTINDTFGHRVGDNVLVRTADVVSKLVRTGELLARLGGDEFAIVAPGADLDG
FT                   VQAMAERVVKALTGLSFEFDGKRFGLTISLGIALLPEHAASAEELVAHADAAMYQAKRS
FT                   GKNCWRIYRPDLDESSHMLSQLGWNDKIQAALNENRLVLHFQGVHVTATRAISHYEALV
FT                   RMIDPDNPDELLQPGSFIPAAERTGRIVDIDRWVIGTAIHKLAGMPSLPALAINVSARS
FT                   FDDPTLARTISDLLTEFHVNPQRLIIELTETAALANIRDSERFIDDLRRLGCTVCLDDF
FT                   GVGFSSFAYLKHLSADVLKIDGMFIRNLVSNREDQVFVRAIVEVARGLGKKTVAEFVGD
FT                   APTLALLGELGVDYAQGYYLSFPIAEISPS"
FT   gene            complement(68936..69799)
FT                   /locus_tag="Daro_0059"
FT   CDS_pept        complement(68936..69799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0059"
FT                   /product="ABC-type phosphate/phosphonate transport system
FT                   periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44818"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44818.1"
FT                   /translation="MRLITKMIVLAFSLLLCASSLSLADEKLAERRPLTVGLMPYLSTR
FT                   TLLANYQPIAAALEDALKQPVQLLTAPDFDTFVRRVLDGEYDIALLAPHYARLAIKSYG
FT                   YTPLLLHKSPIRGVLVSSRAQPLASFNDLRGQNIAIVDRSALLVIAGAITLGENGLTEG
FT                   SDYHFIETVSHSSALHNAISGKARAALVSYSTLVLAAPELQRDALLWRDIASIPGQFYI
FT                   AHSRVPPARQLAVKAALLAFEKTPEGQLFFEKTKHGGFREPTAEDYVLLDKMMPETRRL
FT                   LGNTVR"
FT   sig_peptide     complement(69725..69799)
FT                   /locus_tag="Daro_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            70193..70507
FT                   /locus_tag="Daro_0060"
FT   CDS_pept        70193..70507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0060"
FT                   /product="Protein of unknown function DUF883, ElaB"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44819"
FT                   /db_xref="GOA:Q47K12"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44819.1"
FT                   /translation="MSNVTDLGNSQKIVADMKAVVSDAEEIFRETAGVAGDKMLDVRQR
FT                   ISDRLGAAKVRVADAEAAILAKTKAAACATDTCVRDKPWQFVGIAAGVGLLLGILMARR
FT                   "
FT   gene            complement(70544..72451)
FT                   /locus_tag="Daro_0061"
FT   CDS_pept        complement(70544..72451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0061"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44820"
FT                   /db_xref="GOA:Q47K11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44820.1"
FT                   /translation="MIALRQVTFARAGRPLVIDASVQLHPGWKVGVVGANGCGKSSLFA
FT                   LLANELHAESGNVEIPASWHIARVAQETPALPDSALDFVLDGDIELRRIERELVEAEAK
FT                   GDGLAIGHLHARYGEIGGYSAKARVAEVLHGLGFTDADFSRAVSEFSGGWRVRLNLARA
FT                   LSCRADLLLLDEPTNHLDLDAVFWLENWLKNTPATLLLISHDRDFLDAVVGQIIAIDLQ
FT                   RLTLTSGGYSDYERARAARLATQQSAFEAQQREIAHLSSFIERFKAKATKARQAQSRIK
FT                   TLERMEMVAAAHVDSPFHFSFREPTALPDPLLSIEKASAGYADHRIIDNVTLTLRPGCR
FT                   IGLLGRNGAGKSTLIKLLANAIPQQGGERKEAKALNIGYFAQHQLEQLRPDESPLQHLV
FT                   RLDPTATEQELRDYIGGFDFRGDMATRAIEPFSGGEKSRLALALMIRNKPNLLLLDEPT
FT                   NHLDLEMREALTFALQDFEGGVVFVSHDRHLLRTCADELLLVADGKVTEFDGDLDDYAA
FT                   WLAAQRNAEKAPEPNAAAEKNERLAQRADAKANRQALLAQRRPLVKEIEQLERKLAKWN
FT                   EEKAALDTQFADPNFYTTVDRIKSEEMHKQAGLLGEQIDEAEMRWLEVHEALEALPPTD
FT                   "
FT   gene            72790..73398
FT                   /locus_tag="Daro_0062"
FT   CDS_pept        72790..73398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0062"
FT                   /product="biopolymer transport protein TolA"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44821"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44821.1"
FT                   /translation="MENRSLSVVAGLITLLAMPLAALAAESGTETDQQASWRERLDKAS
FT                   ALQIESKALKEEGLKRNEQKYLECEKKFLVNSCRIDADREYQKTTHEARRLEAEGKALE
FT                   REVKKEQLADRDKRRAEEAPSREADMQMREAETAASRQASELHTEAVRSDKAKKAAEGA
FT                   KRKAEQAEKHRQKQEAHDAKVAAKKLEAERRAAEDGEKK"
FT   sig_peptide     72790..72864
FT                   /locus_tag="Daro_0062"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            73412..74626
FT                   /locus_tag="Daro_0063"
FT   CDS_pept        73412..74626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0063"
FT                   /product="Metal-dependent phosphohydrolase, HD subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44822"
FT                   /db_xref="GOA:Q47K09"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44822.1"
FT                   /translation="MIRKLSVDQLLPGMYVVDLHKRWLDHSIWIKRFKVRDESHVWELK
FT                   EQGITEVSIDTEKGIDLPPSPIARINAVEQKFKSLAEIKAAMHHTVSLGEERRRATRLL
FT                   SEASGTVNGLMVAAKAGLSVDAAQLEPVIGKMMESVIRNPDALVPLARLKRQAAYATDH
FT                   AVATAALIIAFGRQQGMPEPEIEKLALGTMVKDIGNSALDARLVSKPGMLSRAEYSIVQ
FT                   SHVEEGLAVLEATSRLSEMSVAVVLEHHERYNGCGYPYRMAGDEISVAGRMAAIVDTYD
FT                   AMTSERPYRAAISPSHALRQLYDEGGTQYDPALVAAFVKTVGIYPVGTLVLLESGHLAV
FT                   VEQMHPNNMLTPIVRVIYHVGRKQYVTVPVEVDLARKIGNHYGQIVRAESFEHWSISPL
FT                   RWQPA"
FT   gene            complement(74598..75635)
FT                   /locus_tag="Daro_0064"
FT   CDS_pept        complement(74598..75635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0064"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44823"
FT                   /db_xref="GOA:Q47K08"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44823.1"
FT                   /translation="MATPNPFTEQLIAWQKIAGRHDLPWQNTCDPYRVWLSEIMLQQTQ
FT                   VSTATPYYLRFLSSFPDVTALATAPIEVVIEHWAGLGYYARARNLHRCAQQIVTVYAGS
FT                   FPDSVEKLAELPGIGRSTAAAIAAFSFGKRAAILDGNVKRVLCRQFGIDGFPGSVTIDR
FT                   KLWTLAESLLPERDIEVYTQGLMDLGATLCTRSKPRCGDCPVAAACIARCEGRQAELPT
FT                   AKPRTKVPERTATYVLLSDGHRLLLERRPPSGLWGGLLVPPEGEPDQVAARFGLQLGEQ
FT                   SKLPALKHTFTHFKLTLEPVLCRIEPRTDLGEAGLEWVNIDKAAQAGVPTPIRKLIKQV
FT                   ASAGG"
FT   gene            75700..76200
FT                   /locus_tag="Daro_0065"
FT   CDS_pept        75700..76200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0065"
FT                   /product="Flavin reductase-like, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44824"
FT                   /db_xref="GOA:Q47K07"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44824.1"
FT                   /translation="MTQPQHDSRALRNALGRFATGVAVVTAIDPDGHPIGLTVNSFAAV
FT                   SLEPALVLWCLDNNSHNLEPFRRASHHVINILSAEQQDLSNRFATWPADRFVGLHWQRG
FT                   AGGAPIFPDCCATFEVANDTAHSAGDHTIFVGRVERFSETADLAPLLFHAGRYAALASE
FT                   QDD"
FT   gene            76243..76316
FT                   /locus_tag="Daro_R0001"
FT   tRNA            76243..76316
FT                   /locus_tag="Daro_R0001"
FT                   /product="tRNA-Gly"
FT   gene            76851..78380
FT                   /locus_tag="Daro_R0002"
FT   rRNA            76851..78380
FT                   /locus_tag="Daro_R0002"
FT                   /product="16S ribosomal RNA"
FT   gene            78441..78517
FT                   /locus_tag="Daro_R0003"
FT   tRNA            78441..78517
FT                   /locus_tag="Daro_R0003"
FT                   /product="tRNA-Ile"
FT   gene            78529..78604
FT                   /locus_tag="Daro_R0004"
FT   tRNA            78529..78604
FT                   /locus_tag="Daro_R0004"
FT                   /product="tRNA-Ala"
FT   gene            78816..81698
FT                   /locus_tag="Daro_R0005"
FT   rRNA            78816..81698
FT                   /locus_tag="Daro_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            81796..81909
FT                   /locus_tag="Daro_R0006"
FT   rRNA            81796..81909
FT                   /locus_tag="Daro_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(82138..82770)
FT                   /locus_tag="Daro_0066"
FT   CDS_pept        complement(82138..82770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0066"
FT                   /product="Peptidase S16, lon N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44825"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44825.1"
FT                   /translation="MGWFDFIRSPSGNAVETLRIPLFPLSTVLFPGSMLPLKIFEQRYL
FT                   DMAAACMKINSPFGICLIEKGSEVGETAVPHPIGTLATISNWEMEQLGILMITAQGGRR
FT                   FRIIESTVGAGGLLEANVELLAETGPTPLPPERERLVPLLRRIVGDLGKERMPEPYRYD
FT                   EAEWVGYRITEVLPIQNLAKQKLLELDDPIARLEILEKYLTQRRLLG"
FT   gene            complement(82772..83383)
FT                   /locus_tag="Daro_0067"
FT   CDS_pept        complement(82772..83383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0067"
FT                   /product="Phenylacrylic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44826"
FT                   /db_xref="GOA:Q47K05"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44826.1"
FT                   /translation="MSKTICLALTGASGMPYGLRLLECLLNAGCKVQLLYSQASQIVAR
FT                   QELDFELPSRPADAKSALLARFPSISPENLTVFGREEWFAPVASGSNPPDAMIICPCSM
FT                   GTLAAIAQGLADNLIERAADVVMKEGRKLVLVPRETPFSAIHLENMLRLSRAGAVILPP
FT                   SPGFYHHPQSVQDIVDFVVARALDQIGVAHKLMQRWGEER"
FT   gene            complement(83383..83913)
FT                   /locus_tag="Daro_0068"
FT   CDS_pept        complement(83383..83913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0068"
FT                   /product="Heptaprenyl diphosphate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44827"
FT                   /db_xref="GOA:Q47K04"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44827.1"
FT                   /translation="MTRSVIELKVSDEDRRVAWLATAAVGLSLVDAAIPSPLPGVKPGL
FT                   ANIVTLVVLARYGWASAVWVSGLRVLAGSLLLGYFLAPGFFLSLTGTILSLLALGLARH
FT                   LPQRWFGPVSLSILAAFAHIGGQLLLARLWLIPHDGVFLLTPVFAGAALVFGTINGLIA
FT                   AKLLAEPAPSEMP"
FT   gene            complement(83894..84268)
FT                   /locus_tag="Daro_0069"
FT   CDS_pept        complement(83894..84268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44828"
FT                   /db_xref="GOA:Q47K03"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44828.1"
FT                   /translation="MSWLALLRPGDWLVILGSAALVGSSIPVFWQGGLADRAIIRQEGR
FT                   VFAEIDLKARKQFEVGGPLGTTLVAVEPGRARIVSDPSPRQYCVKQGWLMRPGEIAICA
FT                   PNRVSVQIMGRTKVYDSISY"
FT   gene            complement(84268..85125)
FT                   /locus_tag="Daro_0070"
FT   CDS_pept        complement(84268..85125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0070"
FT                   /product="Uncharacterized P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44829"
FT                   /db_xref="GOA:Q47K02"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47K02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44829.1"
FT                   /translation="MLRFMELILISGLSGSGKSVALNLLEDSGYYCVDNLPVVMLTVLI
FT                   GMLKEEHVHKVAVAIDARSGHGIDLLPGKLDKLKRSGINLTFLFLFSHEETLLKRYSES
FT                   RRRHPLATKGQTLEEAIRAERALLDPISDLGHRIDTSGMKANALREWVRQFIEAEPGQG
FT                   LTLMFESFGFKYGIPLDADLVFDVRCLPNPHYDPELRPFNGKDKPIIDFLEGEDEVCRM
FT                   RDDIARFVDTWLPCYIRDNRNYLTVAIGCTGGQHRSVYIAEWLAGEFANRARVLVRHRT
FT                   LAGT"
FT   sig_peptide     complement(85060..85125)
FT                   /locus_tag="Daro_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.880 at
FT                   residue 22"
FT   gene            85185..86354
FT                   /locus_tag="Daro_0071"
FT   CDS_pept        85185..86354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0071"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44830"
FT                   /db_xref="GOA:Q47K01"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44830.1"
FT                   /translation="MPPTPPLLDLPFLAELTALRRDIHAHPELAFDENRTADIVARELQ
FT                   RYGLEVHRGIAKTGVVGVLRAGTAQRMIGLRADMDALPLAELNEFPHHSKHAGKMHACG
FT                   HDGHTATLLGAARYLAEKPDFDGIAVFIFQPAEESEGGAAVMIEDGLFERFPVEAVFGL
FT                   HNWPGIPVGEMMVMPGPVMAGTCAFEIFVRGHGCHAAMPHQGVDSIVAGAQLVQALQTV
FT                   VARTLHPCESAVVSVTQFHAGEAWNIIPEEVVLRGTIRTFKPEVQEAVERAIERLCSGI
FT                   AAANGAQISVRFDHRYPPTVNSLAEAKFCQQVAAEVFGSDKVLTDILPSMGAEDFAYML
FT                   NEKPGCYVWLGNGPGTGGCTLHNPHYDFNDELLTLGTSYWVNLVRRWLR"
FT   gene            87027..87800
FT                   /locus_tag="Daro_0072"
FT   CDS_pept        87027..87800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44831"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q47K00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44831.1"
FT                   /translation="MLDSPVDVDTRWQQFAPDLDPAKLLFSEVIPGGCHWSWTLPRGTA
FT                   LRLTALQPGANLSLVLYAAREKLERYNMPDSLKAQHTAHYTRGHVLMSDMGRSMASIIG
FT                   DSLGWHDPLGLLLDARRLHEKYGTHDYQSFRNGMYRSGRDGLLIEIGKYGLSRRDLIAP
FT                   VNFFSKVTVDDDGCFHFVPQHAPAGASVDLRLDMDVIVAVSAAPHPLDPRSEYAPSPVG
FT                   VAVWRSGVAPADDYCRAFRPENARALYNSDLQYLA"
FT   gene            87805..88464
FT                   /locus_tag="Daro_0073"
FT   CDS_pept        87805..88464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44832"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44832.1"
FT                   /translation="MTMTTTAIRVRESELQAANAIHDVTLPSGEPWLHELKRGQTLRIV
FT                   DLDGNQAADVIFFNRHDTDEHYSATETMLRQGGIYLTTDSVLYSSDGNPMLSIVADTCG
FT                   RHDTLGGACAAESNTVRYALAKKFMHSCRDNYMLCIQESDSGLGKADLVPNVNFFMNVP
FT                   VTGEGDLKFDDGVSGPGKYVELRAEMDLLVLVSNCPQLNNPCNAYNPTPVQFLIWD"
FT   gene            88541..92146
FT                   /locus_tag="Daro_0074"
FT   CDS_pept        88541..92146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0074"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44833"
FT                   /db_xref="GOA:Q47JZ8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44833.1"
FT                   /translation="MFSKVLIANRGAIACRIIRTLKKLGIASVAVYSEADANSLHVTLA
FT                   DESVCIGPAPAAESYLKAERILEAAQQTGAQAIHPGYGFLSENPDFSDACEAAGIAFIG
FT                   PTKAQMLAFGLKHTARELAEAAGVPLLPGSGLLSDVGHARGEAARIGYPVMLKSTAGGG
FT                   GIGMRLIWAEDELAEAFASVDRLARANFKEAGIYLEKYVESARHIEVQVFGDGVGKVLA
FT                   LGERDCSVQRRNQKVIEETPAPGLNDAQRQGLAETAVRLMASVSYRSAGTVEFVMDAAT
FT                   GAFYFLEVNTRLQVEHGVTEEVTGVDLVAWMVLLASGDLRLPATAPRPRGASIQVRLYA
FT                   EDPNKNFQPSSGLLTEVTFPEGVRVETAVKTGSEVPPYYDPMVAKLIVHAESREAAVDK
FT                   LAAALAATRVAGIETNREYLRQILAGSVFRAGEQTTRYLNAFHYQPASIDVLEPGVQTS
FT                   VQDWPGRVGYWDVGVPPSGPMDDLALRAANRLVGNPEGMAGLECTMTGPTLKFNCPVVI
FT                   ALSGAETAATLDGEPLAFWQAHAVKAGSILKVGAIRDAGCRSYLAVAGGIDVPDYLGSK
FT                   STFTLGQFGGHGGRTLRLGDVLHIEATETLPMVELPAEMAPVYEHHWEIGVLYGPHGAP
FT                   DFFTDGDIGTFFATDWEVHYNSSRTGVRLIGPKPAWARTDGGEAGLHPSNIHDNAYAIG
FT                   AIDFTGDMPVILGPDGPSLGGFVCPAVVVQAELWKLGQLRPGDTVRFLPISAASAACRL
FT                   SEVDQAVASLAAPLTTRLPSAVAELGTPVLAELPALGDRPRVVYRQAGDAYLLVEYGPL
FT                   VLDIELRFRVQALMDWLKANPQPGILDLTPGIRSLQVHFDARRCDRAVLLAMLLAAEQA
FT                   LPAVDDMVVPSRTVWLPLSWDDPATKLAIEKYMQSVRKDAPWCPSNIEFIRRINGLESI
FT                   EQVYATVFEASYLVLGLGDVYLGAPVATPVDPRHRLVTTKYNPARTWTPENAVGIGGAY
FT                   MCVYGMEGPGGYQFVGRTVQMWNRWNHGARGTAQFAQPWLLRFFDQVRFTPVSEQELVR
FT                   WRQDFLAGRASVRIEEGSFRLSDYRQFLTDNAASIGDFKARQQAAFEAERERWKEAGQA
FT                   EYISESDIAAAGTDSELDLPEGASLVVNHVPGNVWKILVTPGQRVKAGEPLVIVESMKM
FT                   EFTVPAPEDGEVLQLLCQEASPVAAGQDLLVLKTT"
FT   gene            92156..93958
FT                   /locus_tag="Daro_0075"
FT   CDS_pept        92156..93958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0075"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44834"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44834.1"
FT                   /translation="MIPAQLDFASLAAAYRAGLKPRDLFRHLLRLAQDDTHQAWISLLP
FT                   EERLLALADALEGRDPATLPLYGIPFAVKDNIDLDAMPTTAGCPDYAYLPGESAVVVAK
FT                   LMAAGAIPLGKTNLDQFATGLNGTRSPFGACRNAFDPAYISGGSSSGSAVAVALGQVSF
FT                   ALGTDTAGSGRVPAAFNNLVGLKPSCGLLSSRGVVPACRSLDTVSIFTLSAGDAAKVFA
FT                   AAAGYDAADPFSRPLQPHGRGFPAGDAFRFGVPRDDQLAFFGDTINPALFAAAVARLER
FT                   LGGQRCEIDFAPFLETARLLYGGPWVAERYHAIKDFIERQPESLFPVTREITLAGGRAT
FT                   AVEAFAAAYRLRELKRSCDAVWSDLDLIITPTAGFHPTIAAVEADPIRLNSDLGYYTNF
FT                   MNLLDYSAVAVPAAFRPDGLPFGVTLFAPAHQDIPLLELAARWQADSALPLGTSEGTAK
FT                   VAAGLDVDPTAGGRVRVAVCGAHLSGLPLNWQLTQRGGRLISVCRSAPDYCFYALAGGP
FT                   PLRPGMVRVNEGGSAIDMEVWELPSERFGDFVAGIPAPLGIGKVRLEDGSEVCGFICEG
FT                   AAVASAEDITAFGGWRAWLASRNS"
FT   gene            complement(94027..94482)
FT                   /locus_tag="Daro_0076"
FT   CDS_pept        complement(94027..94482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0076"
FT                   /product="transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44835"
FT                   /db_xref="GOA:Q47JZ6"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44835.1"
FT                   /translation="MADEDKNTSVSRISISLPPALLDELDTMVASRGYGSRSQAIADMV
FT                   HYQLAEHKRKLGNDVMVGTITLLYDRSTRGLQKGLSDIQFKYIDEVISSLHVHLSHDQV
FT                   MEVILVQGHAHDIQEIANELITQRGVITGQLQLMAAVIPPLQAPGDL"
FT   gene            complement(94510..95871)
FT                   /locus_tag="Daro_0077"
FT   CDS_pept        complement(94510..95871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0077"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44836"
FT                   /db_xref="GOA:Q47JZ5"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017536"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44836.1"
FT                   /translation="MNSKEDLARLQQELEAKGVKYCIGAYVDIHGVPKAKVVPIHHLLH
FT                   MAKGSERYTGYALDGLGQAPNDDELTSIPDFSRLIQLPWEPKIAWIPSDNHFQGKPYPL
FT                   NTRVALQNQLAEAAKLGFGMNLGIECEIFLLRQNADGSLSVPDPEDKLAKACYDVRGFT
FT                   NNFSWLDKVATAINDLGWDLYSFDHEDANGQFEFDFQYADALTTCDRLTFFRYMAKHYA
FT                   REEGLLATMMPKPFADKTGNGAHFNMSLYDLQDGRNLFACDPKDDPNGIGLTKLGYHFV
FT                   AGILKHGRALCAVFAPTVNSYKRLVRRGAMNYFSWAPVFNSYGSNNRTNSVRIPSGGGR
FT                   CESRNADGAVNPYLVATLVLAAGLEGIREGLDPGKPNEDNLYAISEAERHARGIEFLPQ
FT                   TLQEAVAAFAADPLVEQTLGKELRDEFIRYKSEEWEAYHLTVSQWEIDRYSYMF"
FT   gene            complement(95911..96669)
FT                   /locus_tag="Daro_0078"
FT   CDS_pept        complement(95911..96669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0078"
FT                   /product="Creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44837"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44837.1"
FT                   /translation="MLWNDLTWQELPDVLAACGHAAILPVGATEQHGPHLGCGVDTVIA
FT                   DQLCRAVAKRTGVPMLPPLPYGCSLGHSRRWPGTIAVTPVVLIEFVKQIGDWAYHSGVR
FT                   RLFIVNAHVTNAAPLRCALEMLRAEHDDLMVAVINTASLSQRVREFHAADGDDWHANDA
FT                   ETSLMLAIAPEGVRPEKLPEADDPDRTGCCVFAHPVNRTSRNGVTGQPSAATAAKGEQW
FT                   FAWLSDDLAELIARGCQETPPLDFSYFSQA"
FT   gene            complement(96674..97597)
FT                   /locus_tag="Daro_0079"
FT   CDS_pept        complement(96674..97597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0079"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44838"
FT                   /db_xref="GOA:Q47JZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44838.1"
FT                   /translation="MNAPQNSSLPSYLDQTAEVRERFQRIYERETILEVRQLSKRYQTP
FT                   QGETEALRGIDFKVHRREFVCVIGPSGCGKSTLIRILAGLDKHSDGDVLLDGKPVNGPG
FT                   RDRGMVFQGYSLFPWLTVKENVMFGPEMSGHTRNTADNQARQWLDLVGLSKFADSYPHQ
FT                   LSGGMRQRVAIARALVNEPRILLMDEPFGALDAQTRAKMQHHLLDIWKNLDITILFITH
FT                   DLDEAVYLADRILVLKPHPGEVQEIIEVPVPRPRTPGQFDSPVFRATKARIEALIHPPV
FT                   ESGEDEENNPEAGPMIRFTNVTDNVE"
FT   gene            complement(97608..98564)
FT                   /locus_tag="Daro_0080"
FT   CDS_pept        complement(97608..98564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0080"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44839"
FT                   /db_xref="GOA:Q47JZ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44839.1"
FT                   /translation="MSAPTLWLNAPQRRRALLTVGSFLLPILVWCLVSYLPFVWHPQVL
FT                   IDEPGGVDYFQTGMRVDRSDFADQLADMAQQGLPLPSGSPANPIYLPAPHEVAKAFYSG
FT                   FTSPPEQKNAPWLHESLWHSIQIIFWGFVISSIVGVPLGILAGTYASLGRLSEPFIEFF
FT                   RYLPAPAFGALAVAVLGIYDGPKIAIIVIGTFFQQVLIIANTTRKLEATLIEAARTLGS
FT                   RGWRLIARVVVPGILPNLYQDQRILLGWAWTYLIVAELIGTSSGITWYITQQARYQHFD
FT                   NVYAAIIIIGIIGFGSDLLLARLGRKLFPWDSGREKG"
FT   gene            complement(98595..99593)
FT                   /locus_tag="Daro_0081"
FT   CDS_pept        complement(98595..99593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0081"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44840"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44840.1"
FT                   /translation="MNTLKSASRTRRWLTRLVLPVAAAFSLTAQAAQPLKIGYSDWPGW
FT                   VAWQVAIDKGWFKEAGVDVKFEWFDYSASMDAFAAGKIDAVTMTNGDALVTGAGGAKSV
FT                   MLMLTDYSNGNDMIVAKPGIKSIKDLKGKKVAVEQGLVEHLLLLNGLKKAGMKESDVTL
FT                   VNAKTNEMPQMLTAKDIAAIGAWQPVSGEAMKAVPGSKPIYTSADEAGLIYDVLAANPA
FT                   SVKARRADWQKVVKVWDKVVAYIEDPKTQPDAVKIMAARSGISPVEYLPLLKGTKLLSL
FT                   EEGKKIYVKGDGFKTLYGSTKIVDSFNVANQVYKAPEKIDGYLDSSFTNGK"
FT   sig_peptide     complement(99498..99593)
FT                   /locus_tag="Daro_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(99954..100256)
FT                   /locus_tag="Daro_0082"
FT   CDS_pept        complement(99954..100256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44841"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44841.1"
FT                   /translation="MACAARDAAARSATTLNEFGDALSRLGPLAKTLTTAQAEVMIAVN
FT                   AGNVDEAKALINSKETSAWRGMRKARFDDIDGASKAGRLENMSGALPQHVSRFTL"
FT   gene            complement(100399..101313)
FT                   /locus_tag="Daro_0083"
FT   CDS_pept        complement(100399..101313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0083"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44842"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44842.1"
FT                   /translation="MTVKLPGSMQVLERGWLSANNILFFDGEKATLVDSGYVTHAGQTV
FT                   ELVRHSLAGRQLSRLINTHSHSDHIGGNAALKAAFDCEIIVPAGLHAAIADWDEDALLL
FT                   SPLGQQNARFQHDSLIGPDNEIEMGGLNWQALAVPGHDMEALAYYNPEQRILISGDALW
FT                   ENGFGVIFPELLGEADGLASTQATLEMLSHLAIDTVIPGHGRPFSTVDAAFERAFRRLN
FT                   QFQNNIEQLAWHAIKVIVAFAMMEKRRIVKNDFPAFVLALPFAVDVNTRFLSMADDALV
FT                   AKIERELLLVNALRLEDGMILAG"
FT   gene            complement(101482..101691)
FT                   /locus_tag="Daro_0084"
FT   CDS_pept        complement(101482..101691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0084"
FT                   /product="Protein of unknown function DUF1289"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44843"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44843.1"
FT                   /translation="MVPSPCINVCQMEANNGLCRGCLRTIEEITVWSRLDDTAKINILA
FT                   AVARRRQEYDPCESELRCDCNRND"
FT   gene            complement(101691..102680)
FT                   /locus_tag="Daro_0085"
FT   CDS_pept        complement(101691..102680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44844"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44844.1"
FT                   /translation="MSLFSAVSDFLKPDPPLDSSVQKALDRVAELVDPLLKLAPGFEKH
FT                   LKGPLQHALGYCDGLVASLPGPIDINRQAFANDPLVHALFATANDIDQMLGRSQAVRDF
FT                   LATPCSWESDHFYAMFAARRQQKTQLGMEQQGEVIRNDVPQLVLYFSGQTLIEPSCQLE
FT                   TTLHGLRCKALESLLHTFHSHLDVLRREREGLRTDVSIERAHLTTFRSAMGGHEIEVGT
FT                   RHLAELDAKLRHSAEAMMPEHLLAALADYLQSPEPALRLTPVSITVDRLGIVKDAPTGD
FT                   INTHTINFPELTARDRRLHLAMLARISRDEALEAVEMVRDQQHRFMLI"
FT   gene            complement(102677..103582)
FT                   /locus_tag="Daro_0086"
FT   CDS_pept        complement(102677..103582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0086"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44845"
FT                   /db_xref="GOA:Q47JY6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44845.1"
FT                   /translation="MSLPAKVKIVEVGPRDGLQNEKLVVPTDIKIELINRLADVGLSVI
FT                   EATSFVSPKWVPQMGDNAAVMQGIKRNPSTIYTALTPNLQGFDGAVQAGANEVAIFGAA
FT                   SESFSRKNINCSIAESLKRFEPVVSAASALEIPVRGYVSCVVGCPYEGAIDPHKAADVA
FT                   KILFDMGCYEVSLGDTIGVGNPATIQRMIEACAKHIPISKLAGHYHDTYGMAIANIYAS
FT                   LEMGMAVFDSSIAGLGGCPYAKGASGNVATEDVVYLLHGLGIETGIDLAKLAGIGDWIS
FT                   SAINRPNGAKAGRALCTGNE"
FT   gene            complement(103668..104351)
FT                   /locus_tag="Daro_0087"
FT   CDS_pept        complement(103668..104351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0087"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44846"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44846.1"
FT                   /translation="MSNQSLVGKRVLITQADMFMGPVLCEVFARHGATVIANTDALLAP
FT                   DAPATVVAQAGQIDALVANLAMPAPTTAATEVSDEEWRDTFAILVDPLARLLRAALPAM
FT                   IERRSGKILVMGSASALRGMKRASTYSAARGAQLAYVQAVGVEVAPHNVQVNAIAQNFV
FT                   DNPTYFPPEVQANPRFQERLKREVPLGRLVGADEDAEFAAYLCSDSANCFVGQVFPVCG
FT                   GWVMR"
FT   gene            complement(104548..105177)
FT                   /locus_tag="Daro_0088"
FT   CDS_pept        complement(104548..105177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44847"
FT                   /db_xref="GOA:Q47JY4"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44847.1"
FT                   /translation="MNDLRRKLILVGGMAAIPMATGCFTSALVQDATTPDRTVYAETVS
FT                   SILVSGDGKALVVVGEKYHYIFDAPETVKATLQSDFRKIVEVGFDRFVVDTSQRITGTY
FT                   RLRIDKNAPAEQKEKALAAGFKALPTGELVASGSVTGKRYAANGIQPTDASQRLQKEYQ
FT                   VSIAEEKALGAKPAKLLLTPITIAVDGVLFLAAIPLLALVAFASQR"
FT   sig_peptide     complement(105088..105177)
FT                   /locus_tag="Daro_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.878 at
FT                   residue 30"
FT   gene            complement(105215..107215)
FT                   /locus_tag="Daro_0089"
FT   CDS_pept        complement(105215..107215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0089"
FT                   /product="3-methylcrotonoyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44848"
FT                   /db_xref="GOA:Q47JY3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44848.1"
FT                   /translation="MFTKILIANRGEIACRVIKTAHRMGIRTVAVYSEADANARHVRLA
FT                   DEAVLLGPAAARESYLVADKIIDACKRTGAQAVHPGYGFLSENADFADALAASGIAFIG
FT                   PPASAIRAMGSKSEAKKLMGSAAVPLTPGYHGDDQTPALLHKEADAIGYPVLIKAAAGG
FT                   GGKGMRLVEKSEDFPDALASCKREAISSFGDDHVLIEKYITKPRHIEIQVFADTLGNCV
FT                   YLFERDCSVQRRHQKVLEEAPAPGMPEERRRQMGEAAVAAAKAVGYVGAGTVEFIANQD
FT                   GSFYFMEMNTRLQVEHPVTEMITGQDLVEWQLRVASGEPLPLRQEQLQIRGHALEARIY
FT                   AEDASKGFLPATGKLVRLAPPAESLNVRVDTGVEEDDEITPFYDPMIAKLIVWDEHRDA
FT                   ALARMRKALADYQVAGVTTNIDFLSRLVACPAFAGADLDTGLIERQKEFLFPETQAVPR
FT                   DVLLVATVGELLWEQHEAKQAARANGDPYSPWHARDGWRMNLSSARTISFRDGEALVDT
FT                   QVRYQRDQWQITLNGETTLARGKKLDGDRFAVEFDDRRLIASVVAVADKRSIFLQGTTF
FT                   TLLRDDPLHRVDAGDSHGGGLTAPMPGKVVAMLAQPGQKVEKGTPLLILEAMKMEHTIT
FT                   APAAGTVKAFCYAAGEQVTDGAALVEFESEA"
FT   gene            complement(107219..108004)
FT                   /locus_tag="Daro_0090"
FT   CDS_pept        complement(107219..108004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0090"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44849"
FT                   /db_xref="GOA:Q47JY2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44849.1"
FT                   /translation="MFTALEIELNGPVATIWMNRPDLHNAFDETLIAELTAACVALDQD
FT                   DDVRVVVLAGRGKSFSAGADLNWMKRAANNGLDDNLNDARALAKMLRTLAELKKPTIAR
FT                   IQGAALGGGMGLAAACDIAVASSKAVFATSEVKFGIIPSAISPYVLRAIGARQATRYFQ
FT                   SAERIDAFRARELGLVHEAVSPEDLDAKIQEIVATLLQGGPLAQAAAKDLIRAVDSRPI
FT                   NDNLVEDTAHRIAHLRATPEAREGIAAFLDKRQPNWIGE"
FT   gene            complement(108017..108634)
FT                   /locus_tag="Daro_0091"
FT   CDS_pept        complement(108017..108634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0091"
FT                   /product="negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44850"
FT                   /db_xref="GOA:Q47JY1"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44850.1"
FT                   /translation="MYLPKHFAETDIGTLHALMREYPLATLVSHGPDGLNANHIPLHLD
FT                   AGASPNGTLQGHIARANPLAKASAVDGEVLVIFQGPEGYISPSGYATKAEHGKVVPTWN
FT                   YTAVHAYGQLRLIDDADWVLAQVSALTAAHEASLPQPWSVSDAPADYIEKMLGAIVGIE
FT                   ITIDRLVGKWKVSQNQPATNQASLIAAMEGQPMADLIRQRQQ"
FT   gene            complement(108638..110245)
FT                   /locus_tag="Daro_0092"
FT   CDS_pept        complement(108638..110245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0092"
FT                   /product="Carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44851"
FT                   /db_xref="GOA:Q47JY0"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44851.1"
FT                   /translation="MTVLKTQLNPRSADFQANADAMRTVVADLHEKVDKIALGGPEAAR
FT                   QKHLARGKLLPRERVSGLLDPGTPFLEIGQFAAYGMYGGDVPAASVIAGIGRVHGVECM
FT                   VVANDATVKGGTYYPLTVKKHLRAQEIALENHLPCVYLVDSGGAFLPMQDEVFPDKEHF
FT                   GRIFFNQANLSAKGIPQIAAVMGSCTAGGAYVPAMCDESIIVKNQGTIFLGGPPLVKAA
FT                   TGEVVSAEDLGGADVHTRISGVVDHLAENDAHALAIARRIIKDLNWKKQPPVTLTAPAE
FT                   PLYSAEELYGVIPTDSKKPFDVREIIGRIVDGSDFDEFKARYGTTLVCGFARIYGYPVG
FT                   IVANNGILFSESALKGAHFIELCAQRGIPLVFLQNITGFMVGRKYENGGIARDGAKMVT
FT                   AVATAKVPKFTVVIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAAGVLATVK
FT                   RDGMEATGKTWSAEEEAAFKAPIREQYETQGHPYYASARLWDDGIIDPADTRRVLGLGL
FT                   SASMNAPAEETKFGIFRM"
FT   gene            complement(110302..110901)
FT                   /locus_tag="Daro_0093"
FT   CDS_pept        complement(110302..110901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0093"
FT                   /product="Conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44852"
FT                   /db_xref="GOA:Q47JX9"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44852.1"
FT                   /translation="MKRICVFCGSNAGHNPLYRTEAEKLGRLLAARGIELVYGAGNIGL
FT                   MGAVADACLEAGGTVIGIIPEALMGKEVAGRAVDHRALTRIEVVDSMHTRKARMAELSD
FT                   GFIALPGGFGTFEEFCEILTWGQLGFHVKPMGLLNVNGFYDPLLGLFDHAVQEGFLRAQ
FT                   NRAMALADTDIEHLLDAMAAYQPEPVSKWLKEEKQL"
FT   gene            complement(110924..111529)
FT                   /locus_tag="Daro_0094"
FT   CDS_pept        complement(110924..111529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0094"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44853"
FT                   /db_xref="GOA:Q47JX8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44853.1"
FT                   /translation="MSEPIDFYFDFSSPYGYLMSEKIDAVAAKHGRKVRWHPVLLGVIF
FT                   QATGSRPPADGVSSKSTYMFHDFHRSARHMGIPYNPPSRFPLPTQNAARAYYWLHGQDC
FT                   ALARQFAHAVYRGFFVDDLDVSSPDTVLDIAAKLGIDRAQLATALQAPEIKARLKDECD
FT                   KALAAGVFGSPHVIIDGEAFFGADRLPQIEHWLETGGF"
FT   gene            complement(111562..112383)
FT                   /locus_tag="Daro_0095"
FT   CDS_pept        complement(111562..112383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0095"
FT                   /product="Protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44854"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44854.1"
FT                   /translation="MAKYETNDTSPRRLAVLIDADNAQATVIEGLLAEVARFGEATVKR
FT                   IYGDFTSPSSSQWKKVLNQHAIKPVQQFAYTTGKNATDSTMIIDAMDLLYTRRFDGFCL
FT                   VSSDSDFTGLALRIREEGLTVLGFGEEKTPDAFRNACHKFIFTEILRPLPAVETVESSR
FT                   PAAIEKLDPQIPHPPSTPVKNSAAKKPLPIQFVVQALDQAEDDDGWANLGAFGSYLTKL
FT                   QPDFDPRLYGFKKLSDLVKSKPHVFTVEERPVAGSNIKVVYVRRTPSKSGH"
FT   gene            complement(112459..113595)
FT                   /locus_tag="Daro_0096"
FT   CDS_pept        complement(112459..113595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0096"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region:Acyl-CoA dehydrogenase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44855"
FT                   /db_xref="GOA:Q47JX6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44855.1"
FT                   /translation="MILTQEQEMIRDSMRAFAQERLAPFAAEWDKNHTFPAEALKELGE
FT                   LGAMGMVVPEEWGGAGMDYMSLVLTLEEIAAGDGATSTIVSVQNSLACGITAKYGTDAQ
FT                   KEEWLKPLARGEKLGCFCLTEPHTGSDAAAITTRADRDGDHFVLNGVKQFITTGKYAHM
FT                   AIVFAVTDKAAGKKGISCFLIPTDTKGFIVGRTEDKMGQHASDTVQIIFEDCRVPASAL
FT                   LGKEGEGYKIALSNLEAGRIGIASQSIGMARAAFEAAVRYAKERVTFGVPIIEHQAVNF
FT                   RLADMNTLLDAARLMVWRAAMLKDAGKPCLKEASMAKMFASEAAEKIASDAIQIHGGVG
FT                   YTSDFPVERIYRDVRICQIYEGANDIQRLVIGRSIASE"
FT   gene            complement(113592..114506)
FT                   /locus_tag="Daro_0097"
FT   CDS_pept        complement(113592..114506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0097"
FT                   /product="Protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44856"
FT                   /db_xref="GOA:Q47JX5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44856.1"
FT                   /translation="MPQKALSLTYAKLVAAMFMWGGTWIAGRIIAQELSAPLAVASIRF
FT                   VVTALALAGFALLTGKGAPAPKTTREWGVVSGLGFFGIFLYGLCFFFGLQHITAGRGAL
FT                   VVALNPVVIVLAAWLFGHERMNRRKALGSAIALAGCLTVIGNGNPLALVEGTVGIGEWL
FT                   IVGCVMSWTAYTFIGRMATRTLSPLATTLYASLIGALLLGLAALVQGDIAPASWSWRVW
FT                   TGLFFLAIFGTAIAYTWFTEAVHTLGAGHASVFINLVPVFAVLQAALLLDERLGLPVLF
FT                   GGLLVIAGVWLTTKQKISLEISK"
FT   gene            complement(114507..115697)
FT                   /locus_tag="Daro_0098"
FT   CDS_pept        complement(114507..115697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0098"
FT                   /product="Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44857"
FT                   /db_xref="GOA:Q47JX4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44857.1"
FT                   /translation="MNDPIVIVSAARTAMGAFQGGFAGLTAANLGAVAIKAAVERAGID
FT                   ANLIEEVLMGCVLQAGQGQAPARQSALQAGLPLSAGCATIHKVCGSAMKATMLGHDGIL
FT                   AGSYGAAVVGGMESMTNAPYLLPKARGGYRLGHGQLMDHMFLDGLEDSYGKETRGRLMG
FT                   TFAEECAASYGFTREAQDEFAVRSTTRAIEASNNGSFAWEIAPTTVAGRKGDVVIDKDE
FT                   GPFAVNVEKIPTLKPAFKKDGTVTAANSSSISDGAAAMVLMRASQAAKLGLQPIARIVG
FT                   HTTHAGTPALFPSAPVGAMQKLFAKTGWTAESVDLYEINEAFAVVTMASLHDLKLDPAK
FT                   VNIHGGACALGHPIGASGARIVVTLLGALKKYGKKRGVASLCIGGGEATALAVEML"
FT   gene            complement(115726..116889)
FT                   /locus_tag="Daro_0099"
FT   CDS_pept        complement(115726..116889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0099"
FT                   /product="GCN5-related N-acetyltransferase:Carbonic
FT                   anhydrase, prokaryotic and plant"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44858"
FT                   /db_xref="GOA:Q47JX3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44858.1"
FT                   /translation="MELNSMTVTLRTLTANDSEALEQVRQYFRNYAAWLGVDLSYQNFD
FT                   QEMASLPGTYVAPQGRLFFAEVDGRPAGCVGVRPLPDSDGVCEMKRLYVDPAERGHGIG
FT                   AALALAAIKAAKEIGFRKLMIDTLPNMRMAVKLYRELGFTEAPNYYQTPVEGTMFLALD
FT                   LENWSEEEIRSENLSHLFDFNRAWARQMQEVDPTYFDRLSHLQTPEFLWIGCSDSRVPA
FT                   NQIVGLLPGEVFVHRNVANVVVHTDLNCLSVIQYAVDVLKVKHIMVVGHYGCGGVGAAL
FT                   QRDRVGIVDLWLRHVHDVHNKHLANVNSLPEAQRHDRLCELNVLEQVVNVCHNPVVQDA
FT                   WSRGQQLTVHGWVYGLKDGLIHDLGITIDCPQDLPSRYDAALKALDA"
FT   gene            complement(116928..118100)
FT                   /locus_tag="Daro_0100"
FT   CDS_pept        complement(116928..118100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0100"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44859"
FT                   /db_xref="GOA:Q47JX2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44859.1"
FT                   /translation="MNIPSLDFGLGEDINLLRDAVKAFADAEIAPRAAEIDRANEFPAD
FT                   LWKKFGDMGLLGMTAGEEYGGTNMGYLAHIVALEEISRASASVGLSYGAHSNLCVNQIR
FT                   RNGTEAQRQKYLPKLISGEHVGALAMSEPNAGSDVVSMKLKAEKKGDRYVLNGSKMWIT
FT                   NGGDADTLVVYAKTDLNAGAKGMTAFIVEKGMKGFTHGTHLDKLGMRGSNTFPLFFDDC
FT                   EVPEENVLGGVGNGTKVLMSGLDYERAVLCGGPLGIMAACMDVVVPYLHERKQFGQAIG
FT                   EFQLMQGKVADLYSTWQATRAYVYAVGRACDATDHSRTLRKDAAGAILYSAEKATWMAG
FT                   EAIQTLGGVGYTNEYPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETA"
FT   gene            complement(118135..118581)
FT                   /locus_tag="Daro_0101"
FT   CDS_pept        complement(118135..118581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0101"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44860"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44860.1"
FT                   /translation="MSIHAHDPDFAERVHASFAKQHAMDLIQATLPVVEPGRTEIHLPH
FT                   WTGVEQQHGFVHGGVVGMIADSAAGYAAMTLVSASASVLTVEYKMNLVAPADGEKLIAR
FT                   GKVVRPGRTLVVTQAEVFAVKDGKETLCALMQQTIMVMHGKTEK"
FT   gene            complement(118650..119042)
FT                   /locus_tag="Daro_0102"
FT   CDS_pept        complement(118650..119042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0102"
FT                   /product="regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44861"
FT                   /db_xref="GOA:Q47JX0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44861.1"
FT                   /translation="MSQTAITFAISDLAREFGITPRTIRFWEDQGILSPEREGSKRIFN
FT                   RRDRARLKMALRGKRLGLSLAEIKDLIGMYASTEDETPQLLECLRVMEKRRAALEQQRE
FT                   DIEAMLAEISQFENQCQKELARRSGS"
FT   gene            119142..120167
FT                   /locus_tag="Daro_0103"
FT   CDS_pept        119142..120167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0103"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44862"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44862.1"
FT                   /translation="MSLHFPHAHPPAAGELTEVAPGVYWLRMPLPFQLDHINLWLLRDG
FT                   EGWTIIDTGFPDDAVRAMWTQILDWLDGPVTRLIVTHFHPDHLGLATWLMEKTGAPLSM
FT                   TTGEFLTAHVVWHEVGGHGARFMVEQFRQHGLDAEHLAKFEQRGSGYRRAVPALPEYYH
FT                   RLMAGGIVRIDGKKWQILIGHGHAPEHLALYCAELGVLISGDMLLPRISTNVSVFAATP
FT                   EADALRWYLDSLDEMARDIPAETLVLPSHGLPFTGVQERVQALHAHHEERLQALENSCE
FT                   QAPQSAAELLDVLFNRALDTHQTMFAMGEAIAHLNYLEQAGRLSRSMDADGVIRYSRLR
FT                   Y"
FT   gene            120199..122034
FT                   /locus_tag="Daro_0104"
FT   CDS_pept        120199..122034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0104"
FT                   /product="Poly(R)-hydroxyalkanoic acid synthase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44863"
FT                   /db_xref="GOA:Q47JW8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44863.1"
FT                   /translation="MSQQTEDQSMNLPNPAEIAKTYAEVAQRASRLITQFMEKKAKDGV
FT                   DAPADELGVAKAFMDLSARLMANPYKLAQTQMNMMWDYFSLWQGSMMKMMGVPGSGPVA
FT                   APKKGDNRFRDEDWEQHFLFDFVKQSYLITARHLHDTVAGTEGLDEATQQKVNFFTRQY
FT                   IDALSPSNFALTNPEVFRETVKSHGQNLIKGLNNLLHDVESGDGQLRIRMTDTSAFEMG
FT                   KNVATTPGKVIFQNELFQLIQYNPTTPDQNKKPFLIVPPWINKYYILDLREKNSMVKWA
FT                   TDQGHTTFIMSWINPDEKLAKKSFENYLLEGSLEAINQVCAHTGEDSVNLAGYCLGGTL
FT                   TMTTLAYMAAKKDKRAASATFFTTMLDFSEPGELGIFLDEGAVAGLEKKMAERGFLEGS
FT                   EMAGTFNMLRANDLIWSFVVNNYLMGKDPFPFDLLYWNSDSTRMPAAMHSFYLRNMYLG
FT                   NLLKEPGGITLGGVKIDISKVKTPCYFISTIEDHIAPWKSTYMGARLPSGPTKFVLGGS
FT                   GHIAGIVNPPAANKYGFWTNDATDGNLPESPEDFLAGATQNAGSWWTHWNQWVTSLPGG
FT                   SAKVKARKPEDGKLAVIEDAPGSYVKFRLDTQKKA"
FT   gene            122047..122499
FT                   /locus_tag="Daro_0105"
FT   CDS_pept        122047..122499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0105"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44864"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44864.1"
FT                   /translation="MKEKGRLRPPFLFDERIDCFFRGTTDTLDRPIPVTPFPEPCLTPS
FT                   VLRTQTERRPAMFDSPVVSVHIPLALRSFSGGHDEITASGDTVGEVLAAVGHEFPAIRD
FT                   YLMSSGGDLLPGVAVFLGPRSIGELQGLATPIELEEVLSIVPIGGE"
FT   gene            122641..123888
FT                   /locus_tag="Daro_0106"
FT   CDS_pept        122641..123888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0106"
FT                   /product="Stage II sporulation E"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44865"
FT                   /db_xref="GOA:Q47JW6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44865.1"
FT                   /translation="MSEEIVSQISKALAHNENPISFAITLMEHLVVPTFVLDADQNVLI
FT                   WNRACERLTDIPAAEVLGTRNHWRAFYEEPRPCLADLLATSSLEQISDLYTASDDPSHP
FT                   SFGVHAENWCWMPRRRQHLYLAIDAGPVFDESGKLIAVVETLRDTTERHIAQIKVQEQA
FT                   SILKAHFDEQERETELARRILDHQIRGDLMQQAGVKYSVIPASNFSGDMVLAARSPSGR
FT                   MYAILADATGHGLSAAVSVLPMVQEFYRLVELSSPLSTLIESINFLLANSLPLGRFVAA
FT                   AFVTLDEAAKEGEIWVGGVPDVLMFDRAGRLERRIASSNLPLGIVKTSDGVQGIERFNW
FT                   IHACQLLLVSDGIVEACNSDDVAFGDKQLIRVVEQRLPGVELTDALQQALQQHLKGSNA
FT                   HDDMSMLVIDCPAGSD"
FT   gene            complement(123885..124340)
FT                   /locus_tag="Daro_0107"
FT   CDS_pept        complement(123885..124340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44866"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44866.1"
FT                   /translation="MTGNFTIPKFKLPDFVANLGQKLPQWPHALVLVGGLNAALKMKLL
FT                   PESELALLEDKLFRVRVLDTGGEASYTYRDGLFRPVFRPEREPDLAFAANLSAYLQLLA
FT                   RQEDPDTLFFNRELEITGDTELGLIIKNMLDAVEWPKFSSRLPLLRH"
FT   gene            complement(124357..125259)
FT                   /locus_tag="Daro_0108"
FT   CDS_pept        complement(124357..125259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0108"
FT                   /product="Peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44867"
FT                   /db_xref="GOA:Q47JW4"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44867.1"
FT                   /translation="MKLSLGPLLYFWPKGEVMEFYAEMAQNPALDIIYVGEVVCSRRQQ
FT                   LRTTDWIGLARDLTDAGKQVVVSAQALLESESDLKALRRLIDDAGCWLEANDLGAVNLV
FT                   HGQDFVAGPHLNIYNEATLASFARFGLKRWVPPLEGSRSMIEALHRKKPADVETEVFAF
FT                   GKIPLAFSARCFTARHYDLNKDDCQFKCLDHAEGLTLKTREGQDFLTINGIQTMSAQSY
FT                   NLLHEMPEMLKMGIDIVRISPQKQHINEIIAAFDAARLGEAVQVDSRDWSTSGLVDGYW
FT                   FGDAGIVQRHTQALAQLGA"
FT   gene            complement(125273..126280)
FT                   /locus_tag="Daro_0109"
FT   CDS_pept        complement(125273..126280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0109"
FT                   /product="Peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44868"
FT                   /db_xref="GOA:Q47JW3"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44868.1"
FT                   /translation="MSSLPDLVCPAGSLPALKAAVDNGADTVYLGYKNDTNARNFAGLN
FT                   FDTKTMAEGIRYAHAKGREVLMAINTFPQTGRVADWHKAVDGAVDQGVDAIILADIGLL
FT                   DYARQRHPQQRLHLSVQGSATSYEAINFCQREFGIRRAVLPRVLTLAQVEHVIKNTTVE
FT                   IEVFGFGSLCVMNEGRCWLSSYACGESPNTVGACSPAKYVKWDKKPGTMETRLNGVLID
FT                   RFGDDEPAGYPTLCKGRFDVQGDTYYALEEPTSLNVLEILPDIIKIGVKAIKVEGRQRS
FT                   PTYVAQVTRTLRAALDSLRDGSERFHVKPAWQAELSKVSEGSQATLGAYSRPWR"
FT   gene            126495..127385
FT                   /locus_tag="Daro_0110"
FT   CDS_pept        126495..127385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0110"
FT                   /product="Response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44869"
FT                   /db_xref="GOA:Q47JW2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44869.1"
FT                   /translation="MNKERVLVVDDEQLNLFIIEEFLEQEDIELEMHSNPLEAWASLSA
FT                   ADSDFSLVVLDRMMPELDGMELLRRMKREARFADIPVIMQTAASSPDQVREGLEAGAYY
FT                   YLTKPYEPEALISIVRAAMEDRRGRSQLRTRAARLEETQKLIQSVEYRFVTLEDVSCLV
FT                   PVLASMCPVPDVAAPGLSDLMVNAVEHGNLGVTYQEKSLLKWEGDWEEEIRRRLALPQF
FT                   RDRFATVRVERNADSVAFTITDQGDGFEWNKFLSFDPDRAFDPNGRGIAMAKMMSFSAL
FT                   DYQGRGNIVVAKVNC"
FT   gene            complement(127389..128390)
FT                   /locus_tag="Daro_0111"
FT   CDS_pept        complement(127389..128390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0111"
FT                   /product="Rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44870"
FT                   /db_xref="GOA:Q47JW1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44870.1"
FT                   /translation="MSRFVAPLSLALLLAACGGPSPIRDTTVDGQKGSVSKSPTPTRKP
FT                   TAVLKRGGGFYKDDGPAEDIPDGLDDIPDAEPKWEPLHKPATKPYVVLGKEYVPNTTVK
FT                   PYKARGIASWYGKKFHGQKTSIGEPYDMFAMTAAHPSLALPSYVRVTSVQSGKSVVVRI
FT                   TDRGPFHADRVIDLSYTAAYKLGLINGGSGQVEVEAIIPGDLAGTTYAQTTSPPRVTST
FT                   TNGDDIEQLAKRMALEERPVQTAVMAGMSGDTGIQKGIYLQLGAFSNVENAENLKNHLL
FT                   RELDWLTETMRVNPGSGIHRLHLGPYANRGDADRVAEKISAVLGFRPTVITR"
FT   sig_peptide     complement(128334..128390)
FT                   /locus_tag="Daro_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.942) with cleavage site probability 0.824 at
FT                   residue 19"
FT   gene            complement(128387..129499)
FT                   /locus_tag="Daro_0112"
FT   CDS_pept        complement(128387..129499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0112"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44871"
FT                   /db_xref="GOA:Q47JW0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44871.1"
FT                   /translation="MIDIVGTLRRSWQQLIAHIDFPLLFITLTIMAVGLATVYSATFDG
FT                   NQRVLSQLGNMGVAMTIMWFVSRLPPQKLMRFAIPLYVLGVVLLVAVFLFGIKVNGAKR
FT                   WLPLGFTRIQPSEIMKIAMPLMLAWYFQKYEATLRFKHYIGAGLLLLIPFALIAKQPDL
FT                   GTALLVGAAGFYVIFFAGLPWKVIAGLVIAAGSAAPLIWSMMHDYQRKRILTLLDPTTD
FT                   PLGAGYHIIQATIAIGSGGAIGKGYLNGTQTHLEFIPEKHTDFIFAVYSEEWGLIGNAT
FT                   LVFLYTLLIGRGLIIASAAPTLFTRLLAGAITLGFFTYAFINMGMVSGILPVVGVPLPF
FT                   MSYGGTALVTLFLGIGILMSIHTHRMLVKK"
FT   gene            complement(129496..131406)
FT                   /locus_tag="Daro_0113"
FT   CDS_pept        complement(129496..131406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0113"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44872"
FT                   /db_xref="GOA:Q47JV9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44872.1"
FT                   /translation="MGDFNNPEADLDRFRFRIGFAAVTVLLAFGVLIGRFVWLQVIQHD
FT                   FYQTRAEDNRIALIPIVPNRGVITDRNGVVLAHNYSAFTLEITPSQAGDLEATIDSLAE
FT                   VIDIQPKDRKRFKRLLDEAKNFESIPIRTRLTDGEVAKFAAHRYRFPGVEVKARLFRQY
FT                   PLANIASHAIGYIGRITERDLKWIEESEKQANYKGTDHVGKTGLEQHYEFELHGETGYE
FT                   EVEIDAGGRALRSLKRIPPVSGNNLALTLDAKLQEITELAFGERKGSLVAIDPSTGGIL
FT                   ALVSNPTYDPNLFVDGITPDNWKELNEHPSKPMVNRAINGAYPPGSTFKPFLALAALEM
FT                   GKRTPNQTINDPGYFNFGNHQFRDDKKGGHGSVDMYKSIVHSCDTYYYMLANDMGIDNI
FT                   AKFMGSLGLGQRTGVDLGKDDSGESKGVLPSQEWKKQRFKKPEQQRWYAGETISIGIGQ
FT                   GYNAYTPIQLAQATATIANNGVMFRPHLVHYIIDTKTGEKRQVEPKPIRDLNLRPQNID
FT                   VIRRAMVGVNKEGTGARAFAGAPYESAGKTGTAQVFSLKGAQYKEGGMKKELRDHALFI
FT                   AYAPADKPKIALAVLVENGGFGAQSAAPIARMVIDYYLLGKLPGGAAKDDPAAIEEDSE
FT                   E"
FT   gene            complement(131425..131946)
FT                   /locus_tag="Daro_0114"
FT   CDS_pept        complement(131425..131946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0114"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44873"
FT                   /db_xref="GOA:Q47JV8"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44873.1"
FT                   /translation="MQPTFSSSRILLPVRPWFIFFSLIAAALLNFLPTAHWPGMPDWIA
FT                   LVLCFWSVREFRKVGMGWGFALGLLMDVADGAVLGQHCFAYVILAYTAASLSRRILWFP
FT                   LVQQALQIMPLLLAAQVLQALMRLAVGADFPGWGYFVGPLIATLLWIPATFILLLPQYR
FT                   PVEQDPNRPI"
FT   sig_peptide     complement(131839..131946)
FT                   /locus_tag="Daro_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.937) with cleavage site probability 0.928 at
FT                   residue 36"
FT   gene            complement(131946..132881)
FT                   /locus_tag="Daro_0115"
FT   CDS_pept        complement(131946..132881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0115"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44874"
FT                   /db_xref="GOA:Q47JV7"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44874.1"
FT                   /translation="MAGLDHAPPPFFKRGPAPLALLTFYIAVSLAIFVLDLRFKSLELL
FT                   RQSIALVIDPVQRVAQTPGSLVDYAASYLQGLRALQLENGELKHNQLTTAPNLQRLAQL
FT                   EVENERLRKLLAVKEREKANGQVTQILYTARDPFSRKVIVDKGQQAGIVAGQPAIDEAG
FT                   VVGQVTRVFPFSAEITLITDKDQVVPVQVVRSGQRSVVFGLGNGQLELRYMPANADIQI
FT                   GDILVTSGLDGIYLAGFPVAKVVDIERDSAYSFARIFCVPIAGVENFGEVMVLDPRKAL
FT                   PPAPPESSGRPGSSDKPSLRKKKKTAGKEH"
FT   gene            complement(132912..133955)
FT                   /locus_tag="Daro_0116"
FT   CDS_pept        complement(132912..133955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0116"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44875"
FT                   /db_xref="GOA:Q47JV6"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44875.1"
FT                   /translation="MFGFLSKYFSNDLAIDLGTANTLIYVRARGIVLDEPSVVAIRLEG
FT                   GPNAKKTIQAVGREAKDMLGKAPGTITVIRPMKDGVIADFTVTEQMLKQFIKKVHDSKL
FT                   FSPSPRIIICVPSGSTQVERRAIRESALGAGASQVYLIEEPMAAAIGAGLPVSDATGSM
FT                   VVDIGGGTTEVGVISLGGMVYAGSVRVGGDKLDEAIINYISRNYGMMIGENTAENIKKN
FT                   IGSAFPGAEVKEMEVSGINKAEGIPRKFTISSNEILEALTDPLNQIVSAVKSALEKTPP
FT                   ELGADIAEKGMVLTGGGALLRDLDRLLMEETGLPVIVADEPLTCVARGCGMALEKMDKL
FT                   GSIFASD"
FT   gene            134057..134344
FT                   /locus_tag="Daro_0117"
FT   CDS_pept        134057..134344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0117"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44876"
FT                   /db_xref="GOA:Q47JV5"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44876.1"
FT                   /translation="MSLTLEQVKRIAHLARIEISDDEALTTQGHLNGIFQLIEQMQAVD
FT                   TTGIEPMAHAQDVSQRLREDAVSEGDRRAAYQAVAPEIEAGLYLVPKVIE"
FT   gene            134341..135798
FT                   /locus_tag="Daro_0118"
FT   CDS_pept        134341..135798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0118"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44877"
FT                   /db_xref="GOA:Q47JV4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44877.1"
FT                   /translation="MINASLKELSLALAAKKVSSVELSSLFLDRIERLNPTLNAFVTVD
FT                   REKSLQMARDADARIAAGTAGPLTGIPIAQKDIFCAEGWLSTCGSKMLANFVSPYDATV
FT                   IRKMHAEAGLVSLGKTNMDEFAMGSSNETSFFGSVRNPWDTQRVPGGSSGGSAAAVAAR
FT                   LAPAATGTDTGGSIRQPAALCNLTGLKPTYGVVSRYGMIAFASSLDQGGPMAASAEDCA
FT                   LLLNTMVGFDERDSTSLERPVEDYARDLDKPLDGLRIGLPKEFFGEGCDAEVMAAVRAA
FT                   IAEYEKLGATCVEISLPNSHLSVPAYYVIAPAEASSNLSRFDGVRYGYRAPEYGNLDDM
FT                   YMKTRAQGFGAEVKRRILIGAYVLSHGYYDAYYLQAQRIRRLIANDFVEAFKHCDVIMS
FT                   PTSPSTAFKLGEKAADPVQMYLSDIYTIAVNLAGLPGMSIPCGFVGGLPVGLQLIGNYF
FT                   AENRLLNVAHRYQQATDWHQRRPGGIE"
FT   gene            135800..136330
FT                   /locus_tag="Daro_0119"
FT   CDS_pept        135800..136330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44878"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44878.1"
FT                   /translation="MRLLWTLLAALMLVSCAETPKTPEEPAAQSSAEKPAAAEETPKFK
FT                   NSTLKYLANRNLKPQPTRPLNVRSRCSHKDAIGTQTRLDLLVKEADVKKFDAQVSMKGY
FT                   GTCRFNLDDFEQVEKLPQALLRHKKQSDCLVRMWEQGPKVTIAFNSCPKSCEGKAFDYL
FT                   WPIMVEAKSGQCF"
FT   sig_peptide     135800..135853
FT                   /locus_tag="Daro_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.990 at
FT                   residue 18"
FT   gene            136344..137798
FT                   /locus_tag="Daro_0120"
FT   CDS_pept        136344..137798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0120"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44879"
FT                   /db_xref="GOA:Q47JV2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44879.1"
FT                   /translation="MTQWEVVIGIETHAQLSTVSKIFSGASTAFGAEPNTQACAVDLAL
FT                   PGVLPVLNKKAVECAIRFGLAIGAEVAQKSVFARKNYFYPDLPKGYQISQMDLPVVVGG
FT                   NITLQVGQGDKAYEKIVRLTRAHLEEDAGKSLHEDFHGKSGIDLNRAGTPLLEIVSEPD
FT                   MRSSDEAVAYARALHALVRWIGICDGNMQEGSFRCDANVSVRPKGQAEFGTRREIKNLN
FT                   SFRFMKEAIDFEVQWQINEIEEGRKIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPD
FT                   LLPLMIPAEWIARVQGEMPELPVQRRERFAGDLGLSAYDASALTASQEIADYFEAVVAI
FT                   AGKANAKPCANWVMVDLAARLNKDGKDIADSPVSAAQLAGLIQRIADSTISNNIAKKVF
FT                   EALWNGEGATADEVIDKQGLKQITDTGAIEALVDEVLAANAANVAEFKAGKEKAFNALV
FT                   GQVMKAAKGKANPQQVNDLLKQKLAG"
FT   gene            complement(137799..138446)
FT                   /locus_tag="Daro_0121"
FT   CDS_pept        complement(137799..138446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44880"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44880.1"
FT                   /translation="MPKRALLTLLLLLATSAQAAGEFYCCHDPVSGRRVCGDTLPEQCR
FT                   GRAYRVLDSGGNIIKEVGPPLTPEQKAEQIVENRRKKQLEDASREQRRRDQALLDTYTT
FT                   PEDIDLAQQKAEADVNFAILSTIARIDAARTKRKKFADEAEFYKKKALPAELDKELRAI
FT                   DHEIRLQQELLDIKKKDFESIKAKYDADRKRYFELTRRPPAAPYSGAAPATR"
FT   sig_peptide     complement(138387..138446)
FT                   /locus_tag="Daro_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 20"
FT   gene            complement(138439..139080)
FT                   /locus_tag="Daro_0122"
FT   CDS_pept        complement(138439..139080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0122"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44881"
FT                   /db_xref="GOA:Q47JV0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44881.1"
FT                   /translation="MDFRQDFIEFAVGCQVLRFGEFKTKAGRLSPYFFNAGLFNDGNSL
FT                   GRLAEFYAKAAEAGGVQFDMLFGPAYKGIPLVAAIAISLAQRGKNFPFAFNRKEAKDHG
FT                   EGGNIVGSPLTGRVLIVDDVISAGTSVRESVELIRAAGATPAGVLIALDRQERGQGELS
FT                   AVQEVQRDYGIPVVAVAGLKDLMTFLAERPDFANHREAVAHYREQYGVDA"
FT   gene            139128..139907
FT                   /locus_tag="Daro_0123"
FT   CDS_pept        139128..139907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0123"
FT                   /product="AP endonuclease, family 1:Exodeoxyribonuclease
FT                   III xth"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44882"
FT                   /db_xref="GOA:Q47JU9"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44882.1"
FT                   /translation="MLRIISLNLNGIRSAWSKNVLPWVAAQNADVICLQELKAQLPDLT
FT                   PEMMAPDGMQAFYHCAEKKGYSGVGIWSREKPDRVIEGFDGGEFDAEGRYIRADFGNLS
FT                   VISLYLPSGSSSPERQEAKFRFLDVFFPQMLALRAEGREIVLCGDWNIAHQAIDLKNWK
FT                   SNQKNSGFLPEERAWLSRLFEEQGWVDVYRRLHPETTDACYTWWSNRGQAWAKNVGWRI
FT                   DYQIATPGIAVMAVQAEVYKDERFSDHAPLIIDYDFK"
FT   gene            139985..140299
FT                   /locus_tag="Daro_0124"
FT   CDS_pept        139985..140299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0124"
FT                   /product="Protein of unknown function DUF883, ElaB"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44883"
FT                   /db_xref="GOA:Q47JU8"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44883.1"
FT                   /translation="MSEQIAAANKEKLVSDLKIVISDTEELLRATAGAAGDKVGELRER
FT                   LGVRLRDAKERVIDLEVALVDKTKAAARATDDFVHEEPWKAVGVAAALGLALGVLIGRR
FT                   "
FT   gene            140304..140711
FT                   /locus_tag="Daro_0125"
FT   CDS_pept        140304..140711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44884"
FT                   /db_xref="GOA:Q47JU7"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44884.1"
FT                   /translation="MTQQSGGDGGREGLFAALKNILATLIAIGKTRAELLVTELEEEKL
FT                   RLMSLWAKAIGAAFLLALGVVMAVCCVALAFWEQRVVVFGIFAVLFIGGGALLVGSLKR
FT                   QASQPSKMFKSSLSELEADMVQLRRYRNKSE"
FT   gene            140708..141001
FT                   /locus_tag="Daro_0126"
FT   CDS_pept        140708..141001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44885"
FT                   /db_xref="InterPro:IPR025612"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44885.1"
FT                   /translation="MNPKLLELATRHGALKARIDEQRRQLTRHAEPLEAALAKGDTVLK
FT                   GVDWLKHHPAAIGIAVAVAVIARPKRAWRWARRSFFLWRGWQAIKSSLSGVR"
FT   gene            141004..141312
FT                   /locus_tag="Daro_0127"
FT   CDS_pept        141004..141312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44886"
FT                   /db_xref="GOA:Q47JU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44886.1"
FT                   /translation="MATGPSEEAVLPGWWRQIISLQRREARRVLAELVSTRGMMPLLMK
FT                   ARNGEGWTPTEKEALLSHLRRMAHLSPYLIALLLPGSVLMLPVYAWWLDRRRLRRGE"
FT   gene            complement(141296..142564)
FT                   /locus_tag="Daro_0128"
FT   CDS_pept        complement(141296..142564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0128"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44887"
FT                   /db_xref="GOA:Q47JU4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44887.1"
FT                   /translation="MPPWLSALLTRKMLICIFTGFSSGLPLYLLLNLLPAWLRSEGVDL
FT                   KTIGFFALIQFPYTWKFLWSPLLDRYSLPGFGRRRGWMLITQIGLLFSIGFLGGFNPKE
FT                   SIWPILWLATLLSLLSATQDIAVDAFRREILGDNELGLGNAVHVNAYRIAGLIPGSLSL
FT                   IIADRLPWNEVFWITGAFMIPGMAMAWLVTEPTIKGAPKTLRQAVTEPFHEFIGRQGWR
FT                   GAITVLGFIFLYKLGDSLSTALATPFYLDMGFTKTDIGLIAKHAGLWPAVIGALLGGLW
FT                   MVRLGINRALWLFGVVQLVSIFGFAWLSSQGHYDSIGASERIALAFVIGLEALGVGLGT
FT                   AAFVAFIARSTHPAYTATQMALFTSLAAVPRTFINASAGWLVENLGWYGFFWLCAGLAV
FT                   PGMVLLLKVAPWNERPDSATRPV"
FT   gene            complement(142564..143175)
FT                   /locus_tag="Daro_0129"
FT   CDS_pept        complement(142564..143175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0129"
FT                   /product="Methionine biosynthesis MetW"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44888"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44888.1"
FT                   /translation="MTHTLGRPDFEVIAGWVEPGHRVLDLGCGDGTLLKHLIETRGVHG
FT                   VGVEIDDANILAAIKNGINIIQGNLERGLDEFADQAFDHVVLSRTLQTVRHTEGILREM
FT                   LRVGREAVVSFPNFAYWKNLRSVLDGRMPVSEDLPYQWYDSPNVRFFTLLDFEALCEQM
FT                   GLIIRERHVLDEDGNIVHNTDNREINFLGSLAVYRLTQNR"
FT   gene            complement(143172..144296)
FT                   /locus_tag="Daro_0130"
FT   CDS_pept        complement(143172..144296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0130"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44889"
FT                   /db_xref="GOA:Q47JU2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44889.1"
FT                   /translation="MPGQSVGAVQPQRAHFDQPLHLRSGGVLPAYDLVYETYGTLNAAK
FT                   SNAILVCHALSGHHHVAGHYADQPDNIGWWDNIVGPGRPLDTDKFFIVGLNNLGGCHGS
FT                   TGPSSLNPATGKPWGADFPIVAVNDWVHAQARLADLLGIDSWAAVMGGSLGGMQALRWS
FT                   ITFPERVRNAIVIAAAPKLSAQNIAFNDVARQAILTDPDFHGGHYYEHNTRPVRGLRLA
FT                   RMLGHITYLSDDQMGEKFGRELRNSAFSFGYGVEFEVESYLRYQGDKFAGYFDANTYLL
FT                   MTKALDYFDPSREDDGNLTATMARTQANFLIASFTTDWRFTPARSKEIVAALLANGRNV
FT                   SYAEIDLNFGHDSFLMEDAHYHGVVDAYLRNIKL"
FT   gene            144543..145163
FT                   /locus_tag="Daro_0131"
FT   CDS_pept        144543..145163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44890"
FT                   /db_xref="GOA:Q47JU1"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44890.1"
FT                   /translation="MLDQRRHLRIRFASLPTISLGYGGAVGEGVIENLSLSGLMVRTSM
FT                   PLEISHNVGCEFRIFQSPLIDVPAAVVSRVGDVFGVRFQPGPISQILIEDAINQALLDG
FT                   NASILSVHELGGKKIMRITGGLSGALRNDFMHALTRMGVDEIDVESVTAVEQAGLALCL
FT                   VATTRHGVTIGAQSQCFAEAWKFAQAVPGDSVPETPGRGQTLE"
FT   gene            145144..147183
FT                   /locus_tag="Daro_0132"
FT   CDS_pept        145144..147183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0132"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44891"
FT                   /db_xref="GOA:Q47JU0"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44891.1"
FT                   /translation="MARPWNSVSRSLLLTALAGVWVDASWADDETVYFSELPVVASVSR
FT                   LPQRIADAPTSVTVIDRELIKASGARDLSDVFRLVPGFQTFPNNTEAAQVTYHGMSDGE
FT                   YSPRLQVLVDGRSLHSPLFSNGVNWATIPVALEDIERIEVVRGTNAVSYGSNAFLGVVN
FT                   IITVDPALAHGFSMSTSYGSQNVRDYAVRAGGRIGDVGDFRFTYKQQNDDGLNNRWDWI
FT                   DSFRSRLFDFRSDFSLSDRDSLQFSIGQVEGVTQRGRLNTTTWQQKPEDPIRDMRQTDV
FT                   YVQFLWRRVLSPTSDLQLRYSYVVDRSSDEFSVPFGGRIYRVNQSGDEGARHELEIQNT
FT                   LKLVDTSRLVWGASWRTDSLRSDWTLPGQGAVQRDLARIFGNLEWKPAHWFTGNAGISG
FT                   ENDSMAGFHTAPRVSGSFHLSPENTIRTGYSRAYRTGSILNYRGDWWTVSGGLPKYQFA
FT                   ANPNMPPERMDTLEIGYLGDWRERRMSLDLRVFNETIRDRLLSIDQNIGNNLIPDTIMP
FT                   IQKVWIRGFEYQYKWQAFDSTRIVLNQTFANIGSSYLQSALLNPNNTLGSADKSVAIRE
FT                   QTEYSMPHRSSSLLLMQKLPWNLDFSVAGYWQDRMKWSTNSWSQKYRRFDARLAYPFRW
FT                   SGQGGEVAYTVQSLNGAHNEYKWNAEPSDRIVDRRQWVSLRLDF"
FT   sig_peptide     145144..145227
FT                   /locus_tag="Daro_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.941 at
FT                   residue 28"
FT   gene            complement(147199..149283)
FT                   /locus_tag="Daro_0133"
FT   CDS_pept        complement(147199..149283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0133"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44892"
FT                   /db_xref="GOA:Q47JT9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR019247"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44892.1"
FT                   /translation="MNRLTLRHRLLLLTLLPSTLIAIALVTYFTFSGIKTLEGELRLKG
FT                   MATVRYLAPISEYGIIAGQVEGLHGLAQATVQESGVKAAIVVNQKGRTIAVSGRVSLAA
FT                   DELRQILSEPKQVAETDQWIAFGAPVKRSMSDTDQLFETNAGKPAIPEVIGHVFVEFDK
FT                   TELANKQRQLLQRGLVIVLLGLLVLAAMAIAMADNLAKPVMRLVQAVKDMSSGRLDTRV
FT                   PASSSGELGVLENGFNEMAAKIEEVHHSMQTRIEEATAQLAFQARHDALTGLLNRREFE
FT                   HRLEKALASVQAGGDEFAILFLDLDRFKQVNDTCGYLAGDELLRQMALLFQGRLREEDT
FT                   LARLGGDEFSIMLANCTGARALQVADDICGLAAAYRFIWQDKVFAIGASVGITTVNRKV
FT                   RNINEILAAGDAACHRAKESGRNRVCEQEVTFNQERRHEASNWASRIANALSEDRLLVE
FT                   AVPLRALQHAASGHVVELTARLNEPGQPPVALAALIDAAERYDLAPAIDRRLIDTAIAA
FT                   QARAKRQHRNLYCLVPLSRSSISSRETIDYIARSLSSQNMAGNKLCFMFSEDILTHLTS
FT                   QAMEFSRQVHTLGCQIGLDDFGGGLSSFSHLRSITPSHVKLSRSLTRDLGGNRASTALL
FT                   RAVQEITADQHIRSIAEDIDDLDTLEQLKDLGIDYAQGKAIAPNEPFEVWFEGAVMRSG
FT                   "
FT   sig_peptide     complement(149209..149283)
FT                   /locus_tag="Daro_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.916 at
FT                   residue 25"
FT   gene            complement(149280..150185)
FT                   /locus_tag="Daro_0134"
FT   CDS_pept        complement(149280..150185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44893"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44893.1"
FT                   /translation="MLRLPRFILILLIALATPAWGGSIALVLSENGGMYGEFANTLDES
FT                   LSGTAWNIVSTSAGDSPATAARPPDLVVTVGSEALRRTLSRGESTPIIATLLPRQTYEK
FT                   ILTEHRRTSGRITAIYLDQPANRQAVFLRHLLPDQKRFGILFSSETRNSASQYRQAFAW
FT                   AGLVLDSEDSDTEKTLLPALNALLTRSGALVALPDASIYHRNNIKAILITAFRLQRPVI
FT                   GYSTAFVTAGALAALHSTPSQIARQTADMIVNSGTNLTPPTGPTQFAIAINPNVAQALG
FT                   LNIPDEASLRRAILADRDAR"
FT   sig_peptide     complement(150120..150185)
FT                   /locus_tag="Daro_0134"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            complement(150238..150831)
FT                   /locus_tag="Daro_0135"
FT   CDS_pept        complement(150238..150831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0135"
FT                   /product="Electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44894"
FT                   /db_xref="GOA:Q47JT7"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44894.1"
FT                   /translation="MIRLLAFLFILLITGPAAAQATHSLELLKEGSTEGINPRYLLQDP
FT                   NGRSVTSEDFRGRYQLIAFGYTYCPDICPTTLVEMAEILKQLGKEAKNIQAIFISVDPE
FT                   RDTGKILKTYTEFFDPRILGLTASPALVRRTAENFKVRYAKVQEPGATSDRYAVDHSAG
FT                   MILLGPDGNFIKKFAFAMPVSEITEQISNLINNR"
FT   sig_peptide     complement(150772..150831)
FT                   /locus_tag="Daro_0135"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.964 at
FT                   residue 20"
FT   gene            complement(150828..151163)
FT                   /locus_tag="Daro_0136"
FT   CDS_pept        complement(150828..151163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44895"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44895.1"
FT                   /translation="MKIVAPLLALILATFANTGSAADAGTEAVEALGRLNGVALACQQP
FT                   ALVARARNAVITTAPKTRGYGEAFETATNASYLEQGKGSACPDAATLASNMAAAEQRLK
FT                   SAFAGSQ"
FT   sig_peptide     complement(151098..151163)
FT                   /locus_tag="Daro_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.725 at
FT                   residue 22"
FT   gene            complement(151221..152012)
FT                   /locus_tag="Daro_0137"
FT   CDS_pept        complement(151221..152012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0137"
FT                   /product="Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44896"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44896.1"
FT                   /translation="MPRLPQRIVCLTTETVEVLYALGEQDRIVGISGYTVRPPEARKEK
FT                   PKVFAFTSGDIDKILATQPDLVLTFSDLQSEISRDLIKAGIPVYAFNTRSIEDILGMVE
FT                   TVGRLVGAEAKALKIVAGLEAEIEKARAIAAERFARTGKKPRVYFEEWDEPLISSIRWA
FT                   SELIEIAGGEDIFAEQARSPLAKDRRPAPEAVIAAAPDIIIGSWCGKHFRPERVAARPG
FT                   WESIPAVRNGKMHEIKSAIILTPGPVAISEGLPQLLDIFDL"
FT   gene            complement(152017..152919)
FT                   /locus_tag="Daro_0138"
FT   CDS_pept        complement(152017..152919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0138"
FT                   /product="Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44897"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44897.1"
FT                   /translation="METRMKIRLLSALATAFVVSTNAHADLVIKDDIGQEIRLKAPAKR
FT                   IVALAPHIAESLYAAGAGDRLVGTVEYSDYPPEAKKVPRVGGYSRVDLEAIAALKPDLV
FT                   LAWESGNNMPQVDKLKGLGLTVYVSQPNKIENVADQLVRLGQLAGTEPAANAAAERFRK
FT                   RLDGLRAANVGKPKVRVFYQIWKTPLMTVGGPQIISDAIKLCGGDNIFGHLAKMAPTVS
FT                   VEAVLEADPEAIIATGMGDAKPEWLHDWDKWTRMTAVKRDNLFHINPDIMQRHTPRILD
FT                   GTEKLCAHLDVARSHRPAK"
FT   gene            complement(152904..153896)
FT                   /locus_tag="Daro_0139"
FT   CDS_pept        complement(152904..153896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0139"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44898"
FT                   /db_xref="GOA:Q47JT3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44898.1"
FT                   /translation="MLEHGGRLREAAAHYNIPLENWLDLSTGINPEAWPVPALPPSVWH
FT                   RLPENHDGLEAAAAAYYGNANLLPVAGSQAAIQWLPTLLPRGVVACISPIYAEHPQAWQ
FT                   HAGHKIRFLQNALLPRALAAATPYVLLCNPNNPTADRHPHDVALDAARQLKKRGGWLIV
FT                   DEAFIDATPEDSLTPLAGSEEAPNLIVFRSIGKFFGLAGIRVGFLFAAPELLGRMSEAM
FT                   GPWTISGPSREAAKLALQDIAWQDASRPRLLSAGERLHQMLSPLGEVKFTALFATLTSH
FT                   HASELHEALARQGILTRRFDQQPLLRFGLPCSEDQWQRLGKALAEWKPA"
FT   gene            complement(153889..154803)
FT                   /locus_tag="Daro_0140"
FT   CDS_pept        complement(153889..154803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0140"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44899"
FT                   /db_xref="GOA:Q47JT2"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44899.1"
FT                   /translation="MMMPEGALAMPAAALVAVLLDRLLGEVRRFHPLVGFGNLAAAIEK
FT                   RLNNHRLASGLFAWALAVLPFVGLAWLVRPVTPLTVDVVLLYFALGAQSLCEHAEAIAK
FT                   PLREGHLDEARQRVSWIVSRETSTLDESGIAKAGVESILENGNDAIFGTLFWFALLGGP
FT                   GALLFRLANTLDAMWGYRTERFNLFGRFAARFDDALNWVPARLTALTYALLGQTRNALA
FT                   CWRTQAPGWDSPNAGPVMSAGAGSLGVQLGGAAIYHGQVESRPPLGSGPPPAAADLGRA
FT                   ISLIRHSLWLWLAVLFAIGLLHA"
FT   gene            complement(154800..155774)
FT                   /locus_tag="Daro_0141"
FT   CDS_pept        complement(154800..155774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0141"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44900"
FT                   /db_xref="GOA:Q47JT1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44900.1"
FT                   /translation="MSLGARPIYRRENREGGANPPRAQRCKEDGRCEKPLVRENPAGKA
FT                   HRPGESESEDRPGDETGLHGQAVIVFPQGEFMENQIDHSFSDAERAAIYRTIFNRRDVR
FT                   GQFLPDPVPDEVLSRVLMAAHHAPSVGFMQPWNFLLVRSPEVKQRVRDIFAKAHAEAAM
FT                   MFPEGKRETYNQLKLEGIVESPINLCITCDRERTGPVVVGRTHIKTMDLYSSVCAVQNL
FT                   WLAARAEGLGVGWVSIFNQPELQAALGIPSEIVPIAYLCIGYVSHFHDKPELEKTGWLP
FT                   RLPIADLLYYDQWGQADVARNESLTNTLATMQDDIQQRGIFPK"
FT   gene            complement(155859..156848)
FT                   /locus_tag="Daro_0142"
FT   CDS_pept        complement(155859..156848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44901"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44901.1"
FT                   /translation="MNPQNGLLTITEASALIESGHFMSIAGDETALRQLPPGHWIGGTI
FT                   PYFIGSEGGITTKDRVYVQLIECFAQPPRLSLRATDELPAICHEAPDNGYTLLIIPAFS
FT                   EAHRLFAENAPNYEEMYMKPLVGWIAGVHLAELGTRKPLVVLGETLEFSDDKAAVIDVA
FT                   LPDHRYAQVEIVNPFRAAPTPILRFPTSGFSAGACEIDGQARNFAEYLVSHQLDSRLPL
FT                   VADYCGALINVSIRNIDLENGQVDFYAPVFAGTEYRMASPLTDYVQTFAAALPGGLGQP
FT                   EFACNCVLNFLYSELEGKQAGAIGGPMTFGEIGYQLLNQTMALLTIGE"
FT   gene            complement(156863..157555)
FT                   /locus_tag="Daro_0143"
FT   CDS_pept        complement(156863..157555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44902"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44902.1"
FT                   /translation="MNPEDWLHKALGINPPWQISHLIENLSTSRLDVWVSLERPKSGWF
FT                   FSQRPSAPDHTLPVWRHLNIGNFKCHIHANPLEAGRHNNLGWIGDDGQPFTRAMVQLIG
FT                   AHFLAGLSIQAVCPLLDIPAADVWKLKHNLDNGRTSLNAPAPLGDSPAVDHIIPEASHA
FT                   VWQQLLSGEFNLDIRVLSLKLLMTKLREQVLRIQDSEVHALKAHELQRYFVRHAHLLAH
FT                   ELEQINRI"
FT   gene            157821..159284
FT                   /locus_tag="Daro_0144"
FT   CDS_pept        157821..159284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0144"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44903"
FT                   /db_xref="GOA:Q47JS8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44903.1"
FT                   /translation="MPCYSLMVQGTTSDAGKSTLVAALCRILKRRGVRVAPFKPQNMAL
FT                   NSAVTVDGGEIGRAQALQALACGLAPHTDFNPVLLKPTTDKKAQVIIHGKVAIDLDAKA
FT                   YHAYKPRAMGAVLESWARLTAEYECVVVEGAGSPAEINLRDRDIANMGFAEAVDCPVII
FT                   VADIDRGGVFAHLVGTLELLSPSEKNRVKGFVINRFRGDIGLLESGLTWLEARTGKPVL
FT                   GVLPYLHGLMLDAEDAIATAAVGGKKAAKLKVVAPAYPRVSNHNDLDPLRLHPEVDFRW
FT                   IGPGETPPAADLIVLPGSKAVRADLDWLRAQGWDKAIHKHLRYGGKLIGLCGGYQMLGR
FT                   MIHDPQGLEGQPGSTPGLGVLAVETTLEAEKQLRNVSGHLSLPGRPAMTGYEIHLGVTR
FT                   GEGLAKGAVELADGVHDGAISADDQVFATYCHGVLDHPEALTALLAWAGMSESEQVDFA
FT                   ARREADLDRLADSVEAALDWEKLSALLPG"
FT   gene            complement(159290..160639)
FT                   /locus_tag="Daro_0145"
FT   CDS_pept        complement(159290..160639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0145"
FT                   /product="Response regulator receiver:Tetratricopeptide
FT                   TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44904"
FT                   /db_xref="GOA:Q47JS7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44904.1"
FT                   /translation="MSEYNKKRFLVIDDQPQARDALRTIAQTIGAFAVEFASNYQDAIY
FT                   RIRNNSPDIILCDYVLGEGRSGQQLLEELRRFNLLPDETIFMMVTGEQSYEQVVSAVEL
FT                   VPDDYIIKPFSPDKLVLRLDRIIAKKNFFAAYYQEKRKQEYARALAILEAQRTSETGRP
FT                   YRFEIQRQQAEVLLASGDAEASEKAYRSILENYEFPWARAGVARSLHKQNRLTEARAEI
FT                   DKVVDSTPHFFDASDLKASICMAQGEHAEAQKVLDEVAKKTPRNYLRKRMLAEAATLNG
FT                   DSETARATMADVIANDTMPGAISPEDRLTMARSHLDGNDKISAEKVLVGLRDVEIQAMN
FT                   LAEQASFAALLAISSPEKGKARFAGLRPALLASELGPTTSLDVMRAALSVSDHELADLH
FT                   AEQLMAGIEAKKVFGAIRKQYALYGRETDFREIQKQVALKRIHHEEKPPA"
FT   gene            complement(160639..161247)
FT                   /locus_tag="Daro_0146"
FT   CDS_pept        complement(160639..161247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0146"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44905"
FT                   /db_xref="GOA:Q47JS6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44905.1"
FT                   /translation="MHKLLDILASGVHDAKNQLFIAESLIAAAEAKHGLKMSEARYAIE
FT                   AAGNRLSRTLAAYGILRHDAALGVTPVLVGDLCEEVVLAQKSHLAGQDIALTVDCQVFD
FT                   EWPLDRDLVTDMLNNAVQNAGRFARSRISLSAREDGGWLVLSVEDDGPGFATLPPTHGT
FT                   GLMVADRLAALHARKGQQGSLHLSNGSSLGGARFELRLP"
FT   gene            complement(161356..161922)
FT                   /locus_tag="Daro_0147"
FT   CDS_pept        complement(161356..161922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0147"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44906"
FT                   /db_xref="GOA:Q47JS5"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44906.1"
FT                   /translation="MPPMKELILGGARSGKSLLAEQRAHDSGLKVTYLATAQALDGEMA
FT                   RRVAHHRERRPVEWGCIEETLHLAACLRELAAADTCVLVDCLTLWLSNLLFAGQAAAQA
FT                   EAGEAIDCPLFRAETSALIELLPQLPGRIILVSNEVGWGIVPMHPVSRLFADEQGRLNQ
FT                   RVAAVCDQVTLVAAGLPLSLKSTAG"
FT   gene            162210..163256
FT                   /locus_tag="Daro_0148"
FT   CDS_pept        162210..163256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0148"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44907"
FT                   /db_xref="GOA:Q47JS4"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44907.1"
FT                   /translation="MHSFEISIPDSGLETALQNKIDRKTKPLGALGLLEKTAKKIGLVQ
FT                   QTLTPQLNNPQMLVFAGDHGAAKAGVSAYPQDVTWQMVENFLAGGAAINVFARQNGLGL
FT                   SVVDAGVAHDFGQRTGLIDAKVAAGTANYIEQAAMTPAQCAQAIQNGAAIVRQLAAKGC
FT                   NVVGFGEMGIGNTASASLLTHCLTGLPLAECVGRGTGLDDAGLARKQDLLEQALIRYRN
FT                   AGGNNDAGAVLAEFGGFEIATMVGAMLAAAEAKMVLLIDGFIVGSAALIASRLAPALLD
FT                   YCVFCHRSAEAGHRTQLLAMGAEPLLDLGLRLGEGTGAALAYPLVQSAVSFLNEMASFE
FT                   SAGVSDKE"
FT   gene            163253..164023
FT                   /locus_tag="Daro_0149"
FT   CDS_pept        163253..164023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0149"
FT                   /product="cobalamin-5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44908"
FT                   /db_xref="GOA:Q47JS3"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44908.1"
FT                   /translation="MIRRELEYFFGAIRFFTRLPVPGWVGHSAEALNHSARYFPAVGLL
FT                   VGGIGALVYWLALYLWPQPVAVLLSMAATIYATGAFHEDGLSDTVDGLGGGWEKARILD
FT                   IMKDSRVGSYGVVAMVLALLGKFVLLSSLAPALVPFALLAGHAVSRFCATVLLATMDYV
FT                   RDDQLSKAKPLANRMSAGAIVVALCFAVAPLLALPWFKAAAGLALAALATLWLARKFQR
FT                   WLGGYTGDCLGATQQFAEIVFYLGLMANLFAQNP"
FT   gene            complement(164057..165169)
FT                   /locus_tag="Daro_0150"
FT   CDS_pept        complement(164057..165169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44909"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44909.1"
FT                   /translation="MSFATSLRILGLILMLGLTGCAVQERSPPTSPAPPVSANTWQQVD
FT                   RDIVSGSLAAKGAAKSFVRHQMEHWRSLVTEKAEADFIPWFSSYVTQQWLTVKVAWYHL
FT                   SAEEENALPADRLAAYMQEQYYDRVLAPVAREIDPASLAEQAVQHYIRGLRGYLRQIPQ
FT                   RHDVPEDQFKRRLASIPAIKLAPPATHDASLEQIAYHDQIEALPAYSALLQSIRDEGGN
FT                   DGVGLSKTRISPVARNISEKLLNKLAISGGTSAASALVGGITGSVISLGAAAVGMIWHE
FT                   AGRKEIETELRATLTDSVADMWTSLMDDPDTGVAAGIHHISDQIENHLPQTFTKPVPLD
FT                   NPPPEIPLPEKSPASETSDIEAQFDNGGDE"
FT   sig_peptide     complement(165092..165169)
FT                   /locus_tag="Daro_0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.863) with cleavage site probability 0.363 at
FT                   residue 26"
FT   gene            165225..165782
FT                   /locus_tag="Daro_0151"
FT   CDS_pept        165225..165782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0151"
FT                   /product="Phosphoglycerate/bisphosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44910"
FT                   /db_xref="GOA:Q47JS1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44910.1"
FT                   /translation="MLHHPHDSPFVSKITMRLHLIRHPKPMIDAGICYGRHDCPALDVL
FT                   SVAAALLRELPSGLPVWSSPLRRCRALAEQLHARPIIDERLAEMDFGRWEGRRWDDIPR
FT                   AELDAWAADVAGYAPPGGESPRQLQQRALGLVDSLAVPEVVIVTHAGVIRTLLAHWQGL
FT                   PPERWTELNFAYGSCTVIDIPR"
FT   gene            165784..166887
FT                   /locus_tag="Daro_0152"
FT   CDS_pept        165784..166887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0152"
FT                   /product="Lipopolysaccharide heptosyltransferase III,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44911"
FT                   /db_xref="GOA:Q47JS0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44911.1"
FT                   /translation="MPGMETFNPLRDAVPLGEIKRALVIKLRHHGDVLVSSPVFSVLKA
FT                   HAPQIEIDALVYADTAEMVTLHPAIAEVHTIDRKWKQLGAVGQLKAELALYNTLKARGY
FT                   DLIIHLTEHWRGAWLCRLLKPRWAVGPAVRGRSKRWKQSFTHIQTMHNPLRHMAESNLD
FT                   SLRRIGIQPGPDERRLTLVPGAAAEGAVAAHLAGFGLRGKDFIHVHPASRWFFKCWPVE
FT                   RMAALVDRLQAAGHVVVLTAAPSQDEKNMLAAIQARLAKPAFSLSGQLSLKELAALTQA
FT                   SKLFIGVDSAPMHIAAAVGTPTVALFGPSGDKQWGPWGVPSRVVASTVHPCRPCGADGC
FT                   GGGKVSDCLVSIAVDEVMAAAQELLGA"
FT   gene            166884..168029
FT                   /locus_tag="Daro_0153"
FT   CDS_pept        166884..168029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0153"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44912"
FT                   /db_xref="GOA:Q47JR9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44912.1"
FT                   /translation="MKIAIIRQRYNPFGGAERFVERALGALAGEGAEVTLITRNWDGAP
FT                   REGFRQITCDPAYSRLLGGRAARDRSFAEAAQAEMARGEFDITQSHERIPGCMIFRAGD
FT                   GVHAAWLDHRARILGPLQRLTQRWSPYHRYVLGAEKAMFADPALQAVICNSQMVADEVE
FT                   RYYGVARSKLQVIYNGVDTEVFHPGLADEFRASMRAANGISENAPLLLFVGSGFERKGI
FT                   PQLLRAVARMQRTDARIVIVGADRKLKAMQKLSELLRLTRRVLFTGPLKDVRPWYGAAD
FT                   GFVLPTLYDPCPNAALEAFACGLPVVTSTTCGAQEWVRSGENGWVVDAVDINGLARRLD
FT                   DLAGLAGNVKAREAARAVAEPLTLPAMADRLLALYRSLGRR"
FT   gene            168078..169835
FT                   /locus_tag="Daro_0154"
FT   CDS_pept        168078..169835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0154"
FT                   /product="Lipid A export ATP-binding/permease protein MsbA"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44913"
FT                   /db_xref="GOA:Q47JR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44913.1"
FT                   /translation="MSHDMTSRELYLRLLTYVRPYWKAFLAALACMGVASLAEPVFPAI
FT                   MKSLLDDGFSKANGPWDWLFYPLAIMGIFLVRAIFGFLGDYLMSWVSNNVVAELRQAMF
FT                   ARMVRLPTRYYSDNLSGRLMSRIAYDVTGVAGAATNALTSLIKDSLSIVGLLVWLLWLN
FT                   WQLTLITLSVVPFIAIVVRVFSKRLRSVARGQQESMGKITQVLQEAIEGHKVVKIFGGQ
FT                   SYEEDRFYESIREQRRLAMRATLASAAQSPLVQFFAASGVAIIMGVALKQASSDQTTVG
FT                   SFVSFVTAMLMLMAPLKRVTDVNAPIQRGLAAAESVFSLVDEETEPDSGKEELGRAQGL
FT                   VEFDGVTFTYPGSERPALDSVSLTVRPGECVALVGPSGSGKTTAANLLPRFYALDAGEI
FT                   RVDGHALPNIRLNSLRDNIALVSQDVVLFNDTIGANIAYGGKRDATLDEIRAAAKAAHA
FT                   LEFIDALPEGLNTMIGENGVKLSGGQRQRLAIARAILKDAPILILDEATSALDTESERH
FT                   VQAALDELMRGRSTLVIAHRLSTIERADRIIALAHGHKQEEGSHAELLAHDGLYARLYR
FT                   MQKAEEVAV"
FT   sig_peptide     168078..168194
FT                   /locus_tag="Daro_0154"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.926 at
FT                   residue 39"
FT   gene            169835..170920
FT                   /locus_tag="Daro_0155"
FT   CDS_pept        169835..170920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0155"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44914"
FT                   /db_xref="GOA:Q47JR7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44914.1"
FT                   /translation="MRILHTESSKGWGGQENRTLNELVTMRDRGHVLAVVGRPGARILD
FT                   RAKEAGFETFVVDMRGAIDFPAVFRLRSVIKRFQADVVNTHSGRDTQLAGMAARTMFKR
FT                   PRIVRTRHLALPITSRFTYSVLPDHVVTVSKYVENYLVEAGVPREGITTIPTGVDFSRY
FT                   DRSTVQGNLRQELGLPAESLLVGTVAILRAKKGHADILDAAPEVLKRFPNAHFVFAGDG
FT                   PQTDNLKARIAADGLQGRIHLLGLRRDVTNVLASLDVFVLPTHQEALGTAFIEAGAMGL
FT                   PAVASNVDGVPEVILDGKTGYLVPAHDGKALIEPISRLLADPVLRQSMGANATEFVRRK
FT                   FAREVMAQGMEALYQRLLGAK"
FT   gene            170917..171747
FT                   /locus_tag="Daro_0156"
FT   CDS_pept        170917..171747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0156"
FT                   /product="Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44915"
FT                   /db_xref="GOA:Q47JR6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44915.1"
FT                   /translation="MSFGQPLPVLMYHHISPKPGLVTCSPENFRAHMQWLAENGWKTLS
FT                   TDEFTRILATGEVPKKSVLVTFDDGYLDNWVYAHPVLKEFGQRATLFLITGWMGEGEVR
FT                   PHAGQPDVPDVPTHAQAMAAAAEGKLDDAFLRWSEVEAMRDAGTFDFHSHTHTHTRWDR
FT                   TIADQSARDQALADDLAASRATLAARLGVDSPHLCWPQGYFDAAYQRVARAAGFTHLYT
FT                   TEHGVVRREVDPGRIPRLVIKDKPAKWFGGRMGIYGRPLLSALYLGLKSGGKGH"
FT   gene            171747..172895
FT                   /locus_tag="Daro_0157"
FT   CDS_pept        171747..172895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0157"
FT                   /product="Glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44916"
FT                   /db_xref="GOA:Q47JR5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44916.1"
FT                   /translation="MRLRLREPLLYRWLRLKRALDKRSRPAEELGTPAIHRILAISCTA
FT                   LGDTLLSTPGLRALRQTYPQAYITLLVHPSLQQLFTGLADVDELIPYDGKWRGFRRAAS
FT                   QLKGYDLAVILHGNEPQATPLAYLSGARHIFKLPNNNCWNFLLSNHEPVFGWDDLGHGI
FT                   GQRLAVAKLAGATGEFDRRMSVPAHAKGRAAVDKALADRGWQEATIVAFQPGASTMSRR
FT                   WPRSRFIAAAVEMLKARPDLRFVVTGSPAEAALCQEVAAGIEAAAPFAGGSRAWASAGQ
FT                   LPLIALPDLLRRASLLVTGDTGPMHLAVTVETPVVALFAVSDPARSGPGYDLDKHIIIR
FT                   KWRTCDPCFSKNCPYAEPICMDNIAVDEVVSAVNTILSRGQA"
FT   gene            172892..174088
FT                   /locus_tag="Daro_0158"
FT   CDS_pept        172892..174088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0158"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44917"
FT                   /db_xref="GOA:Q47JR4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44917.1"
FT                   /translation="MTSPKRVLLLDTGNEWGGGTNSMFELLKRIDHSRFAVTCCFYKDY
FT                   RKGRHGRLLSEELADIGIPLIVLPSRKQPLWAKLAKEIARGLLSWSGRLKKRAVLAIEM
FT                   QWRIKPRVAALKLLLQEGAYDLLYMNNQPSSNLEGYLAAEAASLPVVQHCRIEPTLQAN
FT                   EAAVVNRTATRIICVSQGVADVLAAQHVAENRLRVVYNAIDSRIALPAPVRLPPTTKDL
FT                   VIGTVGQLTARKGVLHLLQAVANLKAEGLPVTCLILGEGPQRTELESAVGRLGLLDQVS
FT                   FVGFQSVPLAWVQVMDVCVLCSSKEGLPRVVLEAMLAGKPVVGSDVTGTRELIVHEETG
FT                   LLYAYGDVAALTASLRRLLSDAELRRRMGAAGCQRVAERYSIEAYVAGVMQVLDEAAR"
FT   gene            174085..175230
FT                   /locus_tag="Daro_0159"
FT   CDS_pept        174085..175230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0159"
FT                   /product="Glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44918"
FT                   /db_xref="GOA:Q47JR3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44918.1"
FT                   /translation="MIYLLLTWLASPLLWLRAALRRSSVNNRILVIQTAKIGDFVATTP
FT                   VFRALRRRLPEVEIVALLHPVNVPLAKGLDSIDRIIVLPKQGFKGWAGKRWLLDLLAEG
FT                   YDGVLILSPNLSNLLVPFWAGVPKRVSVLADRRQGSSRLAWPFLTYGEPHRRGQLFRET
FT                   ALRAIAGLGIKVDAVLLALPNEVRGAESGQAKLNAWSPICQRPLVGFGLGAGNRMKALD
FT                   AAQVAALAGQIVNHTPATLVLIGTDADRAAAETVLAQLPAGRAIDTTGQWGLDELPVLL
FT                   GALDCFVGVDSGATYMADALGVPVVDFMGPADAEDQRPIGRRAVVIRSAEPCAPCSHAF
FT                   DAPYSCHLGTRACIANMPIAAVVQAVETILVSRNSVAEHRQ"
FT   gene            175227..176366
FT                   /locus_tag="Daro_0160"
FT   CDS_pept        175227..176366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0160"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44919"
FT                   /db_xref="GOA:Q47JR2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44919.1"
FT                   /translation="MKLAVFKDYGVGRYFAQLFDSIPNTTFFLSEKNKSGLNITPHRVH
FT                   LLTKKQQLRDYLKSPLKAWRRLKENDNDKKRDFFYLEVERSAAGGEFDVALTGSDRSLH
FT                   TLASLKAKGHQFKLVYWIPFTIPFVDMFDPRSLAIRQAAFPQVDLFVAITDTCRRVLLL
FT                   EGIPAEKIVHVYPGVDTEVFQPRPPPAKDDVFRILFVGKLVSWKGCYTLLYAAKELLSE
FT                   IPNLELMFVGQGAQRQGLEQAAELLGIKDRVKFTGFLKYDALPDIYAQSDAFVLPALPA
FT                   INLAEQFGFVVAEAMACGLPTVVSRVGGLPEVVGERDELIFTPGDFWDLAAKLRAIHAS
FT                   RELAAELGAHCLNHARTHYDARQNGLALKAVLEKMEQGQ"
FT   gene            176363..177685
FT                   /locus_tag="Daro_0161"
FT   CDS_pept        176363..177685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0161"
FT                   /product="O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44920"
FT                   /db_xref="GOA:Q47JR1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44920.1"
FT                   /translation="MSGAAETIAGKPDRLVQLALGMWWGLLFIQPFEKFVAVKYLLMVG
FT                   LIVLAIPLALRAEIRQRLRSRNILLGLGMAIVIWCMTVSAASPYAADSLHSLSRDLLLQ
FT                   AELLLVGCLLVNSASQARTALWMIMAGFAAVSVLSGFEVGSYLAGHALSEGQIPRSHRS
FT                   FWGGYATMASFCLPLIIAFAVSTAADLRQRLLLGVLVVLGVVLTGLYGSRSPLLVVAIS
FT                   VIVLFALLRAWKALAAVFLVMALGAGWVASQSNLGYLEKYRSLAQTDTYVTNQGLSLRL
FT                   DVWSGVVELIEARPLLGYGYGWKKLAWAINDGGYAERWKANDPGKAAYFLGEEEQASYG
FT                   KVNPHNYFLQVAFEIGIPGLLLVLAFWLAVFWQGLKGLVRGPVEYRRLRVVILTTLLAY
FT                   LLSNLANGFWVGGLANMACALVGILVGLAISEQPAPAVEKQ"
FT   gene            177682..178641
FT                   /locus_tag="Daro_0162"
FT   CDS_pept        177682..178641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0162"
FT                   /product="Glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44921"
FT                   /db_xref="GOA:Q47JR0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44921.1"
FT                   /translation="MNILVIRRDNIGDLVCTTPMLAALRRAMPDAWIGVLVNQYNVAVM
FT                   RGNPDVDEVFAYRKAKHRGPGESKLAIWLETAGLLWKLRRKGIDVAIVASPGGDRYARL
FT                   VGARRIIADKPGAPFHEVEAVGKLLAPLGIQPELGPLQLSPLPEVVSAMRPKLAELAGR
FT                   KIWAIHLSAREKSRRWPAGKYIELIERLASPERGFALFWSPGAADHPAHPGDDEKAAQV
FT                   LAACKDKGAVPVVTERLEELIAALSLCDGFVGADGGAMHLAAALNLKTAALFENSEAKR
FT                   TRWYPWGARHVLLQPSTFAVADISVDAVEAAVRALEGD"
FT   gene            complement(178647..181367)
FT                   /locus_tag="Daro_0163"
FT   CDS_pept        complement(178647..181367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0163"
FT                   /product="DNA polymerase A"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44922"
FT                   /db_xref="GOA:Q47JQ9"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44922.1"
FT                   /translation="MPLLLLVDGSSYLYRAFHALPDLRNKAGEPTGAIYGVLNMLRRLE
FT                   SDYKAEYKAVVFDAKGKTFRDDWYPEYKAHRPPMPDDLVQQIEPLHAAIKAAGWPLLMV
FT                   DGVEADDVIGTLATNATADGIETLISTGDKDLTQLVSSHVRWYNTMSNELLDEAGVEAK
FT                   FGVPPGKIVDYLALVGDTVDGVPGVAKCGPKTALKWLAQYGSLDEVVAHANEIGGVVGQ
FT                   NLRDHLGFLPLGKRLVTVACDLSNLPAPSTLTTTARDTATLRELYTRYQFRTWLGEIDG
FT                   PEAAAAVPAREVSETPAAAPTAAIAVHYETVLSWPQFDAWLAKIEAAELTALDTETTSL
FT                   DSFAARIVGISLSVTPGEACYIPLAHTAPGVADQLPREEVLARLKSWLESAAHKKVLQN
FT                   AKYDQHVFANHGIALSGIAHDTMLQSYVIESDKGHDLGQLCTRHLGLATIAYEDLCGKG
FT                   AKQITFDQVDIERAATYAAEDSDVTLRVHNVLHPQFASEPGLSRIYHEIEMPARQVIWQ
FT                   IERNGILIDSDVLSRQSHEMGQKIMALEAQAYELAGQPFNLASPKQLADILFEKQGLPV
FT                   KKKTPSGGPSTDEEVLSELALDYPLPKLLLEHRSLSKLKGTYTDKLPRMVNPQTGRVHT
FT                   HFSQAAVVTGRLASSDPNLQNIPVRSEEGRKIRTAFIAPAGSSIVSADYSQIELRIMAH
FT                   LSGDERLLDAFAHGEDVHKATAGEIFGVTPLEVGPDQRRVAKSINFGLIYGMSAFGLAR
FT                   QLGLERSAAQTYIDRYFARYPGVARYMEEARESARQHGYVETAFGRRLWFPDIRSSNGN
FT                   RRQGAERAAINAPMQGTAADLIKLAMIAVQNWLEKSALKSRLILQVHDELLLEVPDGEL
FT                   MDVRTHLPRLMGQVAELKVPLVVEVGVGPNWEAAH"
FT   gene            181373..182101
FT                   /locus_tag="Daro_0164"
FT   CDS_pept        181373..182101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0164"
FT                   /product="Conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44923"
FT                   /db_xref="GOA:Q47JQ8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44923.1"
FT                   /translation="MTESDKLVTGVETEAILKSTTARESWRIFGIMSEFVEATERLAAI
FT                   KPAVTIFGSARVRPESPYYMLTEQTARLLSDSGFSVISGGGPGIMEAANKGAFFGKSPS
FT                   VGLNIQLPHEQKNNPYQDISQTFRHFFARKYMFVRFASAYVVMPGGFGTLDELMEALTL
FT                   IQTGKGRKIPLILVGSAFWGGMIAWFKDRLVAEGMVDPEDMNLIQLIDEPEKVVEAIFK
FT                   HYESRPFGPLPNEHEMLLNL"
FT   gene            182132..182461
FT                   /locus_tag="Daro_0165"
FT   CDS_pept        182132..182461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44924"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44924.1"
FT                   /translation="MRRLLPILLFAALPVWAQKGDLQPLPAVPPPPPGMEAFDEALEPQ
FT                   VTIVKKDTETREEFRVKGKLYMVKVTPAVGPAYYLVDRQGDGQFIEADINQKPVKPPMW
FT                   VIHSW"
FT   sig_peptide     182132..182185
FT                   /locus_tag="Daro_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.989 at
FT                   residue 18"
FT   gene            182465..183391
FT                   /locus_tag="Daro_0166"
FT   CDS_pept        182465..183391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0166"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44925"
FT                   /db_xref="GOA:Q47JQ6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44925.1"
FT                   /translation="MSVYTKVGRDELAAWLQPLGLGELIDHAGIAAGMQNSNYFVTTTS
FT                   GRFVLTLFERVDLSALDFYLALQDTLAQRGIPCPQPLADGGGRYWRMLCDKPAALLTCL
FT                   SGAALETPGAAHCHAVGAMLAHLHLAAANMPNPLPNPCGANWRQTVGAALLPLVSAEEH
FT                   DLLADELAYQALQDWSKLPRGVIHADLFRDNVLWDSTGRLTGVLDFYFAGEDAWLFDLA
FT                   VVANDWCFDETTLATLLAGYTTQRPLIEAERAAWPAMRRAAALRFWLLRLEVRHQPRAG
FT                   EVVTIKNPDDFRHLLARFRLAPEALPR"
FT   gene            183401..184147
FT                   /locus_tag="Daro_0167"
FT   CDS_pept        183401..184147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0167"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44926"
FT                   /db_xref="GOA:Q47JQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44926.1"
FT                   /translation="MNETPVFPMAPARFTGESREVDPGACFDWLRQGWAMFLVNPGVWI
FT                   GSTVLLLVILMAISIVPLFGQIAAHLLVPLFGAGMIKLCRRLGEGEEPEIADLFAGFHH
FT                   NAGQLVMVGVFFAAGIFGIAFLAFLLVSGGILGGGVTGKVAGFGIALGGVMLAGLLVMV
FT                   LSVPVIMATWFAPALVFFHDMKPLDAMKASFAAGAKNFLPMAIFGVFLVVALFFAMLPV
FT                   GMGLLLLLPVFSGAVYASYRDIFSGS"
FT   gene            184150..184923
FT                   /locus_tag="Daro_0168"
FT   CDS_pept        184150..184923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0168"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44927"
FT                   /db_xref="GOA:Q47JQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44927.1"
FT                   /translation="MRAQTLPAAAGWQWILGGFVIFRRNPLMLGMLVVSYWFTVLFLNV
FT                   VPVIGVVVASLAIPGLSVGLMQAARNLERGQPIGLQTLYGSLKENARTLLALGALYLAC
FT                   TLGILGLSSLVDGGDFLKFMLSSSRAERAAVEDADFILPALFITILMTPVLMAYWFAPV
FT                   LAAWHRLTLGRSLFFSFVACWMNWRPFVAYGIGLVVVAGILPGVVLGLLLLLFPGAASF
FT                   ITGIVIIPMVLVIAPTIFASFYACYRDIFGISEIV"
FT   gene            184916..185569
FT                   /locus_tag="Daro_0169"
FT   CDS_pept        184916..185569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0169"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44928"
FT                   /db_xref="GOA:Q47JQ3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44928.1"
FT                   /translation="MSEPLGLFGGTFDPVHFGHLRLAEESIAHLGLGGVRWIPAGQPPH
FT                   RGVPQVTAQQRLEMVRLAMANNARFSLDPSEVEAEAPSYTVHTLERLRRELGPLQSLVL
FT                   LVGADAFAGLATWHRWRDIFALAHVAVSHRPGFPVEISSLPHELASEFTDRRRADVRGL
FT                   KASPAGGIVTFAMTQLAISATQIRKLLANELSARYLLPDSVLDYIQTHSLYRNS"
FT   gene            185569..185934
FT                   /locus_tag="Daro_0170"
FT   CDS_pept        185569..185934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0170"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44929"
FT                   /db_xref="GOA:Q47JQ2"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44929.1"
FT                   /translation="MDIRKLQKIVVSALEDIKGKDIEVINTSKLTSMFDRIIIATGDSN
FT                   RQVKSLANNVQEKVKEAGAEVISTEGEDGGEWVLVDLGDIVVHVMQANVRQYYNLEELW
FT                   SATPAQRRKAVEQVREG"
FT   gene            185931..186401
FT                   /locus_tag="Daro_0171"
FT   CDS_pept        185931..186401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0171"
FT                   /product="Protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44930"
FT                   /db_xref="GOA:Q47JQ1"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44930.1"
FT                   /translation="MKLAVLAVGHRQPDWVNEGCAEYLKRMPRELAASVTEIKPEARGS
FT                   KTREQLLAAEKSRIRDAMAAGSRLVVLDEKGDDLTTLKLAKRLETWMQDGRDVALLIGG
FT                   ADGLDEEFKQQADDRLRLSSLTLPHGMARLLLCEQLYRAVSVLKNHPYHREG"
FT   gene            186401..187006
FT                   /locus_tag="Daro_0172"
FT   CDS_pept        186401..187006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0172"
FT                   /product="Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44931"
FT                   /db_xref="GOA:Q47JQ0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44931.1"
FT                   /translation="MRLYLASRSPRRRELLNQIGIDFDTVVFRDGMRADSETDETPLPG
FT                   EKPVAYVERVARAKAIHGLKIVEERKLPMRPVLSADTTLEFNGEIIGKPVDRADAAAIL
FT                   RRLSGQTHRVLTGVAINHMGHTEYVLSSSEVTFREIDDEEIRHYVMSGEPMDKAGAYGI
FT                   QGRAGLFVKHLAGSFTGVMGLPVCETGELLKRLGFRPL"
FT   gene            complement(186993..187559)
FT                   /locus_tag="Daro_0173"
FT   CDS_pept        complement(186993..187559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0173"
FT                   /product="phosphopantetheinyl transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44932"
FT                   /db_xref="GOA:Q47JP9"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44932.1"
FT                   /translation="MDRPPAVLRWPASFDKAQNLLIFALATPPTPIRDTARQLVRRVLR
FT                   EILGNVELISVPGQAIRLARPDGRVGISVSHESGLSLLAINFSGPVGIDLLKTPDSRDW
FT                   ESQIPALASDYLGPTIARQLADQAPQERMASFAQAWTAQEARLKCQGLALVEWSSALEV
FT                   SLAECCAQPLTLPAGYVGAVATKAA"
FT   gene            complement(187564..191562)
FT                   /locus_tag="Daro_0174"
FT   CDS_pept        complement(187564..191562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0174"
FT                   /product="Amino acid adenylation"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44933"
FT                   /db_xref="GOA:Q47JP8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR012728"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44933.1"
FT                   /translation="MLETSPPSCPTSRLCGPESPELIRQEILADLFEATAARTPENIAL
FT                   IFAERELSYGELNAAADRVASRLIADGVRPGQIVGLWLPRGIDLLIMQLGIAKTGAAWL
FT                   PFDADTPIDRIKVCLDDAESAGLITTVDIADLGRRCWLADDLQTGHPGPLNHRHDARPS
FT                   DPAYVIYTSGSTGKPKGILINQGAICHFLRSENAILGIREHDRVYQGFSVAFDMSFEEI
FT                   WISYLVGATLWIAPKEVATDPEALPIALIDNRISVLHAVPTLLALFNCDVPGLRLINLG
FT                   GEACPQAIVERWARLGRQVFNTYGPTEATVSASLAELHPGQPVTIGRPLPNYGLLVIDA
FT                   AVENGLRLLPQGETGELCITGPGVAAGYLGRPDLTAEKFLANPWATNEHEGRLYRTGDL
FT                   ARIDEAGQIHCLGRTDDQVKIRGFRVELGEIEAALTRQPGVGTAAVILRQDEGIERLVA
FT                   YLIVDDAEATTGAALRATLATSLPPYMVPSHVEMLDEMPRLTSGKIDRKALRARPLELP
FT                   AGAPGDSDTPENPAEEILFAALARLFPGQAIKREADFFADLGGHSLFAARLASLLRQEA
FT                   RFAGFSVRDIYIHRRVGLIANALSATVEVAIDASATEWTPPPAHRRWLCAIAQGCVLPP
FT                   LVGLRMGQWLAPFFTYHFFTGDPGDSITLAVAISVGVFLIATVLSFVFAIVGKWLIAGR
FT                   LKAGSYPLWGLTYFRWWCANRLIEGAPVYMLSSSPLNIWWLRALGARIGNEAIIGNITL
FT                   RAHDLLQVGDGVSIGNAANLENARVERGQLHLGTISIEDNACIGSYAVIEGNTKIGAYA
FT                   HLEGQSALGEGQALPAGRIWLGSPARDIGEFDPASLPPRPDVSETGLAREGAFYMLGML
FT                   ATAALFFMPVFPSFMLVDWLDGDPSPEILNIPLALQLFKYFALAFPGTAVLIVGTVLSS
FT                   AILRWTLMPRLQAGSWPIHSRVYCSRWLVNQIQESSLNILHGIYATVYAPFWYRLLGAK
FT                   VGRDAEISTAQGLVPDLLTLGDETFIADAVMLGDEEVDGGWLTLKPTVISRRSFVGNGA
FT                   YIPDGTVLPENVLIGVQSRAPANERMQPGDTWLGSPPINLPAREQTAGYPEALTFHPSK
FT                   LRRLGRALVEAFRIISPHALVIAVGYTVVLNVMPLAEAGRWREVFAALTVAGVLFGLST
FT                   ILFVAALKWLCIWRYKKHSVPMWTPFVWTSEAITSLYVGMAVPNLMNYLRGTPWLPLAL
FT                   NLLGCRIGRGVYLDTTDVTEFDCVEIGDYSELNGLACPQTHLFEDRVMKIDLVSIGRRV
FT                   YIGPRTTVLYGAVVGDNVRLGPLSLVMKGESLPAGSSWSGCPAAPASR"
FT   gene            complement(191599..192675)
FT                   /locus_tag="Daro_0175"
FT   CDS_pept        complement(191599..192675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44934"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44934.1"
FT                   /translation="MHLFVDISSHGFGHLAITAPVLNALAEIAPNFRLTIRSALPPAKL
FT                   QQRIKPPYMLIAEASDFGYAMIDATRVDLAASASAYRLAHDNWASRVTQEARFLAGLKP
FT                   DLVLTNVSYLPLAGAAAAGIPAISLCSLNWADLFDHFFGNQTWARPIHSEILAAYRSAQ
FT                   AFLRVTPGMAMGALGNVQLVGPIAALGTQHDLGLNGDKAILIAMGGIAHRLPVENWPRL
FT                   PGVRWLTPANWNCQHPDAIANESFGLSFTDLLCSVDAIITKPGYGTFTEAACNGTPVIY
FT                   QRREDWPEQDCLIEWLTGNARCLEINAEALERGRLADVIKDVLPPKPSAVPVADGIIQA
FT                   AKAIIHHASAQIFALKGA"
FT   gene            complement(192703..193476)
FT                   /locus_tag="Daro_0176"
FT   CDS_pept        complement(192703..193476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0176"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44935"
FT                   /db_xref="GOA:Q47JP6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44935.1"
FT                   /translation="MTQVVLTEVIGKVGLIRINRPEAMNALNNDVVDGIGAAIDIYEAD
FT                   ENIGCIVITGNEKAFAAGADIGFMKDFDYMHAYKTDFITRNWERIKTTRKPVIAAVSGF
FT                   ALGGGCEMAMMCDMIFAADTAKFGQPEIRLGTMPGAGGTQRLPRAVGKAKAMDMCLTAR
FT                   MMDAAEAEKAGLVARIIPADQLLDETLKAAQTIAGYSLPVVMMIKESVNRAYESSLNEG
FT                   LLFERRVFHSAFALEDQKEGMAAFVEKRKPVFKNR"
FT   gene            193624..195579
FT                   /locus_tag="Daro_0177"
FT   CDS_pept        193624..195579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0177"
FT                   /product="Acetoacetyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44936"
FT                   /db_xref="GOA:Q47JP5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44936.1"
FT                   /translation="MTYAIEAKPLWQPNPQTVDKTRMAQFMRSEGYESYADLWQWSIDM
FT                   PEVFWSSLWNYCGVVGEKGTKILVDRDRMPGARWFPEARLNYAENLLQQRDAGEALVFW
FT                   GEDKVKRRMSRGELYAEVARFQQFLIAAGVGEGDRVAGYLPNLPETLVAMLAATSLGAI
FT                   WSSASPDFGVQGVLDRFGQIEPKVLICVDGYWYNGKPVDCLEKNAEVVSKMPSLLKAVV
FT                   VPYLNARPALGNISNAVGWNDILPAEGKEVVFNRVAFDHPLFIMFSSGTTGVPKCIVHC
FT                   HGGVLLQHLKEHQLHSDVRPGDRLFYFTTCGWMMWNWLVSGLACGATLLLYDGSPFAAK
FT                   GTVLFDYAATEKMTHFGTSAKFIDAAAKLGLTPGKTHDLTALRAMFSTGSPLSPEGFDW
FT                   VYREIKQDILLASISGGTDIVSCFVLGNPVLPVYRGEIQCRGLGMAVDVFDDAGQPVRG
FT                   EKGELVCTKPFPVMPVGFWNDPAGEKYKAAYFERFDNIWCHGDFSELTAHDGMIIYGRS
FT                   DATLNPGGVRIGTAEIYRQVEQLPEVLESLVIGQEWPPGRNDDVRVVLFVRLREGDVLD
FT                   ASLVDRIKRQIRDNTTPRHVPAKVVQVQDIPRTKSGKIVELAVRNVVSEQPVKNVEALA
FT                   NPEALEFFRGRPELAD"
FT   gene            complement(195603..196712)
FT                   /locus_tag="Daro_0178"
FT   CDS_pept        complement(195603..196712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0178"
FT                   /product="Acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44937"
FT                   /db_xref="GOA:Q47JP4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44937.1"
FT                   /translation="MSQNASRMPLIDALKAVAALLVLMNHFSSYGPLAEAAREAFPGIF
FT                   GWFFEYGRMAVQVFLVIAGFLAARGLSSEGQALGISPLPLIWKRYLRLVVPYLAAIGLA
FT                   IIAAAIANQWLDDEAIPARATFSQWLAHAFLVHSLLGFDALSAGVWYIAIDFQLFALMV
FT                   ILLWSGRARLIAPALVLAVATASLFWFNRDASWDNWAIYFFGSYGLGAAAWWASDRKQM
FT                   SAWLGVMLTIAVAALIVDFRLRIALALSVALLLGFGRRTGLLAQWPNAKPLAFLGQISY
FT                   SIFLVHFPVLLIANSLYARFNLDSTLSAMIALVLAWATSIAAATLFYRWIESPEASRRI
FT                   TSALGWLLGNTLEIARKVPVIGTLLPRRT"
FT   gene            complement(196780..198051)
FT                   /locus_tag="Daro_0179"
FT   CDS_pept        complement(196780..198051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0179"
FT                   /product="Peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44938"
FT                   /db_xref="GOA:Q47JP3"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44938.1"
FT                   /translation="MPKAPELLAPAGSLDMMRTAFDFGADAIYAGQPRYSLRVRNNEFG
FT                   SMEKLGEGIDEAHARGKQFFVVSNIIPHNAKLTTYLADMAPVIALKPDALIMSDPGLID
FT                   MVRETWPEQVIHLSVQANTVNWASVRFWQKMGVQRIILSRELSLDEVAEIRQRCPDIEL
FT                   EVFVHGALCIAYSGRCLLSGYFNHRDPNQGTCTNSCRWDYKVSTSDGQPAQMIRQEQEI
FT                   LIEEKMRPGELMPIEEDEHGTYILNSKDLRAIEHVHRLVEIGVDSLKIEGRTKSPYYVA
FT                   RTSQAYRQAIDDAVAGKPLDPALLRELEGLANRGYTDGFLQRHHDADYQNYLRGSSESD
FT                   RSLYVGDAVGFDTARGLMEIEVKNRFSVGDRLECVHPSGNYVLSLDRMEDKAGQPVTVA
FT                   PGSGHRVWINLPAMYTNSFVARFV"
FT   gene            198087..199538
FT                   /locus_tag="Daro_0180"
FT   CDS_pept        198087..199538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0180"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44939"
FT                   /db_xref="GOA:Q47JP2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44939.1"
FT                   /translation="MTEEILINFTPQETRVAVMQQGVVQELHIERTASRGLVGNVYLGR
FT                   VVRILPGMQSAFIDVGLDRTAFLHVADIWQPRETATERPIEKILHDGQSILVQVVKDPI
FT                   GTKGARLSTQVSIAGRMLVYLPQEKHIGISQRIESEAEREVLREKITRLVPSDEPGGFI
FT                   VRTMAESASDEEFATDIAYLRKTWADIRDKARTSGPPTLLYQELSLGQRVLRDFVNPET
FT                   TRIFIDSRENFQKLTGFAEEYTPAVLPLLEHYTGQRPLFDLHGVEEEIQKALARRVDLK
FT                   SGGYLIIDQTEAMTTIDVNTGGFVGVRNFDDTIFKTNLEAAVTIARQLRLRNLGGIIIV
FT                   DFIDMENEEHKKAVLDEFNRALAHDHTRLTVNGFTQLGLVEMTRKRTRESLAHVLCHPC
FT                   PTCTGRGEVKTARTVAYEILRELLREARQFNAREYRILAGPDVVDLFLDEESQALAMLS
FT                   DFIGKSVSLQSEPSYSPEQYDIVLM"
FT   gene            199560..200435
FT                   /locus_tag="Daro_0181"
FT   CDS_pept        199560..200435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0181"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44940"
FT                   /db_xref="GOA:Q47JP1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44940.1"
FT                   /translation="MKTEPEFDSLVPPQTFDRRSFLVTSLGAGFALATQPVMAQTAIKT
FT                   DEVGLIAGEIKVPVKDGEMVAYRAVPGGLTKPPVVLVVSEIFGAHEYIRDTCRRLAKLG
FT                   YCAIGPDLFARRGDPRQIASIPEILEKITSKTPDAQVLSDLDACVAWAAAKGADTNRLA
FT                   VTGFCWGGRIAWLYSAHNPSVKAGVAWYGKLVGPANEITPKHPTDLVGQLKAPVLGLYG
FT                   GLDAGIPLETVEAMEKALQQGSSAAKASEIHVYDNAPHAFHADYRPSYRKEEAEDGWKR
FT                   MLAWFRKNGV"
FT   sig_peptide     199560..199679
FT                   /locus_tag="Daro_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.959 at
FT                   residue 40"
FT   gene            200507..200923
FT                   /locus_tag="Daro_0182"
FT   CDS_pept        200507..200923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0182"
FT                   /product="ProQ activator of osmoprotectant transporter
FT                   ProP"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44941"
FT                   /db_xref="GOA:Q47JP0"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44941.1"
FT                   /translation="MTTTEAITEKPIDARALLKGLQTQFDVFRNFSPLAIGIDKQVFAQ
FT                   LPEVSKKALRLAMRSHTISTRYLKEMEKGTVRLNLDGTPAGEVTDENRQHAAELLRERF
FT                   KKQAEQRKAAEAEAKAEQRRVEKLNQLAEKFGRK"
FT   gene            complement(200986..201061)
FT                   /locus_tag="Daro_R0007"
FT   tRNA            complement(200986..201061)
FT                   /locus_tag="Daro_R0007"
FT                   /product="tRNA-Met"
FT   gene            complement(201154..201229)
FT                   /locus_tag="Daro_R0008"
FT   tRNA            complement(201154..201229)
FT                   /locus_tag="Daro_R0008"
FT                   /product="tRNA-Lys"
FT   gene            complement(201248..201323)
FT                   /locus_tag="Daro_R0009"
FT   tRNA            complement(201248..201323)
FT                   /locus_tag="Daro_R0009"
FT                   /product="tRNA-Lys"
FT   gene            complement(201469..202293)
FT                   /locus_tag="Daro_0183"
FT   CDS_pept        complement(201469..202293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0183"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44942"
FT                   /db_xref="GOA:Q47JN9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44942.1"
FT                   /translation="MKPEISIEFFPPQTPEGIEKLRTVRAELAKLNPHFFSVTYGAGGS
FT                   TRERTFAVVKEIAAEGFDAAPHLSCIGSTRESIREILAEYKSAGIKRTVALRGDLPSGM
FT                   AEAGEFRYANELVEFIRAETGDWFSIEVAAYPEWHPQARSPKDDLEAFARKVKAGANSA
FT                   ITQYFYNADAYFHFVDEAKALGVDVPIIPGIMPIAGFTKLARFSDACGADIPRWMRKKF
FT                   ESFGDDADSIRAFGLDVVTELCERLLKGGAPGLHFYAMNQSALTTEICRRLG"
FT   gene            complement(202290..203111)
FT                   /locus_tag="Daro_0184"
FT   CDS_pept        complement(202290..203111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0184"
FT                   /product="Hemolysin A"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44943"
FT                   /db_xref="GOA:Q47JN8"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44943.1"
FT                   /translation="MSMNSFHARQKKPRPTPQPAHERPAGVLRADALLVAQKLAPSRTA
FT                   AQWMIKSGRVSWAGGAISKPALELPEDTPLTVTADPEAHYVSRGGNKLAGALSETGLTV
FT                   AGKVCLDVGQSTGGFTDCLLQAGAKHVVGVDVGHGQLHSQLRHDSAVTAIEGVNCRALT
FT                   AADLGKAFPESGFELIVGDVSFISMTLVLPQLPALLAEHGDLLLLVKPQFEVGPDNIGK
FT                   GGIVRDIALYKDVETKFRTCAASLGLKVRAWLDSPITGGDGNREFFIWLNK"
FT   gene            complement(203121..203468)
FT                   /locus_tag="Daro_0185"
FT   CDS_pept        complement(203121..203468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0185"
FT                   /product="Membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44944"
FT                   /db_xref="GOA:Q47JN7"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44944.1"
FT                   /translation="MLNLLAVWIVNALALLALPYVVPSVQIAGFGTALLVAVVLGLINT
FT                   LLKPLLILLTLPVTLLTLGLFIFVINALLFMLADNLVDGFQVAGFWSALFGSIGYSLIS
FT                   WALSVIFLRKS"
FT   gene            complement(203478..204890)
FT                   /locus_tag="Daro_0186"
FT   CDS_pept        complement(203478..204890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0186"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44945"
FT                   /db_xref="GOA:Q47JN6"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44945.1"
FT                   /translation="MAEFKDYVIADLSLADWGRKEILIAETEMPGLMAIREEFAKTQPL
FT                   KGARITGSLHMTIQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAIAAQNIPVFAVKG
FT                   ETLVDYWDYTHRIFEWADGGYSNMILDDGGDATLLLHLGARAEKDISLLAKPGSEEETI
FT                   LFAAIKAKLAVDPTWYSVRLAQIKGVTEETTTGVHRLYQMHQRGELKFPGINVNDSVTK
FT                   SKFDNLYGCRESLVDGIKRATDVMIAGKVAVIAGYGDVGKGSAQAMRALSAQVWVTEID
FT                   PICALQAAMEGYRVVTMEYAADKADIFVTTTGNFHVITHDHMAAMKNNAIVCNIGHFDN
FT                   EIDVASIEKYQWEEIKPQVDHVIFPDGKRIILLAKGRLVNLGCGTGHPSYVMSSSFANQ
FT                   TIAQIELWTEAVKGSNKYPVGVYTLPKHLDEKVARLQLKTLNAQLSELTDEQAAYISVP
FT                   KEGPYKADHYRY"
FT   gene            complement(205055..206260)
FT                   /locus_tag="Daro_0187"
FT   CDS_pept        complement(205055..206260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0187"
FT                   /product="HDIG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44946"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44946.1"
FT                   /translation="MLKKIPVEKLTLGMHLQAFCGAWLDHPFWRTKFVLTDPNDLCLIK
FT                   ESSIREVWIDASKGSDVATDEVAGTTEIVTAEEIPEPPPVVQEKASFNDEVKRAAKICA
FT                   KGKEAVVSMFQEARMGKAIEAEAAAPLVEEISNSVMRNPGALISLARLKTADDYTFMHS
FT                   VAVCALMIALARQLGLDDRQVRDAGMAGLLHDLGKAMIPLEVLNKPSKLTDEEFDLVKT
FT                   HPEAGYKLLLEGNGISEMTKDVCLHHHEKIDGSGYPKGLNSDTMSLFAKMGAVCDVYDA
FT                   VTSNRPYKAGWDPAESIKRMAEWKGHFDPSVFQAFVKSLGIYPIGSFVRLESGKLGVVI
FT                   EQGEQSLLKPKVKVFFSTKSQAYIRPETIDLARSPEKIAGREDAAKWGIKDVDRYWAGD
FT                   KA"
FT   gene            complement(206325..207488)
FT                   /locus_tag="Daro_0188"
FT   CDS_pept        complement(206325..207488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0188"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44947"
FT                   /db_xref="GOA:Q47JN4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44947.1"
FT                   /translation="MSDYLFTSESVGEGHPDKVADQISDAILDAILAQDKHSRVAAETL
FT                   CNTGLVVLAGEITTNANVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSPDIA
FT                   QGVNAAYDDNLGQGAGDQGLMFGYACDETPSLMPLPIYLSHRMVERQAMLRKDGRLPWA
FT                   RPDAKSQVTIRYVDGKPHSIDTVVLSTQHSPDISLEDLREATIEQIIKPVLPKELIKGD
FT                   IKYLVNPTGRFVVGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAT
FT                   RYVAKNIVAAGLASRCLVQVSYAIGVAEPTSIMVETYGTGKVSNETLTALVRKHFDLRP
FT                   KGIVNMLDLLRPIYQKTAAYGHFGRDEPEFTWEATDRANLLKSDAGL"
FT   gene            207648..208490
FT                   /locus_tag="Daro_0189"
FT   CDS_pept        207648..208490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0189"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44948"
FT                   /db_xref="GOA:Q47JN3"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44948.1"
FT                   /translation="MVFLFRIFSFLPLGLLHVLGGGFGRLIYWLSPTYRHHLQENLAQA
FT                   GIDPSLRGAVAAETGKQMIELARIWMRPLEEAVPLVAEVVGWEHVEAARQAGKGIVFLT
FT                   PHLGCFEITAQYLSSFGDITVLYRAPKSASAQELILMGRKREHLHLAPADLSGVRALIK
FT                   ALKKGEMVGMLPDQAPKTGEGVWLKFFGRYAYTMTLAARLTETGAVSLLTWGERLPGGR
FT                   GYRVHFQLPHNPLSGSTVERAQQINDEVEALIRQCPAQYLWGYNRYKRPGGAEPPPAE"
FT   gene            208497..209372
FT                   /locus_tag="Daro_0190"
FT   CDS_pept        208497..209372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0190"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44949"
FT                   /db_xref="GOA:Q47JN2"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44949.1"
FT                   /translation="MKIFLTWILVGFLWLLHWLPLPILRALGAGLGRLLYAVGRERRKV
FT                   ALINLRLCFPEKTEAEREELAKRHFVAFAQAVLDRTLCWWGSRERLERLFRIHGVEHLT
FT                   DPEGRPVILLSPHFVGLDAQATRISMYVPGCSVYSNQKNPVLNKLLYDGRVRFRDAVLL
FT                   SRQDGMRKIIKAMKDGYRFYYLPDMDFGPKESIFVPFFGVQAATIPALSRLVRLTGARV
FT                   VPCIARQVPDGYEVEVMPPWENFPGESVEADTEFMNKFIESQVLRMPEQYFWLHKRFKT
FT                   RPPGEQRFYK"
FT   gene            209369..209875
FT                   /locus_tag="Daro_0191"
FT   CDS_pept        209369..209875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0191"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44950"
FT                   /db_xref="GOA:Q47JN1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44950.1"
FT                   /translation="MNSSLKVEIRPVTPPDVPAIAALAREIWQATYPGIITQEQIDFML
FT                   EQRYGHERLYDDLEDLHKWLDQAFHGDRRVGFAFSEIYNDEFKLDKLYIHPDVQRQGVG
FT                   GQLIAHVAERAKKQGYPCVILQVNKRNVNAINSYKKYGFVVRTATVDDIGHGYVMDDFV
FT                   MEKKL"
FT   gene            209936..210766
FT                   /locus_tag="Daro_0192"
FT   CDS_pept        209936..210766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0192"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44951"
FT                   /db_xref="GOA:Q47JN0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44951.1"
FT                   /translation="MKLKFSKMHGLGNDFVVLDGVRQSVSLSPEQLCYLADRHFGVGCD
FT                   QILLVEKASQPGIDFRYRIFNADGGEVEQCGNGARCFVRFVHDEGLTDKREIRVETMRG
FT                   IISPRLEGDGNVTVDMGIPRFLPAEIPFLAEDDVIIHLLDVADETLETSVVSMGNPHAV
FT                   QVVDSVDTAPVGEHGPLIEKHPRFPLRVNAGFMQIVDRHAIKLRVYERGSGETMACGTG
FT                   ACAAVVAGIRRGLLDSPVRVTTRGGDLTIAWGGDERPVLMTGPAVTVFTGEIEL"
FT   gene            210763..211434
FT                   /locus_tag="Daro_0193"
FT   CDS_pept        210763..211434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0193"
FT                   /product="Protein of unknown function DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44952"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44952.1"
FT                   /translation="MSAMFPEEIAEYLKNNPSFFEQYADLMAQIFVPHPHGGRAVSLAE
FT                   RQMLTLREKNRSTESKLAELIAFGEENDQISEKVHRLSVALIAAETFQAVIHLLNFHLR
FT                   DDFSVPHVALRLWDKPEEIEGLPEFAAVSEELQVFAETLARPYCGSTAGFGTASWFGEH
FT                   ASHIRSQALIALRNGGGTIGMIALGSEDAQRFYADMGTLYLERLGEMVSAALARVTKSV
FT                   L"
FT   gene            211440..212327
FT                   /locus_tag="Daro_0194"
FT   CDS_pept        211440..212327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0194"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44953"
FT                   /db_xref="GOA:Q47JM8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44953.1"
FT                   /translation="MLAVDTWLAELSDQRRLSAHTVSNYRRDLQKLLAAAGDIPLASLQ
FT                   VHHLRRFVAQLHGQGLAGRSLARALSAWRGFFHWLGERGMVKANPCDGIRPPKSPRMLP
FT                   KALSVDETSRLLMPVDDDDPVQAARDLAMFELFYSSGLRLAELVALDCEALDDIAHESE
FT                   VRVLGKRNKLRLVPVGSKAREALAAWAAVRNELAKPEEKALFVGQRGGRISPRMVEARL
FT                   ARRAVLLGLPTHVHPHMLRHSFASHVLQSSGDLRAVQEMLGHASIASTQVYTHLDFQHL
FT                   AKVYDAAHPRAKSK"
FT   gene            212342..212617
FT                   /locus_tag="Daro_0195"
FT   CDS_pept        212342..212617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44954"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44954.1"
FT                   /translation="MRHGLNDWPSKLAKNQGFVDDSPTSLYDWRFRKIAGIKELFMAIN
FT                   RNRRSSLERRCVSKSTKRLFKSTGKTMFKVMYAAECHQRNRKALGA"
FT   gene            212691..213881
FT                   /locus_tag="Daro_0196"
FT   CDS_pept        212691..213881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0196"
FT                   /product="SAM-dependent methyltransferase / 23S rRNA
FT                   m(5)C-1962 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44955"
FT                   /db_xref="GOA:Q47JM6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44955.1"
FT                   /translation="MAQLILLPGKERSAFKHHPWLFAGSVGRLEGRARPGDTVEVLADN
FT                   LRPLGRAAYSPKSQIRARFWTFDAEESIDDAFFKRRIAAAVALRQALPELRGQQGLRLI
FT                   HAESDGLPGVIADQYGDTVVIQLTSAGADKWRNAIVAGLVKATGCARVYERSDSDVRGL
FT                   EGLGPTTGWLHGEAPATPLSIDENGVRLAIDIAGGHKTGFYLDQRENRALLGQLSAGKD
FT                   VLNCFCYTGGFSLQAMAGGAKSVLSIDSSGPALAQAKANLALNPQLPADRAEWQEADVF
FT                   QALRDFRKAGKLFDLIVLDPPKFAPSAAHADRAAKAYKDINILGCRLLKPGGLLMTYSC
FT                   SGGVGLEMFQKIIADSALDAERSARIVRRLSGAADHPVALNFPEGEYLKGLLVQVD"
FT   gene            213932..214213
FT                   /locus_tag="Daro_0197"
FT   CDS_pept        213932..214213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44956"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44956.1"
FT                   /translation="MLQLRHFLLVAILFFAQLATGAHAVEHAAGDEKGLPTHACQLCLA
FT                   AHDLGAALPSLVALPPVVAVQSVPEALSAHGRSAFPAPLATQRGPPLL"
FT   sig_peptide     213932..214006
FT                   /locus_tag="Daro_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.936 at
FT                   residue 25"
FT   gene            214288..215649
FT                   /locus_tag="Daro_0198"
FT   CDS_pept        214288..215649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44957"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44957.1"
FT                   /translation="MQKSFAMAALLAASCGVQAATDADLAAIRSQIDEMKKTYEQRIAA
FT                   LEQKLAQAETKSRQEPQQVASAPVASSSPSAAANGFNPEVSLILQGQYRNMKDIPGRVI
FT                   GGFVSAGGEGLNNRGFSVDETELVLAANIDPYWRGQAIVAMADGQANIEEAWFQSLAIG
FT                   QGVGLKIGRFRSGIGYLNEQHPHARDFSDAPLMYQAMFGDSYAQDGVQLKWLAPTPLFV
FT                   ELGGEVGRGANFPGTDRNRNGAGGGALYVHVGDDVGFSNSWRLGASWLKTRASERSADF
FT                   VDLGGVAAQGRFAGDSTTWLADFVWKWAPNGNSTQQSFKFQSEYFVREEKGNLSCSSDD
FT                   ATSLCGMPADSSYRTRQSGWYMQGVYQLMANWRAGLRYEQLDSGVRDFGANAANLVIDN
FT                   YRPKKATAMIDYSWSEFSRVRLQLAQDKSMPGITDHQLTLQYVMSLGAHGAHKF"
FT   sig_peptide     214288..214347
FT                   /locus_tag="Daro_0198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.982 at
FT                   residue 20"
FT   gene            215659..216555
FT                   /locus_tag="Daro_0199"
FT   CDS_pept        215659..216555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0199"
FT                   /product="Periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44958"
FT                   /db_xref="GOA:Q47JM3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44958.1"
FT                   /translation="MNKIISTVLLTLASLPAWANLNIFATVPEWGALAKEIGGDKVRVY
FT                   TATNAFQDPHRIEAKPSLLAQARQAQLVIAAGADLEIGWLPLVLRDSGNSAIQTGRPGY
FT                   FEASAFVNRLDVPTTLDRSHGDIHAAGNPHIHLDPRNVLKVGEALTARMAELDAANAAS
FT                   YQATFKAFASKWQVAIARWEKEAAPLRGLPVLVHHQSFVYLDNWLGLKEIGSLEPKPGI
FT                   EPTSGHLTGLLTRQQTVPARMVLRGAYQQEGPSQWIAGKTGIPAVLLPYTVGGTPEAKD
FT                   LFGLYDDTIQRLLKGIR"
FT   sig_peptide     215659..215718
FT                   /locus_tag="Daro_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            216557..217126
FT                   /locus_tag="Daro_0200"
FT   CDS_pept        216557..217126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0200"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44959"
FT                   /db_xref="GOA:Q47JM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44959.1"
FT                   /translation="MLRTEALVAGWQKPATQAIDLSLAAGEIVGLTGPNGVGKSTLLAA
FT                   LAGRARIFSGRIQLQPGLRLALQTQDVPPVDGLPLSGRELLALTGASPKGLPPWLAERI
FT                   DIRLDRLSGGQRHYLALWAVLQAPADLILLDEPTNNLDAAGVRHLTAHLHERSKGGTGI
FT                   IVVSHDAAFVEAACDRVVVLEACDGE"
FT   gene            217116..217880
FT                   /locus_tag="Daro_0201"
FT   CDS_pept        217116..217880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0201"
FT                   /product="ABC-type Mn2+/Zn2+ transport systems permease
FT                   components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44960"
FT                   /db_xref="GOA:Q47JM1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44960.1"
FT                   /translation="MGNELFLIPFLTGLGLAVLLPLLGCYLRLRDEWLAALAYSHVAAA
FT                   GALLALVGGLPPVIGGISAAGLAGAGKRLFARRLVGGASYAMLLLGGWAVAVLMAANQP
FT                   MAERLGHALFDGQLYFAGPDELWLVAAGVPVAMIILRLLSRHLLLAHTYPDLFRIRGLK
FT                   AWPTQIGFDLLAALSLALATMSLGVMGAFALVFIPPWLAFRRAGNWYSGLRWALVLGVL
FT                   GYVGAFLLALGLDQPFGPVLAILLVAVGLVVA"
FT   gene            217926..219236
FT                   /locus_tag="Daro_0202"
FT   CDS_pept        217926..219236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44961"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44961.1"
FT                   /translation="MVFSFFKKQPNKMPERPAARPRVAEPLPEPDLPKPVVGEAPRPLP
FT                   QPLPDLEFTSGKSSAPAAGVAAKPKAAVETANLSSSQIKPPVEETDFSFDDFDRDFTDS
FT                   SVMGIDVDQDVDPLQACVEQVVVLYANGQEGAARSLLETFVRSYHGTEGKRFWLLLFDL
FT                   LQISGDRAAFEKLGADYAEACETSPPTWCQKSSIAQQPTGSVGPRKVFLQGVLTTEGAL
FT                   PVTELAKIIGQKEAATVDCGKLIGCDDEIASELADLLSRARKMRLAVTLLGPEAFMDRL
FT                   NDRLVAGVAEHESAWRLLLELLQRHGTQDKFEERAVDYAITFELSPPSWEPLAPSVQAS
FT                   AMTPKTSDDAHYLSGDLKGCRFEDLGQVIEAHEQPILDFSGVSRLDFVSAGQLVNRLAP
FT                   YKAAGRDIIIRSPNHLVAELMAVVGLNKQARIVVPKS"
FT   gene            219250..219786
FT                   /locus_tag="Daro_0203"
FT   CDS_pept        219250..219786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0203"
FT                   /product="HslV component of HslUV peptidase, Threonine
FT                   peptidase, MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44962"
FT                   /db_xref="GOA:Q47JL9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44962.1"
FT                   /translation="MEQYHGTTILSVRRGNSVAMGGDGQVTLGNIVIKATARKVRRLYN
FT                   GRILAGFAGGTADAFTLFERFEAKLDKHQGNLLRSAVELAKDWRSDRALRRLEAMLSVA
FT                   DREVSLIITGNGDVLEPEQGIVAIGSGGSYAQSAARALLENTELAPRDIVTKSLEIAGD
FT                   ICIYTNRNFTLEVLE"
FT   gene            219783..221123
FT                   /locus_tag="Daro_0204"
FT   CDS_pept        219783..221123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0204"
FT                   /product="Heat shock protein HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44963"
FT                   /db_xref="GOA:Q47JL8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44963.1"
FT                   /translation="MTTMTPQEIVSELDKHIVGQKNAKKAVAIALRNRWRRSQVAEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLARLANAPFIKIEATKFTEVGYVGRDVETIIRDLV
FT                   EMAIKSHRERAMKAMRARAEDAAEERILDVLLPTVRGPNFFAENSESTAAENTTRQKFR
FT                   KKLREGELDDKEVDIEVAAPSLQAEIFAPPGMEELTQQIQGMFQSVGGGKKKSRKLSIK
FT                   EALKLLTDEEAAKLVNDDDVKQEAVKAVEQNGIVFLDELDKIASRSEMHGADVSRQGVQ
FT                   RDLLPLVEGTTVSTKYGMIKTDHILFIASGAFHLSKPSDLIPELQGRFPIRVELDSLSV
FT                   ADFECILTQTDACLTRQYQALLETEGVQLEFVEDGIRRLAEIAFQVNEKTENIGARRLH
FT                   TVMEKLLEEVSFDAGKVGLDKVLIDAAYVNTKLGELAADEDLSRYVL"
FT   gene            221228..222115
FT                   /locus_tag="Daro_0205"
FT   CDS_pept        221228..222115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0205"
FT                   /product="Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44964"
FT                   /db_xref="GOA:Q47JL7"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44964.1"
FT                   /translation="MEDQSLSFRLLAILFPIFGIVAAGYFYGRKHKPEMAVANRLNMDV
FT                   FVPALVFAAMAGKSFDLAAYAPLAVGGFLVLAACGLLAWPIARLAGIQPRTLVPPMLFN
FT                   NSGNIGLPLAVLAWGESALPAAVILFMVENTLHFSFGARLLDPKTRLLTLWRIPVLFAA
FT                   IAGLTVALVKIPIWTPLVIAIKMLGDVSVPLLLFSLGVRMTDVNFSEWKVAVGSAVLRP
FT                   LAGMLIAAGVIQLLGLQGRDAAMLFVFGALPPAVLNFLFAERYKQEPQRVASIVLIGNL
FT                   AALVYLPLALVWVL"
FT   gene            complement(222110..222478)
FT                   /locus_tag="Daro_0206"
FT   CDS_pept        complement(222110..222478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0206"
FT                   /product="heat shock protein Hsp15"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44965"
FT                   /db_xref="GOA:Q47JL6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44965.1"
FT                   /translation="MRVDKWLWAARFFKTRSLASDAVSGGKVKVNGATIKPARDIKIGD
FT                   RLNIINSETRWEVTVQAPSDKRGPAPEARLLYEETPESIAAREAARDSRQFVQDPAADI
FT                   HGRPTKRDRRQLGRFSGS"
FT   gene            complement(222484..223746)
FT                   /locus_tag="Daro_0207"
FT   CDS_pept        complement(222484..223746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0207"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44966"
FT                   /db_xref="GOA:Q47JL5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44966.1"
FT                   /translation="MTHFALNNGVLHAESVALPAIADQFGTPAYVYSRAALEASLREFH
FT                   DVLGGHVAGQGALVCYAVKANSNLAILNVFARLGAGFDIVSGGELQRVLAAGADPKKVV
FT                   FSGVGKTADEMKLALDVGIFCFNVESAAELERLNEVASQCGKKAPISLRVNPNVDPKTH
FT                   PYISTGLKGAKFGVAYDNALDLYRRAAALPSIEVTGIDCHIGSQLLDPSPFVEALDRIL
FT                   ALVDQMAAEGIHIHHLDLGGGLGIKYNAEQAQPTVASYLTPLLDKLAGRGLQVVLEPGR
FT                   RLVGNAGLLLTRIEYLKQGEAKNFAIIDAAMNDLMRPALYEAWHDINPVVPRSGVATEY
FT                   DVVGPVCETGDFLGQARPLVVEAGDLLAVMSAGAYGMAMASNYNTRPRAVEVMVDGDKI
FT                   HVIRQRETVEQLYAGESILPQ"
FT   gene            223946..224263
FT                   /locus_tag="Daro_0208"
FT   CDS_pept        223946..224263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0208"
FT                   /product="Frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44967"
FT                   /db_xref="GOA:Q47JL4"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44967.1"
FT                   /translation="MDDSEFNALAEQALARIDAALEACDADLDFELAPGGVLEIEFADR
FT                   SKIIVNRHSIAKEIWVAARAGGFHFRWDGASWRDTRDNAELMEKLSTLASQQAGEAIVL
FT                   R"
FT   gene            complement(224264..226579)
FT                   /locus_tag="Daro_0209"
FT   CDS_pept        complement(224264..226579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0209"
FT                   /product="Penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44968"
FT                   /db_xref="GOA:Q47JL3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44968.1"
FT                   /translation="MPSTHSALRLILYPVIFLLGLLAIGIAIALIVLVLAYPNLPSLEV
FT                   LTDYRPKIPLRVYTADGFLIGEYGEERRAVVAIKDVPPIMKQAILAAEDDRFYQHGGID
FT                   YTGILRAAGANLIGGGKRQGASTITQQVARNFFLTGEKTYTRKLYEALLSFKIESNLTK
FT                   DQIFELYINQIFLGQRAYGFAAAAQIYFGKPLKDISIAEAAMLAGLPKAPSAYNPVVNP
FT                   TRAKQRQQYVLRRMHELGHISDTQYAAALKEPLIVKRELAGYAVHAEYVAEMARQITAE
FT                   RFPEEVYSRGMKVYTTLIKAEQEAAYISLRKGVMDYDRRHGYRGAESYLDMKDIKSDQD
FT                   EAIDEALQDIPDTGDLIPALVLSADPKQIKVYRKGGEVVTLTGDAMKFAAKMLDDKAPP
FT                   NKRLKRSAIVRLQKDDKGNWQISQLPEVESAFVAVDPKDGAIRALVGGFDFNRNKFNHV
FT                   TQAWRQPGSSFKPFIYSASLEKGFSPNSVIADEPIVIPASQTGTQAWEPHNYDGKYEGP
FT                   MKMRTALAKSKNMVSIRILQAIGTQYAQDYAGRFGFDPAKHPPYLTMALGAGSVTPWQM
FT                   VTAYSVFANGGFKVSPFVVREIRDEREQILAHSAEIEAGSDNIRVIDPRNAFMMDTMLR
FT                   DVAIYGTAAKASAILKRQDLAGKTGTTNEYVDAWFCGYQMTVAGCAWIGFDQPRKLGDK
FT                   ETGGAAALPIWIGYMARALKDVPMQVPQAPEGLIAYGEGRDRSYIYAENAAKERTPEEE
FT                   SQDATPLPKPDLSTPPSD"
FT   sig_peptide     complement(226469..226579)
FT                   /locus_tag="Daro_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.898 at
FT                   residue 37"
FT   gene            226740..227825
FT                   /locus_tag="Daro_0210"
FT   CDS_pept        226740..227825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0210"
FT                   /product="Type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44969"
FT                   /db_xref="GOA:Q47JL2"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44969.1"
FT                   /translation="MGFDISALLNPKARPLFGLDISSSAVKMVELTANGKDGYRVERYT
FT                   IEVLPKDAVSDGNIANLDGVVDCVKRAWKRMGTSTRNVAMALPGSAVITKKIIVPAGLR
FT                   DDELEAQVETEANQYIPFSIDEVNLDYQVIGPAPAVPDELEVLIAASKKERVEDRVAVA
FT                   DAAGLKALVVDVESFAVLAAFELIERQLPDSGKNQVVAMIDAGANVMNLTVLRNGQQVY
FT                   AREQAFGGGQLTQDIARHYGMSFEDAEAAKRAGNLPEGYEVELLNPFMENLALEVSRAL
FT                   QFFFTSTQYNQVDHIVLAGGCAVIPGIDEVVATRTQVNTLIANPFANMVLSDRVRAKSL
FT                   LADASSLMVACGLALRRFDPS"
FT   gene            227822..228391
FT                   /locus_tag="Daro_0211"
FT   CDS_pept        227822..228391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0211"
FT                   /product="Fimbrial assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44970"
FT                   /db_xref="GOA:Q47JL1"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44970.1"
FT                   /translation="MIRINLLPHREEAKKARREQFFVLVGLVSVLGALIVFAGYTLIGG
FT                   AITNQESANDFLKKEIAVLDKQLDQIKRLKEQTQALLSRKQVIENLQRDRGETVYLLSE
FT                   LVKQVPEGIYLKAVKQDGLKINITGNAQSNARISALMRNLEASPWLEQPQLVESKAVVV
FT                   NGRRVYEFGMNFILTRVKPDEGKGKK"
FT   sig_peptide     227822..227938
FT                   /locus_tag="Daro_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.751) with cleavage site probability 0.743 at
FT                   residue 39"
FT   gene            228388..229071
FT                   /locus_tag="Daro_0212"
FT   CDS_pept        228388..229071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0212"
FT                   /product="Pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44971"
FT                   /db_xref="GOA:Q47JL0"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44971.1"
FT                   /translation="MNAKSISLPKFDFQSIADDFRFINPNDPGSWPLIPKATALVGLFA
FT                   AILLAGWWFVWNDQLTELDSKEREEQSLKQQFLDKKRQAVNLDLYVQQLAEIDRSFGAL
FT                   LKQLPDKSEIEALLIEVNQAGLGRGLQFELFKPGQEQVKDFYAELPITVKINGGYHDFG
FT                   AFAADIAKLPRIVTLNNISITSAKDGGQLSLDATTKTFRYLDDEEIAKQKKAEQQKKAE
FT                   QGAKK"
FT   gene            229068..229613
FT                   /locus_tag="Daro_0213"
FT   CDS_pept        229068..229613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0213"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44972"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44972.1"
FT                   /translation="MKRILLIALCGILGACSGADHEDLKQWMAENSKDMRGNIPKLPEV
FT                   KPYEPVPYDVEGTLDPFKPSKIEPESKYKQVAGKGGAFQPDFEAREVRNSLLEKYPVES
FT                   LKMIGYMNVNKHPMAVIQVEDKVKQVKVGDYMGLDFGMVTQISDTEVQLRELIQDSAGD
FT                   WTERKSSLYLQSKEGSKK"
FT   sig_peptide     229068..229136
FT                   /locus_tag="Daro_0213"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.456 at
FT                   residue 23"
FT   gene            229610..231757
FT                   /locus_tag="Daro_0214"
FT   CDS_pept        229610..231757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0214"
FT                   /product="type II and III secretion system
FT                   protein:NolW-like:Secretin/TonB, short N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44973"
FT                   /db_xref="GOA:Q47JK8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44973.1"
FT                   /translation="MKFINYAMAAALTCLAVVSSARAETLPSNAIEAVNVAQQGNEIAL
FT                   RIDLKEALASPPPGFSVANPAKIALDFQSTANGLGKNSQAFNQGDLRSMNVVQVGDRTR
FT                   VVLNLVRNMNYKTRLDGKALYVTLTPIERLAESSAQRTTRFAEESLVGGKHAVNDVVFR
FT                   RGKGGEGRIVVDLSDTGTGIDIRQQGSNLIVDFMKTTVPDRLRRKLDVTDFATPVTSVE
FT                   TKAFGDNVRMVITPMGLWEHNAYQSDNQFIVEVKRVVEDPNKLVQGSKIGYQGPRVSIN
FT                   YQNGDVRALLRLMAEELGLNAVISETVTGTTTLVLKDVPADQVIDIIFQQKGLDMRKKG
FT                   NIIMIAPRDEIATREKLEFESKQQISELEPLKLEQFQLNYQKAADVARLLAGLPPLGAA
FT                   GAAAAPAPGTNVAAQRILSKRGSAVADPQSNIIFINDIPSKLEEIRSFIAAIDTGARQV
FT                   LIEARVVEAQDSFNRALGGKFGFLNKQAVQPAGSGINVAGGSSTTAGQSTSTPMVGVNL
FT                   PSPSTGGSLALSLFTASFSRILNLELAALESDGLGKIVSSPRVITANNVKAKIEDGTEI
FT                   PYVTTQSSGGTTTATVSFKPAKLSLEVTPQITPEGTVRMNLVVKKEEADWTKAVVLNGY
FT                   ANPPIKSSVVETNVVVENGGTVVIGGVFITDTQNSVEKVPLLGDIPFFGWLFKYKNDIG
FT                   KRRELLVFITPRVISDKMRFD"
FT   sig_peptide     229610..229681
FT                   /locus_tag="Daro_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            231806..232357
FT                   /locus_tag="Daro_0215"
FT   CDS_pept        231806..232357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0215"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44974"
FT                   /db_xref="GOA:Q47JK7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44974.1"
FT                   /translation="MSTQDSAKITTVEHRRNIYLVGLMGAGKTTVGRQLARRLSRPFFD
FT                   TDHEIVERTGVPIPTIFEIEGEEGFRRREAQTIYDLTAENNIVLATGGGVVINPENRRR
FT                   LHDTGWVVYLNVSPVLLYERTRHDRNRPLLRVEDPLAKLEELHSIRDPLYREVAHIVVD
FT                   GSHLVASGIVQYLLREFNRL"
FT   gene            232354..233448
FT                   /locus_tag="Daro_0216"
FT   CDS_pept        232354..233448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0216"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44975"
FT                   /db_xref="GOA:Q47JK6"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44975.1"
FT                   /translation="MKTVTQTLNVALGERSYPIHIGTDVLSRPELILPFLSQKRVVVVT
FT                   NTSVAPLYLDELRSGLEKCGIETLPVVLPDGEQYKTWETLNLIFDALLAARCERNTTLI
FT                   ALGGGVIGDMGGFAAACYQRGMPFIQVPTTLLSQVDSSVGGKTAINHPMGKNMVGAFYQ
FT                   PRLVLADLSTLDTLPDRELKAGLAEVIKYGLIRDPDFFVWLEANLEKLLVRDKSALAYA
FT                   VHRSCANKAEVVAADERESGERALLNLGHTFGHAIETGLGYGEWLHGEAVAAGTLIAAE
FT                   LSCRLGWIDADSVARIEKIFVRSGLPVKAPDLGAARYLELMSHDKKVQDGKLRLVLLRE
FT                   IGKAVVSDAATTAQMVDAIEARCT"
FT   gene            233636..238270
FT                   /locus_tag="Daro_0217"
FT   CDS_pept        233636..238270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0217"
FT                   /product="glutamate synthase (NADH) large subunit"
FT                   /EC_number="1.4.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44976"
FT                   /db_xref="GOA:Q47JK5"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44976.1"
FT                   /translation="MEPAVPERQGLYDPANEHDACGVGFVAHFKGQKSHSIVEQGLLIL
FT                   KNLDHRGAVGADPLQGDGAGILIQIPDQFYREEMAKQGVELPPNGEYGVGMVFLPQEAA
FT                   SRHACVEEIERSVKAEGQVVLGWRDVPVNADMPMSPTVKAKEPVIRQIFVGRGPDVFVT
FT                   DALERKLYIIRRRAANAIKSLKLKHGQEFYVPSFSARTVNYKGLLLADQVGVYYADLQD
FT                   KRTVSALALVHQRFSTNTFPTWDLAHPFRYIAHNGEINTVRGNVNWFKAREQAISSPIL
FT                   GDDLKKVWPLHYPGQSDSASFDNALELLVMGGGYSLAQAVMLMIPEAWEKHTTMDENRR
FT                   AFYEYHAAMMEPWDGPAAVAFTDGRQIGATLDRNGLRPARYLVTDDDLVVMASESGVLP
FT                   IPEKKIVKKWRLQPGKMFLIDMEQGRIIDDQELKNSLANAKPYREWIEKIRIKLDEVPA
FT                   AAEKCAESAASLLDRQQAFGYTQEDVKVILEPMVQNGEEATGSMGTDSALPVLSSKNKT
FT                   LYTYFKQLFAQVTNPPIDPIREELVMSLVSFIGPKPNLLNTNDINPPIRLEVSQPVLSF
FT                   ADMEKLRNIEKYTSGKFRSLELDICYPVAWGKDGIEARLASLAADAEDAVRSGANILIV
FT                   SDRKVDAGHVAIPALLATSAIHQHLVKKGLRTSAGLVVETGSARETHHFALLGGYGAEA
FT                   VHPYLALETIESFAKGDAEKAEKFTKNFIKAIGKGLNKVMSKMGISTYMSYTGAQIFEA
FT                   IGLQKAFVEKYFTGTPSNIEGIGVFEVAEESIRLHDEAFSSDPVLANMLDAGGEYAYRI
FT                   RGEEHVWTPDSIAKLQHSTRSGKYETYKEYAKLINDQTKRHLTLRGLFEFKPQGTAIPL
FT                   EEVEPAKEIVKRFATGAMSLGSISTEAHTTLAIAMNRIGGKSNTGEGGEDAKRFLPLKA
FT                   GQKLSEVIGASRIERDYEFKDGDSLRSAIKQVASGRFGVTAEYLVNADQIQIKMAQGAK
FT                   PGEGGQLPGHKVSEYIGFLRHSVPGVGLISPPPHHDIYSIEDLAQLIHDLKNANSRASI
FT                   SVKLVSEVGVGTVAAGVAKAKADHVVIAGFDGGTGASPQSSIKHAGTPWELGLSETQQT
FT                   LVLNRLRSRIRVQVDGQMKTGRDVVVGALLGADEFGFATAPLVVEGCIMMRKCHLNTCP
FT                   VGVATQDPVLRQRFSGQPEHVVNFFFFVAEEVREIMAQLGIRKFDDLVGRADLLDTRAG
FT                   IEHWKAKGLDFSKVFYQPSVPAEVSRRHTETQDHGLEKALDHKLIEQAKPALEKGQKVQ
FT                   IETKIINVNRTCGTMLSGEVARRYGNDGLPDDTIHVKLTGTAGQAFGAFLAKGVTLELT
FT                   GEGNDYVGKGLSGGRLIIKPSPDFRGDTQQNIICGNTVMYGATDGEAYLAGVGGERFCV
FT                   RNSGATAVVEGVGDHGCEYMTGGTVAVLGMTGRNFAAGMSGGIAYVLDEDGSFKNRCNL
FT                   AQVALEKVLPATRQAASEPLHRGIADETQLKELVTRHAEFTGSATAKAILANWDACREK
FT                   FVKVYPHEYKRALTEMAAAQKEAA"
FT   gene            238270..239736
FT                   /locus_tag="Daro_0218"
FT   CDS_pept        238270..239736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0218"
FT                   /product="glutamate synthase (NADH) small subunit"
FT                   /EC_number="1.4.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44977"
FT                   /db_xref="GOA:Q47JK4"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44977.1"
FT                   /translation="MGKPTGFMEFERLNESYDPVEQRLKHYKEFVHTLNDEDAKIQGAR
FT                   CMDCGIPFCNNGCPVNNIIPDWNDLVYRGNWKQALDVLHSTNNFPDFTGRICPAPCEAA
FT                   CTLGINAAPVGIKSIEHFIIDKGWESGWVVPQPPKAKTGKKVAVVGSGPAGLAAAQQLA
FT                   RVGHDVTVFEKSDRIGGLLGYGIPDFKLEKTVIDRRVAQMEAEGVTFKTKVVVGDKAVP
FT                   AGINNDAIEFVSADQLKKDFDAVILAAGSEVPRDLPVPGRELKGIYAALEFLIPQNKEV
FT                   QQGKANPINVKGKHVIVIGGGDTGSDCVGTSNRHGAASVTQFELMPMPPEEENKALTWP
FT                   YWPYKLRTSSSHDEGCSRDFAVATKGFIDDGKGNVKALKAVRLDWKDGKMSEVAGSEFE
FT                   LPCDNAFLAMGFTNPVGGLLDAFGVEKDARQNAKATTDGEGCYKTNVDKVYAAGDVRRG
FT                   QSLVVWAIREGRQAAREVDAFLMGSTTLPR"
FT   gene            239927..240661
FT                   /locus_tag="Daro_0219"
FT   CDS_pept        239927..240661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44978"
FT                   /db_xref="GOA:Q47JK3"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44978.1"
FT                   /translation="MSAELQPALQVTAPSGALDGHMLLILAIMVVAGILGGAANYFLAD
FT                   RHGEPARRDWLKYPVFGVVAALTVPLFLNMISSTLLEGARTKPIDFYVFAGFCLIYVVA
FT                   SRRLFENMVQLLMGQIDQVRRDVGQIKQQRRDEPIMAPTRFEAEPAKVAEPDPKEVLSY
FT                   NDVEILRALSEESFVYGNLAAICDSTGLARDFVSQRLTVMKALGVIETRINDKNVLHWF
FT                   VSARGKAVLGDILGGQEQKKTA"
FT   gene            240702..242060
FT                   /locus_tag="Daro_0220"
FT   CDS_pept        240702..242060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0220"
FT                   /product="glucosamine-1-phosphate N-acetyltransferase /
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.157"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44979"
FT                   /db_xref="GOA:Q47JK2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44979.1"
FT                   /translation="MNIVILAAGQGKRMHSNLPKVLHPIAGKPLAQHVIDTARQLSPEK
FT                   LIVVYGHGGEVVRSTLAAPDLSWAEQAQQLGTGHAVAQALSELGSAAQTLVLYGDVPLT
FT                   TVATLKRLLQAGKDALSVLTVDLANPSGYGRIVRDGAGNMISIVEEKDASAEQKAIREV
FT                   NTGIMAVPTARLADWLGKLKNDNAQGEYYLTDIIALAVAEGMPVRTAQPEGEWEVLGVN
FT                   SKVQLAELERQHQLNLAGELLVAGVRLADPARIDIRGELTHGRDVAIDVGCVFEGKVEL
FT                   ADAVEVGPYCVLKNVKVGAGTRIAAFCHFEDAVIGPDGVLGPYARLRPGTELGPEVHIG
FT                   NFVEVKKSIIGAQSKANHLAYIGDAEIGQRVNVGAGTITCNYDGANKFKTVIEDDVFIG
FT                   SDTQLVAPVTVGRGATLGAGTTLTKDAPPDALTFSRPRQMTLPGWERPKKVKK"
FT   gene            242060..242383
FT                   /locus_tag="Daro_0221"
FT   CDS_pept        242060..242383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44980"
FT                   /db_xref="GOA:Q47JK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44980.1"
FT                   /translation="MDWGFTAFAIGSTLSLAAGGLLLLVGYIGTLPASFSFGWKTGLPV
FT                   LLLPVIGPVWFALSRGAEFRRPAIQLIVGVALLALATALIMGLGPYFADKLVGEMVEAA
FT                   KNR"
FT   sig_peptide     242060..242113
FT                   /locus_tag="Daro_0221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.752) with cleavage site probability 0.555 at
FT                   residue 18"
FT   gene            242420..244471
FT                   /locus_tag="Daro_0222"
FT   CDS_pept        242420..244471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0222"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44981"
FT                   /db_xref="GOA:Q47JK0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44981.1"
FT                   /translation="MSRYTTDSLRSVALVGHGAAGKTSLAEALLFATGAIAAKGSVDKG
FT                   STVADFDAQEKEAGHSLTSAVVNFGYEDTHVHLIDTPGYPDFSGQAIAALAGVDTALIV
FT                   VNAQTGVELMTERMMRYAADRKLCRMIVINKIDADNLDLPGLVADIRERFGKQCMLLDL
FT                   PAHGAADVVEVLEHEAGDADFESVAAAHRALIDQVVEEDENLLAQYLEDGADPSSAALH
FT                   APFEKALREGHLIPILFTSAKTGAGIKELLHVLASLAPNPAEGNPPPFYKGEPGDVTEP
FT                   FHAEPDAAKHVLAHVFKIVADPYMGKIGVFRVHQGTMKKDMQLFVGDSKRPFKVAHLYQ
FT                   LQGKDSVEVDELLPGDIGAIAKVDEIDFDCVLHDSHDEDHIHLVPLEFPKPMAGLAVET
FT                   KKKGDEQRLFETLAKLAMEDPTFVVERHPTSNETVIRGLGEIHLKAKLARMSGQYKLEV
FT                   DTKPPRIPYCETITGSAEAMYRHKKQSGGAGQFGEVHLRIEPKGRGEGFEFVDAVKGGV
FT                   IPGVFMAAVEKGIRQGLEGGVVAGYAVDDLKVTVFDGKTHAVDGKEVAFVVAGRKAVIE
FT                   AIRAAKPIVLEPIVNIEIVVPENAIGDLTGDLSGRRGHITGTDGRGHGLAAISGEVPLA
FT                   ELNDYQSRLKSLTGGQGSYTIEFARYAAVPPNIQQQLASKFQLHDEDE"
FT   gene            complement(244573..248217)
FT                   /locus_tag="Daro_0223"
FT   CDS_pept        complement(244573..248217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0223"
FT                   /product="PAS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44982"
FT                   /db_xref="GOA:Q47JJ9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44982.1"
FT                   /translation="MRNNGAVSGKEIELRDDQLIISRTDNQGRIVYVNPDFIEISGFSE
FT                   AELIGQPHNMIRHPDMPPEVFADLWRDLRAGRPWIGLIKNRCKNGDAYWVEAHVSPIWD
FT                   KDEISGYMSMRRKASRGEIQAAEQTYAAMQKDADNAPIFEHGAASQRKPWRSLHNAFSN
FT                   APLAIKFILASLTAAALVLGLTTYFLASHVSRTLDENARNQLKHDVSLLRAAVSARVEG
FT                   ANIEAVEYSKVLAKRVYAAIGGQKNASRQSLEAMIEKMSASPGNPIDIFLHDLRGVGTI
FT                   FILTPEGFQRRMTTAVDDHGGSPVGSYLTTDHPAYLQLSAGQTFVGPARVFNRQYVTRY
FT                   TPILDAQGTVVGATVIGIDIGEQLDTLKRQIRSMQVGETGYYYIVDTTPGANFGTLILH
FT                   PYKEGQGLANFRMDNGKGLIEEMARIGTGEISYRWKNEEAGEVVARKKLVIFETLDEPK
FT                   WTVAGGTSVDEFTALSDRIVWLVIAGGLAMATTIFVIILILLRKLILNPLNSQVLPTFH
FT                   AISAGHFDTALDVRGNDEMAQVVQGLESLRNRLAYNNERERTLSAMRELARQEAEGLAR
FT                   ARAEFLANMSHEIRTPLNAVIGLAYLLLQNKLGEREMEYVKRIEGAGKLLLAIVNDVLD
FT                   FSKIDAGKMQLEESSFQLDDLLDNLSSLVRTRAQEKNLVLEYVVAPDATQNLRGDALRL
FT                   SQILINLVSNAIKFTAEGSITVFIDVASNKDNRIELEFRIQDTGIGMSAEQTDNLFRAF
FT                   SQADSSVTRKFGGTGLGLAISKRLIEMMGGTIWAHSVPQVGSTFSFRVWLGIDETKPEV
FT                   LRKVGYHVLVVDDNNLARSVLSSLLKKHGCTVLAAESGEAALAALHASAMTSFDCIMVD
FT                   LNMPDMDGLALAQHIRSERGQSTKLIMVTGENVHSSRYRHALGDFDAIVEKPVTAARIG
FT                   EVLAHLEDDAPPRRPATLLPVPAAPLSGLRILVAEDVPTNQLIMRDLLESLGATVEMAD
FT                   NGEQAIEQLAAAGDDIDLILMDIQMPEMDGLEATHRIRTGQKRANIPIIALTAHALEEE
FT                   RQRAAASGMNDFLTKPIEPANLINVIQRWRPTPVRAETTAPAPLQAVKPIQIPDIPGID
FT                   VTAGLHRMLNRPALYEKVLRDFHTRFIGEADRIRSALASEETVSAARGAHSLKGTGGMI
FT                   GANTLAAIAAELEQAITTGSPDISADLERFEKELNRVLDGVKSAFNIA"
FT   gene            complement(248540..249271)
FT                   /locus_tag="Daro_0224"
FT   CDS_pept        complement(248540..249271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0224"
FT                   /product="Response regulator receiver:Transcriptional
FT                   regulatory protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44983"
FT                   /db_xref="GOA:Q47JJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44983.1"
FT                   /translation="MKDNESAKLIAIVEDDPDVAKIIEQVLGDFGFRTCWCRSAGDLLR
FT                   RLRTLAPDLCIIDLGLPDMDGLEAMQRVRAQSGCGILILTGRAHVSDRVMGLELGADDY
FT                   VLKPFEPRELVARVRSIVRRRESSETPARQIAEFGGWRFNLSNNRLTAPNGDELALSTA
FT                   ESELLKVFVSHPNRILQREKLMGSRDLAPSDRAIDVRISRLRRKLEPDPQSPAFLKTVY
FT                   GAGYLFLAAVSWSGEPGASQH"
FT   gene            complement(249268..251289)
FT                   /locus_tag="Daro_0225"
FT   CDS_pept        complement(249268..251289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0225"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44984"
FT                   /db_xref="GOA:Q47JJ7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44984.1"
FT                   /translation="MLLEDASSPTTPRHEMLQAGLDLLDQGITVFDADLRLVAWNRNFL
FT                   KLLDFPESLAYIGAPFESFIRYNAERGEYGPGDIESQITERVAAARNFTPHLTERQRPN
FT                   GRVLLLRGEPLPHKGLVTLYSDITEQRYIEHLTEHQNMQLEERVLRRTAQLENANANLR
FT                   LANEDNVRIAAALGRSEARLRLINDTIPILIGYVDQHEVYQYANKGYADWYGHPEGGVT
FT                   GRGVLDVIGPQVYAQVRDFVHRALAGQQVTYEYEMERQGQSVFARSTLVPEISSDGETL
FT                   GFFVFSHEITEQKRMQAALVQAQKMEAIGQLTGGLAHDFNNLLTVIIGNLAALQDHRPD
FT                   DAGVNEFVEPALQSARRGVQLIKRLLTFSRQQPLEPQAVDIGRLIGSLAKLVRRSLPES
FT                   IAVSTDLAGASIHALVDPGQLESALLNFALNSRDAMPDGGRLHIAARAVELTTDATAFD
FT                   VSPGHYVLIEVADNGCGMDAATLSRACEPFFTTKRFGLGSGLGLAMAYGFAKQSGGGIS
FT                   IQSQPDQGTSVLMALPLAAREPDIDLPGEEAALPHGGELVLLVEDDPNVRRVVRQQLID
FT                   LGHPVIEAEDGSQALDMIDQIHDIAVVVSDVIMPGGLNGRQLAEQTLARRPEMRIVLMS
FT                   GYTDEAETDGTSALPILAKPFDRQDLARALQSAHRGTP"
FT   gene            251452..253089
FT                   /locus_tag="Daro_0226"
FT   CDS_pept        251452..253089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0226"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44985"
FT                   /db_xref="GOA:Q47JJ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44985.1"
FT                   /translation="MVNPYTVGLERNPANYVPLSPLSFLERSAFIYPKRISVIQGARQY
FT                   TWKESYDRARQLASALKSRGIGKGDTVAVMLPNTASMFECHFGIPMIGAVLNTLNTRLD
FT                   AEAIAFMLAHGEAKVLITDPEFSKVVKPALELLEGPKPLVIDSLDPDYTEGESLGEKDY
FT                   ESFLNEGEPDFAWQLPEDEWDAIALNYTSGTTGNPKGVVYHHRGAYLNSASNIISWGMP
FT                   PHSVYLWTLPMFHCNGWCFPWTLAANAGTSVCLRRVDPVLIFGLIKEHKVSHMCGAPIV
FT                   YGMMINAPETLREGIAHTVNGLIAGAAPPAAIIEGAQRMGFNITHVYGLTETYGPASVC
FT                   AKQPEWDRLPIDLQAARNGRQGVRYHMQEAIAVLDPVSMEPVPWDGETMGEIMFRGNLV
FT                   MKGYLKNEKASEEAFAGGWFHTGDLAVVHSDGYVKIKDRSKDVIISGGENISSLEVEDV
FT                   LYRHPAVIAAAVVAKPDEKWGEVPAAFIELKTDAKCTEAEIIEHCRAHLARFKVPKQVV
FT                   FGELPKTSTGKIQKYVLRQHANSALAIE"
FT   gene            253180..254958
FT                   /locus_tag="Daro_0227"
FT   CDS_pept        253180..254958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0227"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44986"
FT                   /db_xref="GOA:Q47JJ5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44986.1"
FT                   /translation="MSTYIAPIRDMQFVLNEVAGLEEICALPGNEECSVELVESILDEA
FT                   SKFATGVLDPINKVGDRTGHVCKDGVVTTAPGFKEAYKLFAETGWMSMPFDPEFGGQGL
FT                   PAVVSMAVNEMWKGANMAFGLCPMLTGGAIEAIAHHASDELKQKYLPKMVEGTWTGTMN
FT                   LTEPNAGSDLAAISSKAKAVGDGTYLVSGTKIFITWGEHDVAENIIHLVLARLPDAPPG
FT                   LKGISLFLVPKFLVNDDGSLGARNDLICASIEHKLGIHGSPTAVMSYGEKEGAIGYLVG
FT                   EENKGIGYMFTMMNHARVNVGLEGVGIAERAYQHALWYARERVQGGIIGDKSGEKKPIL
FT                   HHPDVRRLLMDCKARTEAMRTLAYYGAANIDKAHAGDAAAQARIDLLTPVIKGWSTEQG
FT                   VELSSTALQVFGGVGFVEETGAAQYYRDSRITTIYEGTTAIQANDLVGRKLAREKVPGA
FT                   AMKTLIAEMTATAEELAGNAQLANIAANLKAAIAAQQKAVDWILANYESAPQAVHAGSV
FT                   PFLKQTGIVVGGWLMAKSAAIAAKHLADGSTDDFYKAKLATAEYFATHQLPFAAAYAAE
FT                   VTGGAASTLGLAETLF"
FT   gene            254961..256604
FT                   /locus_tag="Daro_0228"
FT   CDS_pept        254961..256604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0228"
FT                   /product="FAD dependent oxidoreductase:Electron transfer
FT                   flavoprotein-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44987"
FT                   /db_xref="GOA:Q47JJ4"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44987.1"
FT                   /translation="MTMRTDRDAMEYDVVIIGGGPSGLSAAIRIKQLAEQAGKEVSVCL
FT                   LEKGSEIGAHILSGAVLEPHALNELFPDWKERGAPLNTPAGEDRFLFLTEGGSFKLPTP
FT                   PQMSNHGNYIISLGNLCRWLGEQAEALGVEIYPGFAAAEVLYHEDGSVKGVATGDLGIG
FT                   KDGQPGHNFQPGMELHAKQTIFAEGCRGSLTKELFGQFNLRDGVDPQTYGIGIKELWEI
FT                   DPAKHQPGLIVHTVGWPVDSATYGGSFLYHLENNLVAVGYVVGLDYKNPWLSPYEEFQR
FT                   YKTHPAIRGFFEGGRRISYGARALSEGGYQSVPKLHFPGGLLVGDTAGFLNVPKIKGTH
FT                   MAMESGIVAAKAVFEHLCKDNAGAEVVEYGEQIKQSWLWAELYKVRNIRPAFKWGLLGG
FT                   LAYGAIDTFLFGGKAPWTMRHHDDHSQLGDKNAYPKIDYPKPDGKISFDRLSSVFLSAT
FT                   NHEENQQTHLRLKDESVAISVNYAKYGAPETRYCPAGVYEILGEEEGKPRLQINGQNCL
FT                   HCKTCDIKDPTQNINWTVPEGGGGPNYPNM"
FT   gene            256660..257295
FT                   /locus_tag="Daro_0229"
FT   CDS_pept        256660..257295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0229"
FT                   /product="GPR1/FUN34/YaaH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44988"
FT                   /db_xref="GOA:Q47JJ3"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44988.1"
FT                   /translation="MTASTATVTETKIMMSDPTALGVFGLSMVTFVAASQKMGWTTGAT
FT                   YIIPWALLLGSLAQIWASTIDFKKNNYFGSIVLGAYGLFWSAVAMHWAISQGWLGAVDP
FT                   AKADPRQLAYACFGYFFFSLFIMVAAFEVNKMFALMLVLINVLLPSLGLSILGVNPPLF
FT                   SALAAWSELLISLAGFYTAGGLFLNSYFGRTLIPLGKPFGFIRKGPAK"
FT   gene            257531..258598
FT                   /locus_tag="Daro_0230"
FT   CDS_pept        257531..258598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0230"
FT                   /product="GGDEF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44989"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44989.1"
FT                   /translation="MSDTGANRLPGLLGKLGKMTSIRDTEVLEQSLLRTLGPLLGVLDT
FT                   SLYRTDEQQHMARVINYHRSKVIEADGVARMVERVEEVSRLNDLPPEVIALTDNVRLLG
FT                   KPCTRKLDQELLVAYPLFGGNDVCGYFVFQRDREVQATEDAMIRGVLEVFSNYYALLDI
FT                   SQRDRLTGLFNRQALESSFDRIWRALGRPDHFAERENGRRSSPGENYWLAVIDIDHFKS
FT                   INDRFGHMVGDEILLLASRLMITTFRGSDLLYRYGGEEFVAIIAAENAAIARNVFERVR
FT                   LAIEAHVFPRIDKLTVSIGYSQVSLDILPVEVLSRADRSLYQAKQDGRNRVYAYQELVE
FT                   SGVFEPQTYDEVEFF"
FT   gene            complement(258754..259836)
FT                   /locus_tag="Daro_0231"
FT   CDS_pept        complement(258754..259836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0231"
FT                   /product="ClpX, ATPase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44990"
FT                   /db_xref="GOA:Q47JJ1"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44990.1"
FT                   /translation="MTRSSFPKTPGTTSIQTYRPRSCPMPTLLKPSEIVRRLSDHVIGQ
FT                   DDAKKTLAVAIYAHFRRMANIAEDSVELTKSNILLIGPTGTGKTLLCETLARILDVPFV
FT                   TADATSLAQTQFVGDEIEAILHRLLDRANDDLALAQRGIVFVDEVDKLKAVGGESRATS
FT                   GESVQHALLKIMEGAPVRLKDGRHIDTTNILFICGGAFVGLDHILTKTHTFGFISTAEG
FT                   DDQKILERLNARVKPTDLLEFGLIPEFAGRLPIVTRLHDLSQDMLVRILTEPKNAIYKQ
FT                   FQAMLAADGVDLQVEPNVFRQMAELAIEYKAGARSLRGIFEEMMVDVMYAVPDNPAIGR
FT                   VIISSLFERPKLAAAEPKAS"
FT   gene            259943..262159
FT                   /locus_tag="Daro_0232"
FT   CDS_pept        259943..262159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0232"
FT                   /product="Response regulator receiver:ATP-binding region,
FT                   ATPase-like:Histidine kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44991"
FT                   /db_xref="GOA:Q47JJ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44991.1"
FT                   /translation="MGVFHSKAEMSRRVGWFGIVILIAMLAAVAVAVKAMRDQEIDDWR
FT                   QQMGNMSLILAEHTSQTILSAYVVLDSVTERVRQAKVTDQASFRARLATPEMFQMLRDQ
FT                   IRGLPQVDVASIVAANGDNINFSRAYPIPAINLAERDYFKAHLSNPGLGDFISQPVRNK
FT                   GNGKWTFYISRRLNDAKGEFLGLVLVGISVEVFTNFYQRVAHNLGEGASISLFRDDLTL
FT                   LTRWPHRDEVIGTVNRSGTAYDVIAVLKQDEGVVLRDTPRFSTGKRELRVAAVRKIDRY
FT                   PLVLAIVATDDLFLAGWRRSAWLIAGVSLVGAMSLLIVLLILVRNLRQREADMAEMEQL
FT                   KLAAEAANLAKSSFLATMSHEIRTPMNGILGMAQLLLMSGSAEDERHEYVRTILNSGQT
FT                   LLSLLNDILDISKVEAGKLELKPAVFAPQGVIEEVVGLFFAQAEAKGLSITAQWHGPAV
FT                   QRYRADQIRLRQILTNLLSNAVKFTKEGAIRIEAREIEREDGWARLEFAVIDSGIGIAP
FT                   EKRALLFKPFSQLDSSATRQYGGTGLGLSIVRSLAELMGGEAGVESQPGQGARFWVRIR
FT                   AECLHENEESRSIERPVVAPAPVEPAISGHVLVVEDNPTNRKVIEAMLRKLHIRSDSVD
FT                   NGRAAVDTLEQGMRPDLVLMDVQMPVMDGIQATMLIRQREAETGLPRLPIVALTAGAFD
FT                   EDRQHCLVAGMDDFMSKPVNLNDLEKMLGKWMGLRGAPATVRPS"
FT   sig_peptide     259943..260041
FT                   /locus_tag="Daro_0232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.805) with cleavage site probability 0.378 at
FT                   residue 33"
FT   gene            262276..263916
FT                   /locus_tag="Daro_0233"
FT   CDS_pept        262276..263916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0233"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44992"
FT                   /db_xref="GOA:Q47JI9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44992.1"
FT                   /translation="MLPKLSSFPGVQGPVVIIVMDGYGLPKTDVGSAIAAARKPTLDRL
FT                   FASYPNVRLRAHGTAVGMPSDDDMGNSEVGHNAIGAGQVYSQGASLVSNAIASGAIWQG
FT                   EAWQQIVAGAKAGRGVVHFMGLFSDGNVHSHIDHLKAMVVQAKAEGIKTVRIHALLDGR
FT                   DVPETSALDYVVPFEAFLAEISSDGFDARIASGGGRQYITMDRYDANWAMVDKGWQTHV
FT                   LGRGTQFANATAAVNGLREQNPGTIDQDLPEFVVAENGKAIGTIEDGDSVVFFNFRGDR
FT                   AIEITRAFEEAAFDKFDRVRFPKVTYAGMLQYDGDLKLPARFLVAPPAIKDTTGEWFAK
FT                   SGIAQFACSETQKFGHVTYFWNGNRSGKFDGETWQEVPSDVVPFEQRPWMKAAEIADAM
FT                   IAALQSGQYRTLRCNFANGDMVGHTGNFSAATLAVEAVDLSLARVLQAIDAAGGVALIT
FT                   ADHGNADEMFELDKKTKQPAMNKDGSFKAKTAHTLNPVPLILYDNVSGGKLGLKQTETA
FT                   GLSNIAATVANLLGLEKHAAWDESLLEIR"
FT   gene            263992..264882
FT                   /locus_tag="Daro_0234"
FT   CDS_pept        263992..264882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0234"
FT                   /product="Ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44993"
FT                   /db_xref="GOA:Q47JI8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44993.1"
FT                   /translation="MTDPFLALRGEPPAMQVLKHPLAFVLRILRGFSGNQGLLLAGAIA
FT                   YYALLSVVPLLILSVFVLSHLVSQVELLDVLGRYLEWLVPSQSQAVLADVSGFLQNGIG
FT                   IGALLLGTMLFFSSLAFSGLEKAMAIIFFHRGRQKKRHFLVSAVLPYCFVFVLGIALLA
FT                   VTFASASLQAMAHESIYFLGWEWPLRGVSGLLFYLLGLLMETAVLTSLYLIIPVGRTLL
FT                   SHALIGGFSAALLWEALRHVLVWYLTSLSRVSVVYGSLTTAVVALFCMELGATLLLLGA
FT                   QVIAEYELLDDNSSA"
FT   gene            complement(264883..265242)
FT                   /locus_tag="Daro_0235"
FT   CDS_pept        complement(264883..265242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44994"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44994.1"
FT                   /translation="MSHAKSREVTLPLKITEELGLSLDKLRQAWKENPASVPKGLSCSE
FT                   SKEGQFVLVAAESAFVTLPGACVIKGIGAIEMLGEEPLFEAGANSKSLLLKASPDGWKF
FT                   SVKFVPPIVRERNAK"
FT   gene            complement(265270..265692)
FT                   /locus_tag="Daro_0236"
FT   CDS_pept        complement(265270..265692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44995"
FT                   /db_xref="GOA:Q47JI6"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44995.1"
FT                   /translation="MDSKTLLGQEWQTLQNNHEQHERNALCIKLVCLALCLVGLALRAP
FT                   PVWIGITVLLCWAQEGIYKTYQARLAERLLRVESLLGQAEATQASMQLHTEWTASRPGC
FT                   TGLIGSYAISACRPTVAFPYLPIVLMLLVGRWLTWF"
FT   gene            complement(265903..267141)
FT                   /locus_tag="Daro_0237"
FT   CDS_pept        complement(265903..267141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0237"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44996"
FT                   /db_xref="GOA:Q47JI5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44996.1"
FT                   /translation="MRMTLPTLATLLVAGALNLAGSTPAQAHDHHGGLDNRGPLVVGHR
FT                   GTAGYLPDHTLEGYTLAIELGADFIEPDLVSTKDGYLIARHEPNIIATTDVASRPEFAA
FT                   RKRTRLVDGAAETGFFASDFTLAEIKTLRAKQPIPADRPTQFDGKFQIPTFDEVIELAK
FT                   RKSAETGRTIGIYPETKHPTYHQSIGLPLEGKLLAALTRAGWNNRHAPVFIQSFEQANL
FT                   KALSKLTKVRLIQLVDADDVNADGSLAYNAPFDRPYDWTASGKPELLARTFGWFATDAG
FT                   LDEVATYAYGISPWKRYIVSTVDAGASGPGEASRTLSTPTDLIERAHARGLKVHTWTFR
FT                   NEQRRLASDYTGNPVNEYLQFYRLGIDGVFSDFADTAVAARTLFKLEQDGYNKCFTGSG
FT                   LNRAELRACAAGE"
FT   sig_peptide     complement(267058..267141)
FT                   /locus_tag="Daro_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            267331..268089
FT                   /locus_tag="Daro_0238"
FT   CDS_pept        267331..268089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0238"
FT                   /product="Integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44997"
FT                   /db_xref="GOA:Q47JI4"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44997.1"
FT                   /translation="MLEFLLSPEIWIAFFTLTALELVLGIDNIIFISILVDKLPKEKQE
FT                   LARKIGLFLAMFMRIGLLLVLSWIVGLTEPVLTLFGYGISGRDLILIAGGLFLIWKSTG
FT                   EVHQLLEGEEGSESAKVASSFVGVIAQIMVIDLVFSLDSIITAVGMVSQVGVMIAAVVA
FT                   SVGLMMLFAKSIGDFVSNHPTIKMLALSFLVVVGVVLIADGFGHHVPKGYIYFAMAFSV
FT                   GVEMLNIRMRKKAVRPVDLREPYAREFGAD"
FT   gene            complement(268096..268647)
FT                   /locus_tag="Daro_0239"
FT   CDS_pept        complement(268096..268647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44998"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44998.1"
FT                   /translation="MKLKSVLFAASLLAANACWSVGLLEKEIYFSEADIQAQVEKSGTM
FT                   QKSYGNGMIVVAFIEPPKIQLGNPEGKAALSARIKVSLLGNPPIPVDVQGTSGLRYDDN
FT                   AKAFFLENPVANSVQSQALSRESEPMARQAITQLMTAYFRSKPVYVLREDGSLQEKAAR
FT                   WLLRSIRIEPGRVAAVLSPA"
FT   sig_peptide     complement(268585..268647)
FT                   /locus_tag="Daro_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.608 at
FT                   residue 21"
FT   gene            complement(268653..271670)
FT                   /locus_tag="Daro_0240"
FT   CDS_pept        complement(268653..271670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0240"
FT                   /product="Hpt sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ44999"
FT                   /db_xref="GOA:Q47JI2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ44999.1"
FT                   /translation="MGLRQKFLLPLFLISLLVGGLLHFVWIPASIRSAEETHLRLIERH
FT                   LDSVVEGLIPLLLSDQLANIYENLGALEKRNGEWHQVKLSNVKGQQLYPLKGANAGASG
FT                   PVPSPAERQLRRPIRYIDIDLGQLEVTIDLRPFIADNLAHHRDLAALLLAMLLGLSGVM
FT                   AALLELAVIRPTHRLAIAAHELAQGHFDTPLPHTSHDEIGNLVDSFASMRSELQVSRSE
FT                   LLLEIDERKKAANALQEHQEQLEQIVSERTRELVIAKDAAESASRTKSAFLANMSHEIR
FT                   TPMNAIVGLTHLLRRDTTTPKDAKHLDKINLAAQHLLSIINDILDFSKIEADKLIIDEA
FT                   DFEFEQIFQQLNTLITPQAMDKGLEVVDRIDPEIPAVVHGDAMRLGQILANFASNAVKF
FT                   TEHGSIVFRARLLEQIGNLLRIRFEITDTGIGLAPEQRDRLFLPFEQADTSTTRKFGGT
FT                   GLGLAISKRLTELMNGRIGVDSTPGQGSTFWCELPLQCAHSQHERPRRNRLPETINILL
FT                   IDDDPNALEAISHMLKAYDARITTADSGEAGLNCVHSALAEGRHFDLVLTDWAMPGMDG
FT                   IETSRRIREILPQAPRIVLVTAYGREWPMERLREAGIVYQINKPVIPSELESALLEALL
FT                   GEHTAESDHIKHHAETNLAPLSGHRVLLAEDNPINQEVALELLKDVGLRVDIAEDGRQA
FT                   VELAAANDYDLILMDIQMPNMDGIEATHAIRHLPQRTATPILAMTANAFNEDRDACLGA
FT                   GMNDHIAKPVDPQKLYEALLRWIRIPLPAQIAPVEPERTQNDEQFRRELAHVEGLDAEA
FT                   GLHVVSGKVPLYRRLLALYITVHGSDAGKIIEALDNAQLAEARNIAHSLKGASANIGAL
FT                   NVQKIAAAIELPLKQQQINAPAVARPLLPYLQTTLETLTAQLEALLHKPGNGAPPPNFV
FT                   ADFDPAPLIETLRQQLTTAEMTSQRYFVEHRSDFEQSLGRETTGKLALLIGSFEFEKAL
FT                   SLLPAVDSQASPSSPP"
FT   sig_peptide     complement(271566..271670)
FT                   /locus_tag="Daro_0240"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.905) with cleavage site probability 0.634 at
FT                   residue 35"
FT   gene            complement(271675..272505)
FT                   /locus_tag="Daro_0241"
FT   CDS_pept        complement(271675..272505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0241"
FT                   /product="periplasmic binding protein-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45000"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45000.1"
FT                   /translation="MRTPSHLLKIASLLIAVLIGSASHAAGAYSFAVVPQFDQRKLFAT
FT                   WKPIVDNISKRTGIQLNLVATLTVPEFERELSKGSFDFVYANPYHILREEDRQGYVPLI
FT                   RDKTPLRGILVVAKDSPLKSPADLDGQQMAIPSFNALGASLLLRADLAQIFKIKVTPVN
FT                   VKTHSSVYLYVANGLIPAGGGVEKTFQEQEPAVRDLLRVLYTTREMPSHPIAAHPRVPA
FT                   KVQAAIKQAFLELAATDEGRRLLQEIPMTDAVAASMKDYAPMRAWGLASYWVDP"
FT   sig_peptide     complement(272428..272505)
FT                   /locus_tag="Daro_0241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.895 at
FT                   residue 26"
FT   gene            complement(272596..273663)
FT                   /locus_tag="Daro_0242"
FT   CDS_pept        complement(272596..273663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0242"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45001"
FT                   /db_xref="GOA:Q47JI0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45001.1"
FT                   /translation="MVHRTIGNSSPRSQATVAMGFVTGMLAGIAHRQIDLSPLLAALEI
FT                   DIADTASRIPIDRYAELYNRLNRQLDDEAFALFAQPMRVGSFEFLCRGCLSAATLADAL
FT                   TRAARFLHVVLPDLAVSVRRSHGHAELVIAETRRLADNPEDPGRIFAFEWLLRLLHGLS
FT                   CWLAGRGIGLDSVIFPYRKPAHFGDYALIFTEDSRFAPTVPGGMGTLVASFNANLLDLP
FT                   IRRDEAALASFLDGAPGKITMLYRRDREMVIRVRDLLRAALPETLSLDDIADRLHLSPR
FT                   TVHRRLEEEGSSFRGIKDALRRDMALARLTKTRDSIAKVAADLGYADTSAFYRAFVEWT
FT                   GMAPVRYRRQWAAKG"
FT   gene            273719..277069
FT                   /locus_tag="Daro_0243"
FT   CDS_pept        273719..277069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0243"
FT                   /product="Methylmalonyl-CoA mutase,
FT                   N-terminal:Methylmalonyl-CoA mutase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45002"
FT                   /db_xref="GOA:Q47JH9"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45002.1"
FT                   /translation="MIVVYRHNGARDKAAYHRRLSIFSDEADVMTDLSVAKKLSPYKPK
FT                   NKVRFVTAASLFDGHDASINIMRRILQSTGSEVIHLGHNRSVQEIVNAALQEDVQGICI
FT                   TSYQGGHVEFFKYMIDLLKANGGANIKVFGGGGGVIVPSEIKELHDYGVTRIYAPEDGV
FT                   HMGLQGMINEVVQKSDFDVADEGVPTVEQVLAGLKAGDKRLLARVITLLENGEAPALKE
FT                   PLLKAAAETNIPVLGITGTGGAGKSSLTDELVRRFRLDQNDSVKIGLISIDPSRKRTGG
FT                   ALLGDRIRMNAIEHPNIFMRSLATRDTGSEISVALPEVIAACKLAGFDLVVVETSGIGQ
FT                   GNAAIVPFVDLSLYVMTPEFGAASQLEKIDMLDFADFVAINKFDRKGAEDALRDVRKQY
FT                   QRNREAFTTPTDDMPVFGTQAARFNDDGVTALYQALVPALTEKGLNLKPGQLPIVTVKQ
FT                   SSTQRAIVPAQRVRYLAEIADTVRGYHAHTEEQVKIARERQSLRIAKGVFAGCDKNVAD
FT                   FDEMQAFKDAEQDPKAKKLLDMWPATVEAYSGDEYVVKIRDKEIRTKLVSESLSGTKIK
FT                   KVILPKFGDDGETLRFLMRENVPGSFPYTAGVFAFKREGEDPTRMFAGEGDAFRTNRRF
FT                   KRVSEGMPAHRLSTAFDSVTLYGCDPDERPDIYGKIGNSGVSIATLDDLKVLYDGFDLL
FT                   APTTSVSMTINGPAPIILACFFNTAIDQQMVKFEKENSRQPTEDEAEKIREWVLKSVRG
FT                   TVQADILKEDQGQNTCIFSTEFALKMMGDIQEFFVHNQVQNFYSVSISGYHIAEAGANP
FT                   ISQLAFTLSNGFTYVESYLARGMHIDDFAPNLSFFFSNGMDPEYSVIGRVARRIWAIAM
FT                   KNKYGANERSQKLKYHIQTSGRSLHAQEMDFNDIRTTLQALIAIYDNCNSLHTNAYDEA
FT                   ITTPTEESVRRAMAIQLIINREWGVAKNENPNQGAFVIDELTDLVEEAVMKEFEAIASR
FT                   GGVLGAMETGYQRGKIQEESMYYEHKKHDGSYPIIGVNTFLNPKGMAQQEIELARSSDE
FT                   EKQSQIKRLRDFQARNADKSPAMLAKLKQTVIEDGNVFAVLVDAVKCCSLGQISSALYE
FT                   VGGQYRRSM"
FT   gene            277255..280455
FT                   /locus_tag="Daro_0244"
FT   CDS_pept        277255..280455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0244"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45003"
FT                   /db_xref="GOA:Q47JH8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45003.1"
FT                   /translation="MNLIKGRRRVRLTADEKTVPRIHLIGTLLTVLVLTLALGGFFSWQ
FT                   SLSEQRAAFARVELAATQQLEARLQAEMDGVTNFIEFTRSRTEDVLRRSLTEQVDTAYQ
FT                   IVESIYAQEARRRPPAEVKRLIIEALRPARFYEGRGYYFIDDMQGQFILLPTAPQLEGK
FT                   TILDNRDDTGHYIMRGLIEAARQPRDEGFSRYRWYRPDDATQMADKLAYVRHFAPYDWL
FT                   IGTGDYTYKWEALQQKEALARLRALHFGQSGRFGVLDGSGRNLLSPSDRALDGMLIHDM
FT                   AAPEKAALEKLLAAGERGGGFVRYQWLNPENGQLVNKTALVNVVKPWNWFVVATTFDDD
FT                   FQSLLGEELRKHEAGHDQRLLNLLIAIVAALGLGLLSSLLFSRWSKRLFADYHQQRLAQ
FT                   EAALRVQADELKVLSRAIEQSPVSIVITDTGGCIRYVNPKFEQVTGYTSQQVLGQNPRI
FT                   LSSGEKSPDEYRELWRTIKSGQTWQGEFHNRRQDGSLFWERASISPIIDEQGQILHFLA
FT                   VKEDISEHKQIEEALRVSEYKMATILDSVEAYIYIKGTDYCYQYANRRVCELFAREMNG
FT                   IVGHQDTEFFDPATCANLRRNDRRVIEQGERVVEEEVNRTVDGQITSAFLSIKIPLRDQ
FT                   DGQIYALCGISTDITVRKQAEAELEHYRQHLETLVQSRTVELARAKDAAEAANRAKSSF
FT                   LANMSHEIRTPMNAIMGLTHLLQKDVLDSRARERLGKIGESANHLLNVINDILDLSKIE
FT                   AGRLALEIREFSPEAVLRQTISMLDERAAAQGLRLTSHLASDVPALLCGDAVRIGQALL
FT                   NFVGNAIKFSERGEIALRARVDRRDGEQVMLRFEVQDQGIGMDAGQQARLFQSFSQADD
FT                   STTRKYGGTGLGLAINRHLARMMGGDVGVDSALGVGSTFWMTVCLAVATRQPEALAADA
FT                   AAVAPESQIARLYGGRRVLLVEDEPINQEVAAELLSLAGLVVEVAVNGAEAVERVRHGT
FT                   YALVLMDMQMPVMGGLEATRLIRQLPGKAVLPVLAMTANAFDEDRQACLDAGMNDHIGK
FT                   PVDPDLLYASLLRWLAHG"
FT   sig_peptide     277255..277401
FT                   /locus_tag="Daro_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.796) with cleavage site probability 0.725 at
FT                   residue 40"
FT   gene            complement(280552..287079)
FT                   /locus_tag="Daro_0245"
FT   CDS_pept        complement(280552..287079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0245"
FT                   /product="Outer membrane autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45004"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45004.1"
FT                   /translation="MSAHPCPISHKHLRGVANSLAARAATSSAAHRERATVQALIRQML
FT                   ISLAIAQLFLPLPGKLHAEPDPCSLQTPSSVLCNGNQSGGIATGRTLLIDGSTLQSPPV
FT                   TSIDVNTLNAAVAPGSGLPGIYLHNEAGNAVTINAGTSLAPISITANGDNTGGIVVNGF
FT                   GTPTQTNNFFGLPLPSGSGGTGGNVTVNSFATISTDGDQSPGISARSRAGGYSDAVVNT
FT                   YKQLLGTNQGATFGISTVQGDSAKIGQAVTGSNGGTFTLKNNLLGLAPAYTYNLSGMAL
FT                   NNLAPGQHIDTSVSYTVTSIIGYAPSNAVLTLRVTRLADGSLSVLPATYFDVYGRAYEA
FT                   PQAIAYVDGATPLSGQISLAPNFDAYMTRLLEDSAIGGAGGNVSVTTSGSITTKNALSF
FT                   GQASYGILAQSKGGTGLPGGGGVFSGDTGNAGSSGGSVMVNNTATIHTFGEGAHGIVAS
FT                   SAGGNGGRGGGASFAGNGGAGGTGAKGGEVTVINYGNITTESTNAFGILAQTLGGQGGQ
FT                   GGGGGWLGGGGGAGGAGTVNDPVIVGNAGTITTFGDDSHGILVQSIGGFGGGGGGAGGI
FT                   VALGSTGGNAGTGGIATILNLGKVSTAGWNANALMAQSIGGGGGSAGGTGGLVALGGDG
FT                   TAGGNGGMASVYNYGELNATGVGARGIVAQSIGGGGGHGGDSGGLVAIGGDGATTSDGG
FT                   AVIVGNTGKITSASNAILAESIGGGGGTGGSSGGWFGVGGSGGGGGNGGTVTVANSGDL
FT                   TTSGRNAAALFAQSVGGGGGNGGNVVAVGAFASVAIGGAGGNGGDSDKVVAKSTGGSIE
FT                   TWGVQSHGIYAQSVGGRGGNGGFAAAASAGKGLSLSLSVGRSGGGGGDGGEVQVESQST
FT                   ITTHEQDAYGIYAQSVGGGGGNGGFSVAASAAVQGVAVSFSVGGKGGVAGDGKKVEVGK
FT                   DAPITGKITTNGANAYGIVAQSVGGGGGHGGLAVAATLSAGTNGSGSLGLALGGEGGSG
FT                   GAGGAVVVNSAATISTQGEKAYGIKAQSVGGGGGDGGLAVAGGVGGGLGSDSLKLNVAV
FT                   GGSGGAGSMASTVDVDISGGSIETWGKNAHGVFAQSVGGGGGDGGIAIAGTLGLGGKNT
FT                   NVSISAGGVGGTGSIGDTVTVSNAATIKTHGEAAFGIFAQSLGGGGGIGGAAFSGAGDL
FT                   NIGQEGYNVNIDFAFGGKGGSGNKGGMVDITNTGTIETFGTASHGIFAESVGGGGGQGG
FT                   SARTMSINAAVMPVSTLGKYASFSLNLGGKGGSGSDGNTVDIDNQGTIITHGADSHGIY
FT                   AQSVGGGGGTGGEGAHGFFGIPALMFDKTPMYQQVSISMGGSGGAAGSGGAVNVIQHGN
FT                   ITAHEQGSDGIFAQSIGGGGGTGGVGAIGFTGTVGIGGSGGASGNGGKVDVIVDGNINT
FT                   YGGAGYGVFAQSIGGGGGIGGNIDRGLATSWNVGLGIGVIRNSQNGGNGGEVTVSGSGL
FT                   IHTRELGATGIFAQSVGGGGGVAGYQNQSWWGFAGSAGGNGSGDRVTVDWRGSIWTDGE
FT                   NAHGIYAQSAGGEAVDVVVYDENGNPTAKTLQGYQNLGKDVSVTVRGNVITSGVRSNAI
FT                   YAESSGAEGKGNITVKILEQGTVKGGSGADAAGVHLVGGTQNLIENTGYIGTVSGISGL
FT                   AIAGDTGNDVVSSSGTVTGSVSLGTGTNAFTNALGGLFNSGPLVDLGAGNQLINSGTLA
FT                   PGGLGSAATTTLTGNLRQNSSGSLAVDLSLAGRASDLLNIVGAAQVDGKLSVRPVDTGF
FT                   ARPGTLRSVVLTASDGVSAADLTLAAPHSLLTSYVLLYPSANEIAVTRSIDFAPRSLNP
FT                   NAQRIGAHLNAIQATGGTASLAPYIAALFAQPDDQSLATAYEKLGPGALGTLTKSSTAS
FT                   SLEFNDAMHSCRQRDGDYRFIREGECSWIRFGGSIRDQERDDQNPGYRQDMVTMAGGFQ
FT                   KAVRENLHLGLGVSYQQSALNSVFSDVNGERFEGGMIVKQRFDATRLSLSFSAGYGHYN
FT                   TRRLVDIAAPGTYAQARPTLWSGALHGRISHDIMASENAYIRPMLGLGVSYVSRDAYDE
FT                   TGAGGANLRVEKASDTFVSLHPAIEFGGENSIGGEGTLLRHFVRVGMTQFIGSSEHHVT
FT                   ASLEGAPSGVQPFTVTTTSDKTYADLVIGVDILRKSGTTVRLEYSGQFSNNSSTNAIGV
FT                   KVAMPF"
FT   gene            287393..288721
FT                   /locus_tag="Daro_0246"
FT   CDS_pept        287393..288721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0246"
FT                   /product="Peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45005"
FT                   /db_xref="GOA:Q47JH6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45005.1"
FT                   /translation="MSQHQSLADNLLHNSITRRQMLWLIGASALSGCASSPIGGGAILV
FT                   GMSEDEEKAVDQKVAPQQFSQDLGAVQDAPINQYLTEVGQRLHSKSHRPQMPYSYRVLN
FT                   ANYVNAYTFPGGAMGVTRGILVDLDNEAELAALLGHELGHVNARHAAQRQGTAMVTQVA
FT                   MTGVNIIGAVAGVGSLTDIGTQLGASVLLASYSRDNEREADSLGQEYMVRAGYPASGMV
FT                   GLQQLLVDQQKESPGMLKTMFSTHPMSSERRDTARQLAESKYAASNTRDAGRDRFLDNT
FT                   ASLRRIKPTIDACQKGEVAMAGKAYGKAEEQFRTALKATPRDYAANVLMAKCLSVQDKD
FT                   AQAMEYAQTATKIYPQEAQAQKMVGILALGQKDPAKAYEHLDRYDRLMPGDAGVTFLKG
FT                   VSLEGLGRQQEAANQYAAYLKRTQKGKAAEYSYSRLQSWGYVK"
FT   gene            complement(288781..289611)
FT                   /locus_tag="Daro_0247"
FT   CDS_pept        complement(288781..289611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0247"
FT                   /product="Protein of unknown function DUF1555"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45006"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45006.1"
FT                   /translation="MNINPFAKHLAQLTCALGLAFGIQSAHAAPDWQINPEGLGAGGAT
FT                   TVSAANVGGVGFVQVVPSPTNPGAFTFIEHGAYQLLQTGSTNPFGTSDITVTYEVSGSG
FT                   NWFNPAALHFSSGSIKLFSDINFDFGSANGTYGADNGKAIGSFSVFDGGLLNGGLVNVQ
FT                   AQLDAGSLLPGYLFDADGNDMTKAGKVLLQLGIYNQTTNPDALLVSEIICGMAGYGGAG
FT                   CDGTAFINSPQAYAVSDGGSVTLSAVPEPASIALLGIALGAIPVSTRRRSKKAA"
FT   sig_peptide     complement(289525..289611)
FT                   /locus_tag="Daro_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(289817..290491)
FT                   /locus_tag="Daro_0248"
FT   CDS_pept        complement(289817..290491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0248"
FT                   /product="Cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45007"
FT                   /db_xref="GOA:Q47JH4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45007.1"
FT                   /translation="MKNAEELLRTSLWGQSLTAEEMDRALAGTIERSFAPGAFICMKGE
FT                   PVDYWMGIIDGLGKMASHWTTGKTTSLTGISVGGWFGEGSLMKKEPRRYDVMALRETRV
FT                   AFMSRNTFNWLLDHSIPFNRYMIAQLNERLGQFIGMIENERMLDTDARIARGLAALFNP
FT                   VLYPGTNRLLQISQEELGYLAGVSRQRANQALKVLEDAGLVRSEYGGIHIVDLEGLRSF
FT                   GD"
FT   gene            290673..292640
FT                   /locus_tag="Daro_0249"
FT   CDS_pept        290673..292640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0249"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45008"
FT                   /db_xref="GOA:Q47JH3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45008.1"
FT                   /translation="MPTQANFAAVDGLHTFPRLLFHHAQTRPNAPAMREKYLGIWQTWT
FT                   WLDVAERVRALACGLASLGFKRGDNLAIIGDNRPHLYMMMTAAQCLGGVPVPLYQDAVA
FT                   NEMLFVLQDAGIRFVVVEDQEQVDKMLEIQDQVPTLEHIVYDDPRGMRHYSQPFLHDIH
FT                   ELMEMGRIHDRNHSDFLNAEVEQGHFDDTSVMLYTSGTTGKPKGVCQTHAAFIAAAQGG
FT                   VQVDKLGPDGDILSYLPMAWVGDHLFSYAQALVAGFTINCPESGETVMSDLREIGPTCY
FT                   FAPPRVFESLLTSVMIRMEDAGKLKQKMFHHFMAVAKRCGSDILDGKSVGLGDRLQYWL
FT                   GNLLVYGPLRNVLGMSRIRVAYTAGAAIGPELFRFYRSMGINLKQFYGQTETCAYVCLQ
FT                   PDGAIKFDSVGQPAPGVEIKIADNGEVLVKGPMLLKEYYKRPDATAETINADGWFMTGD
FT                   AGFLDEDGHLKIIDRAKDVGKLSNGAMFAPNYIENKLKFFQHIKEVVCFGHERDMVCAF
FT                   VNIDVGAVGNWAERRGIAYSGYADLAGKPEVLELIRECVEQINADLVNDTMVADSQIHR
FT                   FLVLHKELDPDDDELTRTRKVRRNFVAEKYKVLIDALYSGKSNQFIETEVKFEDGRRGK
FT                   VSADLRIIDAKTFPIVKKAA"
FT   gene            292643..293425
FT                   /locus_tag="Daro_0250"
FT   CDS_pept        292643..293425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0250"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45009"
FT                   /db_xref="GOA:Q47JH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45009.1"
FT                   /translation="MSKKIGDVILDLQNISLRFGGVKALTDISFNVRQHEIRAIIGPNG
FT                   AGKSSMLNVINGVYHPQEGKIFWHGNERKRMEPHMAAQQNIARTFQNIALFKGMSVLDN
FT                   IMTGRITKMKANFIEHALWFGRAKNEELEHRKKVEEVIDFLEIQHIRKTPVGRLPYGLQ
FT                   KRVELGRALAAEPSMLLLDEPMAGMNVEEKQDMCRFILDVNDQFGTTIVLIEHDMGVVM
FT                   DISDRVVVLDYGKKIGDGVPDEVKNNEDVIKAYLGAGH"
FT   gene            293438..294352
FT                   /locus_tag="Daro_0251"
FT   CDS_pept        293438..294352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0251"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45010"
FT                   /db_xref="GOA:Q47JH1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45010.1"
FT                   /translation="MNFFLEVLIGGLLSGVMYALVALGFVMIYKASGVFNFAQGAMVYL
FT                   AALSVVGCMEKGAPLWLAIILAFAIMTVFGIATEKFVLRKLVNQPPIALFMATIGLAFF
FT                   IEGVAPMIFGSEPRALELGIVDEPIPWILDNWNMVISKFDLVAAGVAAVLVATLALFFQ
FT                   YTRIGRALRAVADDHQAALSIGIPLQHIWAIVWGVAGFVALVAGMMWGARNGVQFALTF
FT                   TALKALPVLILGGFTSVPGAIVGGLIIGASEKLAEIYIPPVMQDLFGGNFGGIEGWFPY
FT                   VLALLFLLVRPEGLFGEKHIDRV"
FT   gene            294369..295445
FT                   /locus_tag="Daro_0252"
FT   CDS_pept        294369..295445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0252"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45011"
FT                   /db_xref="GOA:Q47JH0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45011.1"
FT                   /translation="MLYREAGQFKTTYAADQQLFPIRQDRIGVITLLVVAFLGVPFFAS
FT                   EYWFSAILIPFLIFALAALGLNILTGYAGQLSLGSAAFMAVGAYAAYNFQLRIEGIPIL
FT                   VSFALAGLTAAGVGILFGLPSLRIKGFYLAVATLAAQFFIVWCLTKFPWLSNNSSSGVI
FT                   STQQLIFFGHELKTPVEKYLLVLSIVVVMALAAKNMVRSTTGRAWMAVRDMDVAASVIG
FT                   IKLMPTKLLAFAVSSFYCGVAGAMYAFCYLGSVEPDGFSLEMSFKILFMIIIGGVGSIM
FT                   GSFLGAAFILLLPIFLDIALPFFADLFGLPFSSATVSHIQITVFGALIMFFLIVEPHGL
FT                   ARLWQIAKEKLRLWPFPH"
FT   gene            295487..296809
FT                   /locus_tag="Daro_0253"
FT   CDS_pept        295487..296809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0253"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45012"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45012.1"
FT                   /translation="MIKSFKPALSAVALSLAMLSQGAAAAEEQFFPLIDYRVGPYGSNG
FT                   QAFYGGFIDYLNYVNIKEKGVNGVQMTWEECETEYNNAKGVECYERLKSKAAKSAGPIH
FT                   TMSTGISYALVDKSAQDKLPLAMMGYGRTDAVDGSVFPYAFPLVTTYQMQASAIVKFIK
FT                   DKNGGNLAGKKIVYLYHDSAYGKEAIIAMEAEASLNKFTLVQIPVAHPGNEQGAQWLKI
FT                   RQEKPDYVVFWGWGVMNQTALKAAQKVGFPRDKMIGSWWTGSEEDVIPAGDAAKGYMAA
FT                   TWNVAGKQVPVIADIEKVVYGAGKGNLQDVAKIGTVLYNRGVSAAVLSVEAIRKGQEKY
FT                   GKGKALNGEQTRWALENLNINDARLKALGATDLLPEIKTSCDNHEGSGKVKIQQWDGAK
FT                   WVPVSGWIEGNKSLIHPLFQASAKQYAKEKGITPRDCSKEK"
FT   sig_peptide     295487..295564
FT                   /locus_tag="Daro_0253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.924 at
FT                   residue 26"
FT   gene            296835..297710
FT                   /locus_tag="Daro_0254"
FT   CDS_pept        296835..297710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0254"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45013"
FT                   /db_xref="GOA:Q47JG8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45013.1"
FT                   /translation="MSPRSFSPSHESETMMNTQTAAAVPDNYLSINNIEVIYDHVILVL
FT                   KGVSLNVPKGKIVALLGANGAGKSTTLKAISNLLHAERGDVTKGSVEYKGNRIDQLTPN
FT                   ELVKRGVIQVMEGRHCFGHLTIEENLLTGAYTRSISRGELKDSLEKVYHYFPRLKTRRT
FT                   SQAGYTSGGEQQMCAIGRALMAKPEMILLDEPSMGLAPQIVEEIFEIVKDLNTRENVSF
FT                   LLAEQNTMVALRYADFGYILENGRVVMEGDAEDLRTNEDVKEFYLGLSSAGRKSFKDVK
FT                   HYRRRKRWLS"
FT   gene            297883..299112
FT                   /locus_tag="Daro_0255"
FT   CDS_pept        297883..299112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0255"
FT                   /product="putative phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45014"
FT                   /db_xref="GOA:Q47JG7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45014.1"
FT                   /translation="MSYYDPLETRDPDEREADLMDKLARQVAHAKETTSYYFQTLAGIN
FT                   PFDCITREALAKLPLTRKRDLIELQKKHPPFGGLNALARHKAKRVFASPGPIYELQGMD
FT                   MDHWRMARVLYAAGFRHGDLVHNCFSYHFTPGAFLMEGGARKLGCAVFPGGVGQTEQQV
FT                   QAMVDLKPDGYVGTPSFLRIIVEKAEELGADISSLKKALVSGEALPGITRNWLNERGIK
FT                   VRQCYATADIGAIAYETEAEEGLVVEEELLVEIVRPGTGDPVEPGEVGEVVVTTFSPDY
FT                   PLIRFATGDLSAILPGRSPCGRSNIRLRGWLGRADQTTKVKGMFVHPEQVAEIAERHPE
FT                   IYRMRLVVDNPGGQDRMVLYCEIEAGNEVLDKAVVSSLREVTKLRGEVAFSAPGGLPND
FT                   GKVIEDSRVY"
FT   gene            299127..299627
FT                   /locus_tag="Daro_0256"
FT   CDS_pept        299127..299627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45015"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45015.1"
FT                   /translation="MRIFVLALAWLALSAQAAEPVLRPSARLLFKQPEMLRAGQCVRYE
FT                   EGGAGFIVTDPIFYLKGEVITAEVQSRHLAKCPVVAGKNIEQYSRDEFNRHAIAYPCVA
FT                   QDVAERDEQIGVVRVRVSDWETPHAKKAENAGRLYRGMFLDRKLEKGMEIELEADLLGV
FT                   CEQ"
FT   sig_peptide     299127..299180
FT                   /locus_tag="Daro_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 18"
FT   gene            complement(299646..300824)
FT                   /locus_tag="Daro_0257"
FT   CDS_pept        complement(299646..300824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0257"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45016"
FT                   /db_xref="GOA:Q47JG5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45016.1"
FT                   /translation="MQNAPETKARGPLAGIKVIEFAGIGPGPFCGMLLADMGAEVTLLE
FT                   RAGGTFASQLFGGGRKAVANRGKKSLCIDLKHPEAKNLVFKLIAEADVLIEGFRPGVME
FT                   RLGYGPKVCLSLNPRLIYGRMTGWGQTGPLAPRAGHDANYAAIAGVLDTGRRHGGAPWA
FT                   PPTLVGDMGGGGLMLAWGIACALLEAQRSGKGQVIDAAMCEGAAVLAHGLFNLEALGEW
FT                   EGHCAIDSSAPFYDVYECADGLWISVCPLEPQFYATFVERLGLSGDPDFTGQQYDKTRW
FT                   PLMQQRLVEIFKREPRKHWEALFDDTDDCVWPVLSMKEAPAHPHNLDREAFVDVAGVRQ
FT                   PAPAPRLSRTPGAIQAPPPLLGEHSREVLTSLGLSDVEVEQLAANGVVSEKR"
FT   gene            301018..301596
FT                   /locus_tag="Daro_0258"
FT   CDS_pept        301018..301596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45017"
FT                   /db_xref="GOA:Q47JG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45017.1"
FT                   /translation="MNKNIDELLERIHGLQDELEEEYRKTREEWAQKKQELADELLRQQ
FT                   RRYKTGLFRFMLRSRFLVVLTAPIIYLGWLPFLLMDLFVSIYQAICFPIYRIPKVRRSD
FT                   YLVFDRQDLPYLNIIEKFNCFYCSYGNGVAAYTREVAARTEQYWCPIKHARRIKASHDR
FT                   YPNFFDYGDAAAFQQGLNRLRKQYGDGGK"
FT   gene            complement(301616..302599)
FT                   /locus_tag="Daro_0259"
FT   CDS_pept        complement(301616..302599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0259"
FT                   /product="Forkhead-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45018"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45018.1"
FT                   /translation="MPAPIQPEKKAMQEKTTRRSPQDKPAPQAINHAYLVHGAVHEISG
FT                   QSATLDEALLGKLFRRRLKRLERVLAAHGGSIIRQMPQSLLASFETAEAALFGSCEMQR
FT                   RCAVIPQIADTQIALKIGIHLATAGRVSTSPVDPAEATASKLSSLLDEASIVISESVAQ
FT                   ALPANLRDKTVAVANEGSEIPAYSIDWNALPMLRATPQRKESIPESSPTPDTQRSGIII
FT                   RQGERTLRFSTDHPMLTIGRDPASDIAINCPKASRQHCRIIYRQGNYVLVDLSTNGTYV
FT                   TAHNAPETLIRKEMVTLNGNGRISFGQSWQQGSDHAFEFEVSLIEP"
FT   gene            complement(302832..303692)
FT                   /locus_tag="Daro_0260"
FT   CDS_pept        complement(302832..303692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0260"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45019"
FT                   /db_xref="GOA:Q47JG2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45019.1"
FT                   /translation="MDMNAGFVVTLAILVFVVVTIAKGVRIVPQGEEWIVERLGKYHGT
FT                   LKPGLNIVIPYLDKVSYQLVTKDIILDVQEQEVITRDNAVILTNAIAFIKVTDPVKAVY
FT                   GVTDFSEAIRNLIMTTLRSIVGEMELDEALSSRDKIKARLRESIADEAVDWGLTVKSVE
FT                   IQDIKPSQSMQKAMEMQAAAERERKAVVTRSEGAKQSAILEAEARLESAKRDANAQVML
FT                   AEASAEAIRRITAAIGDQTGPMSYMLGEKYIAALERMGEKDNAKLVVLPADLQEAVRGL
FT                   FGRKG"
FT   gene            complement(303705..304145)
FT                   /locus_tag="Daro_0261"
FT   CDS_pept        complement(303705..304145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0261"
FT                   /product="Protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45020"
FT                   /db_xref="GOA:Q47JG1"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45020.1"
FT                   /translation="MHPEWWHWVVGGIVLVLAELIIPSFFIVWFGLGALLVGLLALAFD
FT                   LSLTAQLATWTIASLAMVVLWFRVFKQSFVKTRSGTADGEAIGEIGLLVSAVAPFERGK
FT                   VRFQRPILGSEEWVCLSDTAIAAGERVKVTAVEGSFVKVSKA"
FT   gene            304252..305151
FT                   /locus_tag="Daro_0262"
FT   CDS_pept        304252..305151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0262"
FT                   /product="Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45021"
FT                   /db_xref="GOA:Q47JG0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45021.1"
FT                   /translation="MNTALLLLPDFSLILLGAAIRRWMHLGDHFWNGVEKLVYFILFPA
FT                   LLINAIIKTRLDLGAALPLLATALAAMAGGMLLGIVPKLFSRLPALTYASMFQCAYRFN
FT                   SYIALAVAGMLFGSPGIATMGLIVGAAVPFANLVSVWMLARHGDAGLWREVARNPLIWG
FT                   TATGFLLNLAGFVPPAPLQAFLGRLADASIALGLITVGAALRLESTPGVRGFSLWLVLV
FT                   KLLALPLVALGVGSLLGLSGLNYQVVVLFAALPTASSAYILAMRMGGDGRSVAWLISAT
FT                   TLGSMLTLPLWAAWLARL"
FT   gene            complement(305152..305616)
FT                   /locus_tag="Daro_0263"
FT   CDS_pept        complement(305152..305616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45022"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45022.1"
FT                   /translation="MAEEQVHDPLNFMRNMWGNMGFSLPGMVAPTFDLDELDKRIKDMK
FT                   AVEGWLRMNLSMLQMTIQGLEMQRTTVGAVQAMGKMASESVKAMSPEAAEAAPAEAQPN
FT                   AFSDAAMWPWQMMQQMRDQMQQSAEAVAQAAAEEAEETKPKARRPAATKK"
FT   gene            305705..306370
FT                   /locus_tag="Daro_0264"
FT   CDS_pept        305705..306370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0264"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45023"
FT                   /db_xref="GOA:Q47JF8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45023.1"
FT                   /translation="MLKLLVVEDHALVREGLVRLLGQIEAGAKVLESADFESALNVLEN
FT                   EGEFDLVLLDLALPGIDGFAGLDILRRRYPAMPVAVVSAFDDTPTITRVLNLGASGFIP
FT                   KAFSGEALLSAVREVLAGNIFRPNGQSAARLDDATPVPPPPKNGVRPDEIGLTDRQGQV
FT                   LALMVRGLSNRDIADQLGLSEGTVKIHATAVFKALGVSSRTQALVAVARYGIDFESVF"
FT   gene            complement(306340..308433)
FT                   /locus_tag="Daro_0265"
FT   CDS_pept        complement(306340..308433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0265"
FT                   /product="ATP-binding region, ATPase-like:Histidine kinase
FT                   A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45024"
FT                   /db_xref="GOA:Q47JF7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45024.1"
FT                   /translation="MPSRKPETLALSIALVGTLVVLLVFLADLALARHRDLESGERRLQ
FT                   HFGLMMAEHTARTFEAVDVLLRETATDLSHSRRDWETWDTSKGWEYIAQRHSRAMPQLR
FT                   DLIIFDRYGNQRFISTFFPAPHINVKDRPYFIALEDGAESSTFGPYIGRNSGRYTYAIA
FT                   RRLTGDNGHFAGVVFAAMEPAYLQDFCWSNRLSDDFETVLINQKSEIIASCRPSDLSRQ
FT                   SPILGAQAAAVLYGGQLKGFIPENGLTSGNGYLIAVSQVPGFTDLRVLSVIPEKTLLAA
FT                   WHNRLFELGTLALLVSIVLLVTGLLVRRQVRDMAAMTEELAASHDLLEERVREATQELA
FT                   GQKNAAERANTAKSRFLAAASHDLRQPLHALSLFATDLQRQIRSGTPQELPRLAEQISA
FT                   STTILGELLDSLLDISRLDVAGIKPDSRPTPLQPIFERLANSFRRAATDRNMSLRFHPT
FT                   TRWVETDPIMLERMIANLVSNALRYTPPGGSVLVAARNRGDRVLIEIRDNGIGIAPQHQ
FT                   AAIFAEFYQVGNTAREQNKGLGLGLSIVDRLAKALGIEVKLNSRQGEGTKFTLSVASSQ
FT                   PVVAGPAASDKPPQAGKVHCIGTSEEMLSCIELMKRWDYAVSSDDGSRTERRPEDAVLI
FT                   AEPELAAAASAELVTGMPLVVLVRDPGASLPAGAHALPVPVRPAKLRALLNQLQKTLSK
FT                   SMP"
FT   sig_peptide     complement(308353..308433)
FT                   /locus_tag="Daro_0265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.806) with cleavage site probability 0.729 at
FT                   residue 27"
FT   gene            complement(308439..309188)
FT                   /locus_tag="Daro_0266"
FT   CDS_pept        complement(308439..309188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45025"
FT                   /db_xref="GOA:Q47JF6"
FT                   /db_xref="InterPro:IPR026170"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45025.1"
FT                   /translation="MTSPPLRQFALQGAAAILVLSLAWPYYGLNDEVMPWLQTSLAIGG
FT                   VALIFATLSRQPWWWRVIHAGFMPLVWFTHTLAIDPGWFLLAAILLLLVFRGALSGQVP
FT                   LYLSNKQTVAALAELLAARGPTRFLDLGAGLGSTTVPLADALPDSHFTGYENAPLTWLV
FT                   GRFFSLGRPNIRWRWDDLWMAKLGDYDVVYAFLSPAPMPRLWEKVKAEMQPGSLFISNS
FT                   FPVPGMTPERVIEVDCTPPRPLYCYQL"
FT   gene            complement(309198..312650)
FT                   /locus_tag="Daro_0267"
FT   CDS_pept        complement(309198..312650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0267"
FT                   /product="Pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45026"
FT                   /db_xref="GOA:Q47JF5"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45026.1"
FT                   /translation="MSNLALPAGLAATLDDKYTRSSGRVFLTGTQALIRLPMLQRERDL
FT                   AAGLNTAGFISGYRGSPLGNLDLGLWKAKAHLAEHHITFQPGINEDLAATAVWGSQQVN
FT                   LFPGAQYDGVFGLWYGKGPGVDRCGDVFRHANAAGSSKFGGVLVIAGDDHAAKSSTLPH
FT                   QTEHVFKALMMPVLYPANVQEYLDFGLHGWAMSRYSGCWVAFKALADTVETSASVTIDP
FT                   AALTPIIPPDFKLPPDGLNIRWPDPPLVQEARLLNHKLYAALAYCRTNGLNKLIIDSPT
FT                   PKLGILTAGKSYLDVRQALDELGIDDQLAAEIGIRLYKVGMVWPLEPEGVRQFAEGLEE
FT                   ILVVEEKRQLLEYQLKEELYNWRDDVRPRVIGKFDEIGEWSEGNWLLPAAGELPVATIA
FT                   RVIAERIGRFFTSPTIAARLKVIADKQKAAQTPIVLAERKPHFCSGCPHNSSTKVPEGS
FT                   RAVAGIGCHYMVTWMDRSTSTFTHMGGEGVPWVGQAPFTSEKHIFANLGDGTYFHSGLL
FT                   AIRQSIAAKVPITYKILYNDAVAMTGGQPVDGILSVARITRQLEAEGIAKMVIVAAEPE
FT                   KYAEIVDLAPNVPIRHRDELDAVQRELRDYPGVSILIYDQVCATEARRRRKRGKMPAIS
FT                   QRVFINEAVCEGCGDCSVQSNCLSVVPVETAFGTKRQIDQSSCNQDFSCLKGFCPSFVT
FT                   VEGGKLKKGKAAQPDSVDAEDWPLLPAPVLPSTAQPYNLLITGVGGMGVITLGALVGMA
FT                   AHLDGKGISTLDMTGLAQKYGAVFSHLRIADRPEDIHAARIATGEAHAVLGGDLVVSAG
FT                   SEALSKMLEGRTRAVVSCTDTPTADFTRNRDWHFPLPGLQKSLTETLGSAAVDFIDAQH
FT                   LATRLMGDALYANMLLLGYAWQKGLVPVSAAALEQAIELNGAAVTANREAFLWGRRAAV
FT                   APEKVAKIAGPLGGQPFVELTLDELIASRIAHLTAYQDASLAHRYENRLASIRAIGNET
FT                   LTRTVATQYARLLAPKDEYEVARLYAASDFRQRLADTFDGDVQLAFHLAPPLFSKPGSD
FT                   GRPKKIRFGPWLMPVLGLLAKARRLRGSWLDPFRFGHEKAAERSLLADYEADLDLISSH
FT                   HSADSTLALATWPAEVRGFGPVRAAAERQARQARERARTALMA"
FT   gene            complement(312773..314161)
FT                   /locus_tag="Daro_0268"
FT   CDS_pept        complement(312773..314161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0268"
FT                   /product="FAD linked oxidase, C-terminal:FAD linked
FT                   oxidase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45027"
FT                   /db_xref="GOA:Q47JF4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45027.1"
FT                   /translation="MTRKALPEALQQALQQQFQQRFSQGESTRLQHGRDESVHAPELPD
FT                   GVVLAESTDEVAQVVRLCAEHGVPVIPYGVGSSVEGHVLATSGGISLDLSGMNQVIAIH
FT                   AEDGDATVQAGVTRKQLNDALKGSGLFFPIDPGADATIGGMAATRASGTNAVRYGTMRE
FT                   NVLATTTVLADGRVMKTGGRARKSSAGYDLTRLLVGSEGTLGIMTELTVKLYPIPEAIS
FT                   AAVCTFPSIEAAVQTVIQTIQLGVPVARIELLDALSLKAINLFSKTTLAEAPTLFFEFH
FT                   GSPSSATEQAETVQAIADELGGTNFEWAARPEDRSRLWQARHDAYFACLQLKPGCRCFP
FT                   TDVCVPISRLAECIAETQADIAQVSIPIALFGHVGDGNFHLVVLVDTDNAKEMKEAAWI
FT                   SQRVVERAIAMEGTCTGEHGIGLGKRKYLPLEHGDVAVDVMRTIKQALDPNNLLNPGKI
FT                   LPPG"
FT   gene            complement(314158..315465)
FT                   /locus_tag="Daro_0269"
FT   CDS_pept        complement(314158..315465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45028"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45028.1"
FT                   /translation="MPVIAKLRFLVNQTARKLFSMLPQKSRHNVYRSLVDCNPDPNKRL
FT                   VLKIAESKEELEACFKLLHDAYVSSGFMTPDPSGMRVTIYHALPTTTTLCAKYDDQVVG
FT                   TLSLIRESAIGFPLQRIFDLTGVREKEGQIAEVSALAVHPRFRRTGGTILFPLMKFMYE
FT                   YCTTFFDTRHLVIAVNPRHIEMYESLLFFKRLTANVVENYDFVNGAPAVGATLDLKHAP
FT                   EILRKAYAGKAPNRNLYHYFLETKLANIQIPHRRFFTTNDPVLTPELIDYFFNKKTSVF
FT                   ADLSDRKKALLHLIYDLPEYRKILPAIPDKGEGVVQQIRQHRRFSVKCPAKLANSTAFI
FT                   DKPISVEVNEVSRYGFRARVAQQIPAEVWLNATVQLGLNEISRLTVQAVQETDVDDQHY
FT                   CGFRIGEPDLVWRKFVTALYEGHTHTDLDQATRFLP"
FT   gene            315585..316967
FT                   /locus_tag="Daro_0270"
FT   CDS_pept        315585..316967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0270"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45029"
FT                   /db_xref="GOA:Q47JF2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45029.1"
FT                   /translation="MHAKLSVVALSVAAAFALSACGQKEEPKAAAPAAPAGKPEVVVKL
FT                   GHVAPMTGPQAHLGKDNENGAALAIEELNAKGLEIGGAKVKFQLLAEDDAADPKQGAIV
FT                   AQKLVDAKVNGVIGHLNSGTTIPASKLYSDAGIPQISGSATNPKYTQQGFKTAFRVMAN
FT                   DVQQGRALGEFAAKQGVKTVAVVDDRTAYGQGLADEFKKAAEASGLKVVATEYTNDKAT
FT                   DFKAILTKIKSTKAELVFYGGMDAQGGPMAKQMKELGIKAKFLGGDGVCTPEFMKLGGE
FT                   ATEGNFCSLPGQPLEKLAKGPEFREKFTKKFNAEIQLYAPYVYDAVMVMADSMKRADSV
FT                   DPVKFLPAIGQTKYDGVTALIEFDPQGDLKGGAISIYQYKGGKLEYVETLGGSSVATAK
FT                   AEVKEAVDSVKDAAKAVAGAATAVGKEAVGDAKEAAKDVVKAGAEAVKNAADATKAAVE
FT                   KK"
FT   sig_peptide     315585..315647
FT                   /locus_tag="Daro_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.503 at
FT                   residue 21"
FT   gene            317003..317962
FT                   /locus_tag="Daro_0271"
FT   CDS_pept        317003..317962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0271"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45030"
FT                   /db_xref="GOA:Q47JF1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45030.1"
FT                   /translation="MPFPYALKEKDEMDIFLQQIINGLVQGSIYALVALGYTMVYGIMG
FT                   LINFAHGEVVMIGTLVTITVAGSLIKAGMPVALAGLAGVSASVLVCMALGWGLERIAYR
FT                   PLRNAPRLTPLITAIGMSIVLQNLAMMIWGRNYLTFPPLLPKMDFEFAGANFTAIQVII
FT                   VLVSAATMGGLLLLVYRTKLGMAMRATAQNPAVASLMGVNINRVIAAAFVIGSALGALA
FT                   GVMVGGYYEIAHYQMGFMLGLKAFTAAVLGGIGNLGGAMLGGILLGIIEALGAGYIGDL
FT                   TGGFLGSHYQDIFAFIVLIVVLMFKPSGLFGEKTGDRA"
FT   gene            317959..319020
FT                   /locus_tag="Daro_0272"
FT   CDS_pept        317959..319020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0272"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45031"
FT                   /db_xref="GOA:Q47JF0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45031.1"
FT                   /translation="MSKWLNPRSAFGIALIAVALLGLPFVAAMGGQAWVRILDFAILYV
FT                   FLALGLNIVVGFAGLLDLGYIAFYAVGAYTWALLASPHFGLHLPIWVILPIGAGLACFA
FT                   GVLLGSPTLKLRGDYLAIVTLGFGEIVRIFMNNLNAPVNITNGPQGITLIDPVAFGDFR
FT                   FSGTSQLFGLSVSGPIKYYYLLVALAILVIVINLRLQHSRIGRAWQAIREDEIAAKAVG
FT                   INARNIKLLAFAMGASFGGIAGGVFAAMQGFVSPESFSLMESIMILAMVVLGGMGHIPG
FT                   VILGAVLLSILPEVLRYGVGPAQMALFGKMLVDPESLRMLVFGLALVLVMRFKPAGLWP
FT                   SPERKRELQEAGQ"
FT   sig_peptide     317959..318051
FT                   /locus_tag="Daro_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.690 at
FT                   residue 31"
FT   gene            319017..319778
FT                   /locus_tag="Daro_0273"
FT   CDS_pept        319017..319778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0273"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45032"
FT                   /db_xref="GOA:Q47JE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45032.1"
FT                   /translation="MSEVLLKAEAVAKHFGGVKALQEVSLTIRRGEIYGLIGPNGAGKT
FT                   TFFNCMTGLYVPDGGGFVFDGAPLIADAPHQAAERGIARTFQNIRLFGNMTALENVMVG
FT                   RHVRTKAGVLGAMFQNAATKAEEAAIRQRASDLLHYVRIEERADDLAKNLSYGDQRRLE
FT                   IARALATEPKLLCLDEPAAGMNATETAELRELIEGIRRDGTTILLIEHDVKLVMGLCDR
FT                   VAVLDYGALVIEDVPAVVLKDQRVIEAYLGA"
FT   gene            319771..320475
FT                   /locus_tag="Daro_0274"
FT   CDS_pept        319771..320475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0274"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45033"
FT                   /db_xref="GOA:Q47JE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45033.1"
FT                   /translation="MLEVTGLHVAYGGIQAVRSITFHVNAGETVALIGANGAGKTSTLK
FT                   AISRVLDAVGGDVHFCGEEITRLAPHDIIRKGIALVPEGRGVFPRLTVLENLHMGAYVR
FT                   DADADVDKDLQMVFEYFPRLRERESQLGGTLSGGEQQMLAIGRALMSRPKMLLLDEPSM
FT                   GLAPIMVQKIFEVVRAVAANGMTILLIEQNARLALQSSQRGYVMESGEITLNGESAMLL
FT                   DDPKVRAAYLGE"
FT   gene            320488..321321
FT                   /locus_tag="Daro_0275"
FT   CDS_pept        320488..321321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0275"
FT                   /product="septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45034"
FT                   /db_xref="GOA:Q47JE7"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45034.1"
FT                   /translation="MSCIPHLAGASLWDNRDPFATHVAGMAKDSPIQFKGTTLKIIQTQ
FT                   LRTTDHAALHQALTELTGNSPDFFENELAVLDFSQAQALPESADWAGIVNLLRQSGLNA
FT                   VATCGLPDDLATSAAAAGLPVVGVDALGRQRAKVEEAPKAPPVVAPEPAPPPVAATAPE
FT                   PAPRTIILDKPLRSGQRFYAKGCDLIVTAMVSAGAEVIADGNIHVYAPLRGRALAGASG
FT                   DKAARIFTTSLEAELLSIAGLYRTFEAGVPAELLRQPATVSLIEDGLSIVPLALR"
FT   gene            321357..322172
FT                   /locus_tag="Daro_0276"
FT   CDS_pept        321357..322172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0276"
FT                   /product="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45035"
FT                   /db_xref="GOA:Q47JE6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45035.1"
FT                   /translation="MTRIVVVTSGKGGVGKTTTSASFSSGLAMRGFKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVINGEATLTQALIKDKHTDNLYVLPASQTRDKDALSEEGVEK
FT                   VIKELEHQGFDYIVCDSPAGIESGAVMALTFADEALVVTNPEVSSVRDSDRILGILQAK
FT                   SRRAIEGREPVKEHLLITRYNPTRVEAGEMLSYKDIQEILRVPIIGVIPESEEVLQASN
FT                   QGSPVIHQKETDAAEAYHDVIGRFLGEDKPLRFVDYVKPGLLKRLFGGK"
FT   gene            322174..322431
FT                   /locus_tag="Daro_0277"
FT   CDS_pept        322174..322431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0277"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45036"
FT                   /db_xref="GOA:Q47JE5"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45036.1"
FT                   /translation="MSLLSMLFGNKPKTAHLAKERLQLIIAHERDGGGSSANFLPDLQR
FT                   ELIAVISKYVKVNTEDIRVSLEKQGNYEVLEVNIVLPEKG"
FT   gene            322565..323197
FT                   /locus_tag="Daro_0278"
FT   CDS_pept        322565..323197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0278"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45037"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45037.1"
FT                   /translation="MNIRHSFSALAAILLATALHAEEAKPVDTTPRMAYGLMLKQGDKL
FT                   IFSPCRDRSYAYVEDVSADGSVTKVLNSLGLDAGKRLYVELLGVLEGAQLKASSVNMAR
FT                   IEGRCQMPGGKEESWRAAGNDPAWALVAGSEYVQLQRYGKPEVVLPYTEFRTEGNLTRY
FT                   DGAKDNNKLSVRFEKTLCRDAAANGVFGWTATLDLNGQVLKGCAWAR"
FT   sig_peptide     322565..322630
FT                   /locus_tag="Daro_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(323245..324255)
FT                   /locus_tag="Daro_0279"
FT   CDS_pept        complement(323245..324255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0279"
FT                   /product="Ferredoxin:Oxidoreductase
FT                   FAD/NAD(P)-binding:Oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45038"
FT                   /db_xref="GOA:Q47JE3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45038.1"
FT                   /translation="MSYQVTVQPSGKQFAAEADETLLDAALRQGLTLPYGCKDGACGAC
FT                   KGKVVSGTVDHGKAQAHALKDDEKAAGQTLYCCAKAQSDLVIECKQVSSAGDIPVKTLP
FT                   SRIEKLEKLAPDVIELQLRLPASERLQFWAGQYIDILLKDGKKRSYSLANAPHDDALLQ
FT                   LHIRHVPGGLFTDQVFSTMKVRDILRFNGPHGTFYLREDSKKPMILLAGGTGFAPIKAI
FT                   VEHAIAEQCERPMFIYWGAKARVDLYQNALPEQWTAEHGSIKYVPVLSEPASGEWAGRS
FT                   GFVHQAVLADFADLSGYQVYACGAPVMIEAAKRDFMARGLPEEEFFADAFTFSTN"
FT   gene            324289..325179
FT                   /locus_tag="Daro_0280"
FT   CDS_pept        324289..325179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0280"
FT                   /product="NAD-dependent epimerase/dehydratase:3-beta
FT                   hydroxysteroid dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45039"
FT                   /db_xref="GOA:Q47JE2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45039.1"
FT                   /translation="MQKILIVGSGDVARRILSRLARRACVYALLRDAARAAEWRAAGAV
FT                   PVLADLDDRGSLQRIAGLADVVLHLAPPPGEGRRDTRTRNLLAALGKAKSLPRQLIYVS
FT                   TTGVYGDCGGAQIDETRRLNPESARAGRRVDAERCLRDWGARTGVLVSILRAPGIYAAD
FT                   RLPLERLQKGTPALLGEDDGYTNHIHANDLAAACIAALRNGRGNRVYNVVDDSDLKMAE
FT                   YFDRVADAFALPRPPRISRREAEKTLSPVQMSFMRESRRIGNQRLKKELKLRLAYPTVD
FT                   VGIAESLARRNACSS"
FT   gene            325167..325583
FT                   /locus_tag="Daro_0281"
FT   CDS_pept        325167..325583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0281"
FT                   /product="Conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45040"
FT                   /db_xref="GOA:Q47JE1"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45040.1"
FT                   /translation="MLVVKTLHIWMVISWFAGLFYLPRIFVNLAMVPADSHAERDRLLL
FT                   MAGKLYKFMTPLGVLAIVLGFWLWFGYGFSGGWLHAKTTLVAVLAGYHWHCGRVLKRFQ
FT                   LGDNAKSHVWFRFYNELPVIILLVVLFLVVLKPF"
FT   gene            325585..326727
FT                   /locus_tag="Daro_0282"
FT   CDS_pept        325585..326727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0282"
FT                   /product="Putative RNA methylase:THUMP"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45041"
FT                   /db_xref="GOA:Q47JE0"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45041.1"
FT                   /translation="MNKYFAICPRGLEELLVEELRAVGAEELRATHGGVFFSGDWSVCY
FT                   RANLESRLATRILWHIVKGPYAKEEDIYRLAVRQLWPNHFSVSRTMRVVTTAIKCPLKS
FT                   LDFVTLRVKDAICDRFREDLGERPNIETRHPDVSVHVFLSENECTLYLDTSGQPLWQRG
FT                   FRKASVDAPLKENLAAGILKMTGWQPGTPLIDPMCGSGTFLLEAVQMALDRAPGLDRGF
FT                   AFELLKSFEAMNWANIRAAAEARVKPVEPMDIRGYDNDDKAVRATRRNLQEAGFGAAVM
FT                   VDNSDVLETQPLTDHGILVTNPPYGERIGEQDELAALYPQLGTALKRHWAGWNCFFFTA
FT                   DMRLPKLVGLRPSRKTPLFNGPLECRLFEIRMVAGSNRKL"
FT   gene            326831..328126
FT                   /locus_tag="Daro_0283"
FT   CDS_pept        326831..328126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0283"
FT                   /product="Acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45042"
FT                   /db_xref="GOA:Q47JD9"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45042.1"
FT                   /translation="MSIRALYQQKRMPAADAIRVVKNGDTIVVPTAVGEPPSLLTALSE
FT                   ARRDFRDVQVCQILAVRKYGYLDPETVENVRHTAYFYSGATRQGGKDGWVDFIPAYFSE
FT                   MPQLINRGLMPADVVFSMASPMDEHGFFSLSLAADYTMAAIERARVIVLEINPNVPFAN
FT                   GDCHIHISRVAALCESDEPILEVGLPKIGPVQEAIGKYVADMIPDGATLQIGYGGIPDA
FT                   VVMQLTDKHDLGIHTEMVGDGIMSLVEAGVVTNRKKNYHQGKMLATFALGSKKLYQFMH
FT                   RNPALEMHPVDFTNDPYLAGRNDNLHAINATMQIDFLGQCGSESLGSIPYSGTGGQSDF
FT                   VRAANRSNGGKAFIVLPSTAKDDTISRIVPTLSAGTHVSTSKNDINYVVTEFGVAQLRG
FT                   KTAKQRTEALIGIAHPNFRGELREAAKKLKLL"
FT   gene            328136..328459
FT                   /locus_tag="Daro_0284"
FT   CDS_pept        328136..328459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45043"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45043.1"
FT                   /translation="MLQKRFSDQELEQIIEEATIYMCACPAQVVVQIRGLRELFRYQLS
FT                   CEIDPGNDPAVHQAIAEVTIRAHAMMEECLDQILTMEGWDRTTLKMPEGLRRKLSEAIE
FT                   RDI"
FT   gene            328573..328908
FT                   /locus_tag="Daro_0285"
FT   CDS_pept        328573..328908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45044"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45044.1"
FT                   /translation="MNFRKLLVVLLALVMAGLGSSAWAHGGRVRLGVYVGGPVWGPVWY
FT                   PPPYYYPPQVIVVPPPAPPPVYIEQAQPEPQSSQQYWYYCARAKGYYPYVKECPEGWQK
FT                   VLPQPER"
FT   sig_peptide     328573..328647
FT                   /locus_tag="Daro_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            328915..329469
FT                   /locus_tag="Daro_0286"
FT   CDS_pept        328915..329469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0286"
FT                   /product="proline-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45045"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45045.1"
FT                   /translation="MSNSKLMPRLTLLGAALLLGACTVIPTGPSVMVLPGTGQTFERFR
FT                   ADDMDCRQFAQYQVGGKTAGDAAKESAVTSAAVGTAVGALAGAAIGGNSKGAAIGAGAG
FT                   LLMGSATGADASRASTVGTQRQYDNAYIQCMYSKGHRVPVPANMSYSAPVRSQQQQMQP
FT                   QDANIPPPPPGSPPPPPANVR"
FT   sig_peptide     328915..329016
FT                   /locus_tag="Daro_0286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.659 at
FT                   residue 34"
FT   gene            complement(329537..330481)
FT                   /locus_tag="Daro_0287"
FT   CDS_pept        complement(329537..330481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0287"
FT                   /product="Lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45046"
FT                   /db_xref="GOA:Q47JD5"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45046.1"
FT                   /translation="MAEKGVKQKGELKTARIPIKIVPVDTPLRKPEWIRVKAGNSAGRF
FT                   GEIKSMLREKKLHTVCEEAACPNIGECFGRGTATFMILGDICTRRCPFCDVGHGQPLPP
FT                   NPNEPAELADSVSSLKLQYVVITSVDRDDLRDGGAQHFVDVVRAVREASPKTTIETLVP
FT                   DFRGRMDIAIDILGNGLPDVLNHNMETVPRLYKQARPGADYAHSLALMKQFKARYPDVK
FT                   TKSGLMVGLGETDEEILEVMRDLRANDVEMLTIGQYLAPSGHHLPVSRYVHPDTFKMFE
FT                   EEAKKMGFSGAACAPMVRSSYWADQQAHSAGVA"
FT   gene            complement(330474..331091)
FT                   /locus_tag="Daro_0288"
FT   CDS_pept        complement(330474..331091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0288"
FT                   /product="Lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45047"
FT                   /db_xref="GOA:Q47JD4"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45047.1"
FT                   /translation="MPPVVKRLGRVDYQPTFQAMQDFTASRTAETPDEIWIVEHPPVYT
FT                   LGQAGKPEHILRDVGIPLVKIDRGGQVTYHGPGQVVIYLLLDLSRLKIKVRELVTAIEQ
FT                   SVIDLLAEYGITAERRDGAPGVYVGEAKIAALGLRIRNGCSYHGVSLNVDMDLSPFAAI
FT                   NPCGYAGLKVIQTKDFNIPLTAHEAGEQLSQHLLQQLDQKNG"
FT   gene            complement(331092..331361)
FT                   /locus_tag="Daro_0289"
FT   CDS_pept        complement(331092..331361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0289"
FT                   /product="Protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45048"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45048.1"
FT                   /translation="MASYKDTLLEFPCEFPLKIMGKADDSLAQVVLDIVTVHAPDFDGA
FT                   SMEMRASSGGNYLSLTCTVIARSKPQLDALYTDLSGHPMIKVVL"
FT   gene            complement(331363..332238)
FT                   /locus_tag="Daro_0290"
FT   CDS_pept        complement(331363..332238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0290"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45049"
FT                   /db_xref="GOA:Q47JD2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45049.1"
FT                   /translation="MTPYVADPVYLNGRFLPLAEAGISPLDRGFLYGDGVYEVIPVYSR
FT                   RAFRIDEHVKRLQATLDGIKLANPLTADGWKEVIAKLIETAPWDDQSIYLQVTRGADDK
FT                   RDHAFPPASIPSTAFAFASPLVTTPAEVRAKGVAAITVPDLRWSRCDLKVISLLANVLA
FT                   RQQAVDQGCAEALLIRDGFMKEGAASNIFIVKDGVLVAPPKTHLMLPGITYDVILELAA
FT                   THQQALAVREISETELRGADEVWMTSSTKEILAITTLDGEPVGTGKPGPFGEQMWQWYQ
FT                   DFKNTVMRKG"
FT   gene            complement(332243..333418)
FT                   /locus_tag="Daro_0291"
FT   CDS_pept        complement(332243..333418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0291"
FT                   /product="penicillin-binding protein 6, Serine peptidase,
FT                   MEROPS family S11"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45050"
FT                   /db_xref="GOA:Q47JD1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45050.1"
FT                   /translation="MSSPNAKQSTNPMSLFRKTAFILLSIVTAGQAMAQQLPVPPALAA
FT                   KSWLLLEVGSNQVLTAEKSDERLEPASLTKLMTAYLTFAAIRQKTIGLSQTLPVSEKAW
FT                   RTGGSKMFVRVDTQVPVEDLIKGMIVQSGNDACVTLAEGIAGSEENFAQMMNREAQRLG
FT                   MTNSHFINSTGLPDPQHYTTARDLSLLASALIRDFPEDYKKYYSMKEFRYNNITQPNRN
FT                   RLLFIDPTVDGVKTGHTEAAGYCLISSALRDKRRLLSVVLGTTSDSARATESQKLLNWG
FT                   FISYDSVALFAKDQAVATLRVWKGAQSEVKAGFTSDLGIAVPKGYADKVKSDFIAEPRL
FT                   IAPVEAGQKIGTLKVSIDGKPYNEYPVVALENIALGNIFIRIIDTIRLWFN"
FT   sig_peptide     complement(333314..333418)
FT                   /locus_tag="Daro_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            complement(333418..334326)
FT                   /locus_tag="Daro_0292"
FT   CDS_pept        complement(333418..334326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0292"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45051"
FT                   /db_xref="GOA:Q47JD0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45051.1"
FT                   /translation="MTPLNYKHLHYFWVVAQEGSITRAAERLDVAVQTISGQLSLLERH
FT                   LGKALFNSQGRGLVLSEAGRVALGYADQIFQLGDALVDAVEHSNSESTLRLRAGISDGI
FT                   PKLLAYRLLSTVTDMPADVRLICDEGEFETLLADLALHRLDVVLTDRSAPVGGNLKVFS
FT                   TRLGEFATGLFATPALVERYQPDFPNSLDGAPMLLPTRHNALRGRIDRWLENTNIRPKI
FT                   VGEFEDSALLNTFGRGGLGIFPAPLGLAEQIASQLDAQPLGAMAGVSEQIYAISSERRI
FT                   RHPAVEALCAAAPQAGAEPRV"
FT   gene            334429..335307
FT                   /locus_tag="Daro_0293"
FT   CDS_pept        334429..335307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0293"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45052"
FT                   /db_xref="GOA:Q47JC9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45052.1"
FT                   /translation="MKRIILFLATNLAVMLVLSVATSLLGVNKFLTANGLNVGMLFVFA
FT                   AVIGFGGAFISLLVSKTMAKWSTGARVIESPSSSTEMWLVDTVAKLAKRANLPMPEVAI
FT                   YDGEPNAFATGATKNKSLVAVSTGLLQSMTRDEAEAVLAHEVAHIANGDMVTLTLIQGV
FT                   VNTFVVFLSRIVGYVVDGFLRRGDSENSGPGIGYMVTSMICEVIFGLLASIVVAWFSRQ
FT                   REFRADAGAAGLMGSPVPMQNALRRLGNLHTEALPQNMAASGIAGGKGGFMALFSTHPP
FT                   LEERIAALGGR"
FT   gene            335325..336587
FT                   /locus_tag="Daro_0294"
FT   CDS_pept        335325..336587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0294"
FT                   /product="Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45053"
FT                   /db_xref="GOA:Q47JC8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45053.1"
FT                   /translation="MRFANSMFMMQRTNLLILLLGMSATLAVAQPEYDLPKLEALAMES
FT                   SRSVLAAREQITAARHAVESAGAFPNPELEYLGGTARSRGVGGNLGDARSVALTQPLDM
FT                   PWRRAARIGAAEAGLAATSAAVRAFEADSLARLRLRYFEVLRRDAELKNAREDMSLMES
FT                   VRSRIALRVETGEAPRFELIKADAEALNAQKSAQAAGFRVEQARSLLRQAVGGALPPEF
FT                   GLQGRLRDVPELPPLDGLRKQLGETSPDLARARAEMVRAQHQLDLEKRQRWPSIALKAS
FT                   MDEDPETRASKVGVVVSIPLWDRRSGPIGEAAAQLSRTRHEFAAQEFSLAQQLDVAVQQ
FT                   YEIAQSQVTALEGGIVRQAEAALKVSEAAYRFGERGFLEVLDAQRVFRAARAELIAARY
FT                   ELAAAWVEIERLRAIPGETRQ"
FT   sig_peptide     335325..335414
FT                   /locus_tag="Daro_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.983 at
FT                   residue 30"
FT   gene            336584..337723
FT                   /locus_tag="Daro_0295"
FT   CDS_pept        336584..337723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0295"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45054"
FT                   /db_xref="GOA:Q47JC7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45054.1"
FT                   /translation="MKIALILALSSALLLGCNKENNPAAAKQAQDPSIVHPSPELLAQL
FT                   KLADLETKAVAETLRVAGRIDFDEQRLARIGATVTGRVTDIDALLGQSVKKGEVLARLN
FT                   SSELSSQQLAYLKARAQLELNRRNAERAKALFDADVIGAAELQRRESEFQISVAETRAA
FT                   SDQLQLLGVSRAAIDRLGKQGAVDSVTPVTATLNGVVVERKLAQGQVVQPADALFVVAD
FT                   LSRLWAVAQVPEQQVSQVKSGQSVSIEVPALGNEKLVGKLIFVGQTIDPETRTVLVRTE
FT                   LDNREGRLKPAMLASMLIEAKPVERLVVPASAVVRENDEDHVFVAEGDGIFRLLKVKLG
FT                   PEQGGIRVLLSGLKGGEKLVVDGAFHLNNERNRKEMEGS"
FT   sig_peptide     336584..336643
FT                   /locus_tag="Daro_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.862) with cleavage site probability 0.604 at
FT                   residue 20"
FT   gene            337720..340830
FT                   /locus_tag="Daro_0296"
FT   CDS_pept        337720..340830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0296"
FT                   /product="Heavy metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45055"
FT                   /db_xref="GOA:Q47JC6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45055.1"
FT                   /translation="MIESLVRSALKQRLIVAVIAAVLFFFGLDAARKLSVDAFPDVTNV
FT                   QVQIATEATGRSPEEVERFATVPLEVAMTGLPGLEEMRSLNKPGLSLITLVFNDKTDVY
FT                   FARQLVMERLLEVGSRLPQGITPVLGPVSTGLGEVYQYTLERADDGDRTLSEEELMKRR
FT                   IAQDWVVRPLLRSIPGVAEINSQGGYAKQYHVLVNPDKLRHFGLSVADVYQAVGRNNAN
FT                   AGGGVLPQYAEQYLIRGIGLVRDIEDLRAIVLRERDGVPVYVRDVADVQIGHDVRQGAV
FT                   IKNGVTEAVGGVVMMIAGGNAKEVVGRIKARVEEINRKGMLPDGLKIEPYYDRSELVDA
FT                   ALWTVTKVLLEGVALVVVVLFLFLGDVRSSLIVVGTLVLTPLLTFIAMNKLGISANLMS
FT                   LGGLAIAIGLMVDGSVVVVENAYLQLGRMLKSGESSTRVILRAVVEVATPVIFGVGIII
FT                   LVFLPLMTLQGMEGKMFAPLAYTIAIALAISLILSLSLTPVMSTYLLKPPAHDGDHDTR
FT                   LIAVMKQRYLKMLHWALGNEKKTVTLAIIAFVVTVSLLPFLGTAFIPEMKEGSVVPGIN
FT                   RVPNISLDESIKMEMEAMRLVMQVPGVKSAVSGVGRGESPADPQGPNESTPIVSLKPRS
FT                   EWPSGWTQDDIQDAMREKLKALPGVQIVMAQPISDRVDEMVTGVRSDIAVKVFGDDLDQ
FT                   LKRVAGQIGKVAQSLQGAQDLRIERISGQQYLSIEIDRQAIARLGLNVSDVNDVLETAV
FT                   GGKVATEIFEGERRFPGVVRLPERFRNNVEAISNILLTSRNGAQARLADVAKISVMDGP
FT                   AQISRELGKRRIVIGVNVKDRDLGSFVAELQQKVESQITLPEGYYLEWGGQFQNMERAL
FT                   GHLKIIIPITIAAIFFLLFLLFNSLRFATLIITVLPFASIGGIVGLFVTGEYLSVPASV
FT                   GFIALWGIAVLNGVVLVSYIRGLRDQGRSVRQAVIEGATLRFRPVMMTATVAMLGLIPF
FT                   LFSSGPGSEVQRPLAIVVIGGLITCTLLTLLVLPTIYRWFDEDEVEA"
FT   sig_peptide     337720..337812
FT                   /locus_tag="Daro_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.719) with cleavage site probability 0.671 at
FT                   residue 31"
FT   gene            340827..341165
FT                   /locus_tag="Daro_0297"
FT   CDS_pept        340827..341165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0297"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45056"
FT                   /db_xref="GOA:Q47JC5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45056.1"
FT                   /translation="MKEIKAIIRPNKLPLLRDALVALPDFPGMTVSKVEGCSAPSRHVP
FT                   ARTKIKDELTDYTSKVRIEIVAPDEVAETIFLRITEVAQTGHYGDGLVWITDIEKVAFV
FT                   FKTTPGPD"
FT   gene            341284..342204
FT                   /locus_tag="Daro_0298"
FT   CDS_pept        341284..342204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0298"
FT                   /product="PAS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45057"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45057.1"
FT                   /translation="MGKLHQPASGATLMSPAALQEGIASLSRGVYFREASLSMMLSILT
FT                   ESAAQMSGVERVSIWALTNSQSELTCLDLYEQASGQHSKGASIDAGGYPVYFRALQAGT
FT                   AITADDAYLHPLTAEFASDYLPRHKVTAMLDTPIHIRGELQGVLCLEQVASRQPWTAAH
FT                   QLFAQAVANLVTLALVEYEAEEARRAAKEASERLRAVFDASRDALFLADRDSGEILDVN
FT                   RQAEALVGRTRNELLGRHQGSLHPAEFQKSMLGEFRQMFDGCQSLTLASQVQHSDGRKL
FT                   PVEITAEVADLSDGRRLALSVFRPV"
FT   gene            complement(342201..342953)
FT                   /locus_tag="Daro_0299"
FT   CDS_pept        complement(342201..342953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45058.1"
FT                   /translation="MADIPEEDLEETRAALAPTLAATAAILPWVSKPRQLRFDAKLNER
FT                   WVAAGKRLAAAWSDRHGAGAEDIRPAIFSLYAIAIEAADGDSLRLGEALASAADRLENA
FT                   SPSPRLIAAITGAIECLGEADGLEHEAFADRAQHFSMRLEAAASAPDNAERSAVLDRLF
FT                   VDEACEQIELMRDALAALPPDAYALTTEAMKLAQQAELLELWGIMHLARHLTDYIGRNA
FT                   AELDSDEHREEIERLVHALATAIAAVAA"
FT   gene            complement(342961..343437)
FT                   /locus_tag="Daro_0300"
FT   CDS_pept        complement(342961..343437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0300"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45059"
FT                   /db_xref="GOA:Q47JC2"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45059.1"
FT                   /translation="MTRPFKVLGIQQIAIGGPSKEKLRTLWVEKFGLEITSTFVSEREN
FT                   VDEDICAMGTGPFKVEVDLMQPLDPEKKPAVHTTPLNHVGLWIDDLPKAVEWLSANGVR
FT                   FAPGGIRKGAAGFDITFLHPKGNDEFPIGGEGVLIELVQAPPEVVAAFAKLAAQ"
FT   gene            complement(343478..344269)
FT                   /locus_tag="Daro_0301"
FT   CDS_pept        complement(343478..344269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0301"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45060"
FT                   /db_xref="GOA:Q47JC1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45060.1"
FT                   /translation="MLLHPQFDPVAFSVGPLSVRWYGLMYLVAFVQFIFLGRYRIKTRP
FT                   GFLSVEQLDDLLFYGMLGVILGGRLGQVLFYEPAYFLANPLEIFAVWKGGMSFHGGFLG
FT                   VLVAMGLWTRKHHLNWFEVMDFVAPLVPLGLAAGRVGNFINGELWGRVADASLPWAMIF
FT                   PQSGDMQPRHPSQLYHVGLEGLALFVILWWFTAKPRPRAAASGAFLIGYGAFRFITEYF
FT                   REPDHGIFGQSYTISMGQWLSLPMILIGVAMVVFAYRKKSL"
FT   gene            344356..346212
FT                   /locus_tag="Daro_0302"
FT   CDS_pept        344356..346212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0302"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45061"
FT                   /db_xref="GOA:Q47JC0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45061.1"
FT                   /translation="MPQYRSHTSTHGRNMAGARSLWRATGMKDGDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDMGQLVAREIEAAGGVAKEFNTIAIDDGIAMGHSGMLYSLPSRDLIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKVKIQGQVIHLD
FT                   LIDAMVKAADHSVSQAELDDVERSACPTCGSCSGMFTANSMNCLTEAFGLSLPGNGTVV
FT                   ATHADRKQLFLRAGRQIVELCKRYYEQDDASVLPRAIATKAAFENAMTLDVAMGGSTNT
FT                   VLHILATAQEAGVDFTMADIDRISRSVPCLCKVAPMTDKYHIEDVHRAGGIMGILGELD
FT                   RAGLINRDVPNVYAKNLGEAIDRWDVVRQHDVKVHEFFKAAPGGVPTQVAFSQDRRFNE
FT                   LDIDRTHGCIRNKANAYSQEGGLAVLYGNIALDGCIVKTAGVDESIWKFTGKARVFESQ
FT                   DAAVEAILGEKIVAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKECALLTDGRFS
FT                   GGTSGLSIGHASPEAADGGAIGLVEEGDTIEIDIPNRRIHLAVTDGELAQRRAAMEAKG
FT                   EAAWQPVSRERVISPALQAYALMATSADKGAVRDVKQIQRRK"
FT   gene            346209..346826
FT                   /locus_tag="Daro_0303"
FT   CDS_pept        346209..346826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0303"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45062"
FT                   /db_xref="GOA:Q47JB9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45062.1"
FT                   /translation="MTLTVWLGFLAASILIAVTPGPGAVISMSTGMRHGYWSALTAILG
FT                   LQAAILLHLLIVALGLGALLAASEAAFTLVKFLGAAYLVWLGIQKWRAPAVPVDANVPL
FT                   VRRKGLFLQGVLVNLTNPKAIIFVGALVPQFVSPALPQIPQYLLIAATLCLTDMTVMSG
FT                   YALAGTRLGRWLHDPEAIRLQNRAFGGLFVSAGALLAISSKP"
FT   gene            346978..347283
FT                   /locus_tag="Daro_0304"
FT   CDS_pept        346978..347283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0304"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45063"
FT                   /db_xref="GOA:Q47JB8"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45063.1"
FT                   /translation="MKAVYVAMIAAGVVMAGQAQADEALAKAKNCMSCHAIDKKLVGPA
FT                   YKDVAAKYKGDAKAPAMLAAKVKAGGKGTWGQIPMPPNNVTEDEAKKLVAWVLSQK"
FT   sig_peptide     346978..347043
FT                   /locus_tag="Daro_0304"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            347382..347466
FT                   /locus_tag="Daro_R0010"
FT   tRNA            347382..347466
FT                   /locus_tag="Daro_R0010"
FT                   /product="tRNA-Tyr"
FT   gene            347506..347579
FT                   /locus_tag="Daro_R0011"
FT   tRNA            347506..347579
FT                   /locus_tag="Daro_R0011"
FT                   /product="tRNA-Gly"
FT   gene            347610..347684
FT                   /locus_tag="Daro_R0012"
FT   tRNA            347610..347684
FT                   /locus_tag="Daro_R0012"
FT                   /product="tRNA-Thr"
FT   gene            347739..348929
FT                   /locus_tag="Daro_0305"
FT   CDS_pept        347739..348929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0305"
FT                   /product="Translation elongation factor Tu:Small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45064"
FT                   /db_xref="GOA:Q47JA5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45064.1"
FT                   /translation="MAKEKFARTKPHVNVGTIGHVDHGKTTLTAAITTVLSAKFGGAAK
FT                   KYDEIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYVLVFMNKCDMVDDAELLELVEMELRELLSKYDF
FT                   PGDDTPIIHGSALKALEGDQSEIGEPSIFRLADALDSYIPDPERAIDQPFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIVKVGEEIEIVGIRPTVKTICTGVEMFRKLLDQGQAGDNIGALL
FT                   RGTKREDVERGQVLCKPGSVKPHTHFTSEVYILSKDEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGSIELPEGTEMVMPGDNIAMTIKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            348992..349067
FT                   /locus_tag="Daro_R0013"
FT   tRNA            348992..349067
FT                   /locus_tag="Daro_R0013"
FT                   /product="tRNA-Trp"
FT   gene            349092..349445
FT                   /locus_tag="Daro_0306"
FT   CDS_pept        349092..349445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0306"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45065"
FT                   /db_xref="GOA:Q47JB6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45065.1"
FT                   /translation="MADKIKFALALIILAAGVAGFYLLSEQAMILRVLAVLVGLALAVA
FT                   VAWKTEPGQRFFLFGNEAVVEAKKVVWPTRKETMQTTGAVFAFVVVMAIFLYLTDKSLE
FT                   VVLYDWVLGWKKS"
FT   sig_peptide     349092..349169
FT                   /locus_tag="Daro_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.665 at
FT                   residue 26"
FT   gene            349442..349975
FT                   /locus_tag="Daro_0307"
FT   CDS_pept        349442..349975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0307"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45066"
FT                   /db_xref="GOA:Q47JB5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q47JB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45066.1"
FT                   /translation="MSKRWYVVHAYSGFEKSVMRAIQERITRLGMEEKFGRILVPVEEV
FT                   VEMKGGQKAISERKFFPGYVLCEMEMDDDSWHLVKNTPKVTGFVGGTATKPTPISEKEV
FT                   EKIMQQMQEGVEKPRPKVLFEVGEVVRVKEGPFTDFHGSVEDVNYEKNRLRVSVTIFGR
FT                   ATPVELEFAQVEKA"
FT   gene            350083..350514
FT                   /locus_tag="Daro_0308"
FT   CDS_pept        350083..350514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0308"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45067"
FT                   /db_xref="GOA:Q47JB4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45067.1"
FT                   /translation="MAKKIIGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQ
FT                   TQGVEPGLPIPVVITAFADKSFTFVMKTPPATILIKKAAGIKSGSAKPHTDKVGKITRA
FT                   QCEEIAKTKSPDLTAADMEAAIRTIAGSARSMGITVEGL"
FT   gene            350517..351212
FT                   /locus_tag="Daro_0309"
FT   CDS_pept        350517..351212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0309"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45068"
FT                   /db_xref="GOA:Q47JB3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45068.1"
FT                   /translation="MAKLTKKQKALASKVVAQKLYPLQEALTLAKETAIAKFDESIDVA
FT                   VNLGVDARKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEAAKAAGAEVVGFDDLAAEV
FT                   KAGNLNFDVVIATPDAMKVVGQLGQILGPRGLMPNPKVGTVTMDVVTAVKNAKAGQVQY
FT                   RTDKAGIIHATIGRASFSVESLESNLKALIDALAKAKPASSKGQYLKKIAVSATMGPGV
FT                   RVDQSTVVA"
FT   gene            351438..351935
FT                   /locus_tag="Daro_0310"
FT   CDS_pept        351438..351935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0310"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45069"
FT                   /db_xref="GOA:Q47JB2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45069.1"
FT                   /translation="MGLNLNDKKAVVAEVSAQVANAQTIVIAEYRGIEVTDLTVLRKKA
FT                   RESGVYLRVLKNTLVRRAVADTAFAALADHMVGPLIYSVSADPVAAAKVLSDFAKSNDK
FT                   LVLKAGSYAGKVLDKAGVQALASVPSREELLSKLLYVMQAPVAGFVRGLAALAAQREEA
FT                   AA"
FT   gene            351974..352345
FT                   /locus_tag="Daro_0311"
FT   CDS_pept        351974..352345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0311"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45070"
FT                   /db_xref="GOA:Q47JB1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45070.1"
FT                   /translation="MAISKEDILEAVGSLTVMELNDLVKAFEEKFGVSAAAVAVAGPAG
FT                   AGAAAAEEQTEFTVMLTGAGDKKVEVIKVVRAATGLGLKEAKDLVDGAPKAVKEGVSKA
FT                   DAEALKAQLEAAGAKVEVK"
FT   gene            352552..356835
FT                   /locus_tag="Daro_0312"
FT   CDS_pept        352552..356835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0312"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45071"
FT                   /db_xref="GOA:Q47JB0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45071.1"
FT                   /translation="MTYSFTEKKRIRKSFAKRASVLDVPYLLATQLQSFKDFLQDEVAP
FT                   EKRKNEGLQAAFTSIFPIVSHSGNARLEFVSYMLGEPAFDVTECQQRGLTFASSLRARV
FT                   RLVIMDREAPDTVKEVKEQEVYMGEIPLMTTNGSFVINGTERVIVSQLHRSPGVFFEHD
FT                   RGKTHSSGKLLFSARVIPYRGSWLDFEFDPKDTLFFRVDRRRKMPVTTLLKAIGMSSEE
FT                   ILDQFFDFDTFLLSKDKVEFTLVPERLRGEVARFDFVGPDGVLIVPKDKRITAKHIRDI
FT                   GAAAIKQIVVPEDFLIGRVVAKNIVDKATGEVVANANDEITETLLAKLREAEITTVETL
FT                   YTNELDRGAFISNTLRADETATRQAARVAIYRMMRPGEPPTEEAVEILFNGLFYSDERY
FT                   DLSGVGRMKFNRRLARQDVIEYKLMVKGLASKAEAALKNLAEASGFALSAIQDLVSLMP
FT                   FGARAMVENSTLSEVEALAAKLKPLGANVEVREQLTLSPRDIVEVIKILVELRNGRGEI
FT                   DDIDHLGNRRVRSVGELAENQFRAGLVRVERAVKERLSQAESDNLMPHDLINAKPISAA
FT                   IKEFFGSSQLSQFMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCP
FT                   IETPEGPNIGLINSLALFAQVNSYGFIETAYRKVNNGQVTSDIEYLSAIEEGNYVVAQA
FT                   NASLDANGRLSDDLVTCREKGETILAEPGRVQYMDVAPGQIVSVAASLIPFLEHDDANR
FT                   ALMGANMQRQAVPCLRPEKPLVGTGIERTVAVDSGTAVVALRGGMVDYVDAARVVVRVN
FT                   DDETIAGEVGVDIYNLVKYTRSNQNTNINQRPMVRVGDHIAKGDVVADGASTDKGELAL
FT                   GQNMLIAFMPWNGYNFEDSILISERVVAEDRYTSIHIEELTVVARDTKLGPEEITRDIA
FT                   SLGEAQLSRLDDSGIVYIGAEVEAGDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
FT                   DTSLRVPSGIAGTVIDVQVFTREGIERDKRAQAIIDEHLRHYKLDLADQMRIVERDAFA
FT                   RVERLITGKKANGGPKKLAKGTVIDKVYLDSMDPHHWFDIRLADDEAAQQLEQVKDGLE
FT                   QARKDFDIAFEGKRKKLTQGDELPPGVQKMVKVYVAVKRRLQPGDKMAGRHGNKGVVSR
FT                   ILPVEDMPHMEDGSPVDIVLNPLGVPSRMNVGQILEVHLGLAAKGLGHKIGAMLRAQSS
FT                   AKEVRGFLDQIYNSSGKSENLDELNDVEVLEMAENLKGGVPFATPVFDGAKEEEIKAML
FT                   AMAGMPSSGQMTLFDGRTGEAFERKVTVGYMHYLKLHHLVDDKMHARSTGPYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGASYVLQEMLTVKSDDVNGRTKVYENIVKGEHRIEA
FT                   GMPESFNVLVKEIRSLAIDIDLERY"
FT   gene            356857..361068
FT                   /locus_tag="Daro_0313"
FT   CDS_pept        356857..361068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0313"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45072"
FT                   /db_xref="GOA:Q47JA9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45072.1"
FT                   /translation="MKALLDLFKQVTAEEEFDAITIGLASPDKIRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLAKVRRDRMGH
FT                   IELASPTAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAYVVTDPGMVSNLQRAQLLTE
FT                   DQYLEMVEEHGDEFQALMGAEGIRELLRNLELDSEVESLHAELEVTGSEAKNKKLAKRL
FT                   KILEGFQKSGIKPDWMILEVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLK
FT                   RLLELKAPEIIVRNEKRMLQESVDSLLDNGRRGKAMTGANKRPLKSLADMIKGKGGRFR
FT                   QNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFIFHKLEVLGYATTIKQAK
FT                   KMVEGQEPVVWDILEDVIREHPVMLNRAPTLHRLGIQAFEPTLIEGKAIQLHPLVCAAF
FT                   NADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLSPANGQPIIVPSQDIVLGLYYATRE
FT                   KINGKGEGMYFADTAEIERAMAAGQLDVHSRISVRLKQYEPAAVDGEWEEKTVRVETTA
FT                   GRALLAKILPKGLPFKAIDRALKKKEISKLIDESFRRCGLKETVIFADKLMQNGYALAT
FT                   RAGISFCSDDMLVPAKKYEIISSAEAEVKEIETQYTNGLVTQGERYNKVVDIWGRTGDQ
FT                   VAKVMMEELGHEEVIDRHGKKVKQDSFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPD
FT                   GSIIETPITTNFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDLVIT
FT                   EDDCGTKNGFVVKALVEGGEVIEALRERILGRVTVDDLIDPETQETVIFAGTMLDEDLV
FT                   DLIDKLGIDEVKVRTPLTCDTRYGLCAQCYGRDLGRGTMVNAGEAVGVIAAQSIGEPGT
FT                   QLTMRTFHVGGAASRAAVADKVEGKSAGTVRYTSNMRYVTSAKGEKVVISRSGEVLIVD
FT                   DHGRERERHKVPYGAMLSVDEDKSVKAGAKLATWDPHTRPIITEYAGTVRFENVEEGVT
FT                   VAKQVDDVTGLSTLVVIDHKRGGKAAVKGVRPVVKLLDESGQEVRVHGSDHTVSIAFQV
FT                   GSIISVVDGQQVGVGDVLARMPQESAKTRDITGGLPRVAELFEARTPKDASVLAEVTGT
FT                   ISFGKDTKGKQRLVITDLEGNVHEFLISKDKHVLVHDGQVVNKGEKIVEGEPDPHDILR
FT                   LQGIEALARYITDEVQDVYRLQGVKINDKHIEVIVRQMLRRVTIVEPGDTKFIKSEQVE
FT                   RAELLAENDRANAEGKIPATIEHMLLGITKASLSTDSFISAASFQETTRVLTEAAIMGK
FT                   RDELRGLKENVIVGRLIPAGTGLAFHRSRKAQLAGEDIAASRQIEEATAENTTQEADQG
FT                   L"
FT   gene            361226..361603
FT                   /locus_tag="Daro_0314"
FT   CDS_pept        361226..361603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0314"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45073"
FT                   /db_xref="GOA:Q47JA8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45073.1"
FT                   /translation="MPTINQLVRKPRVAEKAKSKVPALEKCPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
FT                   QGVKDRKQSRSKYGAKRPKAA"
FT   gene            361714..362184
FT                   /locus_tag="Daro_0315"
FT   CDS_pept        361714..362184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0315"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45074"
FT                   /db_xref="GOA:Q47JA7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45074.1"
FT                   /translation="MPRRREVPKRDILPDPKFGNVEVSKFVNAIMQSGKKSVAERIVYG
FT                   AFDIITTKGGKDPLEVFSAAMSNVKPMVEVKSRRVGGANYQVPVEVRPARRAALAMRWL
FT                   RESARKRSEKSMGQRLAAEMLEAAENRGGAVKKRDEVHRMAEANKAFAHFRF"
FT   gene            362203..364296
FT                   /locus_tag="Daro_0316"
FT   CDS_pept        362203..364296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0316"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45075"
FT                   /db_xref="GOA:Q47JA6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45075.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILYYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWSGMDKQFQPHHINIIDTPGHVDFTIEVERSMR
FT                   VLDAACMVYCAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRSGANFFKVVDQLKLRLK
FT                   ANPVPIVIPIGAEDKFEGVVDLIKMKAIYWDEASQGMKYDAREIPAELADDAATWREQM
FT                   VEAAAEASEELMNKYLEEGDLSEADIILGLRTRTIACEIQPMLCGTAFKNKGVQKMLDA
FT                   VIELLPSPVDIPPVKGILENESEGERRAADDEAFSALAFKIMTDPFVGQLIFFRVYSGV
FT                   INSGDTVYNPVKGRKERLGRILQMHANQREEIKEVRAGDIAAAVGLKEATTGDTLCDPA
FT                   KVITLERMVFPEPVIHVAVEPKTKADQEKMGLALGRLAQEDPSFRVRTDEESGQTIISG
FT                   MGELHLEILVDRMRREFNVDASVGAPQVAYRECIKKSVEQEGKFVKQSGGRGQFGHVWL
FT                   KIEPNEAGKGYEFIDAIKGGVVPREFIPAVDKGLRDAVTSGVLAGFPVVDVKFTLFDGS
FT                   YHDVDSNENAFRMAASMAFKEGMKKASPTLLEPMMAVEVETPEEYMGNVMGDLSSRRGI
FT                   VQGMEDQVGGIKVVKAEVPLSEMFGYSTSVRSLSQGRATYSMEFKHYTEAPKNVAEAVI
FT                   NKK"
FT   gene            364312..365502
FT                   /locus_tag="Daro_0317"
FT   CDS_pept        364312..365502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0317"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45076"
FT                   /db_xref="GOA:Q47JA5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45076.1"
FT                   /translation="MAKEKFARTKPHVNVGTIGHVDHGKTTLTAAITTVLSAKFGGAAK
FT                   KYDEIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYVLVFMNKCDMVDDAELLELVEMELRELLSKYDF
FT                   PGDDTPIIHGSALKALEGDQSEIGEPSIFRLADALDSYIPDPERAIDQPFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIVKVGEEIEIVGIRPTVKTICTGVEMFRKLLDQGQAGDNIGALL
FT                   RGTKREDVERGQVLCKPGSVKPHTHFTSEVYILSKDEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGSIELPEGTEMVMPGDNIAMTIKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            365564..365875
FT                   /locus_tag="Daro_0318"
FT   CDS_pept        365564..365875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0318"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45077"
FT                   /db_xref="GOA:Q47JA4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45077.1"
FT                   /translation="MANQKIRIRLKAFDYRLIDQSAQEIVETAKRTGAVVRGPVPLPTR
FT                   KQRFDILRSPHVNKASRDQLEIRTHLRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            365985..366623
FT                   /locus_tag="Daro_0319"
FT   CDS_pept        365985..366623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0319"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45078"
FT                   /db_xref="GOA:Q47JA3"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45078.1"
FT                   /translation="MSLGLVGRKVGMTRIFAEDGASIPVTVLDVSNNRVTQVKTPEIDG
FT                   YAAIQVAFGKRRASRVSKPLAGHLAKAGVEAGHVLKEFQIEADQLASFKAGDQVAVTIF
FT                   AEGQKVDVTGTSIGKGFQGGIKRHNFSSNRASHGNSLSHNAPGSIGMAQDPGRVFPGKR
FT                   MAGHLGDVQSTMQGLTIVRVDADRQLLLVKGAVPGAKGSDVVVRPAVKA"
FT   gene            366633..367256
FT                   /locus_tag="Daro_0320"
FT   CDS_pept        366633..367256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0320"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45079"
FT                   /db_xref="GOA:Q47JA2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45079.1"
FT                   /translation="MELKVINEQGQEAAKLQASDVLFGRDFNEALVHQIVVAYQANARS
FT                   GDRQQKDRSEVRHTTTKPWRQKGTGRARAGSNGSPLWRGGGRIFPNSPEENFSQKVNKK
FT                   MFRAGMAAILSELARQDRLVVIDDLSVDAPKTKLFTQKLKSMGLEGNLLVITDELNENL
FT                   YLSSRNLPNVLVLEAQEADPVSLVRFAKVLVTKNAVAKFEEMWG"
FT   gene            367253..367555
FT                   /locus_tag="Daro_0321"
FT   CDS_pept        367253..367555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0321"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45080"
FT                   /db_xref="GOA:Q47JA1"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45080.1"
FT                   /translation="MNQERLMQVLLAPQISEKATYVADKYEQVIFRVASDATKPEIKAA
FT                   VELLFKVEVEGVQVANVKGKVKRFKGATGRRKGWKKAYVSLKPGQEINFVEGGNA"
FT   gene            367555..368382
FT                   /locus_tag="Daro_0322"
FT   CDS_pept        367555..368382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0322"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45081"
FT                   /db_xref="GOA:Q47JA0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47JA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45081.1"
FT                   /translation="MALVKVKPTSPGRRGVVQVVNASLHKGKPFAALVEAKSGNAGRNN
FT                   NGRITVRHQGGGHKQAYRVIDFKRNKDGIPAKVERLEYDPNRTANIALLCYADGERRYI
FT                   IANKGMVVGQPIMSGSEAPIKSGNALPIRNIPVGTTICCVEMLPGKGAQLARSAGTSVQ
FT                   LLAREGTYAQIRLRSGEVRRVHVECRATIGEVGNEEHNLRKIGKAGAMRWRGVRPTVRG
FT                   TAMNPVDHPHGGGEGRTGEGRVPVNPWGQPTKGYRTRSNKRTNSMIVQRRHKR"
FT   gene            368393..368668
FT                   /locus_tag="Daro_0323"
FT   CDS_pept        368393..368668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0323"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45082"
FT                   /db_xref="GOA:Q47J99"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45082.1"
FT                   /translation="MGRSLKKGPFVDAHLIDKVEAVRATSDKRPIKTWSRRSTILPEFI
FT                   GLTIAVHNGKQHIPVFVTENMVGHKLGEFSLTRTFKGHTAGKKAKK"
FT   gene            368678..369007
FT                   /locus_tag="Daro_0324"
FT   CDS_pept        368678..369007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0324"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45083"
FT                   /db_xref="GOA:Q47J98"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45083.1"
FT                   /translation="METRASLRGVRLSAQKGRLVADLVRGKPVGQALNILAFCPKKGAG
FT                   IVKKVLESAIANAEHNDGADIDELTVKTIYVEKGMVLKRFTARAKGRGNRIIKPTCHIY
FT                   LTVGN"
FT   gene            369017..369802
FT                   /locus_tag="Daro_0325"
FT   CDS_pept        369017..369802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0325"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45084"
FT                   /db_xref="GOA:Q47J97"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45084.1"
FT                   /translation="MGQKIHPTGFRLAVTKNWSSRWYANSKDFPGMLNEDIKVREYLKR
FT                   KLAHASVGRVLIERPAKNARVTVYSARPGVVIGKKGEDIEQLRTDLQRIMGVPVHVSIE
FT                   EIRKPEIDAQLIADSIAQQLEKRIMFRRAMKRAMQNAMRLGAQGIKVMSAGRLNGAEIA
FT                   RSEWYREGRVPLHTLRADIDYATSEALTTYGIIGIKVWVYKGDMLDRNEQPVAEEPAAD
FT                   DRRPRRTPGRPDGDKPRTRTVKKVDGAADPAKRVRKAGA"
FT   gene            369804..370217
FT                   /locus_tag="Daro_0326"
FT   CDS_pept        369804..370217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0326"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45085"
FT                   /db_xref="GOA:Q47J96"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45085.1"
FT                   /translation="MLQPNRRKFRKEHKGRNEGLATRGTKVSFGEWGLKAIGRGRLTAR
FT                   QIEAARRAMTRHIKRGGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYWVAEIQPGKVLY
FT                   EMDGVNEALAREAFALAAAKLPIPTTFVTRHLG"
FT   gene            370220..370414
FT                   /locus_tag="Daro_0327"
FT   CDS_pept        370220..370414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0327"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45086"
FT                   /db_xref="GOA:Q47J95"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45086.1"
FT                   /translation="MKASELRTKSVDELKKELLDLLKAQFGLRMQLATQQLSNTSQMSK
FT                   VRRDIARVRTLIREKAVQQ"
FT   gene            370411..370677
FT                   /locus_tag="Daro_0328"
FT   CDS_pept        370411..370677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0328"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45087"
FT                   /db_xref="GOA:Q47J94"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45087.1"
FT                   /translation="MSESSSIKRTLIGRVVSDKMDKTVTVLVERKVKHPMYGKVMVRSK
FT                   KYHAHNEGNSAKAGDLVEIVETRPVSRTKTWAVTSVLEKAIVV"
FT   gene            370831..371199
FT                   /locus_tag="Daro_0329"
FT   CDS_pept        370831..371199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0329"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45088"
FT                   /db_xref="GOA:Q47J93"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45088.1"
FT                   /translation="MIQMQTTLDVADNTGARSVMCIKVLGGSRRRYAGIGDIIKVSIKD
FT                   AAPRGRVKKGDVYNAVVVRTAKGVRRPDGSLVRFDGNAAVLLNNKLEPIGTRIFGPVTR
FT                   ELRTERFMKIVSLAPEVL"
FT   gene            371207..371527
FT                   /locus_tag="Daro_0330"
FT   CDS_pept        371207..371527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0330"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45089"
FT                   /db_xref="GOA:Q47J92"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45089.1"
FT                   /translation="MMEKIRKGDEIVVITGKDKGKRGTVLRRVDDEHVLVEGVNRAKKH
FT                   VKPNPVKGVAGGIVDKDMPIHISNVALFNPATKKADRVGFKALDDGRKVRVFKSNGELV
FT                   NA"
FT   gene            371537..372076
FT                   /locus_tag="Daro_0331"
FT   CDS_pept        371537..372076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0331"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45090"
FT                   /db_xref="GOA:Q47J91"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45090.1"
FT                   /translation="MARLQQFYKETIVSDLVKQFGYKSVMEVPRITKITLNMGVGEAVA
FT                   DKKVLENAVGDMQKIAGQKPVTTKARKSIAGFKIRDGYPIGCMVTLRGPRMFEFLDRLV
FT                   TIALPRVRDFRGISGKGFDGQGNYNMGVKEQIIFPEIEYDKIDALRGMNISITTTAKTD
FT                   AEAKALLVAFKFPFKN"
FT   gene            372084..372389
FT                   /locus_tag="Daro_0332"
FT   CDS_pept        372084..372389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0332"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45091"
FT                   /db_xref="GOA:Q47J90"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45091.1"
FT                   /translation="MAKLALINREEKRRKLVAQYAKKRAALEAIITNVSLSDEERYEAR
FT                   LKMQALPRNSSPSRLRNRCQLTGRPRGVFRKFGLCRHKIRELAFNGEVPGVVKASW"
FT   gene            372405..372800
FT                   /locus_tag="Daro_0333"
FT   CDS_pept        372405..372800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0333"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45092"
FT                   /db_xref="GOA:Q47J89"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45092.1"
FT                   /translation="MAMSDPIADMLTRIRNAQLAEKASVSMPSSKVKVAIAAVLKDEGY
FT                   VEDFAVRQADGKANLEIALKYYAGRPVIERIERISKPGLRIYKGCDDIPRVMNGLGVAI
FT                   VSTPKGVMTDRKARASKVGGEVLCIVA"
FT   gene            372811..373341
FT                   /locus_tag="Daro_0334"
FT   CDS_pept        372811..373341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0334"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45093"
FT                   /db_xref="GOA:Q47J88"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45093.1"
FT                   /translation="MSRIGKNPVVLPAGVEVTVGEQIVVKGPLGSLKTAAHSAVNVAVE
FT                   GQNVTVSKVAGAANAAAMWGTMRANLNNMVTGVSKGFERKLQLVGVGYRAQAQGDTLNL
FT                   SLGFSHPVAHKMPAGVKVECPTQTEILIKGSDKQQVGQVAAEIRAYRKPEPYKGKGVRY
FT                   ADEVVVIKETKKK"
FT   gene            373351..373707
FT                   /locus_tag="Daro_0335"
FT   CDS_pept        373351..373707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0335"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45094"
FT                   /db_xref="GOA:Q47J87"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45094.1"
FT                   /translation="MFNKKQARLRRARKTRAKIAELKAVRLCVNRTNCHIYAQIISPCG
FT                   GKVLASASTLDTDVRKDLANGGNKAAATTIGKLIAERAKAAGIEQVAFDRSGLQYHGRI
FT                   QALAEAAREGGLKF"
FT   gene            373735..374262
FT                   /locus_tag="Daro_0336"
FT   CDS_pept        373735..374262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0336"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45095"
FT                   /db_xref="GOA:Q47J86"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45095.1"
FT                   /translation="MAKPERNKKPQQAEERDDGMREKMVAVNRVTKVVKGGRILGFAAL
FT                   TVVGDGDGSIGMGKGKSREVPVAVQKAMEEARRKMAKVSLKSGTVHHTVMGRHGATTVM
FT                   IQPAPEGTGIIAGGAMRAVFEVVGVTNVVAKAHGSTNPYNIVRATIDGLSKVNTPAEIA
FT                   AKRGLSVDQIQG"
FT   gene            374266..374448
FT                   /locus_tag="Daro_0337"
FT   CDS_pept        374266..374448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0337"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45096"
FT                   /db_xref="GOA:Q47J85"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45096.1"
FT                   /translation="MADKKIKVTLVKSVIGTKQDHRATVKGLGLRKLNSSSELIDTPAV
FT                   RGMIQKVQYLVKVEG"
FT   gene            374452..374886
FT                   /locus_tag="Daro_0338"
FT   CDS_pept        374452..374886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0338"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45097"
FT                   /db_xref="GOA:Q47J84"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45097.1"
FT                   /translation="MRLNTIKPGEGSKKTAKRVGRGIGSGLGKTCGRGHKGQKSRSGGF
FT                   HKVGFEGGQMPLQRRLPKRGFNSLTRARNYEVRLTDLDRLPVDEIDLLALQVAGIVPGD
FT                   ALSAKVILSGAISRKVVLKGVGATKGAKAAIEAVGGSIAE"
FT   gene            374907..376229
FT                   /locus_tag="Daro_0339"
FT   CDS_pept        374907..376229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0339"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45098"
FT                   /db_xref="GOA:Q47J83"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45098.1"
FT                   /translation="MAANPNTVGKGGKFGDLKRRLWFLLGALVVYRIGAHIPVPGIDPN
FT                   ALADLFNSQKGGILGMFNMFSGGALSRFTIFALGIMPYISASIIMQLMSVASPQLEALK
FT                   KEGEAGRRKITQYTRYGTVILALFQGLGIAVALEAQAGLVNDPGFMFRLTTVSTLLTGT
FT                   MFLMWLGEQITERGLGNGISIIIFAGIAAGLPNAIGGLLELVRTGAMHPLTALIICILV
FT                   VAVTGFVVFVERGQRKILVNYAKRQVGNKIYGGQSSHLPLKLNMSGVIPPIFASSIILF
FT                   PATVANWFGSSESMHWLKDVAGTLSPGQPIYVMLYASAIVFFCFFYTALVFNSKETADN
FT                   LKKSGAFVPGIRPGEQTARYIDKILMRLTLIGAAYITVVCLLPEFLILKWNVPFYFGGT
FT                   SLLIIVVVTMDFMSQVQAYVMSHQYESLLKKANFKGAPMIK"
FT   gene            376238..376456
FT                   /locus_tag="Daro_0340"
FT   CDS_pept        376238..376456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0340"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45099"
FT                   /db_xref="GOA:Q47J82"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45099.1"
FT                   /translation="MAKEDYIEMLGEVVENLPNATFKVRLENGHIVHGFISGKMRMHYI
FT                   RILPGDKVTVQLTPYDLTKARIVFRTK"
FT   gene            376532..376645
FT                   /locus_tag="Daro_0341"
FT   CDS_pept        376532..376645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0341"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45100"
FT                   /db_xref="GOA:Q47J81"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45100.1"
FT                   /translation="MKVQPSVKRICRNCKVIRRKGVVRIICKDPRHKQRQG"
FT   gene            376697..377059
FT                   /locus_tag="Daro_0342"
FT   CDS_pept        376697..377059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0342"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45101"
FT                   /db_xref="GOA:Q47J80"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45101.1"
FT                   /translation="MARIAGVNIPNHQHAEIALTAIFGIGRTRAQKICDAAGVGRNVKM
FT                   KDLSDSDMDRLRDEVGKFTVEGDLRREVTMNIKRLMDLGCYRGLRHRKGLPCRGQRTRT
FT                   NARTRKGPRKAIAGKK"
FT   gene            377072..377461
FT                   /locus_tag="Daro_0343"
FT   CDS_pept        377072..377461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0343"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45102"
FT                   /db_xref="GOA:Q47J79"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45102.1"
FT                   /translation="MAKTATKVRKKVKKNVAEGIAHIHASFNNTIITITDRQGNALSWA
FT                   TSGGAGFRGSRKSTPFAAQVAAEAAGKAAQECGVKNVEVRIKGPGPGRESSVRALNALG
FT                   MKITSISDVTPVPHNGCRPPKKRRI"
FT   gene            377474..378103
FT                   /locus_tag="Daro_0344"
FT   CDS_pept        377474..378103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0344"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45103"
FT                   /db_xref="GOA:Q47J78"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45103.1"
FT                   /translation="MARNLDPKCRQCRREGEKLFLKGEKCFTDKCAIERRSYAPGQHGQ
FT                   KSGARLSDYGVHLRAKQKIRRVYGVLEGQFRKTFAEADRRKGQTGENLLQLLEARLDSV
FT                   AYRMGFGASRSESRQVVRHNGILVNGKRVNIPSFIVKPGDVVQLTDRARASLRCKAALE
FT                   AAESRGFPEWISVDVKEGKGTFKAMPQRSELPATLNEGLVIELYSK"
FT   gene            378127..379101
FT                   /locus_tag="Daro_0345"
FT   CDS_pept        378127..379101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0345"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45104"
FT                   /db_xref="GOA:Q47J77"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45104.1"
FT                   /translation="MQSSGLLKPRIIDVQSVSPVQAKVVMEPFERGYGHTLGNALRRIL
FT                   LSSMVGYAPTEVGIDGVLHEYSTVDGVQEDVVDILLNLKGVVFKLHNRDVVNLKLVKEG
FT                   EGAVRAGDIELPHDVEIINPEHVIAHLSPGGKLAMEIKVEKGRGYVPGNVRNLGDAKTI
FT                   GKLVLDASFSPIRRVAYAVESARVEQRTDLDKLIVDIETNGVVEPEEAIRYAARVLMEQ
FT                   LSVFADLEGTAPVAEASKPAQVDPVLLRPVDDLELTVRSANCLKAENIYYIGDLIQRTE
FT                   NELLKTPNLGRKSLNEIKEVLAARGLTLGMKLENWPPAGLEKA"
FT   gene            379158..379556
FT                   /locus_tag="Daro_0346"
FT   CDS_pept        379158..379556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0346"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45105"
FT                   /db_xref="GOA:Q47J76"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45105.1"
FT                   /translation="MRHRNGLRKLNRTSSHRLAMLRNMTVSLLKHEAIKTTVPKAKELR
FT                   RVVEPIITLGKNPTLANKRLAFDRLRDRDIVVKLFAEIGPRYATRPGGYLRILKCGFRV
FT                   GDNAPMAFVELLDRPEVTEAVEIEDAAE"
FT   gene            complement(379624..381165)
FT                   /locus_tag="Daro_0347"
FT   CDS_pept        complement(379624..381165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0347"
FT                   /product="PAS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45106"
FT                   /db_xref="GOA:Q47J75"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45106.1"
FT                   /translation="MIPIMNKMKVLAVDDNRTNLHILQVFLKKLGHEVVLAENGEEAVR
FT                   RFETDAPDLVLLDIMMPVMDGFEAARRIKAMTRDRWTPVIFLSALNRDENLVEGLDAGA
FT                   DDYLTKPINFVVLEAKLRSMQRSLTMQQQSIDSLRRVQAISDNVLDAIVTTNEEGMIVS
FT                   VNQSTERIFGWSTAELLGQNASLLMPVPASASGDIMLSPGDAARPLPGAGQEQEINARH
FT                   KDGHIFPATISISQVELDNQRMIISVIRDISERKETEQKLRENAQQLQDYYDQTQTEQQ
FT                   LALRLMEKQLHRSGLRDKRLRYKVIPAEHFSGDIVAASRSPDGLLYALLADATGHGLTA
FT                   AISVLPVLALFYRMTKLNRSIQEIVLELNQQLKESMPVGRFVAVTLVCLDEKNRKGEIW
FT                   VGGTPEAFLFDRWGRVASTFPSDNLPLGIVGSNELGGHPRLFSWEPESQLALCSDGLLE
FT                   ATDTEGKQFGNSGLINSASNTSPSDRFAKIETALKEHQNGCAASDDVSLMLIDCP"
FT   gene            complement(381320..383137)
FT                   /locus_tag="Daro_0348"
FT   CDS_pept        complement(381320..383137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0348"
FT                   /product="ABC transporter, transmembrane region:ABC
FT                   transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45107"
FT                   /db_xref="GOA:Q47J74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45107.1"
FT                   /translation="MRRATALPKPPAGQALPQTHVWLTLRTLFPYLWSYRLRVLAAMAC
FT                   LIGAKIANVSVPLIFKEMIDGLSGSQQLLALPILLLVLYGALRFSTSLFTELREILFAR
FT                   VTQRAVRQVSLEVFRHLHALSLRFHLERQTGGVSRDIERGSRSISSLISYTLYSILPTL
FT                   VEIGLVLGILFVKYDVGFVVITVISLIVYIVFTVKVSNWRIDIRRAVNENDSAANTRAI
FT                   DSLLNYETVKYFNNEAWEARRYDEQLIKWEEAATRSQTTLAFLNLGQAAIIALGVTAMM
FT                   WRAASGVVAGEMTIGDLVLVNAFLIQLYIPLNFLGIVYREIRQALTDIERMFNLLKENR
FT                   EIADAPDARELPNSPLQINFETVDFAYDPDRQILKNLSLAIPPGKTVAVVGHSGAGKST
FT                   LARLLYRFYDVTGGAIRINGHDLRALKQSSLRAAIGIVPQDTVLFNDSIFYNINYGRPE
FT                   ASREEVFAAARAAQLHEFIESLPQKYETRVGERGLKLSGGEKQRVAIARALLKNPPILI
FT                   FDEATSALDSATERAIQTQLEQVAVGHTTLIIAHRLSTVMNADEILVMSEGHIIERGSH
FT                   AALLAAGATYARMWTLQQQEEHEHPARHG"
FT   gene            383179..383634
FT                   /locus_tag="Daro_0349"
FT   CDS_pept        383179..383634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0349"
FT                   /product="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45108"
FT                   /db_xref="GOA:Q47J73"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45108.1"
FT                   /translation="MKTAAFPGKSGNNSQSGLTMTIDPLVLPNKHCTLRVVPMPADLNQ
FT                   NGDVFGGWVMAQVDVAGAIPAMRRACGRVATVSVNSFLFKQPVSVGDIVSLYADIVRVG
FT                   TTSITVRVEVYAERNYAAPIIVKVTEAELTYVAIDGAGMKRNVPTEK"
FT   gene            383695..384900
FT                   /locus_tag="Daro_0350"
FT   CDS_pept        383695..384900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0350"
FT                   /product="Membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45109"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45109.1"
FT                   /translation="MNKMNLRIVPALLLAIFSGTASAAAFQLWEQNASGLGNAYAGSAA
FT                   VADNASTVFFNPAGMTQLSGFQFSAGVTGVGPSYEFRDNGSTGAFKGSGNGGDAGGWNA
FT                   VPNLYLSGHLTDNLSIGFGVSAPFGLATEYDSNWVGRVQAIKSEIKTVNYNPSLAYRVN
FT                   DKVSLGFGINYQQLDAEITSYTPAGLYRVKGDDSTWGWNAGALFTLSPAMRVGVSYRSA
FT                   VNYTLEGTRSVGANSVAAKADIKLPDTFILSVWQQVSDRWEAMGDLSYTRWSTLDRLDV
FT                   RSSAGVDTEIFNYENSWRLAWGAAYKASDALKVKFGIAYDRTPVRDEYRSARVPDNDRL
FT                   WLSLGGQWNAGRYGKVDVGYSYLYVKDPSIQQSKVVGVAHELRGDYNASAHIVGAQYSV
FT                   GF"
FT   sig_peptide     383695..383766
FT                   /locus_tag="Daro_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.973 at
FT                   residue 24"
FT   gene            384922..385437
FT                   /locus_tag="Daro_0351"
FT   CDS_pept        384922..385437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45110"
FT                   /db_xref="GOA:Q47J71"
FT                   /db_xref="InterPro:IPR021244"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45110.1"
FT                   /translation="MPALELGGMTLGLREGVIMLIALVAVYMLFVLFRMRRLRNKPIET
FT                   PVASSERLAPEAQSVSPLTAAMADGDESWEKTPAGLGEEILRQGLERDLVQLRDEVDAM
FT                   RGELAALREDMLQELAHLRASQTVSPIYGDAMQMAVSGYDPVAIAERCGIARAEAELVV
FT                   ALAKSQER"
FT   gene            385446..386243
FT                   /locus_tag="Daro_0352"
FT   CDS_pept        385446..386243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0352"
FT                   /product="Sporulation related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45111"
FT                   /db_xref="GOA:Q47J70"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45111.1"
FT                   /translation="MADQPEVSENEEHARELRGKLIARLAVAGVLVALLLGVLAFFDYL
FT                   ANPPDEADQQVFTQPVPVAPKKEVSQPVTPAENLPEPPVPEKVEAPAEAPPPPTVDAPA
FT                   SAVVEAKPEAHVAAKLPAANVKPAVSVPPPPAPQAVPEATTAPSNRLAPQRAATPAEAA
FT                   PAKPSVRIIEAKPAPAPAPAPAVVPPSAPRLFSGFLLQAGVFSSTQRAEELHARLTLSG
FT                   VPSTLETRVQVGPFRTRHEAELAQAKLKELGVEAILVPPRGKN"
FT   gene            complement(386248..386565)
FT                   /locus_tag="Daro_0353"
FT   CDS_pept        complement(386248..386565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45112"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45112.1"
FT                   /translation="MKLSPTLIRLSLATALLGSLGACTVVPAYPVGYHRAPPVYVESYP
FT                   AYGYGYPRANIYYESDRRHYDDRGGRYYDNQRYEMPLPPPLQLHRDVRRSLGLPRLPGM
FT                   P"
FT   sig_peptide     complement(386491..386565)
FT                   /locus_tag="Daro_0353"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.835 at
FT                   residue 25"
FT   gene            complement(386699..387025)
FT                   /locus_tag="Daro_0354"
FT   CDS_pept        complement(386699..387025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0354"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45113"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45113.1"
FT                   /translation="MNPRIESLEKMLGGPRDGALLRFSLGNEYLKAGDPAKAAVSFKDA
FT                   VDRDPQYSAAWKALGKARAEAGDNIGCLAAYEQGIAVAEAKGDIQAAREMTVFANRVRK
FT                   ALAD"
FT   gene            387078..387461
FT                   /locus_tag="Daro_0355"
FT   CDS_pept        387078..387461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0355"
FT                   /product="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45114"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45114.1"
FT                   /translation="MAKTIIATPNAPAAIGTYSQAVRVGDTVYMSGQIGLDPASMQMVD
FT                   GIDAQIVRVFDNLKAVAEAAGGSLADVVKLNVFLTDLANFAKVNETMAKYFSEPFPARA
FT                   AVGVKELPRGALVEADAVMVIGN"
FT   gene            387480..389531
FT                   /locus_tag="Daro_0356"
FT   CDS_pept        387480..389531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0356"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45115"
FT                   /db_xref="GOA:Q47J66"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45115.1"
FT                   /translation="MTTSGASAPASPPIRASEALQKKLAKIGLHSEADLLVHLPLRYED
FT                   ETRITPVKRAFGGEAVQIEVVVQSNEVQFRPRRQMIVRAADDSGEITLRFFSFYPSQQA
FT                   ALSEGSRLRAFGEVRGGFFGAEMVHPRFRKVGGDEALPTEMTPIYPSTAGLANSALQKL
FT                   IGKALAVGDLSDTLPETLRQRLKLPGLARSLNFLHRPPPGTDLDTLHARNHPAWRRVKF
FT                   DEVLAQQLSLRRAYLARREQGAPVLVAQDDLGARLLDQLPFGLTGAQLRAMAEIADDLA
FT                   QPYPMQRLLQGDVGAGKTIVAALAACQAISAGWQAAFMAPTEILAEQHYLKLKDWLEPL
FT                   GVKVAWLSGSLKTKAKREQLAATAAEAQLVVGTHALIQDGVDFARLGLAIVDEQHRFGV
FT                   AQRLALRKKGNNPHQLMMSATPIPRTLAMSYYADLDVTVLDELPPGRTPIKTRLVADNR
FT                   REDVVGFVKKSVEEGRQAYWVCPLIEESEALQLQTAQDTYEQLSIDLPELVIGLVHGRL
FT                   KADEKQAVMAAFAAGDIDVLVATTVIEVGVDVPNASLMVIEHAERFGLSQLHQLRGRVG
FT                   RGKYESSCVLIYAGPLGEIARQRLKIIFENTDGFEIARQDLQIRGPGEFVGARQSGVPL
FT                   LRYADLEMDADLVEMARDVAEEMLTEHLELAERHLKRWLGSREELLKS"
FT   gene            complement(389521..390381)
FT                   /locus_tag="Daro_0357"
FT   CDS_pept        complement(389521..390381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0357"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45116"
FT                   /db_xref="GOA:Q47J65"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45116.1"
FT                   /translation="MELVALRTFQTVVEEGGILAASRKLNTVQSNVTGRIRRLEEELGT
FT                   ELFFRKGRGLELAPSGKVLLDYARRMLMLERQTSAAVRQVGESAGELRIGAMETFAALH
FT                   LPSALKAVRSEHPGLELRVFTDTTSTLMDKVLDHKLDCAFVAGPVIHPDLQFDELVVEE
FT                   LVQVHAAGTDPVLLPLILFREGCAYRTRAIAWQRAQGHAVADAMEFGTLEGILGCVAVG
FT                   LGWTLMPRRVAEQSSHAADLVIETVPDEFSRVPTGMIHLREAAPMAALKTLCDGITASA
FT                   NRIRT"
FT   gene            390481..391683
FT                   /locus_tag="Daro_0358"
FT   CDS_pept        390481..391683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0358"
FT                   /product="Protein of unknown function DUF1228:Major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45117"
FT                   /db_xref="GOA:Q47J64"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45117.1"
FT                   /translation="MNSQRERLKVLSAGIFSLLLTFGVARFAYTPLLPIMQQQAGLGLA
FT                   EAGWLAALNYAGYLSGALIASLISNLVLKDKLYRIGLVVAILSTVMMGLTTDPLLWMAS
FT                   RFIAGLSSAAGMLLGTGLILNWLIRHNHRPELGIHFAGIGLGISGCAVAVWLMGGWLDW
FT                   REQWFAFSAIACLLIVPAMAWLPAPDTSPVTKSGVTMHDNPPSPLFLRIFMAAYFCAGF
FT                   GYVISATFIVAIVNGLPGLAGQGGLAFLAIGLAAAPAAFNWDLIARYTGDINALILAAV
FT                   LQIFGIVLPVAVGGLIPTIFGALLFGGTFIGMVSLVLTMAGRYYPTKPAKMMGKMTLSY
FT                   GVAQIIGPAIVGWLATRLGNYSIGLYIAAGVMVMGVVLLVILKLVEKRDATLALEPSLQ
FT                   N"
FT   sig_peptide     390481..390567
FT                   /locus_tag="Daro_0358"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            391698..392681
FT                   /locus_tag="Daro_0359"
FT   CDS_pept        391698..392681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0359"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45118"
FT                   /db_xref="GOA:Q47J63"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45118.1"
FT                   /translation="MFKGILIEKDDAGYRAAVKDIDESQLPEGDVTVRVAMSSLNYKDG
FT                   LAITGKGPVVRKFPMVPGIDIAGTVETSSHADYKAGDRVVLNGWGVGETHWGGLAQKAR
FT                   LKGDWLVPLPAAFSEKQAVAIGTAGYTAMLCVLALERQGVKPADGEIVVTGAAGGVGSV
FT                   AIAVLAKLGYTVVAVSGRPEETDYLKQLGAAEVLDRAAFSSPGKPLGKERWAGAVDVVG
FT                   SHTLANICATTKYRGVVTACGLAGGMDFPSSVAPFILRGVTLVGVDSVMCPRPERLVAW
FT                   QRLATDLDVAKLGLITHEVSLAEAIPTAAQLMDGKVRGRVVVDVNR"
FT   gene            392693..392896
FT                   /locus_tag="Daro_0360"
FT   CDS_pept        392693..392896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0360"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45119"
FT                   /db_xref="GOA:Q47J62"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45119.1"
FT                   /translation="MPYVNIKITREGATPEQKARLIAGATQLLVDVLGKNPKTTVVVID
FT                   EVDTDNWGVGGESITVRRARGE"
FT   gene            392981..394048
FT                   /locus_tag="Daro_0361"
FT   CDS_pept        392981..394048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0361"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45120"
FT                   /db_xref="GOA:Q47J61"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45120.1"
FT                   /translation="MSHLFDPLKLRDITLKNRIGIPPMCQYSAQDGMAADWHFVHYGSR
FT                   AVGGAGLMIVEATAVVPEGRISPGDLGLWKDEQIEPLAKIARFAREQGCVAAIQLAHAG
FT                   RKASVGLGWGEQRTLRADEGGWQSVAPSAISFGEGYAVPHELSIAGIAEVVAAFVAAAR
FT                   RAVVAGFQAIEIHAAHGYLMHQFLSPLSNQRTDAYGGSFENRTRLLREVVTAVRAVWPE
FT                   SLPLLIRLSATDWVEGGWSADETVALCRDLKTLGVDLADISTAGLVPTAKIPVGPGFQT
FT                   EFAARVRHEAGLPTAAVGLITSAAQADHVLRTGQADMVLLGREILRNPYWPQQAAQELR
FT                   QGGAWPNQYLRAALR"
FT   gene            394045..394611
FT                   /locus_tag="Daro_0362"
FT   CDS_pept        394045..394611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0362"
FT                   /product="Protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45121"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45121.1"
FT                   /translation="MSAPNTRRSLGKELAAAAAAYQTADVIPHCAVCAKPCCKLDTLVL
FT                   ELEWKQIKSFWRLEESRPGFDKRLSSGQGPVEIRAGDDGLYYVHSKPCPAYDEAGHACT
FT                   IYGQELKPLGCSDFPVYEDQGSVVADLRCEAVNLEALTAWMARSVGPEFRIIQAADREF
FT                   PFLVTLSVRRVSGAASPNKRPRHRG"
FT   gene            complement(394966..395853)
FT                   /locus_tag="Daro_0363"
FT   CDS_pept        complement(394966..395853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0363"
FT                   /product="Alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45122"
FT                   /db_xref="GOA:Q47J59"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45122.1"
FT                   /translation="MLPSRSEYLDLPDIRLHIRRWGNPKAPTLFLLHGWMDVSASFQFV
FT                   VDELQKDWNIIAPDWRGFGSSEWLNRPYFFAEHLGDLEAILDRYAPEGKVKLVGHSMGG
FT                   ILACLYAGIRPERVESVISLEGFGIAPTTPDMATERYQKWLGVLKSPPRMHLYSDRAGF
FT                   ARRLMHTDRFLTQERANFLSRHLARIGDGETRSGERRHGIIWNGDPWHKAPAPYLFRLE
FT                   ESMAIWRQITCPVLWVAGRQSWVIREFDTRPGDWAARQACFADVREAWVDNADHMLHHD
FT                   QPEEVARIVETFIA"
FT   gene            complement(395978..397291)
FT                   /locus_tag="Daro_0364"
FT   CDS_pept        complement(395978..397291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0364"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45123"
FT                   /db_xref="GOA:Q47J58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45123.1"
FT                   /translation="MEALRIITEEHQNLWRIATTLDMVADEIDGGGHVETAFFTSLFDY
FT                   IDQFMDRAHHAKEDSYLFPSLLRRAPEAAAIIERLQAEHHNGPEVLRDLRAKLAATAAG
FT                   SEANATFTAALRSYAQAVKSHVRSEEKDVMPLAREALTADDWADIDKAFLDNDDPLFGS
FT                   KARAEFREIFHRIVNLAPEPIGLGGHSGGALQKPIAPVGDVLLKIEGMESCYGRIKALK
FT                   GIDLEVRQGELVALVGANGAGKTTFLRTLSGVQPMSAGRIIFNREDISGLRSDLRMRRG
FT                   ICQSPEGRQVFGPLAIEDNLRLGAYTRPKNDVEGDLERVYSMFPILKEKRHLPAGTLSG
FT                   GQQQMLAIGRALMGRPKMLLLDEPSMGLAPLLVEEVFNVVKALKAQGMTIFLVEQNAFA
FT                   ALAIADRGYVLETGNITLTGTGQELISNEQVRAAYLGM"
FT   gene            complement(397305..398066)
FT                   /locus_tag="Daro_0365"
FT   CDS_pept        complement(397305..398066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0365"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45124"
FT                   /db_xref="GOA:Q47J57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45124.1"
FT                   /translation="MSMLEVKDLSIHFGGVKAVQNVSFNIDSGIVYSVIGPNGAGKTTL
FT                   FNLITGVYKPTTGEIRLDGEAIHGKSPNELATRGVARTFQNLQICMNMSAVENVMVGAH
FT                   LRLDRNLFKAALRFPGLKKRDRELRAEAAELMAFVGLEQYVETRADAMSYGALKRLEIA
FT                   RALAMKPRLIFLDEPAAGLNPKETIEVDHLIRKIADAGVTVVLVEHDMKMVMNLSDRIL
FT                   VLDYGKKLAEGTGEEIRKNPDVIAAYLGAHA"
FT   gene            complement(398070..399002)
FT                   /locus_tag="Daro_0366"
FT   CDS_pept        complement(398070..399002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0366"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45125"
FT                   /db_xref="GOA:Q47J56"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45125.1"
FT                   /translation="MKKSVYNGLYVVIAILLVLPFVMPNSFYLDLAVRMAINAVIVLGL
FT                   NLLIGFAGQISLGHAGFLGIGAYASAVLPTHFGWHPLLAMGAGAVATGILAAVVARPIF
FT                   KLKGNYLAMATLGLGIIISIALRNEAQWTGGPDGMPVPAMGLFGFELSNDKQWYWVVAL
FT                   LLSVSVWASLNLIDSPFGRALRALHGSEVASQVVGVDVVRYKVAIFVLSAVFASLMGSV
FT                   TAHYVGFVSPNFADFFHSIELVTMVVIGGMASVYGSLVGAVLLTALPQALATFEGWETV
FT                   VFGAILMLSMIFLPKGLVPTLAAKFGKGE"
FT   gene            complement(399005..399880)
FT                   /locus_tag="Daro_0367"
FT   CDS_pept        complement(399005..399880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0367"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45126"
FT                   /db_xref="GOA:Q47J55"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45126.1"
FT                   /translation="MLAQFLQFLFSGITVGATYALAALGFTLIYNASNVINFAQGEFIM
FT                   LGGMLAVFFTQAGLPLPVALVLAILIPAIVGVIIEKLAIEPVKGAETVTLIIITIGASL
FT                   VIRGLTAVIFGKNTHSLPAFSGETPIDILGATLMPQSLWVLGITALVVVVLWYYFNRTL
FT                   QGKAMLATSYNRLAAELVGINTGWVLFMSFAMSAALGALGGILITPITLTSYDVGIMLG
FT                   LKGFVAAVLGGLGNGLGAVVGGLLVGILEAMGAGYISSAYKDAIPFVLILFILFFMPRG
FT                   LFGGKSTDRV"
FT   sig_peptide     complement(399812..399880)
FT                   /locus_tag="Daro_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.892 at
FT                   residue 23"
FT   gene            complement(399946..400995)
FT                   /locus_tag="Daro_0368"
FT   CDS_pept        complement(399946..400995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0368"
FT                   /product="Ferredoxin:Oxidoreductase
FT                   FAD/NAD(P)-binding:Oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45127"
FT                   /db_xref="GOA:Q47J54"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45127.1"
FT                   /translation="MARIIMQPSGKSVDCAYGDTVLMALEKAGYALPNNCRAGACGECK
FT                   VKVTQGQFDQGMVLDMALSQDERKQGFGLMCMAKPISEELTIEWGTEDAKPKLFPPRED
FT                   ALFVVTDKKQIAARVVELRLRPVGQPIRYWPGQYVTLGNPRADIPARAYSISNAPRPDG
FT                   ELVLQVARADSGVTSNWVHDTLQAGDNVKVSGAYGTFIGDPSVDTPVLCIAAGTGLAPV
FT                   LALAEAALRRGFKKPVTMLFSARTKEDVYSQGMMAWWRTKHRNFDYKVTLTREEADGFL
FT                   KGRVDVVLPQLFKDLSKHTIFIAGSPEFVDSCVAAAKAQGALDELIHTEGFFAQQQPVV
FT                   ADADHLLPL"
FT   gene            complement(401092..402120)
FT                   /locus_tag="Daro_0369"
FT   CDS_pept        complement(401092..402120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45128"
FT                   /db_xref="GOA:Q47J53"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45128.1"
FT                   /translation="MASHKERFADKMEFPPEIQQPNIYPLSWNSKTKKLQEVWEASLRE
FT                   NWDPEKLPWDTLDVDSYTWEERESIAYWWSLLSVFDASAPPVFAEALIKTYEVHEEDPV
FT                   RKCFFSVTRDEQNHEIMCGLAITKMLGHPDPITYEPKTDLGRRLQKNVKWLYFNGSRYW
FT                   TGYKQAVPKYDLAVLFSSFLMGEIAAATIFKQMFDNSREAVFKEGFKNIGRDEGRHMAI
FT                   CMAVMERDYPGLKEETKAIVTKQIRAGYLFLSAVLFEPPMEFWDLPEDFIANQREGEEV
FT                   ARGAGFGIPSYEAKLENWKNAMINLKGVLDRYNIPFPAIPEVGITGQEVSEIDMEDIIP
FT                   VF"
FT   gene            402501..404165
FT                   /locus_tag="Daro_0370"
FT   CDS_pept        402501..404165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0370"
FT                   /product="Phenylacetic acid degradation protein paaN2"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45129"
FT                   /db_xref="GOA:Q47J52"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45129.1"
FT                   /translation="MSHPLLDKHRATLDGALNAIATRAYWSAYNEMPSPKTYGETAAED
FT                   GKKAFEAHLGKQFDLGQPGATGWAGGEQSPYGIDLNVQYPVCNYETLIAAGQQAMGGWQ
FT                   KIGADGRTGICLEILARLNQQSFELAHAVMMTTGQGWMMAFQAGSPHAQDRGLEAVAYA
FT                   YREQSFVPAETTWDKPQGKNPPLVMKKHFEIVGHGVGVVVGCGTFPTWNTYPGLFAALS
FT                   TGNAVIVKPHSNAILPAAITVRTIRAVLAENGIDPNLVTLCVADRAATQKLVTHKAVKS
FT                   IDFTGGNVFGQWLIDNCRQARVYAELAGVNNIVIDSTDAYKPMLRNLAFTLSLYSGQMC
FT                   TTSQAIFVPAAGIETEDGHKSYDDVCADLARAVSGFLSKPEVALAVLGAMQSADTIKRI
FT                   DMADSGTLGKVVLASTKLDNPEFPKAAVRTPVLLACDAADEHAYMEERFGPISFIVKVA
FT                   DTAAAIALSERIVSTHGALTAGIYSTKPEVIDAMTAATMRAKVALSINLTSGVFVNQSA
FT                   AYSDYHGTGGNPAANASYADAAFVANRFVVVQRRYHI"
FT   gene            404296..405090
FT                   /locus_tag="Daro_0371"
FT   CDS_pept        404296..405090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0371"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45130"
FT                   /db_xref="GOA:Q47J51"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR011968"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45130.1"
FT                   /translation="MNFENITFTVEAGIARLTLNRPDKLNSFTGEMHAELRTALDRVQS
FT                   DHSIRVLVLTGAGRAFCAGQDLADPDMAKIDGKMPDIGNVVDRNYKPLVMRLQNLRVPT
FT                   IAAVNGIAAGAGASVALACDLVVATKSACFLQAFSKIGLIPDTGGTWFLPQRVGMARAM
FT                   GLALLADKLPAEKAAAWGLIWECTEDADFAARIDALAKQLSVMPTKALVRTRQAMHAAP
FT                   GHTLEQQLSFEGSFMRELGWSPDYAEGVAAFMEKRAPKFTGE"
FT   gene            405065..406624
FT                   /locus_tag="Daro_0372"
FT   CDS_pept        405065..406624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0372"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45131"
FT                   /db_xref="GOA:Q47J50"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011967"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45131.1"
FT                   /translation="MRRNSPESERVTKQPLPQQAVIAVVGTGAMGAGIAQVAAAAGHPV
FT                   KLLDNRPGAADKAVAGIRAQFAKLAEKGKLTTEAAQAAGERLSAVEQLADLADAALVVE
FT                   AIVENLDAKQKLYADLEAIVGADCIFGTNTSSISVTAIGAALKHPERLAGLHFFNPAPL
FT                   MALVEIVSGLATDKAVADTLFSTANAWGKTAVHAKSTPGFIVNRVARPYYAEALRVAQE
FT                   GAADYATIDACCREAGGFRMGPFELMDMIGHDVNFAVTNSVWRAFYNDQRFLPSLIQQE
FT                   LVDAGFYGRKSGRGFYDYREGAVKPEPQTEAAQTPAGKITVFGESDLAELLVERLQHSA
FT                   LSYNRAPDSDGRIAEIGFAKLYVTDGRSATQRAAETGVANTVLIDLALDYSKATRLAIA
FT                   AAEQCEPAAVASAVGLLQATGFAVSRFLDVPGLIVMRTVAMLANEAADAVNQGVCSEAG
FT                   ADQAMRLGVNYPQGPLAWADQVGVAAIRDVLANLGASYGEDRYRISPLIQRAVFAGRNI
FT                   HD"
FT   gene            406617..407087
FT                   /locus_tag="Daro_0373"
FT   CDS_pept        406617..407087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0373"
FT                   /product="Phenylacetic acid degradation-related
FT                   protein:Phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45132"
FT                   /db_xref="GOA:Q47J49"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45132.1"
FT                   /translation="MTEHKLSPAEAQALAEATADAMYSRDRAAQALGIKIVRVQPGASL
FT                   LTMSVRGDMVNGHHICHGGMIFSLADTAFAYACNAYNKTTVASACHIDFLAPAKEGELL
FT                   EAEAVEQSASGRTGVYDITVRTSGGKTVALFRGKSYRISGEVIAGLQQADQA"
FT   gene            407112..408437
FT                   /locus_tag="Daro_0374"
FT   CDS_pept        407112..408437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0374"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45133"
FT                   /db_xref="GOA:Q47J48"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45133.1"
FT                   /translation="MTVKKPLPGDLEPIETASREEISALQLDRLKWSVRHTYDNVEPYR
FT                   KKCLEKGVHPDDLKTLADISKFPFMTKLDLRDNYPFGLFAVPRDKVARLHASSGTTGKS
FT                   VVVGYTKKDIENWSDLIARSLRAAGVRAGDMVHNAYGYGMFTGGLGAHYGIERLGCTAV
FT                   PMSGGQTEKQVQQIMDFKPDAIMVTPSYSLVIAEEFERLGIKPEDIPLKVGIFGAEPWG
FT                   EGMRAEIERKLGIDAIDIYGLTEVMGPGVACECIETKDGPVIWEDHFYPEIIDPETGEV
FT                   LPDGELGELVFTSLTKEAFPVIRYRTRDLTRLLPPTARSFRRIGKITGRSDDMLIIRGV
FT                   NVFPTQIEEQILRDKRLAGTYQILVTRDGHLDNVEVRCELQSELSGKLSPSEIQAISKE
FT                   LQHHIKTIIGISTRITVMEHDSIPRTLTGKAKRVLDERPKQN"
FT   gene            408448..409653
FT                   /locus_tag="Daro_0375"
FT   CDS_pept        408448..409653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0375"
FT                   /product="Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45134"
FT                   /db_xref="GOA:Q47J47"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45134.1"
FT                   /translation="MNEAFICDAIRTPIGRYGGALAGVRADDLGAIPLKALMERNPQVD
FT                   WTAVEDIIYGCANQAGEDNRNVARMSGLLAGLPIEVPGTTINRLCGSGMDAIGMAARSI
FT                   KSGETELMIAGGVESMSRAPFVMGKAESAYSRSAAIYDTTIGWRFPNPAMKKLYDTHSM
FT                   PQTADNVAADFAIGRADQDAFAVRSQQRWAAANAAGRFKDEIVPVVIPKKKGDPVVVDT
FT                   DEHPRPETTLDMLAKLKGVNGPELSVTAGNASGVNDGACALLLASGAAASQYGLQPLAR
FT                   VVGMATAGVLPRIMGFGPAPAVRKVLAKTGLTLAQMDVIELNEAFAAQGLAVLRDLGLA
FT                   DDAAHVNPNGGAIAMGHPLGMSGARLVTTAAYELKRRGGRYALCTMCIGVGQGIAMVIE
FT                   RV"
FT   gene            409681..410826
FT                   /locus_tag="Daro_0376"
FT   CDS_pept        409681..410826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0376"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45135"
FT                   /db_xref="GOA:Q47J46"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45135.1"
FT                   /translation="MKHSMKKLVVAAALTFGAFGAFAADPIKIGSVLSVTGPAAFLGDP
FT                   ELKTLQLYVDDINKKGGVLGRQLQLVHYDDGSDANKANGFAKRLLEDDKVDVLVGGTTT
FT                   GSTMSMVPLAEKSGTPFVSLAGAVVIVEPVKKFVFKTPHTDRMAAEKVFEDMKKRGLTK
FT                   VALLSETSGFGASGKKETEGVAGKYGITLVANETYGPKDTDMSPQLTKIKTTPGVQAVF
FT                   VFGLGQGPAIVTKNYKQLGVTLPLYQSHGVASDEFLKLAGPAAEGVRLPSPAQLIPEKL
FT                   AAKDPQKPVVTSYEQTYKAAYKADVSTFGGYAYDGLMLAVDAIKRAGGTDKAKVRDALE
FT                   ATKGFVGTSGTFNMSATDHMGLDLSAFRMLEVKGGDWSIVQ"
FT   sig_peptide     409681..409752
FT                   /locus_tag="Daro_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            410915..411928
FT                   /locus_tag="Daro_0377"
FT   CDS_pept        410915..411928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0377"
FT                   /product="Phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45136"
FT                   /db_xref="GOA:Q47J45"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45136.1"
FT                   /translation="MYTQSFNVPDAPGGKAVAPVPSKEDPALQAAFDTRIDADGRIEPQ
FT                   DWMPDAYRKTLVRQISQHAHSEIVGMLPEGNWISRAPSLKRKAILIAKVQDEGGHGLYL
FT                   YSAAETLGTSRDQMLEGLHSGRAKYSSIFNYPTLTWADVGVIGWLVDGAAIMNQIPLCR
FT                   CSYGPYARAMVRVCKEESFHQRQGYEALLVMMTGTAEQKAMVQDAVNRFWWKCLAMFGP
FT                   PDADSPNSVQGMRWGIKRISNDDLRQKFVDATVPQAKVLGVTLPDPDLKWNEERQHHDY
FT                   GQIDWNEFWETVNGNGPCNKERLATRVKAHNDGQWVRDAALAHANKQQARKMKEAA"
FT   gene            411925..412218
FT                   /locus_tag="Daro_0378"
FT   CDS_pept        411925..412218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0378"
FT                   /product="Phenylacetic acid degradation B"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45137"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45137.1"
FT                   /translation="MTTELKEWPLWEIFIRSKQGLEHKHCGSLHAADARQALEMARDVY
FT                   TRRQEGVSIWVVESKAITASNPDEKGELFDPAADKIYRHPTFYEIPDEVGHM"
FT   gene            412218..413000
FT                   /locus_tag="Daro_0379"
FT   CDS_pept        412218..413000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0379"
FT                   /product="Phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45138"
FT                   /db_xref="GOA:Q47J43"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45138.1"
FT                   /translation="MSAAIDYLLHLADNALVLGQRNAEWCGHGPILEEDIALSNVSLDL
FT                   IGQARMLYQLVAQLKGGDATEDKLAYFRDTGEFRNYTLLELPHHGPLSGYAHSSLDYGT
FT                   TIVRNFLYSALMALLWEALAKSNNADLAAIAAKSLKEVRYHLRHSRDWLVRLGDGTEES
FT                   HARVQASLDHLMPYTQEFWAHSPAEAAAVKDGIAVDLNTLKADWDGIVDAALEEATLQR
FT                   PKAGGYVSDGKNGVHSEHLGFLLAEMQSLARAHPNGVW"
FT   gene            413004..413504
FT                   /locus_tag="Daro_0380"
FT   CDS_pept        413004..413504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0380"
FT                   /product="Phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45139"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45139.1"
FT                   /translation="MSANVDAAWAALEYLADPEIPVISLRELGILRDIRVGADGLEVVI
FT                   TPTYSGCPAMSQIEDDVRSTLLAKGISARVVTQLAPAWTTDWMSETGKEKLRAYGIAPP
FT                   HQTPAGSNVVRFISKPAKVETVPCPHCGSAHTVESSHFGSTACKALYKCLDCQEPFDYF
FT                   KPY"
FT   gene            413527..414624
FT                   /locus_tag="Daro_0381"
FT   CDS_pept        413527..414624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0381"
FT                   /product="Ferredoxin:Oxidoreductase
FT                   FAD/NAD(P)-binding:Oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45140"
FT                   /db_xref="GOA:Q47J41"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45140.1"
FT                   /translation="MSALRFHELTIKRVSPEAAGSVAITFNIPDAEREAFSFQPGQFLT
FT                   LRAKVDGQDVRRSYSISSPRSRLAKAGELEIGIRPVEGGVFSNWAAQTLKAGAKLDVMP
FT                   PDGRFVVKKQRAIHRVGFAAGSGITPILSIAATTLEEQPEAKFTLVYGNRRMSSVMFNE
FT                   SLQDLKDRYPDRLTLIHILSRQAQEVDLLQGRIDGAKVQAVIDALLPVKSMDEVFICGP
FT                   EAMIEATEKALIEAGVPESRVYTERFTSGPAQAAKIQADTDAAPTRVAAAKDIALTVVL
FT                   DGKEHELQIGPDEHVLDAAMNAGLDLPFSCKAGVCCTCRAKVLCGEVVMDKNYTLEGDE
FT                   MAQGFVLSCQARATTKRLVVSFDER"
FT   gene            414698..415471
FT                   /locus_tag="Daro_0382"
FT   CDS_pept        414698..415471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0382"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45141"
FT                   /db_xref="GOA:Q47J40"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45141.1"
FT                   /translation="MTQVVLTEVIGKVGLIRINRPEAMNALNNDVVDGIGAAIDIYEAD
FT                   ENIGCIVITGNEKAFAAGADIGFMKDFDYMHAYKTDFITRNWERIKTTRKPVIAAVSGF
FT                   ALGGGCEMAMMCDMIFAADTAKFGQPEIRLGTMPGAGGTQRLPRAVGKAKAMDMCLTAR
FT                   MMDAAEAEKAGLVARIIPAEQLLDETLKAAQTIAGYSLPVVMMIKESVNRAYESSLNEG
FT                   LLFERRVFHSAFALEDQKEGMAAFVEKRKPVFKNR"
FT   gene            415483..416262
FT                   /locus_tag="Daro_0383"
FT   CDS_pept        415483..416262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0383"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45142"
FT                   /db_xref="GOA:Q47J39"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45142.1"
FT                   /translation="MYETLEIERAGKVATIWMNRPAVFNAFDEQLIAELAAACKELDAD
FT                   ASVRIVVLGGRGKHFSAGADLNWMKRASQFTHEQNVEDARKFAGMLRTLSEMSKPTIAR
FT                   VQGAALGGGTGLTAACDMAVASSDAVFSTSEVKFGIIPSAISPYVLRAIGPRHAMRYFQ
FT                   SAERIKASRALAIGLVGDVVELDELDACVDQLVEALLQGGPLAQKAAKDLIGAVNGQPI
FT                   DATISEETAQRIARQRATDEAKDGIAAFLDKRPPAWL"
FT   gene            complement(416303..417100)
FT                   /locus_tag="Daro_0384"
FT   CDS_pept        complement(416303..417100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0384"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45143"
FT                   /db_xref="GOA:Q47J38"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45143.1"
FT                   /translation="MSEELEGKHGVQSLEVGMSILRAMANGQRSMMLKDIAAAADMPAS
FT                   KAHRYLVSLIRAGLVDQDPMTSRYDLGTFALNLGLVALDRLDRVRLGLSAIAELRDEIN
FT                   QTTALAVWGDGGPVVIRWERPRRPITVNVTTGTALDLLMSAAGRVFAAWMPKKITAPLL
FT                   AEELKHAPLPPDLKSKAAVEALLAEIRAQGYAATNGQHKVAGVEAAAAPIFNFKNEITM
FT                   AVLVVGVQGMLDTSPEGNVIQSLKHCAETLSQRLGAHGEPKQP"
FT   gene            417174..417785
FT                   /locus_tag="Daro_0385"
FT   CDS_pept        417174..417785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0385"
FT                   /product="Phenylacetic acid degradation protein PaaY"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45144"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011974"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45144.1"
FT                   /translation="MSKLRVYSIDGIVPVVDPTAYVHPSAVLIGDVIVGTDCYVGPCAS
FT                   LRGDFGRLILEAGANLQDTCVMHGFPGTDTVVEENGHIGHGAVLHGCRIKKNALIGMNA
FT                   VIMDNAVIGEASIVAASAFVKASQEIPPGVLVAGVPAKVIRPLSEQEMAWKSDGTRTYQ
FT                   ELTRRCLATMVETTPLTAVEADRKRIEMPDVVPLTELKNR"
FT   gene            complement(417912..418970)
FT                   /locus_tag="Daro_0386"
FT   CDS_pept        complement(417912..418970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0386"
FT                   /product="Phenylacetic acid degradation operon negative
FT                   regulatory protein paaX"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45145"
FT                   /db_xref="GOA:Q47J36"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45145.1"
FT                   /translation="MLNTGIQNDTRHQVQSKSSTGRHRSEPFPQRPSPAYLVSTAIQSR
FT                   LNEFRQQRRVQAGSLIITVFGDAILPRGGRIWLGSLIRLLEPLELNERLIRTSVFRLVK
FT                   EEWLRTETIGRRADYVLTPSGRRRFEEASRHIYASDAPLWDRRWRLILVVGDLDPKLRE
FT                   QVRRALFWQGFGALGADCFVHPSAELSSVLDTLITEGLSSAIGALMPLFAADSRSAQSA
FT                   SDADLVHRAWDLGHLAEAYSAFVATYQPILDELRRDHLAGVSEQDAFLLRILLIHDYRR
FT                   LLLRDPELPEVLLPANWPGQQSRLLCKELYKRLEPLASRHLDQQLCLADGRVPEEDLSL
FT                   PERFPQNDPLSA"
FT   gene            complement(419183..419641)
FT                   /locus_tag="Daro_0387"
FT   CDS_pept        complement(419183..419641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45146"
FT                   /db_xref="InterPro:IPR016596"
FT                   /db_xref="InterPro:IPR022548"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45146.1"
FT                   /translation="MFKKIASVAIFAAFITGCASVPMESKEASDQAKRFPAPSQGQAGL
FT                   YIYRSAGVGGALKKDIWVDGKCIGESAPNVFFYEEVKGNQEHVIATESEFSPNEIKLAV
FT                   ADGINYFIRQYIKMGVFVGGANLEVANEAEGKEVVRNLEMAKKGTCSE"
FT   sig_peptide     complement(419579..419641)
FT                   /locus_tag="Daro_0387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.568 at
FT                   residue 21"
FT   gene            419775..420026
FT                   /locus_tag="Daro_0388"
FT   CDS_pept        419775..420026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45147"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45147.1"
FT                   /translation="MLAPATRTGRFWLELCENGWSVTGCFDEFNNYDTVVFQSHGGVKH
FT                   PCLALVLALNFHAALAGYCLMHNHWSIRRIDSVKCSKT"
FT   gene            420106..425289
FT                   /locus_tag="Daro_0389"
FT   CDS_pept        420106..425289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0389"
FT                   /product="Alpha-2-macroglobulin,
FT                   N-terminal:Alpha-2-macroglobulin, N-terminal 2"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45148"
FT                   /db_xref="GOA:Q47J33"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45148.1"
FT                   /translation="MSGLSKSRGFGAVAWLVALAVAIAAVLIYAKPWQSETASAGDGPF
FT                   EIADFSNRDFEGSPSLALSFTLPMDAKKGYDEQIQVFEMPPRPGDAKAQVNESEDEGEE
FT                   GAPGSANPQVSTEPADVATDGGKLIKGAWVVGDNPRILYFPHIKPQTRYVVRVAAGLSS
FT                   LSGQKLNEEGRYSVVTATVAPAYYFASRGTVLPAKQNGGLPVVTVNVPEVDVQFLRVKP
FT                   DQLPRFLDKVISGPRPQARAKRQNNDDYDYDVEYDGDYDWRATSLKGAVNNWSLDSLHN
FT                   LTESVFVGRFLTEQKPNKRNVTFLPVEDIKELREPGIYIAVMSQPNRFRYDYQVTYFYV
FT                   SDLGLSTRLFAKGADAYVSSLTTGKAVSGVEVAWMDENAKVVGRAETDSSGRANFAERP
FT                   AAAKVIIARHGQQISMVTLKEPALDLSEYDVAGLPGRPVRLFAYSGRNLYRPGEKFDIS
FT                   VLARDADGRPVPAQPIQAILRRPDGKSQFTATWQPDAKLGGYYQSRIELPVDAATGAWT
FT                   LELRADPADKLATTSFRFGVEEFLPERMKLDLNSKQATVSPDESLKIDIKGAYLYGAPA
FT                   AGNQLLGVAVFERQKNPLAQKLPGFEFGDTNEDSQRQRVELEQNQLDENGDLALEVDLA
FT                   PAKGKRSPYTVRTTLSLLESGGRPVVRNFERVIWPAPVLVGVRPLFTGDYAREGSVAQF
FT                   EVIRANAEAKLHGGKALPVRLFRENRDYYWRFDDQRGWHSGFTETDELVDTTVVSIPDG
FT                   SRGKLGLPVKYGRYRVEITDSETGQITKYRFYAGWSARGDETQGVRPDRVALKFDKPAY
FT                   KDGETAKLTITPPHAGEALVTVEADKTLWLKRVSVPLEGTTIDIPVDKDWKRHDLYVSA
FT                   VVLRPGSAGEKVTPARALGLTHLPLERGDRKLAVSLDAPKKMLPDTRLKVKVKVPGLTG
FT                   QQAVVTLSAVDVGILNITRYATPDPHGHFFGKLRYGADQYDVYGRLIEKMGGQKGKLKF
FT                   GGDAAPKATKSLPKKVRLVDLFSGPVQLNEQGEAEIGLDVPDFNGTLRLMAVVAAPDKF
FT                   GSAEAETIVAAPLVAELMTPRFLTVGDNATIALDLHNLSGVAQKLKVRIENADGLKIQN
FT                   AERELELKDQQKQTLRFPLEAGNAFGLADVRVVVSSAAGLKLERSFGLQVQAATPQQQV
FT                   LKMLAVGPGETVEVKEAELGGFLKSTVQSHLILSDKAPIDVRSAIQGLLTYPYGCAEQT
FT                   TSTAYPHVLVDEEGAKLFGLKPYSRDQRADMLEKAIAKLGAMQAPNGGFSLWGNMSEYQ
FT                   YWLSAYISNFLLDAREQGFKVPEAMQKNAMEFLLKNLQEGAAGLPSGKVTYNQNGWQDY
FT                   RYGGSGRFGVLAYGAYVLSREAKAPLSTLRQMFDLREQAHSGLALVHLGLALKLMGDET
FT                   RAQTALAEGVKKSRDTGYWWGDYGSPLRDAALSYALLDRHKLKVEGQDNLVAVAAAELG
FT                   KNRYTSTQEKLALFLLGRNFAKAGEGEAGWTAEVLGKEKPETINGSGTLIRPLSAAALQ
FT                   GGVRIKNTHKERLYLQLAYSGNPAKMPANRDDAIALTRDLFEADGKPLKSRALKVGESV
FT                   IVRINVNPRSWINTGMVVDHIPAGLEIENLNIAQGEGMASTLINNVNPAEAMQDPRIQH
FT                   VEFRDDRFVVAARLQGRLSLFYRARVVTPGKFVFPPIYAEDMYRPDVYGLATGDATLTV
FT                   TDGKEKPAAVPVPAPAAAPAVVPTPAPAKP"
FT   sig_peptide     420106..420180
FT                   /locus_tag="Daro_0389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.570 at
FT                   residue 25"
FT   gene            425296..427638
FT                   /locus_tag="Daro_0390"
FT   CDS_pept        425296..427638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0390"
FT                   /product="Penicillin-binding protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45149"
FT                   /db_xref="GOA:Q47J32"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45149.1"
FT                   /translation="MRGADWPISWRGWLSRRPRWQWGALLALLLLAGLDAAFPPPVPGR
FT                   DAPNALLIVARDGTPLRAFPDRDHVWRHPVALADVSPLYLQALERYEDRWFRWHPGVNP
FT                   LALTRAAWQWAWHGRIVSGGSTLTMQVARIIAPTPRTLPGKARQILRALQLELHYSKDE
FT                   ILAIYVNYAPMGGVLEGVEAASRAYLGKPAKRLSHADAALLTVLPQVPSRLRPDRQPAR
FT                   ARVARDKVLHRMAGVWPDAEIRDALQEPIIAQTIRDPLLAPLLAERLRKEARGRLRIDT
FT                   TIDAQAQQTVELLLTSRLAALPPRVSMAAMVVDNETLEVRAYAGSADFGDVDRFAFVDM
FT                   VRASRSPGSTLKPFLYGLALDEGLIHSESLLADVPQSFGGYQPGNFQQSFHGAVSVSEA
FT                   LAKSLNVPAVEVLDRLEANRFVAALRRGGLKLDFPKGETPNLSVILGGAGTTLEQLVGA
FT                   YTAFARQGVSGKPRYTLDAPLVEQRMLSPGAAFIIRDVLESGGPVGRAVEQGPGIRRGI
FT                   AWKTGTSFGFRDAWSIGVSDRLTVGVWIGRPDGTPNPGFFGANIAAPLLVDIFDALDHQ
FT                   PATTRVPPPSVQQEKICWPLGTRFDPAEESLCHRQSLAWVLNGTAPPTFPDRLRSGEVR
FT                   YSYEVDAVSGLRVTPECSSRPRRSVEAVRWPAALEPWLSADIRQKAQTPPWDTKCQAKN
FT                   EPEAGLRIVGLTNGEVLRRPRPDQPPVIRLELRGHRGQVYWLINGRLVAHRSASMPLIH
FT                   RLEETGRVDITVMDDQGRFDRLTVSVR"
FT   sig_peptide     425296..425409
FT                   /locus_tag="Daro_0390"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.776) with cleavage site probability 0.709 at
FT                   residue 38"
FT   gene            427796..431080
FT                   /locus_tag="Daro_0391"
FT   CDS_pept        427796..431080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0391"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45150"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45150.1"
FT                   /translation="MLPTFLSDTRLYELTWRDEAGPDLAVEAWWGREALSGGFEICIDL
FT                   LATDTHLELKRFLGRSLTLNTRLSDGSRASRSGLVRAAQKLGADGGFARYRLTVVPWIW
FT                   LLSRGRHNRVFQEKTVIDIVETVFADYADVAAWQWSDEVAGFLADARPRSYCVQYGESD
FT                   YAFVSRLLAEEGLGWCVEEDKEAPAGHRLRLFADSQRFPEDIVSQSANGGQGIRYHRAD
FT                   SQEDQDAILAFGERHRLASSVISAITYDYKAKKNVTLNITSAQPIGGKNAPVLESHDHP
FT                   GLYAWANAAEAERYGRLAMEAREAGHRTWLGRSTVRSLRPGTVFDLIGLPIDPAKADAE
FT                   HRYAATDITHLGINNLSGEAIATIAQRLGQGAQKIDASDALATGDALTPISAPPSLPTE
FT                   LLKLAVERGYGNTFDAHAANVPWRPELEDRSGARINPRPTAPGPMSALVVGPEGQTSPS
FT                   GPDELWCDALGRVKIRFHWQQAETPDDRDSCWVRVLSRQAGPGMGWQWLPRIGQEVLVD
FT                   FVGGDIDRPYLLGALYNGQGEGGISATPGGDSTKTQADNVFDSASDHRPSGQGNTAGGN
FT                   SPAWHGAAETSHRHSAALTGFKSKEFGSASGYNQLLLDDSDQQQRLQLKSTQHHSELNL
FT                   GHLIHQADNYRGSFRGTGTELRTDAWGALRGGQGLVMTTWAHPSAGASTAQPAGDMAPA
FT                   MALLRQADTLARTLNQAAATHQTVQLSSAIGTQGQDQSKIDPEAAPLKALHKVSSGMVD
FT                   AKDQSAAKQDAQQKITNASPDKRPHLTDPAIVQTGKAGIGHVAGQNLQYTNGETLVLAS
FT                   GEDTNLAIAGKARIHSGQAIGLLAGAIAPGDGNTGIKLIAAKDDIDLQAQSDEMKFLAK
FT                   KDIKLVSATQHIDFAAAKKIHLAVQGGASITIDGGITVQCPGTITVHASKKSFTGPGQG
FT                   SYALPQFPQTALPETVAAFSMLLTHIPGPSGKPLSDLDWQIVRASDEDGARMADKSLLK
FT                   GVSNGEGRLALSQSEQDLLKDEYDDSPNNIWVRFGGQVRKLCITQEKEDWTDTQKMEYA
FT                   LDALGYTDMISNVDGSTPTETGHAKWARLCAGSMATEAVFNLIKKG"
FT   gene            431086..433428
FT                   /locus_tag="Daro_0392"
FT   CDS_pept        431086..433428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0392"
FT                   /product="Phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45151"
FT                   /db_xref="GOA:Q47J30"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45151.1"
FT                   /translation="MNTRSSPAVERSMQQVISKDQKAHDSYGTTNIDLHYGQEFSSPVG
FT                   GNTVTPLVSGKAYFASLIEALRGASSEVLIAGWQINWDAQIGPDGLRLVDIILEIAKKS
FT                   GGPKIYLMPWDNPSQVETYAKSTENVLRALEDRLGKGKVFVYRSPKRSDEDEMFFSHHQ
FT                   KLVAIDRKTAFIGGIDLAYGRYDDETYCLKADADGRDGMNRYNSCIPATGTVVGKIIDH
FT                   DLLLGGWYSLAGNRKKVLDDIITGHALQPVKTGSRVSLDPATQPRMPWQDLQQRIDGPA
FT                   AANVAASFILRWNIGAGSALVPTLDPPVIATKPIPGDSGCSVQVLRSASANLRNAEAGK
FT                   VAEKDAEAAFPNQKGKPEGAEDDIRQALLTLINESRHYIYIENQFFTTAFGAPSPARDA
FT                   AFSGPANEVNEGVKWGVRATRTMPGDADGPIRNAVCQALADRIRKAIITKGHPPFHVYI
FT                   VLPVHPEGFLNAGPTMTQIHWTMQSLVFGRQSLLERVKAALKEVKRDPEEWPQYLTLLN
FT                   LRNWAQLGDRYVTEQIYVHTKLIIVDDCFVLHGSANINDRSLLGRRDSEIAVLVHDSQE
FT                   EYTDLDGTGRQVLTLKHARATRKAIWRKIFGLEQKICLPTGGAHPANELAGMIDRPADP
FT                   KTVKAIQSVAQANTDAYEAVFDWVPRNVSIFDESEASSIWSRWEYPNGQNPLRPKERGS
FT                   LNGLMPFQEVFWKATQFKANAVAQLNSIKGFITALPIRWTERENNNLGYHIALVAINDV
FT                   PLPRYPGASGEKPTVLTGMPPSGGREV"
FT   gene            433425..434564
FT                   /locus_tag="Daro_0393"
FT   CDS_pept        433425..434564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45152"
FT                   /db_xref="InterPro:IPR041290"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45152.1"
FT                   /translation="MNFRHIVIGCLMLGLFLTTCASAAGQFDWQTDCVGRFTLALPGKV
FT                   EVAMLVNKAFENPDDDPMYPTDAAITFLGGRGMAYYHFSDVIETSGNTSGNATRSTQSI
FT                   GVGAVHLTTGPRADKAEFERFQRAMDSYYTQTKRRLINSVSKKDNEQVPFIEMMASPFS
FT                   HSHAWKWHASYYLLWRDDRLFSYKYSETDPSAFPTPQYISDHIRSREIFEVPKEQGLCL
FT                   HHAFLPDDGTLPRAVAMTYRLIDHPEIEIYFSDNFTNGDEKASPEKIINDFWESQGRGR
FT                   YAKKLQLINPHIPGVVHFPDVELAGFKGKRSLVEITNPDGSLDHGYFAFVRGDKTPKDD
FT                   RPDLTLYVVGKNVNATGTPLSKDQIEEIANHIASSIRRR"
FT   sig_peptide     433425..433496
FT                   /locus_tag="Daro_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.812 at
FT                   residue 24"
FT   gene            434949..437384
FT                   /locus_tag="Daro_0394"
FT   CDS_pept        434949..437384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0394"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45153"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45153.1"
FT                   /translation="MIFADSQRFPEDIVSQSANGGQGIRYHRADSQEDQDAILAFGERH
FT                   RLASSVISAITYDYKAKKNVTLNITSAQPIGGKNAPVLESHDHPGLYAWANAAEAERYG
FT                   RLAMEAREAGHRTWLGRSTVRSLRPGTVFDLIGLPIDPAKADAEHRYAATDITHLGINN
FT                   LSGEAIATIAQRLGQGAQKIDASDALATGDALTPISAPPSLPTELLKLAVERGYGNTFD
FT                   AHAANVPWRPELEDRSGARINPRPTAPGPMSALVVGPEGQTSPSGPDELWCDALGRVKI
FT                   RFHWQQAETPDDRDSCWVRVLSRQAGPGMGWQWLPRIGQEVLVDFVGGDIDRPYLLGAL
FT                   YNGQGEGGISATPGGDSTKTQADNVFDSASDHRPSGQGNTAGGNSPAWHGAAETSHRHS
FT                   AALTGFKSKEFGSASGYNQLLLDDSDQQQRLQLKSTQHHSELNLGHLIHQADNYRGSFR
FT                   GTGTELRTDAWGALRGGQGLVMTTWAHPSAGASTAQPAGDMAPAMALLRQADTLARTLN
FT                   QAAATHQTVQLSSAIGTQGKDQSRIDPEAAPLKALHKVSSGMVDAKDQSAAKQDAQQKI
FT                   TNASPDKRPHLTDPAIVQTGKAGIGHVAGQNLQYTNGETLVFESGEDTNLAIAGKARIH
FT                   SGQAIGLLAGAINPGDGNTGLKLIASKDDIDLQAQSDEMKFLAKKDIKLVSATQHIDFA
FT                   AAKKIHLAVQGGASITIDGGITVQCPGTMTVHASKKSFAGPEQQNYGLPRFPENPFETT
FT                   PPKFDFKLTDMPGPDGAVLSETSWRMVLAADESEALTHSATLMSGQSDAQGMLALSSD"
FT   gene            437412..437651
FT                   /pseudo
FT                   /locus_tag="Daro_0395"
FT   gene            437651..440107
FT                   /locus_tag="Daro_0396"
FT   CDS_pept        437651..440107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0396"
FT                   /product="Phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45154"
FT                   /db_xref="GOA:Q47J27"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45154.1"
FT                   /translation="MAKPSSTVHQIIGTDGKPHTATGCFNPWIGSGPDVFAMPRDGNKA
FT                   IPLLSGKAYFADLIASVDAAQSEVLILGWQVSWDALLAPGVRLYDLLYRNAKRGVKFYV
FT                   MPWNDTNPVQTYDDQTKAVLEDINKRLGLKGDKKAIHVLLSGSYAGTNANYFSHHQKCV
FT                   VVDRKIGYMGGLDLSYGRYDDETYTLKPDADGRAVLNRYNPCIAWAKPLKESDVVDPDL
FT                   MSGLADNTRPSVWQSIGSGMAGIPILSAQAADDRTPAEKNSDKAYNGGWQAPYEDNAAL
FT                   ANKQKTDFNTLDLSTLDEHMQPRMPWQDVHCRIEGPVVSDMVRNFVVRWNIGSKTKLAL
FT                   PDSPASYPKSGSARIQFLRSAPAAMRIKEYAQAGKEAFAAPSAGTDDGIQQAMIRLIEN
FT                   AAHFVYIESQFFVSDFGEKISPRDLSPVGEYIRNSSKGIGRGTVSIVRQADELSSAALN
FT                   QTPQNGICRALIERIQQAIFDASKPRFHVYITLPVHPEGDLMKHAIAAQVYWTMQSIAG
FT                   GSHSLLNGIRRALRAKELKDKKQPYESALKDPNNKEYEKIPVEACERYVTLLNLRNWAK
FT                   IGQNMVTEQIYIHSKLMVVDDRFALLGSANVNDRSLLGERDSEIAVLVIDTDTSQCDVG
FT                   TGSQKPVRTFARDLRMGVWKKIFGITGNIRPASHLKQAIEQPANPASWQAIQKQAKANA
FT                   EAYEKAFPFVPKNWSGAKDDDGEPIPCSVLPSWVGGGLSAPMPSQPEFWKRPQFKADGV
FT                   AGLESIKGFITALPIHWAKNENLDFKLPTAILVQKDPLPGGVLSPTPPAAVASADKANK
FT                   GVGNAA"
FT   gene            440112..441179
FT                   /locus_tag="Daro_0397"
FT   CDS_pept        440112..441179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45155"
FT                   /db_xref="InterPro:IPR041290"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45155.1"
FT                   /translation="MALLAALICGSAGCAETVPSEWPKECVGRLQLALPGEADQGAILG
FT                   RERFRDSVQYGRPDSRFPDGETADWTALSLGRVTHPLMKEEKLEALVALRKIKANVTKT
FT                   YKTEEKINVQAWPIGKQEGMGWVAPNRRITLNIFAGDALFSWSQTSNDAAEFAEVERSA
FT                   KNIVAGLRPRQLFDVPSEPGLCLPYVFIPDNGQEKHAIAMTYRLKEHPDITVNLKSKTA
FT                   EPAPKPGGDIRPDSITNDFRTDTFWGTVTAPGNLRSARSIWHAPAKRQTQLAGRSGMET
FT                   FLAVVRLDEDKEDFIYHAVSRGNPDTLEAAPDVRLVVEQKRENAIKRGIQPLTQDEVLK
FT                   LARQIAASVGQRPNR"
FT   gene            441230..442042
FT                   /locus_tag="Daro_0398"
FT   CDS_pept        441230..442042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0398"
FT                   /product="Phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45156"
FT                   /db_xref="GOA:Q47J25"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR041290"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45156.1"
FT                   /translation="MCNWAKIGQNVVTEQIYIHSKLMVVDDRFALLGSANVNDRSLLGE
FT                   RDSEIAVLVIDTDISWRTRVQNGAELLQSKALLQSIAAGLRPRQLFDVPSEPGLCLPYV
FT                   FVPDNGQEKHAIAMTYRLKEHPDITINLKSETAEPTPEPGGDIRPDAVTNDFRTDLYWG
FT                   AKVTPSRVKSARSIFHAPARRSLQLDGRPGQETFLAVVRKNATEEDYIYLAVARGNPDT
FT                   PEAAPDIRFFVEQERENAIKRGIKPLTQDEVLKLARQIAASVGQRRGQ"
FT   gene            442062..442487
FT                   /locus_tag="Daro_0399"
FT   CDS_pept        442062..442487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45157"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45157.1"
FT                   /translation="MSFYGMTHCNFGRFFRLTVAITDRHTKPNRFLGRALTLNTRLSDG
FT                   SQVSRSGFVRAAQKLSADTPQEVMEAREAGHRTWLGRGTVRSLRPGSAFDLIGLPVDPA
FT                   KAEAEPRRLTLAAHVWTSLFRSIHVELCADHTRLGGC"
FT   gene            442414..442920
FT                   /pseudo
FT                   /locus_tag="Daro_0400"
FT   gene            443517..443828
FT                   /locus_tag="Daro_0401"
FT   CDS_pept        443517..443828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0401"
FT                   /product="regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45158"
FT                   /db_xref="GOA:Q47J23"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45158.1"
FT                   /translation="MKNDYTKAIPPAWQAMSKIFVALGDEHRQRILLLFEPGERLNVGQ
FT                   IAEVSTLARSTVSHHLKILHESGVLASEKLGKEVWFWINRESLESTFTNVLDYLREHS"
FT   gene            443828..445969
FT                   /locus_tag="Daro_0402"
FT   CDS_pept        443828..445969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0402"
FT                   /product="AMP-dependent synthetase and
FT                   ligase:Phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45159"
FT                   /db_xref="GOA:Q47J22"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45159.1"
FT                   /translation="MRKLLRPLLRGLARLLFRIEVPMQQASFDHQRLLIVANHQSFLDG
FT                   LLIGLFLPIDPVFVVHTTIANSFFFRILLSQVEYLAVDPTSPMAMKKVIRLIESGRPVV
FT                   IFPEGRITLTGSLMKVYDGPAFVAAKTGATVVPVRVDGASRSYFSRLSGKHPKELFPKI
FT                   RLSILPERHFPMPEGATAKLRRRKSGEAMRRLMQEMIFASRPQQTLYAALCDAADIFGR
FT                   RRRLLEDVKQIEYSYNDLLKMALILGRQIERLSQPGEKVGLLLPNLVPTIGLIFGLAAR
FT                   RRIPAMLNYTAGLEAMQSSIDAAEIKTIVTSRAFVEQAKLADKLAGLSRVQLIYLEDVR
FT                   EQIGLADKLWLVLYAIHFPRAFELPASPEDAAVVLFTSGSEGKPKGVVLPHRAILANIA
FT                   QIRSVIDFSVYDKVLNALPIFHSFGLTAGALLPVLNGASLFLYPSPLHYRVIPELAYDR
FT                   GCTVLFGTSTFLANYAKFANPYDFYRLRYVVAGAEKLSESVRNVWFEKFGLRIFEGYGA
FT                   TETAPVLAVNTPMAYRTGTVGNLLPGVEHKLVPVPGIDQGGLLHVRGPNVMAGYLKSDK
FT                   PGVLQPPVSDIGEGWYETGDIVELDEDGFIKIVGRVKRFAKIAGEMVSLEVVEKLATAT
FT                   SPALPHAASSQPDPAKGEALVLFTTDGELTRDLLAAKAREIGVPELAVPRKIHKVEALP
FT                   LLGTGKVDYVTLKRLAEAV"
FT   gene            445986..446333
FT                   /locus_tag="Daro_0403"
FT   CDS_pept        445986..446333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45160"
FT                   /db_xref="GOA:Q47J21"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45160.1"
FT                   /translation="MNALVVILVAALPFALVAFVLYRVLIVHVMGKTLRPAFAVLLYWI
FT                   VIAVVPWALLWVQVPLANYIFGSFSSLQTAAWDVGLAINLSLGMTLSYLTGVVAAVLAT
FT                   RQFLHGATHGV"
FT   sig_peptide     445986..446042
FT                   /locus_tag="Daro_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.940) with cleavage site probability 0.910 at
FT                   residue 19"
FT   gene            446323..447570
FT                   /locus_tag="Daro_0404"
FT   CDS_pept        446323..447570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0404"
FT                   /product="Amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45161"
FT                   /db_xref="GOA:Q47J20"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45161.1"
FT                   /translation="MAFRSPPIDLSRRRLIGLLAGGAALSAAGWSSAKPMLVNKCRVAI
FT                   PAGLIDSPWLQQAWAGIDPAQLWDCHVHLAGIGDGGSGIVVGPQLSSVLHPLHYAQRLF
FT                   YMNAGCAHDAPGKVDQAYVARLLNLCDAMPEGFKVMLFAFECFHDGKGDSHPEHSAFYV
FT                   PNAWAAKLARDFPARFEWVASLHPYRASAADDLKLAIANGARAVKWLPAAMGMDPSDAK
FT                   CDAFYRVLAESGTPLIVHCGEEKAVKGSDTQAFGNPLRLRRALDAGVKVIVAHCASLGD
FT                   DIDDDGKARCSFDLFLKLMSEPRAKGLLLGDISAITQRNRKPALIRTLLERGDLHDRLL
FT                   HGSDYPLPGIVPLTSTSALARAGLLPKAAISDLDILRQHNPLLFDFTLKRLLNWQGHSF
FT                   SPAIFHTCRLFAASHA"
FT   sig_peptide     446323..446424
FT                   /locus_tag="Daro_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.466 at
FT                   residue 34"
FT   gene            447567..449447
FT                   /locus_tag="Daro_0405"
FT   CDS_pept        447567..449447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0405"
FT                   /product="Phospholipid/glycerol acyltransferase:Major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45162"
FT                   /db_xref="GOA:Q47J19"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45162.1"
FT                   /translation="MSGQFGLLKQKRFAPFFATQFLGAFNDNLFKNALVVLLTFQAAHW
FT                   TTLKPELLANLAAGIFILPFFLFSATAGQLADKYDKARLARLVKVLEMVIMGVAAAGFF
FT                   MTSLPVLMGALFLLGCHSTLFGPIKYAIIPQHLHEEELVGGNALIEAGTFVAILIGTLA
FT                   GGLLAGTVEHPAWIAVGGFVVAFAGYLTSRGIPVAPAPAPELKVNLNPFSETWRNIAFA
FT                   RQNRTVFLSILGISWFWLYGALFLAQFPAYAKFVLGGGESAVTLLLATFTVGIGLGSML
FT                   CERMSGKHVEIGLVPFGSIGLTLFGLDLYFASPVGLSGTTPHELLALLSIPAIWRVLFD
FT                   LMMLGVFGGFFIVPLYALVQLRSSAEHRARIIAANNILNALFMVVGALGAAAMLGEGLS
FT                   MPALFGIAALLNAAVAIYIYGLVPEFLLRFVAWLLVKAVYRLRMTGVENIPQEGAAVLV
FT                   ANHVSFADAVIIMGASPRPIRFVMDHRIFKMPLLGFVFRHCGAIPIASAKENPVMMDAA
FT                   FTEVAKALANGDLVGIFPEGHITPDGELQPFRPGICRILAANPVPVIPMALSGLWGSFF
FT                   SRVDGHAMQTPFRRGAFSDIALNIGAPVSAGDAAPEVLRAQVQSLRGEWR"
FT   gene            449533..449835
FT                   /locus_tag="Daro_0406"
FT   CDS_pept        449533..449835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45163"
FT                   /db_xref="GOA:Q47J18"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45163.1"
FT                   /translation="MRFLMNLFKVLLLSIGFLVIIGGTLGSLCGIVILDAGVTIGGALV
FT                   ALAGVGLYMGANRALDTTRAEAAEDYAEMVMRQEAARATGGNDEASPDKTDGNVR"
FT   sig_peptide     449533..449643
FT                   /locus_tag="Daro_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.840) with cleavage site probability 0.398 at
FT                   residue 37"
FT   gene            449832..450590
FT                   /locus_tag="Daro_0407"
FT   CDS_pept        449832..450590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0407"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45164"
FT                   /db_xref="GOA:Q47J17"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45164.1"
FT                   /translation="MIPAEYAALVHGLFEAAALAIGAALYRFGKRRAGGPGILAPGEFA
FT                   VAVGCVFGAAIGNKAVFWIEMPHLFIQYWQTPTVLFSGQSMVGGLLGGLIGVEVAKTLT
FT                   GITRSTGDAFVMPVLLGLAIGRIGCFLAGLEDGTFGVATDLPWAIDFGDGVGRHPTQLY
FT                   EIGLAGVLAWMLARWRARLADRPGLRFRLMLVAYLLWRLLIDGLKPVPYVYPLGLSGIQ
FT                   WTCLAALIVYLPATVRLWATLPGLPERKNA"
FT   gene            450587..450823
FT                   /locus_tag="Daro_0408"
FT   CDS_pept        450587..450823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45165"
FT                   /db_xref="GOA:Q47J16"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45165.1"
FT                   /translation="MMQILKVLGRVILISCGLMAVAAGGLCTVLGSTSGSDMRWMAMIG
FT                   VVSLLAGVAVVWATFRNWRREPSASQESEGEKP"
FT   sig_peptide     450587..450655
FT                   /locus_tag="Daro_0408"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.663 at
FT                   residue 23"
FT   gene            450820..452244
FT                   /locus_tag="Daro_0409"
FT   CDS_pept        450820..452244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0409"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45166"
FT                   /db_xref="GOA:Q47J15"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45166.1"
FT                   /translation="MSRKNRPWLFYDTTTSVCTTCLRQVEAKIVIKGNEVFLDKWCPAH
FT                   GTERVLIADDAEYYRLCREVYVKAPEMPERFNTAMQHGCPYDCGLCPDHMQHSCLSVVE
FT                   ITEHCNLRCPVCYAESGPERQTHRSLAEVEAMLDAVVANEGEPDVVQLSGGEPTLHPDF
FT                   FAILDAAKARPIRHLMVNTNGLRLALEPDFVARLATYKPGIEIYLQFDSLRDEVLQQMR
FT                   GADLAAIHERALVNLEAHAISTTLVMTVKRGVNDEEIGAVIQHGLKYRCVRGVTLQPVS
FT                   DAGRNLDFEPKRHRLTVSEVRRRVAEQSGLFTLEDIVPVPCNPDTLAMGYALKLGDEVM
FT                   PLTRHLGPEALLAGPRNTIVFERDPAMKDAVFKLFSTNHSPESQANCLSALLCCLPVIS
FT                   APELAYENVFRVLIVQFMDAANLDLRALKKSCIHFAQPDGRLIPFEAYNLFYRGERAEK
FT                   TATIQREIIEFAERRR"
FT   gene            452373..453197
FT                   /locus_tag="Daro_0410"
FT   CDS_pept        452373..453197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45167"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45167.1"
FT                   /translation="MSGKTGKLHKHLLRDAVIESVRITRYAIRDGQPDPEKPVLTTGRN
FT                   VAFIEAGVASWRFDIEDARPLQLSAAKPPHASVEARWYDTQAALTAGIKVVSGGDANTF
FT                   GAMGALLVPPGFAIPTVTATPDNVLYYGLQLVPSGSDFSIASEHCPIALMQYDYTPDYK
FT                   KHFLMKKRGGGGIFVETHAFPHIHIPTSPECGGYIVIGKPVAAGRFDFTAFRIPYGYAL
FT                   YTPSNTIHGDGTLVGEYALTVADPAMVSADTVLMYNRETLDMARGVVPDWKP"
FT   gene            453227..454180
FT                   /locus_tag="Daro_0411"
FT   CDS_pept        453227..454180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0411"
FT                   /product="PAS:GGDEF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45168"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45168.1"
FT                   /translation="MEIAQAFNGIDRLERSDDWGVYKTLLESTKAIPWKINWQTKQFDY
FT                   IGPQIETLLGWPRDSWLGAMDWIERIHLEDREKTANFCISQSEQGVDHEADYRALKADG
FT                   SYVWIRDVVHVIRDTNGVTTDLVGFMFDISARKQMEEDVFELNRKLEAWSNQDGLTGIA
FT                   NRRLFDHTMAAEWARGKRSREPLSLLMFDVDHFKGYNDHYGHVKGDECLIRLAREVSQM
FT                   PLRSTDLFARYGGEEFAFVLPQTPSDAAQQIAEKCREVVAALKIPHALSPAGTITISVG
FT                   VCTMLPGEESSYMTLIERADDKLYRAKRNGRNRVCC"
FT   gene            454289..455050
FT                   /locus_tag="Daro_0412"
FT   CDS_pept        454289..455050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45169"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45169.1"
FT                   /translation="MNTAVQIPADQLAALANADTQRLAARMAQDVFAGVFRQAVVADAA
FT                   PDVGVLGEVAAHCYDWCQGGASDEARALRLALLISGLDQWGLAYTQAFKLDAIHALTAL
FT                   IGGLRTRLDARNDMLFQTYFEQIDAVESDAIDFKVDLRRGIHLALWHAMAACENAEQAA
FT                   GIVQPLGSMMVALNQQMPELGWRLLADALANIQIALLSDIVPESAQAQEGTQQLFASLR
FT                   HALSPERYQAILAYSGQAVVAWQKASRTGTA"
FT   gene            455110..456000
FT                   /locus_tag="Daro_0413"
FT   CDS_pept        455110..456000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0413"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45170"
FT                   /db_xref="GOA:Q47J11"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45170.1"
FT                   /translation="MNWPALKERINLYEKLMRLDKPIGILLLLWPTLWALWLSALGRPN
FT                   WIVVWIFILGTVLMRSAGCVINDYADRDFDKHVERTKERPLTAGKVTTKEALALFAGLS
FT                   LLSFLLVVFLGNTLVIWLSLPAVFLAASYPFTKRFFAIPQAYLGVAFGFGIPMAYAAHL
FT                   GEVPAEAWWLLLANVFWAVAYDTEYAMVDRDDDLKIGIKTSAITFGRFDVAAVMLCYGV
FT                   TLAIIGGIGYSLNRGPAFYAGLAVATCIMGVHYTWIRGRERMPCFKAFLHNNWVGLSIF
FT                   VGIVVDFLVSGRNLW"
FT   gene            455994..456419
FT                   /locus_tag="Daro_0414"
FT   CDS_pept        455994..456419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45171"
FT                   /db_xref="GOA:Q47J10"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45171.1"
FT                   /translation="MVKVLIFVLLCLSTGAFAEDTRQLAKLPAPAQESLRQEMLDNLVA
FT                   VNEVLSLMAEGKVKEAGESAETKLGMSAMGKHRSKPFDARPGPHMPPAMHGIGMDGHKA
FT                   VSEFASVAKTGDRDKAIALLPNLTSACVGCHFSYRTR"
FT   gene            456416..457879
FT                   /locus_tag="Daro_0415"
FT   CDS_pept        456416..457879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0415"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45172"
FT                   /db_xref="GOA:Q47J09"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47J09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45172.1"
FT                   /translation="MKYHDLRDFMSQLEKTGELKRVGVEVDTYLEMTEICDRVLRAEGP
FT                   AILFEKPKGHSIPVLANLFGTPKRVALGMGEESVQALREVGKLLAYLKEPEPPKGLKDA
FT                   WDKLPILKQVLNMAPKKVSNAPCQEIVWEGKDVDLSRLPIQHCWPGDIAPLITWGLVVT
FT                   KGPHKNRQNLGIYRQQVLGPNKVIMRWLAHRGGALDFREFQLANPGQPFPVAVVLGCDP
FT                   ATILGAVTPVPDSLSEYQFAGLLRGGKTELTQCIGSGLQVPASAEIVLEGVIHPGEMAL
FT                   EGPYGDHTGYYNEQAEFPVFTIDRITMRKNPIYHSTYTGKPPDEPAVLGVALNEVFVPL
FT                   LQKQYPEIVDFYLPPEGCSYRMAIVSIKKAYPGHAKRIMFGIWSFLRQFMYTKTIIVVD
FT                   DDIDIRDWKEVIWAMTTRMDATRDTTLVDNTPIDYLDFASPVAGLGSKMGLDATNKWPG
FT                   ETTREWGRPIVMDADVKKRVDTMWQELGI"
FT   gene            458185..458352
FT                   /locus_tag="Daro_0416"
FT   CDS_pept        458185..458352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45173"
FT                   /db_xref="InterPro:IPR026421"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45173.1"
FT                   /translation="MPKIVSQVASNTVETQPTAAQHAQPVAPTIAIRKSCNPDGIGLSH
FT                   YVLMDRKAAK"
FT   gene            458349..459722
FT                   /locus_tag="Daro_0417"
FT   CDS_pept        458349..459722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0417"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45174"
FT                   /db_xref="GOA:Q47J07"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR026423"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45174.1"
FT                   /translation="MIAAIAERAARGTLFQALDIGHPLYAAVTDPQTAFWALVDKTRIH
FT                   EAGRDPALLAAYGAMAELFSRELHALRFGLKPSGVYLNPTERCNLNCTYCYLPDSQRSS
FT                   GSHMPVETLLASLGKLRDYFRSVMPADRKPRAIFHGAEPLMNQAAVFAAIDAFADDFVF
FT                   GLQTNGTLLDDAALDFLTSRNVSIGLSLDGPVAGITDATRRTWGGKSVHDKVLRAMEKL
FT                   RGYGSWSVITTCTTENLPYLTHMVELFHANEVPTCMLNTLRCTLPGARGVKPADGDMGK
FT                   AFFAALDRTYELYQETGRKLMVANFANILIGILAPTARRLMCDISPCGGGRAFFALAAD
FT                   GSLYPCSEFIGLPRFNGGSLLTGGVEAALDSAAFREVTTRDVDRFSPCGDCAIRHFCGS
FT                   PCPAEAFEMNGGMDKIGAFCDFYKEQVNYALRLIADGKADDYLWDGWDEGTETVFVMS"
FT   gene            459726..460280
FT                   /locus_tag="Daro_0418"
FT   CDS_pept        459726..460280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0418"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45175"
FT                   /db_xref="GOA:Q47J06"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45175.1"
FT                   /translation="MPGGRFNMTPFSCFQAPSAMHSRLVITATDLADLCHVEAFHDLLE
FT                   HYARDPMGGGDGLSDYAKVHLVSTLKEVPGFHGALAWLDGKAVGLIDCFAGFSTFAARP
FT                   LLNVHDIVVRENLRGQGIGQALLAWAEQRARQLGCCKLTLEVLSNNTRAMASYRQAGFA
FT                   PYVLDPAAGHALLMQKYLPEE"
FT   gene            460284..460685
FT                   /locus_tag="Daro_0419"
FT   CDS_pept        460284..460685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45176"
FT                   /db_xref="GOA:Q47J05"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45176.1"
FT                   /translation="MQEPVPVDDLKGVRLSLVQYTHFIYGLHAIAVLIGVTSAATVAGG
FT                   FVFGLPSLVAVFLNYLKRGEVSGTWLESHFRWQIRTFWFTLLWLIVYGLLIITIIGIPV
FT                   AWILIALLGLWVGYRVIRGWTALFAVRSI"
FT   gene            460751..463114
FT                   /locus_tag="Daro_0420"
FT   CDS_pept        460751..463114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0420"
FT                   /product="PAS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45177"
FT                   /db_xref="GOA:Q47J04"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45177.1"
FT                   /translation="MKRDFFSLAGFGEAASKLPIERRIHLIRIETFFGHAPGNAIRIAL
FT                   VSLIFTTALEKSGAGQNTIFAWIGVTLLTCLAMIGYEAWVRHVGLSIDNAESHLRRRRL
FT                   LGLFAAVSVATGTVLVPVDADPLYHALAVFLAYGMVSVTALAYAVLQRFYTEIALIASG
FT                   PVLVRYVWLWHEKGDSFFGFLAIVIVFTTALILFRGAANTRWTTQAIEGYLQLHDEIVE
FT                   RCRIEAALAAAEENASRLAAMLRLMCDNVPDMIWAKDLEGRYLFANQAMASCLLCASDT
FT                   GEPVGKTDLFFAERERAAHPEDSQWFTFGEQCLATDLETLRRGVPSAFEEMGNVRGRYL
FT                   CIDAFKAPFVDGSGQVIGTVGSARDITERKQVERELAKYRENLEGVVRERTRELTVAKD
FT                   LAETANRAKSAFLANMSHEIRTPLNAITGMAYLMRRDGVSEKQGERLDRIDAAGQHLLE
FT                   IIHDVLSLSQIEAGRMTLEAKPLDLSVVCTGALEVLADEARRKGLSLRQEFGELPVGLH
FT                   GDAVRLRQSLLNYLGNAVKFTEAGSVVLRCHELSRNDSGHLIRFEVVDSGPGMSPESRT
FT                   QLFQPFHQVDSSSTRVHGGTGLGLVITRRLAQLMGGDAGCDSTPGVGSRFWFTVCLADG
FT                   EPAPNASEGAVVNAANELLRHRFAGRSVLLAEDSWVNREVVVEMLEDQLLVVDVVENGV
FT                   AAVERVRERDYDLVLMDVQMPEMDGLEATRRIRAMPQRERLPIIALTANAFAEDRQACL
FT                   EAGMNDYLAKPFSPDKLFARVLHWLLEAERQAGH"
FT   gene            complement(463111..463719)
FT                   /locus_tag="Daro_0421"
FT   CDS_pept        complement(463111..463719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0421"
FT                   /product="Protein of unknown function DUF161"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45178"
FT                   /db_xref="GOA:Q47J03"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45178.1"
FT                   /translation="MTTPESHRHNLFEDAQALLVAPLLVAFAIFLFREAGLLTGGTVGI
FT                   AFLIHYLSSWPIGLVLFVVNLPFYALALRAMGKAFTVKTFLSITLLSLYTELLPALIHL
FT                   QSLNRGFAAVMGGFLAGIGLLILIRHKASLGGLGILVIHLQNTRGWRAGKLQMAADFLI
FT                   LGAAIFVLDPVSVGWSIVGALALNLVIAVNHKNGRYMGT"
FT   gene            complement(463744..464439)
FT                   /locus_tag="Daro_0422"
FT   CDS_pept        complement(463744..464439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45179"
FT                   /db_xref="GOA:Q47J02"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45179.1"
FT                   /translation="MSERSPFVADFLNESGLNRQFVFDLSALPADIADKLAPQAGERQL
FT                   ILFGHGGRLLWECVKASGLTGENPIDDYSIRTVERWFAEQVPGHRYRILFPGEQPIGLQ
FT                   ALGKLAGWHHPSPIMVGVDREWGSWYAYRAAVIADTDFAPSPAEEARSPCPSCVTKPCV
FT                   AACPADALHGDQFDLERCSRYRLQPESACAHGCLARQACPVGSQHRYEDAQIMHSYSRS
FT                   LAVIRQYYR"
FT   gene            complement(464432..465871)
FT                   /locus_tag="Daro_0423"
FT   CDS_pept        complement(464432..465871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0423"
FT                   /product="D-Ala-D-Ala carboxypeptidase PBP3, Serine
FT                   peptidase, MEROPS family S13"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45180"
FT                   /db_xref="GOA:Q47J01"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45180.1"
FT                   /translation="MFIKRLAPLILAGISLAALADGLPPSVLGALKAAQIPAKNVAVVI
FT                   QAVDSGSPLVAHNASQAMNPASVMKLVTTYAALDLLGPAYTWKTTVWTESAPVDGILSG
FT                   NLYIKGSGDPRFAIEHLWSLLRQLQVRGIRQIAGDVVLDRTAFNVPSIDPGAFDDKPMR
FT                   PYNVGPDGLLLNFRSLRFTLVPDNGKPRVLMETPSEGLRVDNQLRAGNGDCGSNWKDLI
FT                   NVRLIPENSGNRLEFTGTYSALCGEKPLNLSPLPADAQADGLIRALWKELGGNLNGQVR
FT                   GGTVPIGAKLLAQHESAPLADAVRDINKFSNNVMARQVFLTLGNDSAPATAERSKQRIS
FT                   DWLAARNLRFGELVLDNGSGLSRVERISADSLNRLLLDAWKNPVMPEFVSSMPIVGIDG
FT                   TMKKRLNSSEATGRAHIKTGTLDGVKAASGYALDALGRRYAFTFLINHPKAQAGSAAID
FT                   ALLVWVAQRRVGEKTPVLENE"
FT   sig_peptide     complement(465809..465871)
FT                   /locus_tag="Daro_0423"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            466019..468166
FT                   /locus_tag="Daro_0424"
FT   CDS_pept        466019..468166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0424"
FT                   /product="PAS:GGDEF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45181"
FT                   /db_xref="GOA:Q47J00"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q47J00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45181.1"
FT                   /translation="MNDVVNQPSKTGSDSLLVLGYQVWLAVAYLLVALLCWLGVSMEFS
FT                   QIDENIETLARERGAALFRLVELTRDWNAKHGGVYVRVTEATQPNPYLKHPKRDLQTTD
FT                   GLQLTMVNPAFMTRQIAEIAEQADGVQFHITSLKPIRPANTPDAWEVDALETFEGGKRE
FT                   VLSLVQSEKGAMHRYMAPLFVKQPCLNCHSEQGYRLGEIRGGISVSMPAEKILSVRRDQ
FT                   RRRIMLVFGAGALMFALLMHFVIRRSRQHFLHLKAVTAGQEKLIAERTQALSSANEQLI
FT                   GEVAERKRKEIQISESEARYRSVIETSQNAILIMQAPNFVIVFANEQGAALVGLAPSQM
FT                   IDRPILDFVCQQDRSMVAERLARRARGEPVSPTVRAHFCRLDGSQVRVGDVHVARIESA
FT                   SEYPQWVLSVHDVTNRLANERALQISAAVMENAAEGIVVTDAQNRIIQVNPAFSAITGY
FT                   RPQEVLGKDPSLLGSGRHESGFFREMWETLEKEGHWAGEIWNRRPDGTVYVVWLAISAI
FT                   RGEGVESGGRHVATFIDITQRKEVEELLRHRAQSDPLTDLPNRTLFYDRLQVALTHARR
FT                   YSEEFALLYIDLDHFKIVNDTLGHAAGDELLIEASHRLTQAVRQSDTVARLGGDEFAVI
FT                   LPKTGSQSEIEEVAQRVVETMVRPFLLSAGTINISTSVGVAIYPRHGEDLEAIRASADA
FT                   ALYSVKQSGRNGYRLYVPPGH"
FT   gene            468403..468693
FT                   /locus_tag="Daro_0425"
FT   CDS_pept        468403..468693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0425"
FT                   /product="Chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45182"
FT                   /db_xref="GOA:Q47IZ9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45182.1"
FT                   /translation="MNIRPLHDRVIVKRVEAERTTASGIVIPDSAGEKPDQGEVLAVGP
FT                   GKRDDNGKQIALDVKVGDRVLFGKYAGQAVKVDGQEVLVMREEDIMGVLVA"
FT   gene            468734..470386
FT                   /locus_tag="Daro_0426"
FT   CDS_pept        468734..470386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0426"
FT                   /product="Chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45183"
FT                   /db_xref="GOA:Q47IZ8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45183.1"
FT                   /translation="MAAKEVKFGDSARARMVEGINILADAVKVTLGPKGRNVVLERSFG
FT                   GPTVTKDGVSVAKEIELKDKFANMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVREGM
FT                   KFVAAGMNPMDLKRGIDKAVVATIAELQAFSKPCTTTKEIAQVGSISANSDSDIGEIIA
FT                   NAMEKVGKEGVITVEDGKSLANELDVVEGMQFDRGYLSPYFINNGDKQQALLENPFVLL
FT                   FDKKISNIRDLLPILEQVAKAGRPLLIIAEDVDGEALATLVVNNIRGILKTVAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVIAEETGLTLEKAVLKDLGQAKRIEVAKENTTIIDGAGEAA
FT                   AIEARVKQIRIQIEEATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGIVAGGGVALIRARAAVGKLKGDNHDQDAGIKIVLRAMEQPLREIVANA
FT                   GDEPSVVVDKVQRGKGNYGYNASTGEYGDMVEMGVLDPTKVTRTALQNAASVAGLMLTT
FT                   ECMVAELAEDKPAGGMPDMGGMGGMGGMGGMGM"
FT   gene            470602..470910
FT                   /locus_tag="Daro_0427"
FT   CDS_pept        470602..470910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0427"
FT                   /product="Protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45184"
FT                   /db_xref="GOA:Q47IZ7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45184.1"
FT                   /translation="MQDTLDRVTANPKFHEFIAMRSRYSIIMAIISAAAYYGFIVLVAY
FT                   DPAFLATKLGAGMTTSLGVPLGVGVIAFTILLTWIYVRRANSEFDETNEAIIREAQK"
FT   gene            470912..472591
FT                   /locus_tag="Daro_0428"
FT   CDS_pept        470912..472591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0428"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45185"
FT                   /db_xref="GOA:Q47IZ6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45185.1"
FT                   /translation="MTKFTKILAGLLAMAVAGGAIAAGADLGNTTQQATNWIAISMFAV
FT                   FVGGTLFITKWAASKTKSAADFYTGGGGITGFQNGLAIAGDYMSAASFLGISGLVFANG
FT                   FDGLIFSIGWLVGWPVITFLMAERLRNLGKFTFADVASYRFAQTPVRVFAASASLVIVA
FT                   FYMIAQMVGAGQLIKVLFGLEYMYAEILVGSVMMMYVLFGGMTATTWVQIIKACMLLAG
FT                   ATFMAVSVLLQFGFSPEALFTKAVEVHSKHDAIMAPGALIKDPISAISVGMALMFGTAG
FT                   LPHILMRFFTVPNAKEARKSVAWATTWIGYFYILTFIIGFGAITNLVQNPGDFYVGGEI
FT                   AKGLKGGGNMAAVHLAKAVGGDVFLGFISAVAFATILAVVAGLTLSGASAVSHDLYASV
FT                   FNKGCSSEQELRVSKITTVLLGILAVVLGIAFEKENVAYMVMLAFVIACSSNFPVLFMS
FT                   VLWKNCTTKGAVVGGFVGLASAVVLTIGSASVWEAVMHNPKGSAWFPYNSAAIFSMTAA
FT                   FVTIWLVSILDNSAQAKKERALYPSQQLRSETGLGASTASSH"
FT   sig_peptide     470912..470980
FT                   /locus_tag="Daro_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.918 at
FT                   residue 23"
FT   gene            472916..473587
FT                   /locus_tag="Daro_0429"
FT   CDS_pept        472916..473587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0429"
FT                   /product="Response regulator receiver:Transcriptional
FT                   regulatory protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45186"
FT                   /db_xref="GOA:Q47IZ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45186.1"
FT                   /translation="MRILIAEDDAIIADGLSRSLRQGGYAVDWAPNGMEADTALVTVSY
FT                   DLLILDLGLPKLSGLEVLKRLRARNSQLPVLILTALDGTGDRVKGLDLGADDYMVKPFE
FT                   LPELEARVRALTRRSAGTSPTIQCGALTYDQVGRVAQIQGQTLELSAREVGLLEVLLSR
FT                   MGRLVSKDQLVDHLCGWGEEVSHNAIEVYVHRLRKKIEPGGVKIATVRGLGYCLERPPG
FT                   E"
FT   gene            473565..475070
FT                   /locus_tag="Daro_0430"
FT   CDS_pept        473565..475070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0430"
FT                   /product="ATP-binding region, ATPase-like:Histidine kinase,
FT                   HAMP region:Histidine kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45187"
FT                   /db_xref="GOA:Q47IZ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45187.1"
FT                   /translation="MSAPLASNSPTPPSETERSLFGEILDWMLAPLLFVWPLSIAFTHY
FT                   FANNVANYPYDQALREHVAAIARQVKLVNGKPQLSLPASARALLRADETDSVYFHVVTF
FT                   DGRFLAGDKELPLSQLPLDDAMVSGEIYQRDADFKGQDLRMAYTYLAEPNMPKSQWVVI
FT                   EVGETTEKRSQLANKIVASVILPQFIIIPLAVMLVWFGLSRGLRPLTRLRQTIDARQPD
FT                   DLSPIATRRVPEELEPLVEAFNEMLERMKRSVEAQQRFVADAAHQLRTPLTGLKTQAQF
FT                   AIRETDPEALRHALRQIATGVDRAGRLVNQLLTLARTEGGELAQRRHEPLDLSLLVREV
FT                   VEDWVTVAIEKDIDLGYESEGPAMISGNSFLLRELAKNLIDNALRYTPAGGRVTCRVVV
FT                   NPDTVLLEVEDNGVGISEEQADLVFERFYRVDDASTEGSGLGLAIVQEIAMQHDSRASL
FT                   RPNPLGKGAIARIAFAAWSPPPLPPPPPDDFSELYRQSPPIGT"
FT   gene            475156..475231
FT                   /locus_tag="Daro_R0014"
FT   tRNA            475156..475231
FT                   /locus_tag="Daro_R0014"
FT                   /product="tRNA-Phe"
FT   gene            475300..475581
FT                   /locus_tag="Daro_0431"
FT   CDS_pept        475300..475581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45188"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45188.1"
FT                   /translation="MPVDCRCGFSCHGRFEVLHHALAAFTGGLLAKPNYQFEKRQRDLA
FT                   KKSKQEEKRRQKLLAKGGEQEPGGLSDQPLESADSPSTPVTAGVEGQS"
FT   gene            475632..476369
FT                   /locus_tag="Daro_0432"
FT   CDS_pept        475632..476369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0432"
FT                   /product="Protein of unknown function DUF548"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45189"
FT                   /db_xref="GOA:Q47IZ2"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45189.1"
FT                   /translation="MGPAFASAALALSEALNLPSSGEADFVLQVGTEGLQLQELGPHAP
FT                   GPLSVDFVRGPLAHRRLQGGGSGQMIAKAVGIQPGVRPDVLDATAGLGRDAFVLAQLGC
FT                   NVRLIERHPVIAALLADGLQRARLDPDVRPIIERMHLQTGDAIQLMNAWEGDPPQVIYV
FT                   DPMFPHREKSSLVKKEMSMLRPLVGDDLDASSLLEAALKLATHRVVVKRPRKAPSVLGP
FT                   KVGYVLEGKSSRFDIYPKRSLKP"
FT   gene            476542..477024
FT                   /locus_tag="Daro_0433"
FT   CDS_pept        476542..477024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0433"
FT                   /product="phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45190"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45190.1"
FT                   /translation="MPAFPRDTIMDLLLWRHAEAEDGEDDLKRRLTERGEKQARAMGAW
FT                   IRQHQPKDLRIIVSPSVRTQQTAEALKLPFETNRKIGPEACVSELIAASGWPTAKGAVL
FT                   IVGHQPSLGRFASLLLAGQESEWSIKKGALWWLSNRVRRDETQTVLRAMIPVELLD"
FT   gene            477081..478199
FT                   /locus_tag="Daro_0434"
FT   CDS_pept        477081..478199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0434"
FT                   /product="Protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45191"
FT                   /db_xref="GOA:Q47IZ0"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45191.1"
FT                   /translation="MATNKKIAARSPAIAETKKPRSRPPRQRAVASGDIAPTLTPDGIE
FT                   GFTVHAAVDGAQESKLGAMRDVIAGMPPEESVALLKGLLKQQGVVAEALPTSPDDELVR
FT                   DWREGGYPYKNLMQRRNYERQKYRLQVELLKLQAWVKETGQKVVILFEGRDAAGKGGTI
FT                   KRFMEHLNPRGARVVALEKPSEMERGQWYFQRYVQHLPTNGEIVLFDRSWYNRSGVERV
FT                   MGFCTDQEYAEFVRQAPEFERMLARNGTHLIKFWFSVSREEQRRRFRERKVHPLKQWKL
FT                   SPIDMASLDKWDDYTKAKEAMFFHTDTADAPWTVIKSNCKKRARLNAMRYVLHKLPYNN
FT                   KDTDRIGNLDPLIVGRANVVFERGEHQGVPIL"
FT   gene            complement(478196..478687)
FT                   /locus_tag="Daro_0435"
FT   CDS_pept        complement(478196..478687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0435"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45192"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45192.1"
FT                   /translation="MTPTPPQARRSTEEQSRLEATLRDVFEHKLCFNELLGFKVESLDP
FT                   AAPKISFAMRQDLIGHFLHGRLHGGVIATVLDTVGGLAATVAIAEKFSGETTEQVGHRF
FT                   GRIGTIDLRTDYLHQGIGKKFTATGRVTRLGGRIASVQMTLENETGQLIATGCASYVIS
FT                   "
FT   gene            complement(478713..479405)
FT                   /locus_tag="Daro_0436"
FT   CDS_pept        complement(478713..479405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45193"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45193.1"
FT                   /translation="MAKLVLSLNGTVINQFFTDKPNLCIGQAADNDIVINDPLVGEHCA
FT                   HIVGIGEDHILESLEGDYGILVNGKACFRQILQHRDIIHLGAYHLRYLNSRVSSELNMD
FT                   RTMLIEALPLEAQAGKAITSLPSARPNKMYFPEGYVQIQKGRGHHLPGENVALDRVVTT
FT                   FGTPGEQLVVLTRRPQKIYLTHVEGPQMPRVNQKSIGREPVALQDGDLIEAASHRLEFH
FT                   LGRPPTKR"
FT   gene            complement(479421..480311)
FT                   /locus_tag="Daro_0437"
FT   CDS_pept        complement(479421..480311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0437"
FT                   /product="Protein phosphatase 2C-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45194"
FT                   /db_xref="GOA:Q47IY7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45194.1"
FT                   /translation="MSRKAKPICYISARFPAPHWLFADKLNKQRFSLEAIALSDPGRMR
FT                   ALNEDAVAVDVEYGFAVVADGMGGHNAGEIASRIAVDTLRERLPIKIQQFRAGARQPRP
FT                   HQFAEQLIGEANRAIYSTAAGHANCKGMGTTIALWLMHGEHAALLHIGDSRIYRLRNGQ
FT                   LQQLTRDDSLLRDQVESGLISANEAASSHNRHFVTRALGLELQTAVHIHEEALRAGDLY
FT                   LLCSDGLTDMVEDSDIELILDQLKTNLELAAQHLIQLANDYGGADNISVALVRVFDTAP
FT                   EKSGLLGRLLSWLKR"
FT   gene            480379..481752
FT                   /locus_tag="Daro_0438"
FT   CDS_pept        480379..481752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0438"
FT                   /product="Protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45195"
FT                   /db_xref="GOA:Q47IY6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45195.1"
FT                   /translation="MAIEQLGRFKITGTLGQGAMGTVYRAHDPLIERTVAIKTVACAGL
FT                   SKDEALAFEQRFYREAKSAGRLSHPNIVTIHDVGRNESLAFIAMEYLNGQSLRELLDSG
FT                   VVLPPERCTEIAADVADGLAFAHANGVVHRDIKPANIMVLDNGSVKISDFGVALIPSGS
FT                   TTVEGTAFGSPKYMSPEQVTGQKVDGRSDIFSLGAVLYEMLAGRPAFDGEELTAVLYQV
FT                   LHAAPPLPSSFNPELPRVFDRLIAKSMAKDPDKRYQNATDLAADLRKCRRMLREARKKA
FT                   EGDDQVRNKRQGRDASSPALVKVNPSPWLTAAALASVVSIVGALFWYYGSKPRFEAAPA
FT                   VSVAENASSPLVPAPESLAPKVPGVATEGGSKAAKVKSESAASVPVALADGVVRLAIAP
FT                   WGEVFVDGKMAGVSPPLTEVRLSPGKHHVEVRNTNFPPHRQVVEVVADKNIRIKHKFQ"
FT   gene            481761..482252
FT                   /locus_tag="Daro_0439"
FT   CDS_pept        481761..482252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45196"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45196.1"
FT                   /translation="MFLPTSPALSRFTALCMVVLLCAACASQSAPKTEGGGNQKAGGGN
FT                   QKTGSGQAKSVPTAPQALSKAQQELAAGVASYEDGAYKQAARQLQNALALGLDSGAEQA
FT                   RGHKYLAFMHCVGKRQKQCREEFGKAMAADPAFDLTPAEAGHPTWGPVFRKLKAARKAP
FT                   "
FT   sig_peptide     481761..481850
FT                   /locus_tag="Daro_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.960 at
FT                   residue 30"
FT   gene            complement(482327..484102)
FT                   /locus_tag="Daro_0440"
FT   CDS_pept        complement(482327..484102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0440"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45197"
FT                   /db_xref="GOA:Q47IY4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45197.1"
FT                   /translation="MSNLVEVKVPDIGDFAEVPIIDLFVKVGDSIKVDDAICTLESDKA
FT                   TMDVPSPVAGVVKEVLVQLGAKVAEGSLLIKVESGAAAAAPAPQAAAPAAAPAAVPVAA
FT                   PVAGSHAGGADIECEMLVLGAGPGGYSAAFRSADLGMKTVIVERYATLGGVCLNVGCIP
FT                   SKALLHVAAVMEEAEHANDLGVTFAAPTVDIDKLRAHKDKVVGKLTGGLAGMAKGRKVE
FT                   IVRGYGTFIDPHHIEVEVTDGTGQDKTGAKKIVKFQKCIIAAGSAAMHLPFIPKDPRIV
FT                   DSTGALELRFVPEKMLVIGGGIIGLEMATVYSTLGAKVDVVEMMDGLMQGPDRDAVKVW
FT                   EKQNAKRFDKIMLKTKTVAVDAKDDGLYVKFEGEGVSPEPVKYDMILQAAGRTPNGNKI
FT                   GADKAGVAVTERGFINVDAQMRTNVPHIFAIGDLVGQPMLAHKAVHESHVAAEAAAGQK
FT                   SAFDASVIPSVAYTHPEVAWVGVTEDQAKKDGRKIEAAKFPWAASGRAIANGADYGFTK
FT                   LIFDAETHRVIGGAIVGPNAGDMIGEVCLAIEMGCDSVDIGKTIHPHPTLGETVGMAAE
FT                   VAHGTCTDVPAPRKK"
FT   gene            complement(484115..485755)
FT                   /locus_tag="Daro_0441"
FT   CDS_pept        complement(484115..485755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0441"
FT                   /product="Dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45198"
FT                   /db_xref="GOA:Q47IY3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45198.1"
FT                   /translation="MSQIIEVTVPDIGDFDSVPVIDLFVKVGDTIKVDDAIVTLESDKA
FT                   TMDVPSTVAGVVKEVLVSLGSKVGEGALLIKVETGGAAAEPAAAPAPAAQAAAPAPAPA
FT                   AAPVAAAPAAGGGVVEVKVPDIGDFAEVPVIELYVKVGDAIKVDDAIATLESDKATMDV
FT                   PSTVAGTVKEVLVQIGSKVGEGTVLIKVESGASAPAAAPQAAAPAPAAAAPAPVAAPVA
FT                   APAAASPAALAPALAAGSKVHASPSVRAYARELGVDLNKVPATGPKNRIVKEDLTKYVK
FT                   GVMSGAVAGPTAGGGASLGGGLDLLPWPKVDFAKFGEIEVKPLSRIKKISGQNLSRNWV
FT                   MIPAVTYHEDADITDIEAFRVLLNKENEKGGGAKLTMLAFLMKACVKGLQKFPEFNSSL
FT                   DGDNLVLKKYFNIGFAADTPNGLVVPVVKNVDKKSVFELAQESGDLAKQARDGKLKPAD
FT                   MSGACFTISSLGGIGGTYFAPIVNAPEVAILGVNKSAMKPVWDGKQFVPRLVLPLSLTA
FT                   DHRVIDGALATRFNVYIAQLLADFRRVAL"
FT   gene            complement(485768..488443)
FT                   /locus_tag="Daro_0442"
FT   CDS_pept        complement(485768..488443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0442"
FT                   /product="2-oxo-acid dehydrogenase E1 component homodimeric
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45199"
FT                   /db_xref="GOA:Q47IY2"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45199.1"
FT                   /translation="MAEQPNALPDPADVDPQETKEWMDALDGVINQEGPTRAHYLIEKV
FT                   IGQARLQGVDIPYSANTEYINTIPAHQQPKYPGNADMEIKIHSYIRWNAMAMVVRANKD
FT                   TNVGGHIASFASAAALYDVGFSHFWRSINDPSGGDLIFFQGHSVPGVYSRAFMLGRLTA
FT                   EQMDNFRQETDGKGISSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLDSRGLAK
FT                   AGDRKVWAFLGDGETDEVESLGAIGMAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQE
FT                   LESEFRGSGWNVIKLIWGTQWDTLFQRDKKGIMKQRMMELCDGEYQTFKAKNGAYVREH
FT                   FFNTPELKELVADWTDDQVWQLNRGGHDIFKIFAAYNAAVTHKGQPTLILAKTIKGFGM
FT                   GQAGEAMNISHQQKKMDIEQIGRFRDRFGLPVPDDKLYELPYLKFAEDSEEYKYMLQRR
FT                   MDLGGFLPQRRRKAEPLQIPALDTFAALLKASGEGRELSTTMAIVRIMNMMLKDKNVGK
FT                   NVVPIVPDESRTFGMEGMFRSVGIWNQEGQNYVPEDHDQLMFYKESKTGQVLQEGINES
FT                   GAMSDWIAAATSYSVHNVQTIPFYICYSMFGMQRVLDLCWAAGDQRARGFLIGGTAGRT
FT                   TLNGEGLQHEDGHSLILSNLIPNCVSYDPTFQYEVAVVAQDGMRRMFQEQEDVFYYLTV
FT                   MNENYEHPEMPVGAEADIIKGMYLFKKGADSAAPRVQLLGSGTIFREVIAAADLLKQDW
FT                   GVEADLWGCTSMNELARNGQDVQRWNMLHPLEAPKLSHVEEKLAGAKGPVIASTDYIKL
FT                   FSEQIRPFVKAPYVTLGTDGFGRSDTREKLRHHFEVDRHWVTLAALKALADNGEVKREV
FT                   VAAALVKYNLDPNKPNPLSV"
FT   gene            488459..488701
FT                   /locus_tag="Daro_0443"
FT   CDS_pept        488459..488701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45200"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45200.1"
FT                   /translation="MHFILFCLLSKTTLARYESVREPVFSLIIVPHCKNKIRIVQYSRA
FT                   HTSHFSCMFTARFERGNAVGRQYHLPRQSSRVAKA"
FT   gene            complement(488698..488994)
FT                   /locus_tag="Daro_0444"
FT   CDS_pept        complement(488698..488994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45201"
FT                   /db_xref="GOA:Q47IY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45201.1"
FT                   /translation="MDTKTNHFRQLTAAWLALVTLTLLSLGLSEWFRDIRLLPLLVAAI
FT                   MWIKGAVVARCFIESHVAHPFIKRVLKVFIGIAPIALLATAFFGSTLARWATL"
FT   sig_peptide     complement(488911..488994)
FT                   /locus_tag="Daro_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.837) with cleavage site probability 0.548 at
FT                   residue 28"
FT   gene            complement(488997..489596)
FT                   /locus_tag="Daro_0445"
FT   CDS_pept        complement(488997..489596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0445"
FT                   /product="putative denitrification protein NorE"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45202"
FT                   /db_xref="GOA:Q47IX9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45202.1"
FT                   /translation="MTAVTIDEPPPPEDSTRRIPGNKGMWAGITCEFVEFTVLFAVYFI
FT                   ARAHFPDAFHAGAQKLSVISGTTITLLMITSSYFIACSLNAIRQDKHRAAVIWLVVGLI
FT                   IALGYPLTKALEINWNLAHGINGESGIFFTVYYYLTFTHLVHATWGILGILWVLARLLF
FT                   HGYSSRDYAGLEALACYWHATDIIWLVIFPLFYVLA"
FT   gene            489783..491657
FT                   /locus_tag="Daro_0446"
FT   CDS_pept        489783..491657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0446"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding
FT                   protein:Thiamine pyrophosphate enzyme, C-terminal
FT                   TPP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45203"
FT                   /db_xref="GOA:Q47IX8"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45203.1"
FT                   /translation="MAAVMPAPAASRVLMSGNEAVARAVWESGVKVAAAYPGTPSTEML
FT                   EVISTYPDLYAEWSVNEKVSLEVAIGAAYAGSRSFCCMKHVGMNVASDALMTLTLTGVV
FT                   GGLVIAIADDVGLSSSQNEQDSRYWGRFAHVPVFEPADSQEAYEMTKLAYELSEKFQVP
FT                   VILRMTTRINHVKSLVTVGERNEYVGAGFKKEPARFVMVPGNAGKRIPLMFQRDIALRA
FT                   EAEKSALNFIEPGSDKRVGFIASGPAYMHVKESFPNAPVLKLGFSCPAPFEKCRELAAM
FT                   VEQVVIVEEVEPLIETELKAQGLKVIGKEILPLQGELSPNVLKPAIAKLLGEPVPVMDS
FT                   VVPMKVFPRPPTMCVACPHLGVYYTLSQVRNLNISGDIGCYTLGAGHPWNALDTCVSMG
FT                   ASMGVALGMDKGRGEADKDKRIVAVIGDSTFLHMGMQGLLDMVYNKGNVTVLLLDNRAV
FT                   GMTGGQDNPGNGRDIYGDDSPRVDFAKLVSALGVKEERIHKVNPYELPVLFKTIRDEVK
FT                   VPDVSVIITDQPCVLIKDYHKLKPFEVIEDKCTGCGNCIDVGCPAIHVTRRAKEVKPSG
FT                   REVDLAFVRIESSVCTGCTLCVQPCAPGAIVHYAPVSPIKLVTKGCSA"
FT   gene            491654..492265
FT                   /locus_tag="Daro_0447"
FT   CDS_pept        491654..492265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0447"
FT                   /product="Pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45204"
FT                   /db_xref="GOA:Q47IX7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45204.1"
FT                   /translation="MSENTNILVVGIGGQGVMTATEILAEAAIALGHDAKKTEVAGMAQ
FT                   RGGVVSSHLRFGKKVLSPQITPGTADVLLGFESAEAMRWQHMLKPGGITLMNTAKLVPP
FT                   VVELGLFDYPEDPLAEIRKCGNKVVAFDATTIAQNLGDIRLGNTVMLGAIADQLPFGAE
FT                   VLLDCVLKRFQRKGEKLVELNRRAFEAGRAAVGAAEAAVA"
FT   gene            492339..493193
FT                   /locus_tag="Daro_0448"
FT   CDS_pept        492339..493193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0448"
FT                   /product="5,10-methylenetetrahydrofolate dehydrogenase
FT                   (NADP+) / methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45205"
FT                   /db_xref="GOA:Q47IX6"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45205.1"
FT                   /translation="MTAQIIDGKALAEELRQGFKARVEALTAKGHKPGLVVILVGADPA
FT                   SEVYVRNKVNGCLAIGMHSEKITYDATIDQATVLNKIAELNADPNIHGILVQLPLPKHF
FT                   DEEAVLEAISAEKDVDGFHAENVGALAQGNPRFIPCTPYGVMKMFEKGNVDLTGKEAVV
FT                   IGRSNIVGKPMALLLINAGATVTVCNSRTKDLKFHTSRADILVAAVGKPKFVTGDMVKP
FT                   GAVVIDVGINRLPDGKLCGDVDFASCLEVAGQITPVPGGVGPMTITMLLANTIEAAERK
FT                   AGL"
FT   gene            493190..493690
FT                   /locus_tag="Daro_0449"
FT   CDS_pept        493190..493690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0449"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45206"
FT                   /db_xref="GOA:Q47IX5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45206.1"
FT                   /translation="MNAVQQPVVGIVMGSDSDWPTMQAAAVILKDFGVPFEARVVSAHR
FT                   TPDLLFDYAAMAGERGLKAIIAGAGGAAHLPGMLAAKTIVPVLGVPVQSKALSGVDSLH
FT                   SIVQMPKGIPVATFAIGEAGAANAALFAVAMLANENPALNAKLQAFRQAQTEKVLAMKL
FT                   PGV"
FT   gene            493703..494032
FT                   /locus_tag="Daro_0450"
FT   CDS_pept        493703..494032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0450"
FT                   /product="Small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45207"
FT                   /db_xref="GOA:Q47IX4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45207.1"
FT                   /translation="MHHLYLAVAIVAEVIATSALKAAEGFTRLWPSVLVVAGYAIAFYC
FT                   LSILQNLMPVGIIYAIWSGVGIVLVSLVAVFVYGQVLDLAAMLGIALIVAGVVVLNVFS
FT                   KTVPH"
FT   gene            494032..495192
FT                   /locus_tag="Daro_0451"
FT   CDS_pept        494032..495192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0451"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide
FT                   synthase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45208"
FT                   /db_xref="GOA:Q47IX3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45208.1"
FT                   /translation="MPVKSAMILPPATLGMLGGGQLGRFFVSAAHELGYQVWVLDPDKN
FT                   SPAGQIAERHFCVDYNDYAALDEFAAGCAAITTEFENVPADTLDYLAKFVPVRPSAAAV
FT                   GICQNRIAEKSFLRDNGLPHGPFAAIRCEDDIRNADASLFPAILKVARFGYDGKGQATV
FT                   HNREEALVAFGQFKGEQCVLEQRLTLDYEVSVVLARDERGRVACFPTGENQHTKGILDV
FT                   SIVPARTTACVKSDAEEVAARIAEKLGYIGTMGVEFFISRGQLIVNEMAPRPHNSGHYT
FT                   IDACVTDQFEQQVRALCGLPLGEPRAHSASVMVNLLGDLWYDGETYREPDWAKLHAVPN
FT                   LKLHLYGKHHARPGRKMGHFTVIGDNAEAVQKAALAARAAIGIRDE"
FT   gene            495189..496184
FT                   /locus_tag="Daro_0452"
FT   CDS_pept        495189..496184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0452"
FT                   /product="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45209"
FT                   /db_xref="GOA:Q47IX2"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45209.1"
FT                   /translation="MSPTEADYQRAVELLRAGELVAMPTETVYGLGADAANPAAVAKIF
FT                   AAKGRPADHPLIVHLSGHDAVDRWAEQVPAVAWELMEAFWPGPLTVILKKQAWVPDAVT
FT                   GGQDTVGLRVPGHPVALELLRRFAAATGEHAGIAAPSANRFGRISPTTAAHVAEELGDA
FT                   VSMILDGGPCAVGIESTIVDCSRGEPVVLRPGHISPLHLEAILGRRPAIETAVGAPRVS
FT                   GSLEAHYAPVTPLRMVAGERLLDFINAQRHRGGKCAVISANQPPQAGMPHAWRLMPADP
FT                   VGYAHDIYAALRDMDHAGVDLIVVEAIPEDSAWAAVADRLRRAVAGAGQA"
FT   gene            complement(496216..496554)
FT                   /locus_tag="Daro_0453"
FT   CDS_pept        complement(496216..496554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0453"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45210"
FT                   /db_xref="GOA:Q47IX1"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45210.1"
FT                   /translation="MATSCNLADRQCTPCEGGIAPLENSVAAVMLDTLPGWTLDGQRLD
FT                   KTYVFRNHYEAMAFVNAIAWVSHRENHHPELIVGYKDVRVRYWTHAIGGLSENDFICAA
FT                   KLEKLLEI"
FT   gene            496667..496742
FT                   /locus_tag="Daro_R0015"
FT   tRNA            496667..496742
FT                   /locus_tag="Daro_R0015"
FT                   /product="tRNA-Ala"
FT   gene            496857..497513
FT                   /locus_tag="Daro_0454"
FT   CDS_pept        496857..497513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0454"
FT                   /product="CBS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45211"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45211.1"
FT                   /translation="MSNKSISHPVSMSFLKFHRMEDRDMTLAAKVRTHKISKDVTLSVS
FT                   GYNLIGPDSPAIEAMTDFLRVNVVAIAADASVVLANARMISRGVRLLMVANGDDQVDGL
FT                   ITARDILGEKPMQVAQARGCKRDELLVADLMTPIGHVDTLYLNEVLHARVADILDALKR
FT                   LGRQHMLVEDVDPVTGLPRVRGLFSATHIGRLLGVPVLGFELASTFAEIEAALAD"
FT   gene            497529..498935
FT                   /locus_tag="Daro_0455"
FT   CDS_pept        497529..498935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0455"
FT                   /product="Helix-turn-helix, Fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45212"
FT                   /db_xref="GOA:Q47IW9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45212.1"
FT                   /translation="MTSAEELRQLASESLLAHYAEYCEGAVIVDAAARIVWMNERYPER
FT                   LGIAVPACVVGQEIEKVIPNSLMRQVVETGRPIMLDIMEFGEAAFVVTRLPLHDKAGKV
FT                   VGAVGFMLYDDPRQMASLMARYQRLRSDLAEARKKLAEARRTKYTFASFVGTGAACSAV
FT                   KQMARRAARTTASVLILGETGTGKELLAQAIHAASLRADASFVAVNIAAIPETLLEAEF
FT                   FGVAPGAYTGAERNGRDGKFKLADGGTLFLDEIGDMSPALQAKLLRTLQEGEFEPVGSN
FT                   RLTTVDVRVIAATSRNLEKMVADGQFRADLYYRLNVITLNTPPLRERLEDFSLLADYLV
FT                   DHVCRQQGMPPRGISAGAINRLCRHDWPGNVRELANVLERALLMSDSDTLEADDLEAVM
FT                   PAVPLDSPKVVSLRPIGMAEAVAQAEREAIRLALRHARGNKAEAARQLGISRAALYEKI
FT                   SALGVDAESA"
FT   gene            499097..500494
FT                   /locus_tag="Daro_0456"
FT   CDS_pept        499097..500494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0456"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45213"
FT                   /db_xref="GOA:Q47IW8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45213.1"
FT                   /translation="MDFLIVLASLAFLMFVAYRGYSVILFAPIAALGAVLFVDPNLVAP
FT                   MFTGLFMDKMVGFVKNFFPVFLLGAVFGKVIELSGFSKSIVAAVIKLIGRERAMLAIVV
FT                   VCALLTYGGVSLFVVVFAVYPFAAEMFRQGGIPKRLIPGTIALGAFTFTMDSLPGTPQI
FT                   QNIIPTTFFKTDIYAAPWLGVIGAVFILICGLSYLEWCRRRAAAAGEGYGDGHSNEPEP
FT                   FENEKLVHPLIAILPLIMVGVMNKVFTTAIPALYGEKVSFIPAVIGKAAPVVQQTKAVA
FT                   AIWAVEGALLIGIATVFVFGWKMVFSKFGEGSKSAIGGALLATMNTASEYGFGAVIAAL
FT                   PGFLVVANALSAIPNPLVNEAITVTALAGITGSASGGMGIALAAMAETFIANAQAAGIP
FT                   LEVFHRVASMASGGMDTLPHNGAVITLLAVTGLTHRQSYKDIFAITCIKTAAVFVVIAV
FT                   FYATGIV"
FT   gene            500522..502525
FT                   /locus_tag="Daro_0457"
FT   CDS_pept        500522..502525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0457"
FT                   /product="propionate CoA-transferase"
FT                   /EC_number="2.8.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45214"
FT                   /db_xref="GOA:Q47IW7"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45214.1"
FT                   /translation="MPESRHPMAASLRASDTGKVVSARDAVRLIRDGDSVATGGFVGIG
FT                   FAENIAVALEQRFVESQAADLHGQGSPRNLTLVYAAGQGDGKDRGLNHLGHDGLLARVV
FT                   GGHWGLVPKVQALAVANRIEAYNLPQGVITHLFRDIAAGKPGTITRVGLGTFVDPRFGG
FT                   GKLNDCTKVDLVRIMEIDGEEYLFYKAFPINVGIIRGTTADPDGNITMEKEALTLEAQA
FT                   IAMAARNSGGVVIVQVERIAERGTLNPRQVKIPGILVDCVVVAEKPEYHMQTFSEPYSA
FT                   AFAGEIKVPMSAIAPMEMSERKIIARRAAMELKANAIVNLGIGMPEGVANVATEERIID
FT                   LLTLTAEPGVIGGVPAGGLSFGAATNAQAIIDQPSQFDFYDGGGLDIAFLGLAQADKQG
FT                   NLNVSKFGPRLAGAGGFINISQNAKKVVFVGTFTAGNLDVAIKDGQLQIVEDGKSIKFV
FT                   DEVEHRTFSGPEAARRGKSVIYITERCVFQLTPQGLQLIEIAPGVDLQRDILDKMEFPP
FT                   IIDGQPALMDERIFREEPMGIRPELLESPLAERLTFDAAQNLFFLDFSGLNVRNGDDIR
FT                   RIEAAVDAALDPIGHKVNAIVNYDRFSILPELIDDYITMVKGVVDRHYHDVTRYTSSTF
FT                   LRMKLGEALEKRQIAPKISETEAEAKEQLAKP"
FT   gene            502636..503772
FT                   /locus_tag="Daro_0458"
FT   CDS_pept        502636..503772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0458"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45215"
FT                   /db_xref="GOA:Q47IW6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45215.1"
FT                   /translation="MEKTSSGRLAGRKTRIALGLAMLAAAGAFFWSRSGTPTPVEAPKS
FT                   AAAVRPALTVRLTSPQTLDWPLVLPATGNVVAWQEAVIGAEIANYRITEVRVQVGDSVR
FT                   KGQVMARIASDTVASELAEAKASVAELEASAAEAKGNAERATELREKGFYSSQLNTQYQ
FT                   TALHTAQARLAAARARLQAAGLRMDKTDVLAPDDGVISARSATVGSLTQPGQELFRLIR
FT                   GGRLEWRAEVPSSDLGRVKSGVVATLTAPSGESVKGAVRAVAPSVDPQTRNGLVYVDLP
FT                   VSGAIRAGMFARGEFELAQSPALTLPQSAVVLREGFAYVFRLEGVDRVAQTKVLLGRRV
FT                   GERIEVVSGLAAEARVVESGVGFLADGDAVKIVTGAAQ"
FT   sig_peptide     502636..502743
FT                   /locus_tag="Daro_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.642 at
FT                   residue 36"
FT   gene            503769..506852
FT                   /locus_tag="Daro_0459"
FT   CDS_pept        503769..506852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0459"
FT                   /product="Acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45216"
FT                   /db_xref="GOA:Q47IW5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45216.1"
FT                   /translation="MNVSSWSIRNPTPAILFFVMLTLAGVMAFKAMKIQQFMDIDLPTV
FT                   TVTASLPGAAPAQMETEVARKIENSVATLQGIKHIYTKVQDGTAIVTVEFRLEKPTQEA
FT                   IDDVRDAVSRIRADLPGDLKDPVISKVNLSGAPILTYTVASSRMDDEALSWFVDNTVTK
FT                   ALLSARGVGAVSRVGGVTREIRIELDPAKLLALRATAADISRQLRQIQQEASGGRSDVG
FT                   GIEQSVRTIATVKSADELGAMDIVLSDGRHLRVDQVASVIDTVGEQRTTALLNGKPVVG
FT                   FEITRSKGAGEVEVADNVKRSLDKLQAEHPDIAITEAFNFVDPVIENYDGSMKLLIEGA
FT                   LLAVLVVWLFLRDGRATFVAAAALPLSAIPTFAAMYLMGFTLNVVTLLSMSLVVGILVD
FT                   DAIVEIENIMRHLRMGKSPYQAAMEAADEIGLAVIATTFTLIAVFLPTAFMSGVAGKFF
FT                   VQFGWTAAIAVFFSLVVARMLTPMMAAYLLKPVSHTEATPGWLKRYEGWAAWCLQHRIV
FT                   TLLAAAAFFVGSFMLVPLLPKGFMPPDDLSQTQIYLSLPPGATFQETLAAAEQARTIAE
FT                   ANQHVKLVYTAVGGGKAGSDPFAPAGAAEVRKATLTLNLTPRGQRSGTSKQAIENQLRQ
FT                   ALTAIPGVQVKVGLASGNAKYILVLASENGALLSEHARVVERELRTIPGLGNITSTASL
FT                   VRPELVVRPDFARMADLGVTSAAIADTLRIATAGDYDQGLAKLNLAQRQIPIVVKLPPA
FT                   ARTDLALLERLSVPGAHGPVMLANVAAVSIGGGPAEIDRYDRLRNINFEIELNGQPLGE
FT                   VEAMALKLPSLAKLPPGVIQTTVGDAEAMGELFTSFALAMATGVLCIYIVLVLLFKDFV
FT                   QPVTILAALILSVPGAFLALFITQKAVSMPSMIGLIMLMGIATKNSILLIDYVVLARRE
FT                   HGLDRWSALLDACRKRARPIVMTTVAMGAGMMPIALGLGVDPSFRAPMSIVVIGGLITS
FT                   TFLSLLVIPVVFTYVDDLILLVRTKFSSSRSRRLSPER"
FT   sig_peptide     503769..503861
FT                   /locus_tag="Daro_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.381 at
FT                   residue 31"
FT   gene            506968..509475
FT                   /locus_tag="Daro_0460"
FT   CDS_pept        506968..509475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0460"
FT                   /product="Response regulator receiver:ATP-binding region,
FT                   ATPase-like:Histidine kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45217"
FT                   /db_xref="GOA:Q47IW4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45217.1"
FT                   /translation="MAESPPAIYGQLSLRARFWLALIGCLAFIWLVTFYELDRRQMGDL
FT                   HEVEHSTEFQAQAYAENTLSLIKRLNEILLDLRTRWDGDPASFAAAVQHRQDYMADIAF
FT                   QVAVIDEHGWLAYSNLGAPKERLDLSQREHFRVHLDGRDRLFISKPLKGKVSGKWSIQF
FT                   TRPIITKDGFKGVLVVSVSPDNFASFREKLAPDAVIIIVTDSGDIMARQPDNDMAMGKR
FT                   ISGTPYLQAQAPVSGSFSRQAQLDGVKRIYGFYRLPEYGLSFVVGHSVDRVLAPYRAHR
FT                   VVIVSAASAISLAIVILLLLLFRALSLRADMEKRLQDSQAMLRSAVDTIGEAFVIYDQN
FT                   DRLAYCNEQYRAYYPTSADLLVPGKTFEEIIRAGAERGQYPEAIGRIDAWVAERLAVHR
FT                   SGNSDLIQALDDGRWLRIREHKTPEGFIVGFRIDITAVYAAKEAAEAANAAKSNFLAMM
FT                   SHEIRTPMNGILGMAQLLLLPDLSKEEGNEYARTILNSGQTLLTLLNDILDFSKIEAGK
FT                   LEFSAVAFDPAQLVRETVTLFTGAVREKGIVIDTDCQGTGGARYRADSTRLRQMLANLV
FT                   SNAVKFTTQGFVRVDAREINRDRGTALLEFSVSDSGIGIPVDKQSLLFKPFSQADSSTT
FT                   REYGGTGLGLSIVRRLAEMMGGEVGVESESGQGARFWFRIRAELIAAGAECREAERASV
FT                   GDSRPRAASESPRRILVVDDNMVNLRVAQAMLRKLGIEANAAENGLEATQAATAAERPD
FT                   LILMDVQMPLMDGLEATRKIRAWEQANNQPRLVIVALTAGAFAEDYEHCIAAGMDDFLA
FT                   KPINHDQLQQLLGKWLGSERPGR"
FT   gene            complement(509472..513128)
FT                   /locus_tag="Daro_0461"
FT   CDS_pept        complement(509472..513128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0461"
FT                   /product="Protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45218"
FT                   /db_xref="GOA:Q47IW3"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45218.1"
FT                   /translation="MLRRKLLLASTVILIASATWLTTSESGLQATTRLASSLTGGQLQI
FT                   EQASGRLSGPLDLGRLHWQSTGLDIEATQIHLDWSPSALLHGTLQIAELTVGHLHIANQ
FT                   PSASPSIAPTDLRLPLAIEVQKLAIATLSYGEAFTATDLAARLSSDGRQHRLEDFHAQT
FT                   AGITASARATLDGAAPFRLEASAEIAGRLDERALAMSATADGQLERISLSAVASQGIAG
FT                   HAEVVLTPFANAAFASARILLEDIDPAIWLAGALQARLSITADVQPEGDGIVGSFGLTN
FT                   HQPGPLDRQRLPLNTLAGTLDWQGNTARFASLHAALPGDGDLDGSGEWQDGALKLALTA
FT                   SRLDASRIASILRPTRLNGPLATTLGAKRQDLKMALKDKTFSLLVEASHADGRVELPQL
FT                   QLAAGDARLNAHGELDLKKPRRFAAEGELLRFDPSRFARLPSAQINASFKAGGQLAAQP
FT                   TIDGSFTLKDSRLAGQPLSGQGQIRVAWPRIPQADIQLASGVNRLTAHGAYGQPGDLLS
FT                   IQIEAPQLAPYGLEGGLSSRFELTGGAQNPRLAGTLNAARLGLPGVIRLNELSLKSEAG
FT                   SEASSPLILDINIASIDMPDQPSLLKLIRFQGNGTNQSHQLNASAEVAGKNRLTLAAEG
FT                   ALGSDYSAWQGKLLEARLNSTDQARNFRLDAPAPIKLAATGWSIGPIRLAGDPLDWQAT
FT                   LQASADARQLHTSLNARGSRIGQVDGELSAAMRGAWSLDRQARWQGRLKSDIADLGWLA
FT                   ELIGEGWQSEGRLAGELQLAGTPAAPLSSGRFRGEKLALRLPGQGLNLANGELDVDLRA
FT                   NLLRINRLGFDSLLQALPRPLRLEVRDDLAGLTQKPGRLEVTGEMRIDQGQAQDKAFLD
FT                   IHLDRLGAYQLPDQWVAVSGDGRLTWQDGTLGAQGKLAVDAGYWQLAPSGMPRLSDDVI
FT                   VKRPGKDKAAATLRPKLNLDITTDLGRNFRFNGAGLSSRLGGEIRITARGRDLPRASGT
FT                   IRTRDGRFDAYGQKLEIERGMLNFNGLLDNPGLDVRAVRKGLAVEPGVQISGTAQKPVV
FT                   KLVSDPELPDAEKLAWLVLGHGPEQMGAGDATLLFSAAGGLLGNDSGNVIQQLKKTFGF
FT                   DEFGVRQGNLGDTGGRQQISRVAGGNSVDTTSTTGQQILSVGKRLSSNALLSYEQTLGR
FT                   AEGIVKLTVNLTRQIAVIGRAGSDNALDVFYTLTFGRDTAADKARPPAGQKP"
FT   gene            complement(513130..514809)
FT                   /locus_tag="Daro_0462"
FT   CDS_pept        complement(513130..514809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0462"
FT                   /product="surface antigen (D15)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45219"
FT                   /db_xref="GOA:Q47IW2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45219.1"
FT                   /translation="MIARRLPLLLLLCLAQPVVAGELDLQAPDNITKLLAPYLPDEAGS
FT                   PGKLQGLLSEILATEGYFSPVFEFAEKGDGLKLTLDPGLRTTINSLDLLIDGPVEAGTR
FT                   KALIDDWALPVGQPFRQEGWNTAKQQILSRLLAVEHADARLLDSEASIDTEAHRADLRA
FT                   HYDAGPRYRFGPLHVEGLQNYSPELIERYNRSVQPGQPYREDKLNALQTTLQSTPYFAS
FT                   VQTMLDRDAVEVHDDGTATAPILVRVRERSPHRVSFGAGASSNTGARVEFNYHTPNLFA
FT                   QAWELDSGLRLEQKRQTAYADVFLPPDERNRRHSVGVMAEATDIQNLKTERYAFGAQTI
FT                   QQRGSVEQRLSLNWQNEKRDPDGASPVTSRALVPNGTWTWRHVDSLIEPRNGTVLQGQI
FT                   GGGSKAALSDQNFIRFHARFQHYIPLGRVDTLTLRGEIGYTLADSRQRIPQDYLFRTGG
FT                   ASSVRGYAYQSLGIKEGNATVGGRYLGIASAEVTHWLDEAWGIAAFVDAGDAVDSLQDI
FT                   RLAVGYGLGARWRSPAGPIGVDLAYGERTRQVQLHFSLAIPF"
FT   sig_peptide     complement(514747..514809)
FT                   /locus_tag="Daro_0462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(514819..516879)
FT                   /locus_tag="Daro_0463"
FT   CDS_pept        complement(514819..516879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0463"
FT                   /product="probable site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45220"
FT                   /db_xref="GOA:Q47IW1"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45220.1"
FT                   /translation="MIKKLRACLYWFLGKTAPLGNPIANALERFRDAEADTLELTRQLV
FT                   AVLRPQNRRDHAAPERYLAMLEQLESDASLRAAFRGHIVHFIATRRLVTFFTESGILPG
FT                   TGFFSEWWRILGSRLLPEVPDERRLKDCLHVIYDRASDWRWLEDIPAEASQRFWELIAP
FT                   AEELRTIDWRSIQEQMLDGMLLLAHRVSGLGVESELMRASPNFDDDTPRFVALSAEALD
FT                   FVNAFRAALNDPEQTPDDGSQLLVIADQCQDTLQRIRKRALTIGTSLHLSYLLTRSEQS
FT                   LERLRDLAAILTAGEQSTARGEAIQAWVEFAHAAFLAENRRNSLRFYIGQLSHLLAVRV
FT                   TENAARSGEHYICDTPADYGRMWRSAAGAGVLISLMALLKIKAAALHAPLFGEAFMFSM
FT                   IYGLGFVIIFLLGMTVATKQPAMTAQTLASLIGDLKLNRSADLERLVDVIAAVSRSQLA
FT                   AIAGNVMVALPVAIAVGLGLGFLADVPPITVDKGAHLLADLDPLSWALPHAAIAGFYLF
FT                   LSGLITGYFDNRAAYADIGPRLARLRWLRAFFGQERAGRIGNYIQERLGGIMGNFLFGC
FT                   MLGSTGVIGTILGLPLDIRHIAFASANLGYALTGFQFELPLKAVAWAAFGIAAIGFTNL
FT                   AVSFTLALRTAMRARGIRFEHGGPLLKAIWVRLRLQPRSFLLPPRQASVDA"
FT   gene            517048..517701
FT                   /locus_tag="Daro_0464"
FT   CDS_pept        517048..517701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0464"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45221"
FT                   /db_xref="GOA:Q47IW0"
FT                   /db_xref="InterPro:IPR002368"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45221.1"
FT                   /translation="MNIVKKSLVLALLAGIGFSAVAQERVYLIDQRDVVAKSGFGLCWR
FT                   DGYWTPAAAAADKAGCECDKDLLPASACGAAPAAAPAGAAAAGVKPSGEKITVAADALF
FT                   DFNKAVLRPAGKAKLDELVSKAKAIKLEVILAVGHTDRIGSDSYNQKLSEKRAAAVKEY
FT                   LVAKGIEANRVYTEGKGEKQPVTGDKCKGNAKTKALIDCLQPDRRVDIEVIGTK"
FT   sig_peptide     517048..517116
FT                   /locus_tag="Daro_0464"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            517763..519952
FT                   /locus_tag="Daro_0465"
FT   CDS_pept        517763..519952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0465"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45222"
FT                   /db_xref="GOA:Q47IV9"
FT                   /db_xref="InterPro:IPR001423"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45222.1"
FT                   /translation="MSLLRPLSRLLIAVLVSASTAVVAADAARPRIGLVLGGGGARGAA
FT                   HIGVLEVLEKLHVPVDCVAGTSMGALVAGTWAAGMSPATMRQNLAAADWGDMFIDDPEY
FT                   AELSHRNKQMARRFLPGSESGVMADGVKYQPGVVTGQKIKLFFNQLLRANQGERNIEDL
FT                   PLPLSVIATDIGTGERVVFRDGPLTQAMRASMSVPGLLAPVDHQGRKLVDGGLVDNLPI
FT                   AEVRERCQADVVIAVNVGSPLLKAEAIGSLLTVSAQMIAILTEQNVSRSLTLLRQGDIY
FT                   IKPELGAITAGDFSKHAEAADLGRQAAEAMRPQLAQLSLDEAAYLAWWQGIEVRRRTSP
FT                   RIDEIQITGLNKVNPAAIERHLHVEPGETIRPSAINHDLLRMYGDGWYESVDYTVLTQR
FT                   DKNILRVMPLEKRWGPDYMRFGINLQADNSQGTSFGLRAAYHSTWLNRLGGELLVTGDV
FT                   GSTNRLGANFYQPLDARQRFFAEATTGVEQSRLNIYQDDRRIAQYKVTESGFGTYLGVN
FT                   VGVLGPLRLGWLQRHRYYDPDIGVPSLPKADQAFGGWKIGLDFDQFDRMHFPTRGWAAQ
FT                   LSYFDSPEAGYSRADANLQGAFSLGGTVFNARFRYTGSPRGELPVYDAAQLGGFLNMTA
FT                   FAPNQLIGDDVRYAGLRTEQIIGSLPLGLRGDMRLGLALEAVQLGKRYTETNRSGILDS
FT                   AAVYLGGQTPLGMAYVGFGYSTSRVSNLFLFVGTP"
FT   sig_peptide     517763..517837
FT                   /locus_tag="Daro_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 25"
FT   gene            519936..520733
FT                   /locus_tag="Daro_0466"
FT   CDS_pept        519936..520733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0466"
FT                   /product="Competence protein ComEA helix-hairpin-helix
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45223"
FT                   /db_xref="GOA:Q47IV8"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45223.1"
FT                   /translation="MSVRPEPKTGGILTNSPFWRENMKSRFLLLMASCLLWAGVALAQI
FT                   NINTATPEQLDGLKGIGPTKAKAIVDYRKKNGPFKSVDELQNVPGIGPATLKDLRPDVV
FT                   VSGTSRAPVTASTPAARPLAETPKPAALPPARPMVKSNQEAARPAAPALPGKTAPAPVA
FT                   AEKPATPAGPAKPAMPGKPAVDSKPQAVPAVAAEKLTAPAAPARPAMPGKAANEAKAAA
FT                   PASAMKPASPPAVPAKPASPATKPAAPAAPAKPAAPAGPAASY"
FT   gene            520761..523499
FT                   /locus_tag="Daro_0467"
FT   CDS_pept        520761..523499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45224"
FT                   /db_xref="GOA:Q47IV7"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019925"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45224.1"
FT                   /translation="MSDSLTLCATTRLAQTLRGELPAEQAVWRTRQALTLGQWLATLAD
FT                   EALLSGIADLPVALDAFSERLLWEKVIAAALTEAAPLFDIQGMAASAAEAQALCRVWKL
FT                   KPGGGELSDEAKLFIGWQADFDKRCRAAGWIDAAGLQRQLIELIAAGHFALPSVIILAG
FT                   FDRYTPLEQDLMAALAVRGVIVESSPDFPVEGSAQERLACADVEAECHAVVAWAREQLV
FT                   ARPDCRLGIVAPDLAGVRDRLEFLLDDVLHPALIRPDAAEVPRCFNFSLGRALADLPLI
FT                   RVGLDLLALGSGRAKVEQGRLSGLLLAGGWSAAEAEADGRARLDAALRRDLPYFTTLPA
FT                   LIKLAGRLAENEPPLCPQTIAALEAFVETAGAATRKLLPGQWSGVFRNCLKAAGWPGDR
FT                   PLSSHEFQARQAFGEVLDGFGRLDALLGPLAFAEAVRRLSQLCRQRLFQPETRGRPAIQ
FT                   VLGVLESAGLGFDALWVMGMNDDQWPPPPRPNPLLPAEMLRAVGAAHASAEVELDFARR
FT                   VHVRLSHSAPVVTFSYARAEGNRVLRPSPLIAGIPLAGEKNAELETLARQMAGVAVSSV
FT                   DQIDDALAPPVAEGEKVSGGSWVLRAQAICPAWAYYQYRLGGEAMEEPVEGLDPAARGT
FT                   LVHEALEAFWTAIASFDALVALDEAAREQAISEAVGKALQHFELDRRTTLPARFRELEA
FT                   ARLAKLLDLWLQVEARRGLPFEVVACEQPAEVEIEGIKVKMVVDRIDRLADGRQIIIDY
FT                   KTGAAIDTKNWAEQRITEPQLPIYAALVNDEVTAVVFAKVLLDKPGFAGVADEKDILPG
FT                   VQGIGDDKQKIFDPAEFPDWIAVITHWRERLHAVAKEVKAGQAGVVFANEKDLQYCEVL
FT                   PLLRLPERRRLLAGFVAHSGSEAANRLLGQTFPVSSSEIGR"
FT   gene            523503..526907
FT                   /locus_tag="Daro_0468"
FT   CDS_pept        523503..526907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0468"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45225"
FT                   /db_xref="GOA:Q47IV6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45225.1"
FT                   /translation="MVLAIDRLEEDRIARQRALEVASFIVEAPAGAGKTELLTQRYLRL
FT                   LAVVEHPEEVLALTFTNKAATEMRDRILGSLELASGDKLPEQPHKQLTFGLARQVLAHD
FT                   AERGWSLLGHPGRLRITTLDSLCASLARQMPYLSRFGSQPGVSDDAEAHYATAARRTLE
FT                   MVESGSDDAEVIAEALAFMDNNAGRLEKLLIAMLGRRDQWLHHASRIESGAMKREVEAG
FT                   FAALIERDLAAVGGLLDGRMQSLLMPLARFAAANAPGLLDAIADWSSPLTAAIADLPTW
FT                   QALAGLLLTGTGTLRKSVDKRIGFPADKELADQKKAMLELLGDLRSVDGLEAALAMLVK
FT                   LPQPELSEAEWATVECFSRLLRLAAGQLWLAFQEAGEVDFIEIAARAGLALGDDDAPTD
FT                   LAQALDYRIRHLLVDEFQDTSPSQVGLIEKLTRGWMPDDGRTLFVVGDPMQSIYRFRKA
FT                   DVGLFLRVRERGIGDIRLGHLRLFRNNRSYPGIVDWVNAAFPSIFPAEDSPEAGAVRYA
FT                   ESAATRSPRADSGVVVHPVIEHEGGDAAGEEARRVLTIIREARRAAPAERIAVLVRARS
FT                   HLDALVSEIRRSAPELRFQAVDIEGLDGRQHVQDLLTLFRALHHRADRVHWLALLRAPW
FT                   CGLKLADLHALAADDKKSTIWQLMQDEARLARLSDDGQQRLRHVLGVLHQAFAGRDRQH
FT                   PRRWLEGVWLMLGGPRCLEAPEALNDVEAFFALVDKLVASRTLSAETLAAHAAELYAPS
FT                   DPLGDAVQMMTVHKSKGLEFDTVILPGLHRETGGNDSSLLLWDEVAGADGDEHLLVAPI
FT                   KQKGAGNGEPTAYDYLKKLEAERAAHEDERLLYVAATRAIRRLHLLGIAVADAKKEEGL
FT                   KSPANGTLLKLLWPGVAQREFLAALTEGESGEPARASIDPATFVPPLVRLREVHVPPAL
FT                   RSPAEGVRPADNPVDLDTPESTLSLEASVGTLVHRCLELIAKNGLPAWSDKRISGLQPV
FT                   YQRWLQAQGHSEADAESGAGEVVAALVSTLASDTGRWLLTDHPQSAAEQAWSSTDGSLT
FT                   VNHVIDRVFVADACRWIIDYKTVRLPDAELPQRAESYRPQLERYASLFAGDPLPLRLAI
FT                   YFPLQGRLIELPAAMPSARAAQFSLFE"
FT   gene            526989..527741
FT                   /locus_tag="Daro_0469"
FT   CDS_pept        526989..527741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0469"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45226"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45226.1"
FT                   /translation="MLRSLAISLLFFALPAAGLLGGAVRAAEPVLRVVVLENSPPMSYR
FT                   DETGQLTGFSVEIARALCQEIRANCAFDVADQSTLLDTVAKGKADIAAAAVFETAERRG
FT                   RLLFAKPYYRSLSLWLARPDVVPGRSGIRVAVVHGSAQEDYARRQGWEMHQVRNNADLA
FT                   GVLLGGEAQAALVPMISALQLQKSDPFRRLGLAPTVLRAPELSGDASFGISSRRPGLRE
FT                   EINAALDRIKRNGTYDRINSRFLPFRVS"
FT   sig_peptide     526989..527069
FT                   /locus_tag="Daro_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            527827..529065
FT                   /locus_tag="Daro_0470"
FT   CDS_pept        527827..529065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0470"
FT                   /product="GGDEF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45227"
FT                   /db_xref="GOA:Q47IV4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45227.1"
FT                   /translation="MHAGRAFGFLAALFVLAFGLAVVLLAMDQQRVIDANAHLEEQTVP
FT                   EIIRYQRLARNLEQLRQEGERIFAVSSHASRQQSMFVVTLIASHPSVLEHPGAAKLARE
FT                   TEQFLGEVVRQSVRDEQRPAIHYQEWQRLASRLGIQVDDVSIEGINLATSDLNVAADAM
FT                   RLARYKLIIALLLVGLFLLAFIVLVRRHLIQPLQRIDHALSNLSAASPLPDFDTSRMLE
FT                   IQAVEEAIREHHDLLIQNEQARQVLEKLANKDGLTGLMNRRFFMQSAEAELQRAQRYRR
FT                   PVTVAMADLDFFKKLNDTYGHAAGDAVLCAFADLVRDSSRQSDLVCRYGGEEFAFLFPE
FT                   ISPTEAEALAERLRASCANAEIGLPDGRTVKVTVSMGLADASECPIEIALKHADDALYE
FT                   AKRLGRNRVVLGA"
FT   sig_peptide     527827..527907
FT                   /locus_tag="Daro_0470"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            529155..530822
FT                   /locus_tag="Daro_0471"
FT   CDS_pept        529155..530822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0471"
FT                   /product="phosphatidylethanolamine:Kdo2-lipid A
FT                   phosphoethanolamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45228"
FT                   /db_xref="GOA:Q47IV3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45228.1"
FT                   /translation="MRRLLDALLRFGQRLAGGQVIASIETVTLLVSLFFALFCNQLFLR
FT                   GMLAGYDMAQPGSWLLAGSLLVGLAAVHFIMLSPFMTRWTTKPLLALLLVATAFAVHFM
FT                   TRYKVYLDTNMLRNVLATDVREARDLMTWSLIPQLLLYAALPLWLLSRLRLKQRTVGRA
FT                   LLVRLGSIVLALLVLGGAIFLNFQDIASLMRNNREFRFLVTPANYLYSLVQVSRSQALA
FT                   VEAAREPVGADAQPGPGWKNRDKPVVMVMVLGETVRAANWGLSGYARQTTPELAAEAGI
FT                   INFADVTSCGTDTETSLPCIFSPWGRRKYDEARIRNSESVLDVVARAGFRVVWVDNQSG
FT                   CKGVCKGVESIRPDLAKSPDHCFGGECQDGALVDSLKQLVDETPGNLMIVLHQMGNHGP
FT                   AYFKRYPDEFKAFKPACEDPDLPHCSEDSIVNAYDNAIRYTDHVLASLVRTLRDHQSHD
FT                   SALLYVSDHGESLGEKGLFLHGVPYKIAPEVQTKVPMVMWFSPGFAPSFALDTACLGKV
FT                   AASPQSHDNLFHTFLGLLDVKTSVYAPEMDFSAKCRKG"
FT   gene            complement(530831..531205)
FT                   /locus_tag="Daro_0472"
FT   CDS_pept        complement(530831..531205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0472"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45229"
FT                   /db_xref="GOA:Q47IV2"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45229.1"
FT                   /translation="MTDAAAFKGKKGLTRLWNALGYSRDGLAAAWKNEAAFREEVLLAV
FT                   IAIPLAVYLGKTGIDRALMVGSIILILIVEILNSGLEAVVDKASPEKHELAKRAKDMGS
FT                   AAVLLSLINAAAIWAFVLLG"
FT   gene            complement(531202..534027)
FT                   /locus_tag="Daro_0473"
FT   CDS_pept        complement(531202..534027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0473"
FT                   /product="Excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45230"
FT                   /db_xref="GOA:Q47IV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45230.1"
FT                   /translation="METIRIRGARTHNLKNINLDLPRDQLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLFARAGTPYCPDHNQPLEAQTVSQMVDTVLALPAETKLMILAPVVANRKGEQV
FT                   DLFTELRAQGFARVRVDGTVYEIDAVPKLAKTQKHTVDVVVDRLKVRDDMRQRLAESFE
FT                   TALRHAEGRAIALEMDSNVEHLFSAKFACPVCSYALQELEPRLFSFNNPMGACPKCDGL
FT                   GVIQFFDPKRVVTQPTASLAGGAIRGWDKKNQFYFQIIESLADHYGFSVDTPWNDLPEK
FT                   VQQLVLYGSGNVAINFRYLNEKGTRFDRSHSFEGIIPNLERRYRGSESNAVREELAKYV
FT                   SSSACPSCAGTRLRIEARHVRVGDKTLYEISRMPLGEARNYFNCLTLTGAKAQVADKIL
FT                   KEITARLSFLINVGLDYLCLERSAETLSGGEAQRIRLASQIGSGLTGVMYVLDEPSIGL
FT                   HQRDNDRLLETLKNLRDMGNTVLVVEHDEDAIRAADYVVDIGPGAGVHGGFIVAQGTPA
FT                   EVQANPLSMTGDYLSGRKSISAPKTRRVPDPNKQLKVVGAYGNNLKDVTLEIPGGLLTC
FT                   ITGVSGSGKSTLINDTLYAAAARHLYGSTTEPAPHKEIIGLELFDKVINVDQAPIGRTP
FT                   RSNPATYTGLLTPIRELFAQVPESRVRGYGPGRFSFNVKGGRCEACQGDGMIKVEMHFL
FT                   PDIYVPCDVCHGKRYNRETLEVQYKGKNIYDILGMTVEQAREFFDPVPNIARKLQTLVD
FT                   VGLSYITLGQSATTLSGGEAQRVKLALELSKRDTGRTLYILDEPTTGLHFQDIEMLLSV
FT                   LQRLANNGNTIVVIEHNLDVIKTADWIVDLGPEGGDGGGRILVSGTPEEVAKCKASHTG
FT                   RFLKPLLEKKK"
FT   gene            534258..535043
FT                   /locus_tag="Daro_0474"
FT   CDS_pept        534258..535043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0474"
FT                   /product="Peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45231"
FT                   /db_xref="GOA:Q47IV0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45231.1"
FT                   /translation="MKFVSPLVRALPVAALSALLLSACSNTGNSVSAANAEGLMSAGKS
FT                   VAQAATLSDAEVMQLSDKSCAELDGQSKIAAPKSKYALRLAKITKSMPKDVNGVAISYK
FT                   VYETKDVNAWAMNNGCVRVYSGLMNLMTDDEIRGVVGHEIGHVALGHSKKSMQVAYAAG
FT                   AARQIAAVSGNSAVAALSSSDIGAIAEKLVNAQFSQAQESDADDYSFDLLTAAKLKREG
FT                   LISAFEKLAKLGDSNSMRSSHPSSSGRAQHIRDRIAAKK"
FT   sig_peptide     534258..534359
FT                   /locus_tag="Daro_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.526 at
FT                   residue 34"
FT   gene            complement(535456..536073)
FT                   /locus_tag="Daro_0475"
FT   CDS_pept        complement(535456..536073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45232"
FT                   /db_xref="GOA:Q47IU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45232.1"
FT                   /translation="MGIIINPVCKRLSSGGEMNTIKKMLAIVAILTLVPILAYLFLLGQ
FT                   SHAYVSDLSLEQDFAENAGLLWKWMADINLPGIGRPGVIHVERLEVVHALRNSVFVFCT
FT                   IGTVALISVPAILAGIVLTPIGLFTGDWKTFGIGLLCFLASPLSLALAALSALLIWVLF
FT                   FLQPCTPGYVIVWFLLGAPIAALGGLFGAAPAGSIVIIIFKE"
FT   gene            complement(536292..537251)
FT                   /locus_tag="Daro_0476"
FT   CDS_pept        complement(536292..537251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0476"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45233"
FT                   /db_xref="GOA:Q47IU8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45233.1"
FT                   /translation="MELRQLRYFLAIAEHGSFSKAASSVHVAQSALSHQLAQLEDELGQ
FT                   PLFHRLPRGVALTPAGRAFHPHALSILRQVEDARHSVTQAEGETVGKVIFGIPHSVSQA
FT                   LALPLLKAVRAALPRVELELTEELTGNLIPQLRTGLIHLAVLFDDGQLDEFRCHPLLEE
FT                   ALLLISPAEAPDAPSGPISLRDALRLPLILPAWPHGVRPIVEAAARQAGRAAPNVVADI
FT                   SSISILRTSLLAGLGHTLLPPMPLLHELDSGALRATPIAPETLTRRIMLCASRQIPASA
FT                   ATLAVAHVAQTLVGQLCADGSWREAQLIATESPPFIES"
FT   gene            complement(537517..538848)
FT                   /locus_tag="Daro_0477"
FT   CDS_pept        complement(537517..538848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0477"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45234"
FT                   /db_xref="GOA:Q47IU7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45234.1"
FT                   /translation="MTDDLKILIIEDDPDVALGCEQALQLEGLAAECAGSAELARHRLH
FT                   ADFPGIVISDIRLPGQDGLSLQRELHALDPELPVLLITGHGDVSMAVQAMKDGAYDFLQ
FT                   KPFAPEQLVDIARRALEKRRLVLEVRALRRQLDQRNLLEARLIGNSAGMARVRGLIGAL
FT                   ASSAADVLIHGETGTGKELVARCLHDASPRAKGNFVAINCGGLPETLFESEIFGHEAGA
FT                   YTGAGKRRIGKIEYANGGTLFLDEIETMPVPMQIKLLRVLQERTLERLGSNTAIPIDCR
FT                   IIAATKEDLTALSEQGKFRADLYYRLSVANLPLPPLRERREDIPLLFEHFLLQAAARHE
FT                   RAVPTTSAGRMQQLVGYHWPGNVRELRNVADRCVLGIEAGSPPFGQPAGDAPRPLAETV
FT                   DAFERALIADALRRYGSLARTAEALLIAKTTLHDKIRKYGLHGE"
FT   gene            complement(538845..540695)
FT                   /locus_tag="Daro_0478"
FT   CDS_pept        complement(538845..540695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0478"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45235"
FT                   /db_xref="GOA:Q47IU6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45235.1"
FT                   /translation="MPRLRSLPLLLLCLLLVALSGFSAYRIAQRLGIADLQATGLHRLD
FT                   LYAASLEREISKYAFLPGTLSLEPEVLDLLAGTAGDSAAARVNGYLEKLNERAGTLSIY
FT                   VMDTRGKVLATSNWRRPDSFLGEELSFRPYFREALESGNGRFFGIGTTRGEPGYYLASA
FT                   LTGDNGTLGVAVIKVSLEQLEKSWTTVEAPVLVADENGVVILSAVPGWKFTTLRPLDDS
FT                   TRAAFDHTQQYNRRALQPLGIKQIEDYDHGARLVRIAANGPETVSVYPVTGRFLEQSRT
FT                   LPGTPWTLTVLSHLEQVDDLAQSRAALAAIAAACLCLLGVILNERRRHLRDRLAAREAL
FT                   QQAHDELERKVEERTADLSSANQQLQDEVGERIRAERTLRAAQDELVQAGKLAVIGQLS
FT                   TGIAHELNQPLAALRTLSANAERFLERGDVDTTRTNLGRIADLVDRMGRITGQLRNFAR
FT                   KSSGQSAPVPLCHALDNALALLDARIRRAGAEIERSCPVDEPVALCDANRLEQVLINLV
FT                   GNALDAMADQTRPRLELAWECAEGMVRLHVRDHGPGLSDEALAHLFEPFFTTKPAGDGL
FT                   GLGLAISAGIIRDFGGSLHGANHPDGGAIFTLELPLAPAP"
FT   sig_peptide     complement(540609..540695)
FT                   /locus_tag="Daro_0478"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.890 at
FT                   residue 29"
FT   gene            complement(540735..541490)
FT                   /locus_tag="Daro_0479"
FT   CDS_pept        complement(540735..541490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0479"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45236"
FT                   /db_xref="GOA:Q47IU5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45236.1"
FT                   /translation="MIDWTLLAPAAFFAGMVDAVVGGGGLIQIPVLLGQFPQTAIPTLF
FT                   GTNKVASIAGTGAALWRYARRVRIPWAVVLPATVAALLGAWGGAALVAWLPRETMRPLV
FT                   VVMMIAVAVYTFMKKDLGQQVTRVIDGRDRWKGALFGGLIGVYDGFFGPGTGSFLIFGF
FT                   VRLFGMDFVQGSASAKVINFATNLSAIAFFASHGPLLWQVGLVMAVCNLAGSWVGTHLA
FT                   LKHGAGFIRKAFLGVVVVLIAKQLADLFG"
FT   sig_peptide     complement(541431..541490)
FT                   /locus_tag="Daro_0479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.899) with cleavage site probability 0.887 at
FT                   residue 20"
FT   gene            complement(541595..542896)
FT                   /locus_tag="Daro_0480"
FT   CDS_pept        complement(541595..542896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0480"
FT                   /product="Sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45237"
FT                   /db_xref="GOA:Q47IU4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45237.1"
FT                   /translation="MKMNRLTTWIGIAMLLGVIVGYACNALAPSPAAAKEIAGYFGILT
FT                   DIFLRLIKMIIAPLVFATLVAGLANMGDSKTVGRIGGKALGWFVGASFCSLLLGLIFAN
FT                   LLQPGVGLSVPLPEASATLNLKTSALNLKDFITHVFPKNIFEAMAANEILQILVFAVFF
FT                   GLALGHLHNQMARSLVCTMEEVVHVMLKVTDYVMRFAPVGVFGAVAGAITTNGLGMLLV
FT                   FGKLLVSFYAALAALWIVLITAGYFVLGKDIFRLLKLIRGPMLVGFSTASSESVYPKLM
FT                   EQLEKFGIRNRVVSFVLPLGYSFNLDGSMIYTTFAALFVAQAYDIPMTLTAQITMLLVL
FT                   MVSSKGIAGVPRASLVVVAAVLPMFNLPEAGLLLVLGIDHFLDMGRTVTNVLGNAIATT
FT                   VVAKWENAIDPVPPELADADEALPVPEEPAALAA"
FT   sig_peptide     complement(542792..542896)
FT                   /locus_tag="Daro_0480"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.929 at
FT                   residue 35"
FT   gene            complement(542936..544360)
FT                   /locus_tag="Daro_0481"
FT   CDS_pept        complement(542936..544360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0481"
FT                   /product="Aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45238"
FT                   /db_xref="GOA:Q47IU3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45238.1"
FT                   /translation="MTTTPFRLEHDLLGDREVPTAAYYGVHTLRALENFPITGISIAVY
FT                   PDLIRALAQIKKAAAQANQQLGLLDARRAGAIAEACGEIIDGQWHNQFVVDVIQGGAGT
FT                   STNMNANEVIANRALELLGKTRGDYKTLHPNEHVNMSQSTNDVYPTALKLATYVGIFRL
FT                   VEAMAYLRKAFERKADEFADVLKMGRTQLQDAVPMTLGQEFSTYAVMLGEDEERLKEAA
FT                   LLIREMNLGATAIGTGINAHPDYAPLVCRKLAEISGIPVVTAPNLIEATQDCGSFVQLS
FT                   GVLKRVAVKLSKVCNDLRLLSSGPRAGFNEINLPPRQAGSSIMPGKVNPVIPEVVNQIA
FT                   FEVIGNDTTVTFAAEAGQLQLNAFEPIIAHSLFKSALHLTNGCRVLADHCVNGITANRD
FT                   QLRESVERSIGIVTALNPYIGYANATEVAAEAFRSGRGVAEVVIERGLMSPEQLAEVLR
FT                   PEVLTRPQVIPLPVAA"
FT   gene            544619..545842
FT                   /locus_tag="Daro_0482"
FT   CDS_pept        544619..545842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0482"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45239"
FT                   /db_xref="GOA:Q47IU2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45239.1"
FT                   /translation="MQHNQTIMSAPTDRMSPEERRAGASLASIFALRMLGLFLILPVFS
FT                   VYAKTLPGGDNLALVGFALGAYGLTQAFFQIPYGIASDIFGRKLVIVVGLLIFALGSFV
FT                   AAWAPDMNWIIVGRVLQGAGAISAAVTALAADLTREEHRTKVMAMIGSSIGLVFALSLV
FT                   GAPILYGWIGMSGLFIMTGVLALSAIVLLIKAVPPAPAPQGHEKLPLRRVIFDPDLLRL
FT                   NLGIFTLHMVQMAMFVVLPHALVNHGGLEAASHWKVYLPAVLVSFAIMVPAIIAAERKD
FT                   KMRPIFIAAVGLLVVVQAGLFVLHESLWALALWLLLFFVAFNVLEATLPSLVSRTAPPA
FT                   AKGAALGVYNTTQAIGLFIGGAAGGYIAQHFGDNAVFAACTGLVLIWLVVANSMNFPQR
FT                   RPVAAATR"
FT   gene            545859..546329
FT                   /locus_tag="Daro_0483"
FT   CDS_pept        545859..546329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0483"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45240"
FT                   /db_xref="GOA:Q47IU1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45240.1"
FT                   /translation="MASVNKWIGIGNLGRDPETRFTASGEAICNFSIACTESWKDKQTG
FT                   ERKEMTEWVRISAFGKLAEICSQYLKKGSQVYVEGSLRTRKWTDKDGQERYTTEIRCDD
FT                   MKMLGSRQGMGAPAGGGGGGGSGYDEPTDYSPAPPKNKPKPSFDDLGDDIPF"
FT   gene            546367..547215
FT                   /locus_tag="Daro_0484"
FT   CDS_pept        546367..547215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0484"
FT                   /product="Metal-dependent phosphohydrolase, HD subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45241"
FT                   /db_xref="GOA:Q47IU0"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45241.1"
FT                   /translation="MANAVTFKVLEDIARDLSGSEITFPTFLDITFQVRSALKDPNLSV
FT                   EQLAKLVGAEPLMSAKIIRMANSVALNPSGREIADVKNAIVRVGMEAVRTVSFAVAMEQ
FT                   LLKSKQMQPFEGISQRLWEHTSHVAALCRVLARKMAKINGDEAMFAGLVHDLGVFYLMS
FT                   RAANFPELVNDKVELHALLVDWHDNIGHALLSALGSPESVLLAVQEHETDREIESIGNL
FT                   SDVLYVANKIANRTSSWRDPELDGAVDTSVLDKLFDAETLAEIVEESEEEVQSLKVALG
FT                   G"
FT   gene            547292..549184
FT                   /locus_tag="Daro_0485"
FT   CDS_pept        547292..549184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0485"
FT                   /product="potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45242"
FT                   /db_xref="GOA:Q47IT9"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45242.1"
FT                   /translation="MGSHEQTADVTGQRFAALALAALGVVYGDIGTSPLYAVKEVFAGN
FT                   HPIPVTMLNIYGSLSLIFWALVIVVSVKYVTFIMRADNRGEGGIMALIALALHTVHDKP
FT                   QHAKWIMIVGVLGAAMFYGDGMVTPAMSVLSAVEGLEVATPALKPFVIPLTMVVLFILF
FT                   FVQRSGTATVGAFFGPVMLVWFSALALLGVHNIVDHPAILMALNPAYGIEFLLENKAHS
FT                   LVAMGNVVLAVTGAEALYADMGHFGRKPISRAWFAFVLPALVLNYFGQGALILGDPEAA
FT                   KNPFFLSAPDWALYPLVGLATLATVIASQAVISGAFSVTRQAMQLGFVPRMEVQYTSDR
FT                   EQGQIYLPAVNWGLMVAVMILVLGFRSSNNLAAAYGIAVTGDMVITSILATVVVAKVWK
FT                   WGWFKAGLLFACFLSVELVFLAANILKIPDGGWFPLVAGMGVFVLMTTWKRGRQLLSDR
FT                   LRGERLELSMFLDSLASSMPTRVAGTAVFLNADPKGVPHALLHNLMHNKVLHERVVLLS
FT                   VQFFDVPYVPDIDLVEVRQLKENFWSVVIQYGFKDIPNVPEALALCADAGLAFSSLETS
FT                   YFIGRETLIPRLGSEMAFWREKIFVAMFRNAGSATAFFKIPSNRVVELGTQVVL"
FT   gene            complement(549288..549776)
FT                   /locus_tag="Daro_0486"
FT   CDS_pept        complement(549288..549776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0486"
FT                   /product="Cytidyltransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45243"
FT                   /db_xref="GOA:Q47IT8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45243.1"
FT                   /translation="MSYASPSFESKICPPHQLAARAAQLDHPLVFTNGCFDILHRGHVT
FT                   YLAQAAALGTSMVVALNTDASVKRLGKGDDRPVNALEDRLAVMASLACVSLVTWFDEDT
FT                   PLQRILECRPDILVKGGDWPVDKIVGCSEVRGWGGTVHSIPFIHQTSTTALLEKIRRL"
FT   gene            complement(549879..550784)
FT                   /locus_tag="Daro_0487"
FT   CDS_pept        complement(549879..550784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0487"
FT                   /product="regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45244"
FT                   /db_xref="GOA:Q47IT7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45244.1"
FT                   /translation="MNTPSFNIAAVERDTGLSKDVLRMWERRYGFPVPERDLNGERVYP
FT                   ADQVDRLRLIKRLMDQGHRPGKLIATPAEELTALAPRRARASESIPTGEGEDLTDLLAL
FT                   IKQHDAAGYQQAMQQRLARQGLQRFVQDTVSPLTHQVGEAWEDGSFEVFEEHLFTELTK
FT                   RLLRQAIAALSGGPRRPRVLLTSVPDETHILGLLMAEAMFALEGAECIPLGTQMPLLEI
FT                   GRAAEAHRADIVALSFSTAFPQRQIPALLQQLRIVLPDGIELWCGGGGIARLAAQDGIR
FT                   LIPSLDRAIDELNEWRTTHA"
FT   gene            550893..551450
FT                   /locus_tag="Daro_0488"
FT   CDS_pept        550893..551450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0488"
FT                   /product="Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45245"
FT                   /db_xref="GOA:Q47IT6"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45245.1"
FT                   /translation="MFSSLKRCFGIAALITVGVVPVAAAAECPPLLNHSFASLQDGKPM
FT                   PLCQYAGKVILVVNTASYCGFTSQYDGLEKLYARLKDKGLVVLGFPSNDFGEQEPGSEK
FT                   EIADFCRLTYGVEFPMVSKTVVKGKGAHPFYLKLAEITGSKPKWNFHKYLINRDATQVV
FT                   AYTSFTKPDDKDLLKKIDEFLK"
FT   sig_peptide     550893..550970
FT                   /locus_tag="Daro_0488"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.806 at
FT                   residue 26"
FT   gene            551476..552276
FT                   /locus_tag="Daro_0489"
FT   CDS_pept        551476..552276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0489"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45246"
FT                   /db_xref="GOA:Q47IT5"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45246.1"
FT                   /translation="MNAPENIFLPDVQAAADTRRLAIQSVGVKGLRYPLQLENAAGELT
FT                   STVATFAMSVGLPPEVKGTHMSRFVELLEARTGPLTQVGLLRMMADMLLRLDASSGRIE
FT                   LAFPYFIRKMAPVSGVESLLDYDATLIVDQRAWESATLTLRVVAPVTSLCPCSKKISDY
FT                   GAHNQRSHITLEARLRSPMSIEDLVRIAEEEASCEVFGLLKRPDEKWVTERAYDNPKFV
FT                   EDLVRDIALRLMNEPRIAEWKVASENFESIHNHSAYAELYGCNE"
FT   gene            552287..553606
FT                   /locus_tag="Daro_0490"
FT   CDS_pept        552287..553606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0490"
FT                   /product="Amine oxidase:FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45247"
FT                   /db_xref="GOA:Q47IT4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45247.1"
FT                   /translation="MVKRQRIAVVGAGISGLASAWLLSRQHDVTLFEAGAYLGGHTNTV
FT                   EVALEGKSHPVDTGFLVFNEKTYPNLIAMFALLGVDSVETEMSFAVSLENPDLEWAGSN
FT                   LATVFGQKRNLVRRKFWAMLSDILRFNRESSAWLATHPDNRRSLRDFLSAGRYSSAFSD
FT                   WYLLPMAAAIWSCPTGQMLDMPLATFIRFCQNHGLLQVFDRPMWRTVKGGGREYVRKIA
FT                   AELDANGAIIRLACPVSAVTREAEGLRVVRAAGSEHFDQVVMACHSDQALAILGFTASD
FT                   AQREVLSAIRYQPNRAVLHTDRVLLPRDEKLWSAWNYFAGKGEPGDQPVGVSYLINKLQ
FT                   PLPFKTPVVVTLNPAREPDPAKVLAEFDYAHPIFDGPAIAAQQKLAGVQGENGIWLAGA
FT                   WGSYGFHEDGLKSALRVVNGMGVSAPWQGVAEVLRETESA"
FT   sig_peptide     552287..552349
FT                   /locus_tag="Daro_0490"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.908 at
FT                   residue 21"
FT   gene            553614..554378
FT                   /locus_tag="Daro_0491"
FT   CDS_pept        553614..554378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0491"
FT                   /product="Protein of unknown function DUF1365"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45248"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45248.1"
FT                   /translation="MNFRPQLFLGHVMHRRLRPVVNAFVYPVFYVQLPVRDLAATNCGI
FT                   FSVDRRNILSFRSKDHGARDGSPLLPWITALLRERGLPDDGEIMLQTFPRVFGLVFNPV
FT                   SFWFCHDRAGELIAVLAEVNNTFGGTRSYLLHNPGGAPLRDGQELRADKDFHVSPFNEI
FT                   EGGYRFRFHLNRPVPLARIDYDDAEGELLLTSISGKPRAWRAATLLGAFLRMPLMTAGV
FT                   LFRIHWQALKLWLKGVPFRGAHVSQPLRESTK"
FT   gene            554375..555559
FT                   /locus_tag="Daro_0492"
FT   CDS_pept        554375..555559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0492"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45249"
FT                   /db_xref="GOA:Q47IT2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45249.1"
FT                   /translation="MNNTMIFSGSQSLARDTRLVFDLLEKIQGGMLEVRLPDGSCALFG
FT                   NGEHGVTLQVHDEAMFGMVLARGDIGLAEAYLDGHWDSPDITGLLRLLARNRDALQKAV
FT                   YGSWRNLLAARVRHWLNRNSRAGSKRNIMAHYDLGNDFYQLWLDPTMSYSAAIYREADD
FT                   GSLEAAQHAKYNRILNCLKAGPGQRVLEIGCGWGGFAEKAVQRGLAVTGLTLSPAQLVW
FT                   AQLRVPTADLRLQDYRDTQEQFDHVVSIEMFEAVGERFWPGYFKTVAQALKQDGRAVIQ
FT                   SITIRDDLFASYRKGTDFIQQYVFPGGMLPSRQAFRAAAAKQGLLVRNEYAFGLDYART
FT                   LAEWRHAFEAKWPQIAALGFDEHFRRLWHLYLCYCEAGFLAGNIDVVQFELTHS"
FT   gene            555528..556079
FT                   /locus_tag="Daro_0493"
FT   CDS_pept        555528..556079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45250"
FT                   /db_xref="GOA:Q47IT1"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45250.1"
FT                   /translation="MSSSSNSRIPEPVLSTSRRRLLLALAAAPLSAYASTDTDPMAGLS
FT                   RWGSGEFRRFGFLVYEAALWAGDDPLRPPLALKLTYKRNIAGQAIAEASVKEIRNLGIA
FT                   DEVSLKRWGEQMARLFPDVKPGDHIIGQYRAEAAVFHFNDRQLGSIDDPVFARAFFAIW
FT                   LDPKTSAPDLRAALLKRSAV"
FT   sig_peptide     555528..555632
FT                   /locus_tag="Daro_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.873 at
FT                   residue 35"
FT   gene            556734..557957
FT                   /locus_tag="Daro_0494"
FT   CDS_pept        556734..557957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0494"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45251"
FT                   /db_xref="GOA:Q47IT0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45251.1"
FT                   /translation="MTPSRILAYGLLGLPLAFAALPIYVHVPRFYAETAGLPLALLGFI
FT                   LLGARLLDAGIDPWLGWLADRVSRRRMVALALLPFGLGFVALLNPPAENVGLWLLASLA
FT                   LTYLGFSAATVAYQAWGADVGINSALRTRLTAAREGFGLLGVVLAAALPTVLAASLNDG
FT                   IARLSWVLPPLLLIAAATTFSRVGVGQPLPASNQALLPSLRRVFADLAFRRLLLVFVVN
FT                   GIAAALPATLFLFFVADVLQAEANSGALLALYFIAGAASLPVWVRLAGRIGRVAAWGLA
FT                   MGLAILAFAGASLLGAHDVATFAAICVISGLTLGADLALPSAIAADLGERQGQPGACFG
FT                   VWNFVSKLNLALAAGLSLPLLALLGYVPGSSAGLPALTFAYALLPLAFKALAAALLWRW
FT                   RHSLESES"
FT   sig_peptide     556734..556793
FT                   /locus_tag="Daro_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.917 at
FT                   residue 20"
FT   gene            557954..558487
FT                   /locus_tag="Daro_0495"
FT   CDS_pept        557954..558487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0495"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45252"
FT                   /db_xref="InterPro:IPR024409"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45252.1"
FT                   /translation="MKLLAAALFSLGLTACASTGVEQYRAEQPALDLKTYLNGTLDAWG
FT                   MFQGRSGEVKKRFHVVIDAKWSGDVGVLDEHFKWSDGTTSRRVWTLTRQPDGTYRGKAD
FT                   DVIGEAIGEVSGNALRWRYVLALPVDGKVYNVDFDDWMFLMDDKVMMNRSYMSKWGFNL
FT                   GEVTLSFVKRQSAP"
FT   sig_peptide     557954..558016
FT                   /locus_tag="Daro_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.555 at
FT                   residue 21"
FT   gene            558484..559239
FT                   /locus_tag="Daro_0496"
FT   CDS_pept        558484..559239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0496"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45253"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45253.1"
FT                   /translation="MNPKITDWQGKRVWLLGASSGIGAALARELAGRGARLALSARSVD
FT                   KLLALGLGDALLLPCDATDRVSLGATRQGLLAVWGGVDLVVYLAGDYVPMRADDFNLAV
FT                   AERVIDVNFNGAMRLADSVLADLRPGGGIAFVASVAGYRGLPKALCYGPGKAALIHFAE
FT                   VLHLDLAPKGIGVWVINPGFVSTQLTARNDFAMPALQTPEQAARAMVDGFGKGNFEIHF
FT                   PKRFTRLMKLFAHLPYGWYFPLIRRFTGG"
FT   gene            559241..559663
FT                   /locus_tag="Daro_0497"
FT   CDS_pept        559241..559663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45254"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45254.1"
FT                   /translation="MTLDQLICFYNDFAPDSVARFPEFYSADAYFKDPFNEVRGITAIQ
FT                   RIFTHMFGQVAEPRFVVTEKVVDQHGAMLVWEFYFRVRLWGKGKAQVMRGVSHLRFDAE
FT                   GKVNYHRDYWDTGEELYMKLPGLGTLMRGLRRVLAA"
FT   gene            complement(559689..561380)
FT                   /locus_tag="Daro_0498"
FT   CDS_pept        complement(559689..561380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0498"
FT                   /product="TrkA-N"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45255"
FT                   /db_xref="GOA:Q47IS6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45255.1"
FT                   /translation="MNSAFFLVLRRMRAPIIVLIVIYAISVVGLTLVPGVDAESRMTAP
FT                   LSFFHAFYFISYTATTIGFGEIPAAFSDAQRLWVTVCIYLTVVGWSYSVVTLIALLQDK
FT                   GFQNTLTANRFTRRVRQIKQDFYLICGCGETGSLIARTFDQIGQAFVVIEKDELRVEEL
FT                   DLLDFKTDTPAFAADARQPDNLQLAGLMHPKCRGVLAITNDEQANLAIAIAVRLLNPDI
FT                   PVIARAEQGSIAANMASFGTDFIINPYERFADRLALAVSSPERFRLIELLTSLPESPIP
FT                   ETLRPPRGHWILCGYGRFGHAVAERLRGTGITLTIIDPSAPDANREIAGDGTEASTLHQ
FT                   AGIEHATGIVAGSRNDINNLSTAITASEIKPDLFVVARQNHAANSALFTAFDADFTVLP
FT                   SRIIAQECIAILTAPLLARFLDHVSQLAESHCEQLVKRLQEASGGLTPVIWDIRLNAAE
FT                   APATWQALMHDRKIRLGEILIDGADRDSRLPAVPLLIERGRDYVLLPADDFRLEAGDQL
FT                   LFASALSSQRKLELTLKNANELDYVLSGQENSGSLLGKLLKANSQP"
FT   gene            complement(561399..561782)
FT                   /locus_tag="Daro_0499"
FT   CDS_pept        complement(561399..561782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45256"
FT                   /db_xref="GOA:Q47IS5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45256.1"
FT                   /translation="MNLEKVIFGFFILLAATLNFGFFIGDIARAELHSVYELAAALFVS
FT                   LIATALKFGDRTQIGAIHLSTSLVADLQLIAAAVTWGIAEHVTGVGMTAHVTSSVVSLS
FT                   GGALFANIVSVIILIVETVMLRR"
FT   gene            complement(561865..562533)
FT                   /locus_tag="Daro_0500"
FT   CDS_pept        complement(561865..562533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0500"
FT                   /product="Transport-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45257"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45257.1"
FT                   /translation="MMQKAKLSLAALLMIAALPALQGCVEAALLGTAAAASVMSAHDRR
FT                   STGTQTDDETMEWKSNNHVPAQYKDHSHVNFTAFNRRVLITGEVPNEEAKSSIESEIRK
FT                   IEGVRDVINELGIGPATPLGSRSNDSFITSKVKARLVDTNQLSANHIKVLSERGIVYLM
FT                   GIVNERESKVAIAVARTTAGVVKVVNVMEIVSDDETRRLDNQVLGARSAPPQSAPVENR
FT                   "
FT   sig_peptide     complement(562450..562533)
FT                   /locus_tag="Daro_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.732 at
FT                   residue 28"
FT   gene            complement(562530..563120)
FT                   /locus_tag="Daro_0501"
FT   CDS_pept        complement(562530..563120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0501"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45258"
FT                   /db_xref="GOA:Q47IS3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45258.1"
FT                   /translation="MDLIARVAKNFEDSAQTKLNAVDMMAAPIAAAIETMTNCLINGGK
FT                   ILACGNGGSAGDSQHFAAELIGRFEAERQELAAIALTTDSSILTAIGNDYSFNQIFSKQ
FT                   VRGLGHSGDILLAISTSGNSGNIIEAIKAAHEHDMHVIALTGKGGGQIGEMLRDADIHL
FT                   CVPADRTARIQETHLLVIHCLCDGIDALLLGVE"
FT   gene            complement(563162..563527)
FT                   /locus_tag="Daro_0502"
FT   CDS_pept        complement(563162..563527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45259"
FT                   /db_xref="GOA:Q47IS2"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45259.1"
FT                   /translation="MRFLLTISLLCWLATAQAESIRVLVQNSPLAGSQYYAVGELWQEM
FT                   KVGDGLDLFREPDNKHDRNAIRVEWRGHKLGYVPRAQNRAVAAAMDAGDRLTARVSSLS
FT                   DNKNPWQRVAFEVFVEL"
FT   sig_peptide     complement(563471..563527)
FT                   /locus_tag="Daro_0502"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.948 at
FT                   residue 28"
FT   gene            complement(563505..563867)
FT                   /locus_tag="Daro_0503"
FT   CDS_pept        complement(563505..563867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0503"
FT                   /product="Protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45260"
FT                   /db_xref="GOA:Q47IS1"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45260.1"
FT                   /translation="MQVKANDTTTARGREAEDRAARHLERGGLRVVERNFRIRGGEIDL
FT                   ICRDGKGLVFVEVRQRSRSDFGGAGASITAGKRRRIVLAAQHYLLGKPDCDCRFDCVLI
FT                   DGEQLEWIKHAFSADD"
FT   gene            563878..564717
FT                   /locus_tag="Daro_0504"
FT   CDS_pept        563878..564717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0504"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45261"
FT                   /db_xref="GOA:Q47IS0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45261.1"
FT                   /translation="MTEESAVLYVVPTPLGNLADLTRRAEEVLRTVPWIAAEDTRHSGP
FT                   LLKQLGAPARTIPAHQHNEHEAAARIVEKLRSGEAVALISDAGTPGISDPGARIVAAVR
FT                   AAGCKVVPLPGPCAVTTALSASGLLDEHFLFYGFLPSKGGQRRQALEALREQPCALVFY
FT                   EAPHRVLETVEDMATVFGERTLVIARELTKLFESIHSLPLAEALDWLKEDANRQRGEFV
FT                   LMLSGAPAETESGEGERVLKLLLAEGLPVKQAAKLASTITGAAKNALYERALLLRGQ"
FT   gene            564854..567712
FT                   /locus_tag="Daro_0505"
FT   CDS_pept        564854..567712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0505"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45262"
FT                   /db_xref="GOA:Q47IR9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45262.1"
FT                   /translation="MSPVMERGETGVSPQLWCVILTLGLALGWALPSVRFFSTPAQYLP
FT                   VHTALEFVAMAVACMVFALAWNLRRQPGNSDKILLGAGFLAVCLIDFGHTLSYAGMPDL
FT                   LTPSGPEKAINFWLAGRYVAAAALLGIAVLPKRDLSACAGNCLVAGVVVVAACAWWLGL
FT                   MHPQWFPRTFVPGEGLTPFKIGAEYLLAALYALAAWGLLVKAKRTDNANLHWLAAAAWV
FT                   QGLAEMFFTLYGEVTDLFNLLGHVYKAVAYLMVYRAMFDAGVLAPFREMKLERSRLQAL
FT                   LSAIPDPVFVKNANGVFMSCNKAFERLLGAPEKSILGKTDYDFFDKDLADFFREKDRAA
FT                   TAAGRPLSNEEWLEFAADGYSGLFETTKTPLYLDGQAIGTLGIAHDITRRKRIEADLRL
FT                   AAAAFESQTAMLVTDANGVILRVNQAFLRDTGYAVEECVGQTPRILRSGRHDPAFYQKM
FT                   WESIRSSGVWQGEIWDRRKDGSIYPKWLTISAVLGDSGEVTHYIGLHQDVSERKLAESR
FT                   IHQLAYYDQVTGLPNRILLQERLSQVMAKCRASSNYGVLLFVDLDNFKTLNDTLGHNVG
FT                   DLLLKQVGEVLRRCSRESDTVARLGGDEFAVIMSELGTDPSAAMQGAEAAARYLLSELG
FT                   RTFQLGNVIHRNTVSIGATLFKGEQESIESLMRQIDLAIYQAKGAGRNTVRFFDPSMEI
FT                   ALRERAAIEEALRYAIEEEQFLLHYQAQIGEDGRIEGAEVLLRWQHPERGMVSPAIFIP
FT                   LAEETGDIVLLGSWVLKQAAAQLARWAESPVMAGLVLAVNVSAVQLRQPDFVEQVTTVL
FT                   REAGADPGRLKLELTESMLVNDVEATIAKMQSLKAIGIGFSLDDFGTGYSSLSYLKRLP
FT                   LSQLKIDQSFVRDVLVDANDVAIASSVVALAKSLGLGVIAEGVETEAQRELLAGIGCHC
FT                   YQGYLFSRPLPIGDFERLVSGA"
FT   gene            567736..568836
FT                   /locus_tag="Daro_0506"
FT   CDS_pept        567736..568836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0506"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45263"
FT                   /db_xref="GOA:Q47IR8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45263.1"
FT                   /translation="MMETPAMCWASLLKSRKLPRETIMQLTITRPDDWHLHLRDGEALA
FT                   SVLAHTARQFGRAIVMPNLKPPVTTVEQAAAYRDRIVAALPVGACFEPLMTLYLTGNTP
FT                   ASEIAKAAASGFVKAVKLYPAGATTNSDAGLTDIAKAYDTLAEMERVGLPLLVHGEVTD
FT                   PKIDLFDREKVFIDTVLLPLTLRFPTLKVVMEHITTKDAAEFVAGSPANVAATITAHHL
FT                   LYNRNAIFQGGVRPHWYCLPVLKRETHREALVAAAISGNPKFFLGTDSAPHAKGAKEAA
FT                   CGCAGCYTAYAAIELYAEAFEQAGGLDKLEAFASFNGPDWYGLPRNSGTVTLVKENWTV
FT                   PADYPYISTDTIVPLRAGETLSWKML"
FT   gene            568848..569285
FT                   /locus_tag="Daro_0507"
FT   CDS_pept        568848..569285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45264"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45264.1"
FT                   /translation="MRLRHLLLPLLAVPLLSACVNDGATYEIDNSREHVLSLIREQPYF
FT                   WDSKVNLYLVVSRMPACMRRHNMGTGTDKTKVEVYQVPSGAFIIKVGKRMFATETQTCE
FT                   SFAKMDSEPVEGMGQMIGTFLVKNGELVFVKEEKDTSAADE"
FT   sig_peptide     568848..568910
FT                   /locus_tag="Daro_0507"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.331 at
FT                   residue 21"
FT   gene            569282..570058
FT                   /locus_tag="Daro_0508"
FT   CDS_pept        569282..570058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0508"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45265"
FT                   /db_xref="GOA:Q47IR6"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45265.1"
FT                   /translation="MSAASLYASPLFEPLQRWLERLPLRPDAQAVAQLAMQFPIHAENG
FT                   QRIRFVPPQPDGLVYECRIWESGEVETRPDNWHDFFNALVWLSFPKTKIAVSAAHMRAM
FT                   QAPGEKRTNSRDVLTHFDECGIVVLSSRPELLDLLRGFCWKELFVERRTEVISSMRFVI
FT                   FGHATYEQLLKPFRGLTAKAVLYEVSEDWLLMSTEAQVAAVDTLLAVDLTSGKYNRPRD
FT                   FQPLPLLGIPGVTPESENPDYYDDTWQFRPGRRAKD"
FT   gene            complement(570055..570318)
FT                   /locus_tag="Daro_0509"
FT   CDS_pept        complement(570055..570318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0509"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45266"
FT                   /db_xref="GOA:Q47IR5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45266.1"
FT                   /translation="MAKEELLEMQGVVNDVLPDTRFRVTLENGHELIAYTSGKMKKNHI
FT                   RILVGDKVTLELSPYDLSKGRITFRHIENRGTPNPQAQRRRY"
FT   gene            complement(570349..571230)
FT                   /locus_tag="Daro_0510"
FT   CDS_pept        complement(570349..571230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0510"
FT                   /product="Transglutaminase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45267"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45267.1"
FT                   /translation="MVRIQFAIDLHYELNYPGADFVFNIHAAQTASQAIISENLVVSQQ
FT                   VPTVIQTAPATHARFLRLTGAPGPLHISYQALVDIDHHIGNPDLIPETPIGQLPLSVLN
FT                   YIYPSRYCQSDRLANLSMSEFGHLPKGYRRVEAIRNWVNKHVAFRSNTTSSTTSALDTV
FT                   TDRVGVCRDFAHLMIAICRALSIPARFTTGIDYGADPALGPTDFHAYVEVFLGGRWYMF
FT                   DPSGTAIPMGFVRLGTGRDAADVSYATIFGSVSSPPPLISVTAITEPGRPWELPRHRPE
FT                   AISTDASPVDAG"
FT   gene            complement(571512..573218)
FT                   /locus_tag="Daro_0511"
FT   CDS_pept        complement(571512..573218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0511"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45268"
FT                   /db_xref="GOA:Q47IR3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45268.1"
FT                   /translation="MIANPATKYTAFPPVQLADRQWPNRTITQPPIWMSTDLRDGNQSL
FT                   FEPMNAEKKMRMFKLLCDIGFKEIEIAFPSASETEFGFVRNLIEGGHIPDDVTIEVLTQ
FT                   AREHLIRRTFEALKGAKKAIVHVYNATSKTFRDNVFGMSKAEVVQMAVDAVKLIRAQAE
FT                   AMPDTEIILEYSPELFTATELDFAKEVCDAVTTAWGATPQRKVILNLPTTVEIATPNIY
FT                   ADQIEWMHRNLARRDSVIISLHPHNDRGTAVAAAELGLMAGADRVEGCLFGNGERTGNV
FT                   DLVTVALNMYTQGVHPGLDFSDINAVARAFEHCNQLPIHPRHPYVGDLVFTAFSGSHQD
FT                   AIKKGFSAQEAAEQWSVPYLPIDPADVGRSYDSVIRVNSQSGKGGIAYLMETEHGVVMP
FT                   RRLQVEFSGVVQQHTDAHGGEVSADGIWAMFARTYLDATTPIRYREHHLFEQGRNQGIR
FT                   LNIDIDGTPHILTGEGNGPINAAVHALQSAGINIQVRSYEERSMVPMGEDGNARACAFM
FT                   EIAGKGGDKSGGECYGVGVDSNIVTASIKALLSGVNRLGAARTSGDQSQAA"
FT   gene            573351..573827
FT                   /locus_tag="Daro_0512"
FT   CDS_pept        573351..573827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0512"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45269"
FT                   /db_xref="GOA:Q47IR2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45269.1"
FT                   /translation="MELDRYDREILAILQADGRISNQDLADRIGLSPSPCLRRVRVLEE
FT                   SGLITGYRAMLDAKKLGLSLMALIGISMDQHTPERFANLEATISEIPEVLECLLITGQQ
FT                   SDYQLKVVVKDMDGYQDLLLNKITRIQGVTGVHSSFVLRKVVDKTALPLVEASR"
FT   gene            573995..574657
FT                   /locus_tag="Daro_0513"
FT   CDS_pept        573995..574657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45270"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45270.1"
FT                   /translation="MPGYQVRFQTVAIGNSDYQIRSLLDRQQYHDPEGEAEAAGISPAS
FT                   WSLFGQIWPSARVLARTMDSFDLVGKRILEIGAGLCLASLVVHRRSGDMTASDAHPMSR
FT                   PFLEENLLLNHLGPMTYADGNWGRDNPELGLFDLIIGSDVLYERDQPLMLASFIDRHSA
FT                   LGGEVLIVDPNRGNRPAFRRAMAGFGYLYGESKADCTFADGEAYRGSFLHFHRGLVS"
FT   gene            574654..575319
FT                   /locus_tag="Daro_0514"
FT   CDS_pept        574654..575319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0514"
FT                   /product="Thiopurine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45271"
FT                   /db_xref="GOA:Q47IR0"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR022474"
FT                   /db_xref="InterPro:IPR025835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45271.1"
FT                   /translation="MSNPDNALWQQCWRDRNIEFHQKTVNQLLIRYWHSLNLAEGSRVF
FT                   VPLCGKSLDLLWLAQQGCEVIGIELSPIAVRAFFRENGLLPARRQVGRLTEWSSGPIRI
FT                   FCGDIFALTAADLGPISAVYDRAALTALPESVRAIYVAHLHALIPETCPIFLLTAEDPE
FT                   EGDADGAEPNVAEELLTLYAERFTVDLVHVAPSFQMNPETPDAPPLPIEHKFYRLLPS"
FT   gene            575391..575719
FT                   /locus_tag="Daro_R0016"
FT   misc_RNA        575391..575719
FT                   /locus_tag="Daro_R0016"
FT                   /product="RNA component of RNaseP"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(575807..576526)
FT                   /locus_tag="Daro_0515"
FT   CDS_pept        complement(575807..576526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45272"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45272.1"
FT                   /translation="MTFGTIFKKTALSAALALALAGSATAAVTYNQDLSAPSDIPGLTG
FT                   FQTTGAMMGGMQVVATFVEGNGSTFTESRSWAATGATSGGVTGTGWSLTQTGDTYAGLW
FT                   SFNFTNVGTTAPFTLLTLSLNGNSGLTLFDRYFDGTAGTTGSFNGTDLSFTDGTISAAV
FT                   TYSDVVGVGGALPVEDIFHQVFINFREGIATSFQFLQDTDNDSRFNQPIPEPGTLSLLG
FT                   LALAGASWRARRRQASN"
FT   sig_peptide     complement(576446..576526)
FT                   /locus_tag="Daro_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 27"
FT   gene            complement(577223..578398)
FT                   /locus_tag="Daro_0516"
FT   CDS_pept        complement(577223..578398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45273"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45273.1"
FT                   /translation="MLVDFFLHLKSRQLPVSTNELLALLEALEARLVTGSLDDFYLLSR
FT                   TLLVKDETLYDRFDRAFGEYFKGVEALPGFDAMVPEEWLELAARKHLSEADRARLQKLG
FT                   YEKVLEQLKERLAEQKERHAAGSKWIGTAGTSPFGHGGYNPEGVRIGGESVGNRTAIKV
FT                   WDQREFRNLDDSLDLGVRNIKVALRRLRRFARKGAATELDLDGTIAGTARNGGWLDLHL
FT                   RPERHNAIKVLLFLDVGGSMDDHIQDCEELFSAARSEFKHLEHFYFHNCVYEGVWKDNH
FT                   RRHSERLSTWEVIHTYGPDYKLIFVGDASMSPYEVGRPGGSVEHWNEEAGAVWLQRMID
FT                   AWPRAAWLNPLAENYWGYTPSIGMIREVIGNDRMFPLTLDGLERAMRNLSK"
FT   gene            complement(578399..579304)
FT                   /locus_tag="Daro_0517"
FT   CDS_pept        complement(578399..579304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0517"
FT                   /product="AAA ATPase, central region:ATPase associated with
FT                   various cellular activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45274"
FT                   /db_xref="GOA:Q47IQ7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45274.1"
FT                   /translation="MALPARPLVIQSPHPQPTRRTMKFEGTDSYVATRDLTLAVNAAVA
FT                   LQRPLLIKGEPGTGKTLLAEEVARALNMPLFQWHVKSTTKAQQGLYEYDAVSRLRDSQL
FT                   GDPRVEDISHYIVHGVLWQAFECDEPSVVLIDEIDKADIEFPNDLLRELDRMEFHCYEL
FT                   HRTIKAKHRPLIIITSNNEKELPDAFLRRCFFHYIKFPDRETMQRIVGVHFPVLKHELL
FT                   KEALEVFFDLREVPGLKKKPSTSELIDWLKLLLAEDIPPEALRAKEAKDAIPPLHGALL
FT                   KNEQDVHLFERLAFMSRRKP"
FT   gene            579404..580174
FT                   /locus_tag="Daro_0518"
FT   CDS_pept        579404..580174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45275"
FT                   /db_xref="GOA:Q47IQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45275.1"
FT                   /translation="MRYPVLVYRRNGFLNIAVEGQRCLFRYFVCCEGEMEAMMSELQVA
FT                   PVSNDKEAWWKRRNLQLDTFSKLFSIVGVAGALSVATIAYLNYQSQLEENDRAASVLDM
FT                   RVNTETIPISDSKCIVLVNIDLTNKGRRAINPYAHTDDDGGEQQYSGEGLTLSVTRHSI
FT                   PSKDAPIAEDAPDDIRVVPRYNILEKKYSYRNTRRWDEIYVIKPNTSYRETEAITLQRH
FT                   ALYEIRARFYAFRRAKNGEPEVWTNTETKYLYVE"
FT   gene            580277..581431
FT                   /locus_tag="Daro_0519"
FT   CDS_pept        580277..581431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0519"
FT                   /product="Methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45276"
FT                   /db_xref="GOA:Q47IQ5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45276.1"
FT                   /translation="MRAMKIPRFPEVAWLESGEKDTVRWRSEAGIAPHADIRIADDRTG
FT                   ADDAFRLLESGTALLWRGDWVNARHLMQALTKRADRRFGAQRGKAPKTPAEAFARHRET
FT                   QGQRAALLNRLLVPLNADYTVPLRRAQDVAEACHAAYGAPTDEDSLVALRELLAVISAH
FT                   EWRKKGVPVPAVQGRIYPHYGVFSPVRGEYVDLIASAPIPAGCDLAFDIGTGSGIIAAV
FT                   LARRGVAQIVATDQDARALACAGENIEQLGLAAAVRIVKADLFPEGKAPLVVCNPPWLP
FT                   AQPTSPVEYAVYDPDSRMLRGFLAGLAAHLADGGEGWLIISDIAELLGLRSREKLLAWI
FT                   AEAGLKVIGRLDTHPKHPKAQDASDPLHAARAAEVTSLWRLGKT"
FT   gene            581496..581882
FT                   /locus_tag="Daro_0520"
FT   CDS_pept        581496..581882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0520"
FT                   /product="Secreted repeat of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45277"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="InterPro:IPR014558"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45277.1"
FT                   /translation="MKKTKLMCALLTSLTLAACAGGGMYAAAPAKVMDGALTGAGGMTL
FT                   YTFDKDAAGSGKSLCNGPCATNWPPLFAMDGDMASGDYSVVNRDDGKKQWAFKGKPLYY
FT                   WAKDQKPGDRTGDGFNNVWHTAKP"
FT   sig_peptide     581496..581579
FT                   /locus_tag="Daro_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.620 at
FT                   residue 28"
FT   gene            581892..582392
FT                   /locus_tag="Daro_0521"
FT   CDS_pept        581892..582392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0521"
FT                   /product="Sigma-70 region 2:Sigma-70 region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45278"
FT                   /db_xref="GOA:Q47IQ3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45278.1"
FT                   /translation="MDSRAILAELPRLRRYARAMLGDRAAADDLVQDTLERAWSRISQW
FT                   RQGSDLRAWLFGIMHNLRIDQLRRAGLAITSLDEDAAEVPLRPTQTDRLELMDLESALR
FT                   QLPDEQREILLLVALEEMSYADIATLLGIPIGTVMSRLSRGRERLRVVMDGRQQTANLR
FT                   LVR"
FT   gene            582389..583183
FT                   /locus_tag="Daro_0522"
FT   CDS_pept        582389..583183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45279"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45279.1"
FT                   /translation="MTSQPITEDELQAYVDDALTPEWQAVLEAHLALNPGDAERVVAYR
FT                   AQKQALKALFQPMLDEPLPERLQILTVQPLRAPTGGGWTGGLWQRLAAGLLVAALGGAG
FT                   GWLAHGQYLQGDRMARMVPLSHQAAVAHVVYSPDVRRPVEIAADQEEALVKWLSKRLGT
FT                   PVRPPKLGALGYELVGGRLLPGNSGPVAQFMYHDASGQRMTLYVTTESIEKRDTGFRFA
FT                   REGPVNVFYWVDGKFGYALSAGIDKGELAKVATAVYDQLDQK"
FT   gene            583216..584214
FT                   /locus_tag="Daro_0523"
FT   CDS_pept        583216..584214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0523"
FT                   /product="Catalase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45280"
FT                   /db_xref="GOA:Q47IQ1"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45280.1"
FT                   /translation="MQRTQFTVPVLALAALIPHATMAADPTPDASQVVAAVEGVFGVTP
FT                   GERRNHIKGTCAAGEFVGTKEAAKLSRSPLFSGKPVPVVARFSLSGGNPKAPDVAKSAR
FT                   GMALQFQLPKGQLHHITMLNTPMFGAANPQTFLDLMQALQPDPATGKPDPEKMKAFKAS
FT                   HPDNQAQAQYLASNNPPASYASSSYWGIHTFKFVDKKGKATLVRWQFVPQDGEKRLSDD
FT                   ELKTAGANFLESALIERAKQGAVRWDMMVSIGQPGDSETDPTVLWPAERPRIKAGTLTI
FT                   RSAEAQKGAPCEPINFDPLVMAPGIQPTDDPVLRFRSPAYAVSFGKRLSER"
FT   sig_peptide     583216..583287
FT                   /locus_tag="Daro_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(584279..585427)
FT                   /locus_tag="Daro_0524"
FT   CDS_pept        complement(584279..585427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0524"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45281"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45281.1"
FT                   /translation="MLCRKLSSLALLLLASTVALADIRIGVIASSTGPTAVVGIPQKNT
FT                   VALLPTEIGGQKVEYIVLDDASDPTNAVTGVKKLISEHKVDALIGPTTTPAALAMLDFV
FT                   AESRVPLVTTVGSSAIILPLDDKRRWVFKTTQNDDLIAGALIEHMLAAGTKTVGFIGFN
FT                   DPYGENWFKVFTAMAEKSGLKMVASERFNRTDQSVTGQALKVMTSKPDAVLIAATGGPA
FT                   VLPQTTLQEKGYKGRIYQTHGVATNDFIRIGGKAVEGTLMAGGPMLVAADLAGNNPIKA
FT                   VALGYVKAYEGKYGAGTMSTFGANTYDAGLLLQKAIPAALKKAKPGSVEFREALRDALE
FT                   QSKEVVGAQGIFNMNAQNHNGMDARARVMMAVKDGKWVLLKD"
FT   sig_peptide     complement(585362..585427)
FT                   /locus_tag="Daro_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(585597..585848)
FT                   /locus_tag="Daro_0525"
FT   CDS_pept        complement(585597..585848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45282"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45282.1"
FT                   /translation="MHTESVLTYLKKHGQLRDSEIASGTGFALPEVRACLKELSGRGDI
FT                   SLCSMTVFENGKATEGLFSRVSGYFPKPAPGRKPGVKT"
FT   gene            complement(586037..586113)
FT                   /locus_tag="Daro_R0017"
FT   tRNA            complement(586037..586113)
FT                   /locus_tag="Daro_R0017"
FT                   /product="tRNA-Met"
FT   gene            complement(586121..588094)
FT                   /locus_tag="Daro_0526"
FT   CDS_pept        complement(586121..588094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0526"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45283"
FT                   /db_xref="GOA:Q47IP8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45283.1"
FT                   /translation="MAKAKDTAKEAPKARTSKAKDKAAEKALLQGQMAETPEPLDAEAR
FT                   KMRLKALIKLGKERGYLTYAEINDHLPDDVVDAESIEAIISTFSEMSIQVFDEAPAAED
FT                   LLMSDTAAVAADDEEVEAQAEQALSTVDSEFGRTTDPVRMYMREMGSVELLTREGEIEI
FT                   AKRIEEGLKHMIQAIAACPTTISDILELAAKVESDEMRIDELVDGLIDPNAVEEAPAAE
FT                   MPEAEEDEEEDGDDDGEGAGGGAAAASLLQLKTDALERFKNIKGIHAKMQKMLPTKGSH
FT                   DKVYIKLLQQVSDELMNIRFTSRSIERLCDSVRGMVEQVRGCERKIQQICVDRVKMPRP
FT                   HFIQSFPGNEINLDWADAEVAAAPKTYVAILTRNAPDIKEEQKKLLALQDRIGIPLKDL
FT                   KDINKQMSTGEAKARRAKREMTEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVD
FT                   KFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKMNRISRQILQETGA
FT                   EPDPATLAKKMDMPEDKIRKIMKISKEPISMETPIGDDDDSHLGDFIEDSGTLAPADAA
FT                   MYSSLRGVTKEILDTLTTREAKVLRMRFGIEMNTDHTLEEVGKQFDVTRERIRQIEAKA
FT                   LRKLRHPTRSDKLRSFVDTNNS"
FT   gene            complement(588141..589877)
FT                   /locus_tag="Daro_0527"
FT   CDS_pept        complement(588141..589877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0527"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45284"
FT                   /db_xref="GOA:Q47IP7"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45284.1"
FT                   /translation="MIPDSFIQDLLARVDIVDLVDGYVPLKKAGANYAACCPFHNEKSP
FT                   SFTVSPTKQFYHCFGCGAHGTAISFVMEYQGLGFVDAVKDLATRAGMQVPESEGRSFKD
FT                   EKPGQTRTLIEIMARAAAYYKDQLKKSPHAIEYCKKRGLTGEIAARYGIGYAPDGWQNL
FT                   QEVFPDYNADELKIAGLVIENEAGRRYDRFRDRLMIPIINPKGEIIAFGGRIIDQGEPK
FT                   YLNSPETPLFEKGRELFGLPQARQALRETDTAIVTEGYMDVIALAQNGVGNAVATLGTA
FT                   TTATHVTKLLRQVDRIVFCFDGDNAGRKAAWRALENSLEALADNKRLGFIFLPQEHDPD
FT                   SYIREFGKEQFDRQVTQAMPLSDFLLRELAQRCDLTSSEGKAQLIYEAKPLLLKLPTPL
FT                   LRLQLVKRLAEASGFAQAEVERLCELKSYTPAAPPKAKRTAPSLTRNLLRIVLHKPQLA
FT                   AQLPIALLPDTPERAALTRLHQLVTANRETSSYAGLREQLRGLPEESVIENAASELLGL
FT                   PFDEEGAEMEFRDTLEKLQEGGEKRAFAELQVKAQQFGVAGLSAAEKQAYIQFLTTKAN
FT                   RS"
FT   gene            complement(589884..590330)
FT                   /locus_tag="Daro_0528"
FT   CDS_pept        complement(589884..590330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0528"
FT                   /product="GatB/Yqey"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45285"
FT                   /db_xref="GOA:Q47IP6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45285.1"
FT                   /translation="MSLKARITEDMKTAMKAKESAKLSAIRLLLAAVKQKEVDERVELD
FT                   DTVVVAVIEKLTKQRKDSVTQYEAAGRQELADAEKFEIAVLAAYLPEKMSSEETAAVVA
FT                   AAVAETGAKGPADMGKLMGVLKPRLAGKADMAEVSKLVKAALAG"
FT   gene            complement(590414..590626)
FT                   /locus_tag="Daro_0529"
FT   CDS_pept        complement(590414..590626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0529"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45286"
FT                   /db_xref="GOA:Q47IP5"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45286.1"
FT                   /translation="MPNIRVKENEPFEVAIRRFKRTVEKTGLLTELRAREFYEKPTTER
FT                   KRKAAAAVKRQHKRLRSLTLPPKLY"
FT   gene            590723..591799
FT                   /locus_tag="Daro_0530"
FT   CDS_pept        590723..591799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0530"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45287"
FT                   /db_xref="GOA:Q47IP4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45287.1"
FT                   /translation="MLKNLAAPSVKMCAMLILGVESSCDETGIALYDSEAGLLSHALYS
FT                   QVAMHAEYGGVVPELASRDHIRRVVPLLREALGQAGKMLDEVDAVAYTRGPGLAGALLV
FT                   GCAFAEALALAIDKPTIPVHHLEGHLLSPLLSSDPPTFPFVALLVSGGHTQLMKVTGVG
FT                   EYELLGETLDDAAGEAFDKSAKLLGLPYPGGALLSKLAEQGTPGVHELPRPMLHSGDLS
FT                   FSFSGLKTAVLTLVREHADAMSDEFKANAARAFQEAIVEVLVKKSLKAMKQTGLKQLVV
FT                   AGGVGANKQLRTTLNDEAKRKRFRVYYPELEFCTDNGAMIALAGCLRLQSGSPSKAAGS
FT                   FAVQPRWPLMEMSVSPTK"
FT   gene            complement(591909..592187)
FT                   /locus_tag="Daro_0531"
FT   CDS_pept        complement(591909..592187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45288"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45288.1"
FT                   /translation="MPTSTFKEFEAQALAEGFDEVLERTWPADATLDTHTHPFALKARV
FT                   VAGEMWLTIGDRTQHLKAGDDFALDREVAHAERYGHQGTSYWVARRN"
FT   gene            complement(592197..592697)
FT                   /locus_tag="Daro_0532"
FT   CDS_pept        complement(592197..592697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0532"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45289"
FT                   /db_xref="GOA:Q47IP2"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45289.1"
FT                   /translation="MTQSVTLGGNAITIAGKFPNKGDSAPAFSLVAKDLSDTTLASFAG
FT                   KRKILNIFPSIDTPTCATSVRQFNAKANGLPNTAVLCISADLPFAQARFCGAEGLDNVV
FT                   TLSTLRGREFLEAYGVAITSGPLAGLTARAVVVLDENDKVIHSELVSEIKNEPDYAAAL
FT                   AAL"
FT   gene            complement(593115..593711)
FT                   /locus_tag="Daro_0533"
FT   CDS_pept        complement(593115..593711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0533"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45290"
FT                   /db_xref="GOA:Q47IP1"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45290.1"
FT                   /translation="MQIAIALVAAYLLGSVPFAMISSKLFGLADPRTYGSGNPGATNVL
FT                   RSGNKKAALVTLIGDALKGWAAVFIAQRMGFSDNVIGLVALAVFLGHLYPIFLKFKGGK
FT                   GVATAAGVLIALDPMLGLAVAGTWLFMAYAFRYSSLAAVVAAAMAPVISVLMHGGNGQT
FT                   VVVGILGMALIGKHWQNIQRLMAGQESKIGSKKKA"
FT   gene            593787..594137
FT                   /locus_tag="Daro_0534"
FT   CDS_pept        593787..594137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0534"
FT                   /product="Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45291"
FT                   /db_xref="GOA:Q47IP0"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45291.1"
FT                   /translation="MDIIFLEELRAETWIGIYPREKAMPQTVEISLQIGVSTASAGASD
FT                   DIRDTVDYAVVVDRLRADLAAVHFNLIEALAEHVATYVLETFAVHWVLVSVAKLGMMPG
FT                   VKRVGVIIERSV"
FT   gene            complement(594229..594720)
FT                   /locus_tag="Daro_0535"
FT   CDS_pept        complement(594229..594720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0535"
FT                   /product="Conserved hypothetical protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45292"
FT                   /db_xref="GOA:Q47IN9"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45292.1"
FT                   /translation="MSKAEHAPETQATKFLKANKVPFSTHLYAYEEHGGTKVSARELNV
FT                   DEHAVVKTLVFEDENAKPLIVLMHGDCKVSTKELARQINCKKVEPCKPEVANRHTGFLV
FT                   GGTSPFGTKKAMPVHVEKTILDLPLIYINGGRRGFLVGIHPHDILRVLHPKVVEAALKA
FT                   "
FT   gene            complement(594962..595363)
FT                   /locus_tag="Daro_0536"
FT   CDS_pept        complement(594962..595363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0536"
FT                   /product="Class I peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45293"
FT                   /db_xref="GOA:Q47IN8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45293.1"
FT                   /translation="MPPIALNESEVEFIAIRAQGAGGQNVNKVSNAVHLRFDIAASSLP
FT                   EEIKAKLLAMRDQRISSDGIVVIKAQKHRSLERNREDGLVRLRELIAAAAFVPTVRRAT
FT                   KPSRSSQRKRVDSKVKRGQVKLLRSRIDE"
FT   gene            complement(595374..596282)
FT                   /locus_tag="Daro_0537"
FT   CDS_pept        complement(595374..596282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0537"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45294"
FT                   /db_xref="GOA:Q47IN7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45294.1"
FT                   /translation="MKIASQADLSEIDNFCDALWLEDGLAKATLDSYRSDLSRLALWLA
FT                   NNASEPLLDLHETTLTAFIAHLAKQTRATSQARYLSTLRRFYRWQLGRGRIVADPTLKL
FT                   ANPSRPSRLPKVMSEKQVEALLDAPDLDTPLGLRDRAMLETIYATGLRVSELVNLRLHE
FT                   VSLADGVLRALGKGSKERLVPLGQLAIEWIKRYLNEARPDILNGQHSDDLFITARGGGM
FT                   TRQAFWQLIKRYALIAGIAPDKLSPHVLRHAFATHLLNHGADLRVVQLLLGHADISTTQ
FT                   IYTHVARERLKTLHAVHHPRG"
FT   gene            complement(596260..596748)
FT                   /locus_tag="Daro_0538"
FT   CDS_pept        complement(596260..596748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0538"
FT                   /product="Methylated-DNA-(protein)-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45295"
FT                   /db_xref="GOA:Q47IN6"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45295.1"
FT                   /translation="MQTRPNQTYQAIVAAPGFCLGVQCDDDEITGIDFLEPRPEIAASS
FT                   PLAAEAVRQLKAYIADPHFAFGLPLRPAGTTFQRRVWEQISAIPTGQTHTYGEVAKNLK
FT                   NAPRAVGQACGSNPYPVVVPCHRVVATGGGLGGFSRERGGFLLDVKRWLLTHENSLPG"
FT   gene            complement(596769..597944)
FT                   /locus_tag="Daro_0539"
FT   CDS_pept        complement(596769..597944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0539"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region:Acyl-CoA dehydrogenase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45296"
FT                   /db_xref="GOA:Q47IN5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45296.1"
FT                   /translation="MAKASFNWEDPLLLDSQLAADERQVRNAARSFAQKALAPRIRDAF
FT                   RNETTDPAIFREMGDMGLLGPTLPPQYGGAGLNYVSYGLIAREIERVDSAYRTLLSVQS
FT                   SLVMLPIYAFGSEEQKQKYLPKLGKGEWIGCFGLTEPNSGSDPGSLATRARTVPGGWKL
FT                   SGSKNWISSAPIADVFVVWAKDDDGVIRGFILDKGMPGLSAPVIHGKVGMRAAITGEIV
FT                   MDEVFVPNENLLPGVSGLKGPFTCLNSARYGIAWGALGAAEACWHTARQYTLDRKQFDK
FT                   PLAANQLIQKKLADMQTEITLGIQGALRLGRMMDDGSATPEIVSMMKRNSCGKALDIAR
FT                   TARDMLGGNGISDDFGVIRHLVNLEVVNTYEGTHDVHALILGRAQTGISAF"
FT   gene            complement(598011..599267)
FT                   /locus_tag="Daro_0540"
FT   CDS_pept        complement(598011..599267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0540"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45297"
FT                   /db_xref="GOA:Q47IN4"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45297.1"
FT                   /translation="MDIKHYMHTVGRQARAASRRLAGATTAEKNAALLAIAAAIRRESA
FT                   ALVAANQEDLTAARAAGLETAMLDRLTLSAKGVESMAEGVEQVATLADPIGEMTDIKYR
FT                   PSGIQVGKMRVPLGVIGIIYEARPNVTADAAALCLKSGNAAILRGGSEAIRSNRAIAAL
FT                   VHEGLKAAGLPAESVQVIDTTDRAAVGELITMREFVDVIVPRGGKGLIARLLAESRVPM
FT                   IQHLDGNCHVYLEAEADPAKALKIVENAKTQRYGTCNTAESLLVDRSVAAMLLPPIAAM
FT                   LTAKGVEIRGCAETQAIVPNAIAATEEDYYTEYLAPIISVKVVSGIDEAIEHINQYSSH
FT                   HSEAIITDNHPKAMRFLREVDSASVMINASTRFADGFEYGLGAEIGISTDKIHARGPVG
FT                   LEGLTSQKWVVLGDGHVRG"
FT   gene            599381..599623
FT                   /locus_tag="Daro_0541"
FT   CDS_pept        599381..599623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45298"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45298.1"
FT                   /translation="MAEKLILPTEVKVCATCSYWDGERHVDAEMKLVVVSEDCEGECLV
FT                   QEAAKPGLHDVRKECSCIWEDLEPDVPADDSAEAA"
FT   gene            complement(599624..600631)
FT                   /locus_tag="Daro_0542"
FT   CDS_pept        complement(599624..600631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0542"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45299"
FT                   /db_xref="GOA:Q47IN2"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45299.1"
FT                   /translation="MLLKGEQLAAHLERELRPLYVLYGDDPLLVIEAADAIRAKSRQQG
FT                   YSEREVLTVLPQFDWGTLLSAGGNMSLFGDKKLIDLRIPTGKPGKEGSAALQQWCQHLS
FT                   MDNMLLITLPELDWREEKAVWFTALVNAGVAIKLMAPPLAELPGWIAGRLRRQQQSADL
FT                   ESLKFIAERVEGNLLAAHQEIQKLGLLYPTGQLSMAQIREAVLNVARYDIDGLREALLA
FT                   GDIGRLTRTLDGLMQEGEAPPLVLWAMSEEIRALTIIRAGMDAGKPMDMLLKDAKVWGP
FT                   RATPVKKALQRLSTSALEAALQHAGKIDRLAKGIGQGNIWEEFLRLGLRLTAAK"
FT   gene            complement(600797..601315)
FT                   /locus_tag="Daro_0543"
FT   CDS_pept        complement(600797..601315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0543"
FT                   /product="Rare lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45300"
FT                   /db_xref="GOA:Q47IN1"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45300.1"
FT                   /translation="MPLLRPLLALILAVALAGCGFHLRGVGSGNLPYKTMYISLPDTAD
FT                   VNIWLQRYIKASGSTEIVDDAKSAEGIFQQVSDTRQKTILSVNALGRVREYRLQLDYRF
FT                   RVVNQKGQILVPTNEINLTRDITFDDSNILAKDLEEGLLWRDMNNDLVNQIMRRLSVIK
FT                   PKNPDLEEE"
FT   sig_peptide     complement(601238..601315)
FT                   /locus_tag="Daro_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.447 at
FT                   residue 26"
FT   gene            complement(601325..603955)
FT                   /locus_tag="Daro_0544"
FT   CDS_pept        complement(601325..603955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0544"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45301"
FT                   /db_xref="GOA:Q47IN0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45301.1"
FT                   /translation="MNSAMPMQDKYTPADIERAAQQHWDKTGAARAVEDATKPKYYCLS
FT                   MFPYPSGKLHMGHVRNYTIGDVLSRFHKMQGYNVLQPMGWDAFGMPAENAALQNNVPPA
FT                   GWTYSNIDYMRQQLKSLGFAIDWEREFATCTPEYYRWEQWLFTRLYEKGLVYKKLGTVN
FT                   WDPVDHTVLANEQVIDGRGWRSGALIEKREIPMYYMKITAYAEELLSELDNLPGWPEQV
FT                   RLMQKNWIGKSTGVRFAFPLADNPDEKLWVFTTRADTIMGVTFVAVAAEHPLATKAAAN
FT                   NPELAAFIEECKKGGVAEADIATMEKKGMPTGIYVTHPLTGQQVEVWVGNYVLMSYGDG
FT                   AVMAVPAHDERDFAFALKYNLPIKQVVAVDGETAFSHEAWAEWYADKAKGKLVNSGKYD
FT                   GLGYEAAVDAIAADLAAKNLGDKKVQFRLRDWGISRQRYWGCPIPIIHCKTCGDVPVPD
FT                   DQLPVVLPENVEITGAGSPLAKMPEFYECQCPKCGGDARRETDTMDTFFESSWYFLRYA
FT                   CPDNTTAMVDERVAYWCKGGIDQYIGGIEHAILHLLYSRFFTKLMRDVGLIGDLGEPFA
FT                   NLLTQGMVVAPTFYRELDGGKKQWINPADVDVVTDERGRPTGATLKTDGLPVVIGGTEK
FT                   MSKSKNNGVDPQALIDQYGADTARLFIMFASPPDQSLEWSDAGVEGAYRFLRRLWKTTY
FT                   DHLQAGLVAASTSNDGLSSAQADLRRKLHQTMGKVADDYGRRKQFNTAIAAVMELLNAY
FT                   DKCDLKDAAGRALAQESLESIALLLFPIVPHIGQALYAQLRPGADAGNAAFPKADPAAL
FT                   KQDEIELMVQVNGKLRGAIRVSAEADKATIEATALANEDAIKFMEGKPAKKVIVVPGRL
FT                   VNIVA"
FT   gene            complement(604192..604542)
FT                   /locus_tag="Daro_0545"
FT   CDS_pept        complement(604192..604542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45302"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45302.1"
FT                   /translation="MNSMNAPKILPWIARKAGISDELALKLWRRAVSEAEYLTGKAEGS
FT                   EFWGLSVERFLSIVEDEVGNTPSYSLSPAPQMSWMWRHQTRMSLLSLMAAKNAYRCWQN
FT                   TFGDMYGQKKAA"
FT   gene            604793..606934
FT                   /locus_tag="Daro_0546"
FT   CDS_pept        604793..606934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0546"
FT                   /product="ATP-dependent DNA helicase UvrD"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45303"
FT                   /db_xref="GOA:Q47IM8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45303.1"
FT                   /translation="MSDLLANLNSPQLQAVTLPPVHALILAGAGSGKTRVLTTRIAWLI
FT                   STGQVGPHGVLAVTFTNKAAKEMTARLSSLVPINVRGMWIGTFHGLCNRLLRAHFREAG
FT                   LPQTFQILDSADQLAMVKRLLKNLNIDDEKYPPRELCHFINAHKEQGVRAAQAEAYDNY
FT                   TQKRVEIYAEYENQCNREGVCDFAELLLRCYELLQRNEPLRAHYQQRFRQILVDEFQDT
FT                   NVLQYAWLKLLAGGGAHIFAVGDDDQSIYRFRGAEVGNMREFERDYAGANVIRLEQNYR
FT                   SHGNILAAANAIIKNNRERLGKNLWTDAGDGEPIRAFEAYSDLDEARFIVEEIRELVRD
FT                   GNSPTQIAILYRSNAQSRVLEHELFTKGVPYKVYGGLRFFERQEIKHALAYLRLLGNQD
FT                   DDTAFLRVVNFPTRGIGARSLENLQATAHQINSSLYNAAASLTGKAGQTVGAFVRLIET
FT                   LRQETANLPLPEIIEHVVEKSGLAQHYRVEKEGQERLENLDELINAAATFVDDEGAIGE
FT                   GGALASFLAHASLEAGEHQAGEGQEAVQLMSVHAAKGLEFDVVFISGLEQGLFPHENSV
FT                   NEGKDGLEEERRLMYVAVTRARQRLYVSCAQTRMLHGQTRYCVPSSFLDEIPEGLMRKL
FT                   NKKAESATAVPAFGSFGGGYAEPAAGGLRVGQTVEHAKFGVGVIVSTEGRGSDARVQVN
FT                   FGGAGMKWLALEYAKLTPV"
FT   gene            607015..607773
FT                   /locus_tag="Daro_0547"
FT   CDS_pept        607015..607773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0547"
FT                   /product="Protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45304"
FT                   /db_xref="GOA:Q47IM7"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45304.1"
FT                   /translation="MSIALFLKSLLSSLLLPPGNGLLLMAIAGLGRRRRWAFSLAFLGA
FT                   LLLLLQSLPLVGAGLMGTLERRAGPVLQDAAGGQVIVVLGSGLELNAEEYGGDTATDRT
FT                   LLRTRYGATLARRFDLPVLVSGGRPVNATRSEAEVMADILENEFKVPVRWREMQSMDTI
FT                   QNAALSAAILKKSGVRRIVLVTQAFHMPRAVRLFRAAGLEVIPAPTHFKTGGVGTIGVA
FT                   DILPSASALHNSFYALHEWLGIVWLALTVE"
FT   sig_peptide     607015..607188
FT                   /locus_tag="Daro_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.783) with cleavage site probability 0.535 at
FT                   residue 58"
FT   gene            607830..608804
FT                   /locus_tag="Daro_0548"
FT   CDS_pept        607830..608804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0548"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45305"
FT                   /db_xref="GOA:Q47IM6"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45305.1"
FT                   /translation="MPHAIRFHQTGGPEVLSWEDVDLPAPAPGEATVRHHAVGLNYIDT
FT                   YHRTGLYPLTLPSGIGMEGAGVVEAVGEGVGEVKVGDRVAYAGGPLGAYAEVRNIPAHR
FT                   LLKLPDSISFATGAAMMLQGLTAAYLLRKTYRVQPGDAVLIHAAAGGVGLIACQWAKAL
FT                   GATVIGTVGSSAKAELAKAHGCDHVINYSSENFTQRVREITAGEGVAVVYDGVGKDTFI
FT                   GSLDSLRPLGMMVSYGNASGPVPPLDLLLLSQKGSLFITRPTIATYTAKRADLEALGAE
FT                   LFDAVVSGKVRIEVNQTYALKDAAQAHRDLEARKTTGSTILLP"
FT   gene            608801..610126
FT                   /locus_tag="Daro_0549"
FT   CDS_pept        608801..610126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0549"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45306"
FT                   /db_xref="GOA:Q47IM5"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45306.1"
FT                   /translation="MMAKIKAGLLSLRDLFATAWWIILLAAIGFAIAYQFVEPAPPKKI
FT                   VITTGGESGAYYQFAQRYATILAKDGVTLEVKASAGSLENIERLKNGEAQIAFVQGGVV
FT                   PPKEDPDAEDDSGLLSLGSLFYEPVWVFYRSDKELTRLTELRGKRIAIGQEGSGVRQLA
FT                   QQLLKANDIPAGDHLVPLSGLNAAEELQQGRIDAAFIIAAENAPVVQVLLRSPGIKLMS
FT                   FSQAGAYQRRFPFLTKLTFPHGVADLVRDFPPDDIKVLAPTANLIIRDDLHPALQTLLL
FT                   HAASDVHGKSGFFQDAGEFPSYKDQMLPLSPDAARYFKSGPPFLQRYLPFWLAVLVDRL
FT                   IVMLVPIFALLIPLLKVAPAIYTWRIRRKVFLCYGELKFLEEDLTHHFDPAKLTHYRDR
FT                   LDALDIEASQLHVPLGFTDLVYTLREHVNLVRSILDKREKQA"
FT   sig_peptide     608801..608902
FT                   /locus_tag="Daro_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.904) with cleavage site probability 0.864 at
FT                   residue 34"
FT   gene            610123..610749
FT                   /locus_tag="Daro_0550"
FT   CDS_pept        610123..610749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0550"
FT                   /product="putative partition-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45307"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45307.1"
FT                   /translation="MKAFLVANPKGGSGKSTLATNLAGYFANKGEDVMLGDIDRQQSSR
FT                   EWLAIRPFALPTIDTWEVGDDKISRPPKGTSHVVLDTPAGLHGKMLERVLKLSTRVIVP
FT                   VQPSMFDMLATRHFLTELLSEKAVRKGKADVAVIGMRVDARTRAAGELERFFSTFDLPV
FT                   LAYLRDTQVYVQATAAGMTIFDLPPSRAERDIEQWQAIVDWVEAD"
FT   gene            complement(610771..613851)
FT                   /locus_tag="Daro_0551"
FT   CDS_pept        complement(610771..613851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0551"
FT                   /product="PAS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45308"
FT                   /db_xref="GOA:Q47IM3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45308.1"
FT                   /translation="MKISPTHAPICEKRPSPARSVFSEGAAWLALGLILAVTAAICALV
FT                   RETTEEQIYQRFLYRAEQQRSNILFRLEAHAQVLRGAAALFDASETVDRREWRDYIAHL
FT                   HLAKTLPGIQGIGFSLMVSQRDKAAHERAMRAEGFPDYAITPAGTRERYSSIIYLEPFA
FT                   GRNLKAFGYDMFAEPVRRDAMEYARDYGEPALSGKVTLVQENQQDVQPGFLIYVPVYRP
FT                   SMPHETIKERRTALLGFTFSPFRAEDLMRSAVSRDNKDVEIELYDGEIRPERLLFDSHI
FT                   DQSSASQGRQQVELPIEFGGHQWIALFRSRPEFDSITASQLPISIALIGTLIGLMSFFW
FT                   LLRKNRFQQSITAYADRLEENETRLRTLINTMPDIVCLKDGAGRWTEANTLLLRLFALE
FT                   SVGYQGMTGGELAAAGHFDYARLAALEASDEQVWLNGERLHDELTIPVEGQHDRIFDIA
FT                   KVPLFAADGSRHALLTVGRDITERVETEKALRSAERKFRGLIEQSLAGVYIIQGRCFRY
FT                   VNPYFARIFGYDSPDEIIDQPLFEELVSPQDRQMVANNVRRRLNGEMETLHYSFVGQRK
FT                   DGSPVDVEVFGTKVDYEDQPALIGVVIDITERKQAEAELKRHRENLEEQVNARTADLLL
FT                   AKEAAEAANRAKSTFLANMSHELRTPMNAIIGMTHLLIRGNENASQREKLAKVSNAADH
FT                   LLHLLNDILDLSKIEAERLTLEKIPLRISDIVANAISMAGEKIAAKGLQFNQQISPQLV
FT                   TTELIGDPLRLRQILLNLLDNALKFTAQGSISLSASVTDETSENLTIRISIEDTGTGIP
FT                   DEAKDRIFAPFEQVDGSTTRQHGGTGLGLSIVKQLIHLMHGKIEVSSTPGIGSCFTLTA
FT                   RLDKAPSKPRHQATPERPVRAPQPLTLGNKQLLLAEDEPVNREVMLDLLSDIPGLRVDI
FT                   AENGERAFELASTRHYDLILMDMQMPKMDGLEATRAIRQLSGYAETPILATTANVFNED
FT                   RERCIESGMSDFITKPVEPGLLYTKLSSWLAANSGAD"
FT   gene            complement(613940..614851)
FT                   /locus_tag="Daro_0552"
FT   CDS_pept        complement(613940..614851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0552"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45309"
FT                   /db_xref="GOA:Q47IM2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45309.1"
FT                   /translation="MKISFDLLLILDAIDRHGSFTAAATALHRVPSALSHAIAKLEGEL
FT                   GATLFHREGRRATLNEAGHTLLEDGRHLLRSASELERRVQRIAQGWEAELRIAIDTIIP
FT                   VERIYPMLERFYAAGHSTQLRLSYEVLGGTWDALATDRADLVIGASGDMPARSGIATRL
FT                   LCRHSQFVFAIAPSHPLAAWTEPIPNSELLRHRTIAIADTSQELAARTIGLIEGQDILR
FT                   VPDIRAKAAAQVAGLGIGHLPRWLADPEIAAGRLVEKALADPRHPMPLHLAWRTRQSGK
FT                   ALNWFLDSLAEKANIDRLTQGL"
FT   gene            614957..615664
FT                   /locus_tag="Daro_0553"
FT   CDS_pept        614957..615664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0553"
FT                   /product="Pirin, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45310"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45310.1"
FT                   /translation="MIQVRPSAERGYADHGWLRARHSFSFADYYDPAEMGWGVLRVINE
FT                   DRVAPGKGFGTHGHRDMEIVTYILSGALEHKDSLGHGGVIRRGEVQRMSAGTGIRHSEF
FT                   NPLPDQETHLLQIWIEPSQHGTPASYEQQALPIEELRGRWRLVASPDGAEGSTTIGQDA
FT                   RLWASVLVPGEAAEYRLAAGRLAYVQVVSGQLSVNGQRLVAGDGAKIADETQLEFLAGE
FT                   EAEILLFDLPPVA"
FT   gene            615699..616253
FT                   /locus_tag="Daro_0554"
FT   CDS_pept        615699..616253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0554"
FT                   /product="Flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45311"
FT                   /db_xref="GOA:Q47IM0"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45311.1"
FT                   /translation="MSKTIVVYHSGYGHTKRVAEVVAEGAAAELLAIDSEGNLPEGGWD
FT                   KLAAADAIIFGTPTYMGGPSWQFKKFADASSKPWYARAWQDKVFGGFTNSASPVGDKGA
FT                   TVIQLQTLASQHGGIWVSLGLLPSNTKAATHADVNHLGGSVGLLVRSPSDASVDEIPQG
FT                   DLDTARQYGQRITAVAARLRG"
FT   gene            616331..617131
FT                   /locus_tag="Daro_0555"
FT   CDS_pept        616331..617131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0555"
FT                   /product="Response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45312"
FT                   /db_xref="GOA:Q47IL9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45312.1"
FT                   /translation="MALTTSLADLSVLLVEPSSMQAHLVKRMLEHQGVKKVTVVETASA
FT                   ALASLKQEHKYVIVISSLYLPDLAGTELVTAMRANADMETIPFILVSSETRPQVLEPVR
FT                   QSGACSIVSKPFTEQQLSRALFAAADYLNPPEDIDVTEIENLRVLLVDDSLASRRHLRR
FT                   LLEELGIERITEAVNGKEAVSLLEQSMVDLVITDYNMPEMDGRELTEYIRTQSWQAEVP
FT                   VLMVTSEQNMGRLAAVERAGVSAICDKPFEAGNIRRLISDSLTR"
FT   gene            complement(617109..617657)
FT                   /locus_tag="Daro_0556"
FT   CDS_pept        complement(617109..617657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45313"
FT                   /db_xref="GOA:Q47IL8"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45313.1"
FT                   /translation="MNLTAAYGLLAHGLIFGAMAALLPLGPLHQRVVLTATATALLVGI
FT                   APAMHGLFGTPSATLLQLAILQLARRTPSPFTQPVAAGLLTFALFFYPLALGWGPFDPY
FT                   ALGYQPAPLLAALLALGLALWWRRQPGWLTILAIDLLAYASGIFVNLWDALFDPLLVLL
FT                   ALAIVVRQWAIRFIASRNR"
FT   sig_peptide     complement(617595..617657)
FT                   /locus_tag="Daro_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.931 at
FT                   residue 21"
FT   gene            complement(617654..618781)
FT                   /locus_tag="Daro_0557"
FT   CDS_pept        complement(617654..618781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0557"
FT                   /product="Glycosyl hydrolase, BNR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45314"
FT                   /db_xref="GOA:Q47IL7"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45314.1"
FT                   /translation="MQPLSPAVIHHGSAGLFLAALAAAFLRLPATEAPAFVPPPVVASP
FT                   LPADMTRSNLPSAGATAGPASLTLLADGKVAAAWLAGPGNDNSAATIWLSILGRSGWSQ
FT                   PLPAATRESTAAGTFAHMSSLGRPLLLAEGSWLHLWYESLPLGSGAGAAIVHSLSTDGG
FT                   KTWSKAERLQTSPLGTLGNGLGGPPLMLADGGLGLPLDQRFPKQGSEWLRLSATGRIVD
FT                   KRRLAHAAPTLQPAVVALDDHRGLAVLRDNRAGTSRATLSTTNGGQTWETASELALPAP
FT                   DAPVALLRLASGRLLLAGNPQQGKEALQLWLSADDGQTWAMKRIVEAASDGGAEFADPA
FT                   LLQGRDGRIHLTYTWRQQQIRYVAFTEAWLAGGAP"
FT   sig_peptide     complement(618683..618781)
FT                   /locus_tag="Daro_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.639) with cleavage site probability 0.542 at
FT                   residue 33"
FT   gene            complement(618970..619758)
FT                   /locus_tag="Daro_0558"
FT   CDS_pept        complement(618970..619758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0558"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45315"
FT                   /db_xref="GOA:Q47IL6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45315.1"
FT                   /translation="MTQEEPLVLRQDRADGLTTLTLNRPGQFNSLSKDMLTAIQAELDA
FT                   IAASDSVRVVVIAGAGKAFCAGHDLKEMRGNHSKAFMQALFKQCGKLMLTITQMPQPVI
FT                   ARVHGIATAAGCQLVSMCDLAVAADVSKFAVSGINVGLFCSTPAVGLARNLGRKAALEM
FT                   LLTGEFIDAMEAKAKGLVNRVVPADALDAEIERLAGSILAKSAVAVRMGKGMFYQQLEM
FT                   GLSEAYEYASEVMACNMMSDDAGEGIDAFMQKRKPVYTGR"
FT   gene            619858..623328
FT                   /locus_tag="Daro_0559"
FT   CDS_pept        619858..623328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0559"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45316"
FT                   /db_xref="GOA:Q47IL5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45316.1"
FT                   /translation="MNSPRYVHLRLHSEYSVTDGIVRVGDAVKRAAGDSMPAMAMTDLG
FT                   NLFGLVKFYTGARGKGVKPIAGADVWITNPDAPEDAYRLLLLVRNRVGYQQLCELLTKA
FT                   YLVEGRRDRAEIRREWFAELGSDGLIALSGAHLGDIGEALLNGNFDLAGERAKAWEAIF
FT                   PGAFYLEVQRYGQPQQEAIVQQTADLAGELGLPLVATHPIQFMNRDDFRAHEARVCIAE
FT                   GYVLGDTRRPKLYTEEQYFKTQAEMVELFADLPEALENTLEIAKRCNLTMTLGKNFLPD
FT                   FPIPPGMTDGEYLVQEAKKGLEVRLAELYPDPEVRQQRRPEYDERLVFECKTILQMGFP
FT                   GYFLIVADFINWGKKNGVPVGPGRGSGAGSLVAYSLRITDIDPLEYALLFERFLNPERV
FT                   SMPDFDIDFCQDNRWRVIEYVREHYGADAVSQIATFGTMSSKAVIRDVGRVFGLPYSMC
FT                   DRISKLIPIVQNKPVSLAEALEQEPQLKQMMEGDGDGETIRELFDLAGRLEDLTRNVGM
FT                   HAGGVLIAPGKITDFCPIYQATGADASPVSQFDKDDVEKAGLVKFDFLGLRNLTIIELA
FT                   VEYIRRMTGEKLDLMSLGFKDPAAYQILKDANTTAIFQVESEGMKKLLKKLAPDRFEDI
FT                   IAVLALYRPGPLGSGMVDDFILRKKGQQKIDYFHPDLTACLSPTYGVIVYQEQVMQISQ
FT                   IIGGYTLGGADMLRRAMGKKKPEEMAKHRETIAQGAKEKGYDPALAEQLFDLMTKFAEY
FT                   GFNKSHTAAYAVVTYHTAWLKAHHCAAFMAATMSSDLDNTDSVKIFYEDTIANKIKVLG
FT                   PDVNVSNYRFEPVDRGTIRYGLGAVKGTGEQAVNVILKARAEGGPFKDLFDFCMRCDKR
FT                   MVNRRTTEALIKAGAFDTIAPEIAPGKGADRCKLLATVGVAMDFAEQAERNAMQTSLFD
FT                   MADVADEHAPEYVNVRPWDEKTKLMEEKTALGFFFSGHPYNTCKKELSRFIRRPLNRLE
FT                   PAKEMTTIAGLVVGVRTQMTRRGKMLFVQLDDGTGMVEVSVFNELFEAERAKIVTDEVL
FT                   VIEGKVSYDDFSGGNRVVADKLMTLGEARARFARHLLLKMNGNADAQRLKSLLTPFAPG
FT                   SAPVRIRYRNELAECELVLGAASRVRLDDALLEALNGWLQPENVEIVYQ"
FT   gene            623325..623804
FT                   /locus_tag="Daro_0560"
FT   CDS_pept        623325..623804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45317"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR027565"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45317.1"
FT                   /translation="MIRWLDQSMMVALVDSARQAPRRRVHRNFHPDDVYPAHRLMIAIE
FT                   PDSYVPPHRHLSPTKDETLLVLRGSLGVVFFDADGVAEEQVALRAGGEVLGVDIPHGVF
FT                   HTVFALEPGTVIFEAKAGPYVPIAPDERAAWAPVEGSAEAPAYLAGLRQMFGGSV"
FT   gene            complement(623889..625406)
FT                   /locus_tag="Daro_0561"
FT   CDS_pept        complement(623889..625406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0561"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45318"
FT                   /db_xref="GOA:Q47IL3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45318.1"
FT                   /translation="MGLFGNNAALEKIDRDIAAIAEGSADLSHSVGTTGNDAAGRISGN
FT                   INRFFGRVRSLISHSRERSVSIAADAARMNQLVQQTDDAVRRQEALAATVFDSSNRVNQ
FT                   AVGEVAMNSDAIQSSTQNNLDLAQRSLEQMETVASTMRSTNAHIEHFSSTVSELHTSSM
FT                   KINEIVSLINDISDQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEKVKTATQVIG
FT                   QNTQSMINLVSDTSAKTQTIVGEVTRANGYIETSAADLTTMVGDFKQTTEQLATISSAI
FT                   YNLRESNQAIHSEVEEIRDHSREISGRMRQCIDSAKTLRESTEDLQCTLADFRTGNNMF
FT                   DTLHDKCTAFRDDVAGILQKLADRGVNIFDQAYKEIPGSNPKRYTTAYDNQCDGELTRL
FT                   YDNLLREVPGLVYSLSMDTNGYAPAHNAVFSNPPSGDPAIDLVKCRHKRIFNDPVGMKG
FT                   AKNQKPSLFQTYVRDTGEILADLTMPVMVNGRHWGGVRIGFKTDLVK"
FT   gene            complement(625794..626381)
FT                   /locus_tag="Daro_0562"
FT   CDS_pept        complement(625794..626381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0562"
FT                   /product="Excisionase/Xis, DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45319"
FT                   /db_xref="GOA:Q47IL2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45319.1"
FT                   /translation="MAEPEYLSTRQAALRLGVSLGTVQNMVENGALEAWKTAGGHRRIP
FT                   VASVDALLARRRNLTPSAQEGGGQLDILVAEDDHTLQMLYQMTFDSWGLPIKLRIVANG
FT                   FDGLLQVGQRVPDILIADLMMPGMDGFEMIRRLRANADLARMDIIVVSAIDSEEIKKRG
FT                   LPNDITIFGKPIPFHEIKGFLLGRIAARQRAS"
FT   gene            complement(626526..627191)
FT                   /locus_tag="Daro_0563"
FT   CDS_pept        complement(626526..627191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0563"
FT                   /product="Alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45320"
FT                   /db_xref="GOA:Q47IL1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45320.1"
FT                   /translation="MAAWLNCMFPPNLKTDHDKEFPMAVLVGKQAPDFTATAVYGNNEI
FT                   KELKLSSFKGKPVVLFFYPLDFTFVCPSELIAFDHRLEEFKQRGVEVIGVSIDSQFTHL
FT                   AWKNTAVKEGGIGPVGYPLVADVKHEICRAYDVELEAAGVALRGSFLIDKNGTVMHQVV
FT                   NMLPLGRNIDEMLRMVDALQFFEENGEVCPAGWNKGKPGMVASTEGVAAYLAKNAKKL"
FT   gene            627326..628771
FT                   /locus_tag="Daro_0564"
FT   CDS_pept        627326..628771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0564"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45321"
FT                   /db_xref="GOA:Q47IL0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45321.1"
FT                   /translation="MLKVLVFLPVVGAVLLAVLPARRALPLWQVAMAFALASLGYALWL
FT                   ATRFEPAGAAVQMFESRAWNVRLGSYFALGVDGISLAMVLLTALLSLIAVLVSRRMEQG
FT                   ARLYFMLVLLLESAMFGVFTARDWSLFYVFWEATLLPLFFLIDRLGGPNRQRAALNFFL
FT                   YTLGGSVFMLVALLFLYDAAPGHSFAMADMAEGGRGLPLNTQLLIFAGLFIGFGVKMPV
FT                   FPLHGWLPLAHVEAPSPVSILLSGVLLKMGAYGLIRAAETLPAALLATQDWLAILAFIS
FT                   LLYGGILAWRQQDLKAMVAYSSISHMGVVLLGIATLNVTGLTGAVVQMVAHGLTAATLF
FT                   LVVGLLYQRTHSRDLADYGSVLGKAPRFAFFIAFGLLAAIGLPGSAGFIAELHVLVAGY
FT                   TRWGGWVLLLGVAMLVGAAYSLRVIGRLCLKGETMDLPDMTRTETLCGGLLAACILVLG
FT                   LWPAPLLKLIAGSVGRVAGLFGG"
FT   sig_peptide     627326..627400
FT                   /locus_tag="Daro_0564"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.671) with cleavage site probability 0.566 at
FT                   residue 25"
FT   gene            628773..631811
FT                   /locus_tag="Daro_0565"
FT   CDS_pept        628773..631811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45322"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45322.1"
FT                   /translation="MSAAHELPIRERLAHWVEHLTHVLPAQAPIRDFVHHNTLHGFQHL
FT                   PFTEALASAQALTGATTYWPESRFRECLASGRISPDDLSAALDDFGVGDLDQPVVRNLT
FT                   RRDILLASLRFGCEAPNACRQAWLLDETSLADDPLFAYFCRSVELAPSKGASENWQVQA
FT                   LARWDALCGRVGRTWTWRALLEYLSGEDVLEWTRSILQRHLAAHLDLGVAAWRNPAQGQ
FT                   GFFAAWRASAGLDMAWEMDELPNARDEILHLPDSPLDVLLEELPRLVPDHSQWYGYLER
FT                   LSLELPGWSGMFLWRDRNPGRGDGTPIAMLDYLTVRVLLERLLTDDLLRRLAGSPLSLA
FT                   ELHAYYAARPEEFLVRAALHEPGLPEDLLGRAAHLVQLAREGHVDVAEWRRLAAALAPA
FT                   MAAAQDDGAAWQMAGLSRQLGLTPADLEMLSGDDLTALQTCAASLSSLQRGHIWLLAYE
FT                   RHYREQLFSALTANHPRQATPAAPSAQVVMCMDDREEGTRRHLEEIAPDVATYGAAGFF
FT                   GVPMFWQGLDDAGKTALCPVVVQPTHLLRELPAAGEEGSLAGHAARREKRLRWNERLYQ
FT                   ATRRRAVAGPVLTALGAVPALASLLAVTLVPGWFGETARRWREQYEGRVSTRLGLTAEQ
FT                   PVAATPEQPQLGLTDAEQIERVEAFLRMIGLTAGFAPLVLMFGHGSGSQNNPHLSAYDC
FT                   GACSGKHGGPNARVFAAMANRPAVRAGLAARGLSIPDSTWFVAAEHNTCDDGIEWYDLD
FT                   STPERFQAAVDRLLGQMAEACRAHAAERCRRLASAPFKPSPWKARQHMIGRANDISQAR
FT                   PELGHATNAAAFIGRRQMSRGLFLDRRVFLISYDPVGDDDGCIVEGILLAAGPVGAGIA
FT                   LEYYFSTVDNERFGCGSKITHNITGLFGVMEGADSDLRTGLPWQMVEIHEPMRLLVVVE
FT                   QTPEVLTAIVGRQPPLQELINNEWIIVAAKHPITGAIDLYCPRRGWLPWSGQAVLPQVA
FT                   RSVDWFAGESQPLAPAIILGGVR"
FT   gene            631808..633334
FT                   /locus_tag="Daro_0566"
FT   CDS_pept        631808..633334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0566"
FT                   /product="NADH-Ubiquinone oxidoreductase (complex I), chain
FT                   5/L, N-terminal:NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45323"
FT                   /db_xref="GOA:Q47IK8"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45323.1"
FT                   /translation="MSALLNHLPNWVWLVPALPLLVVVINGARVLLGLASGDAAESLTA
FT                   RLSSLAAFGGLVLLLAIDGLALLHGAPGHRRLGHWFGTGNWEATFSFMLDPLSLTLGTL
FT                   TALIGWLVIRFSANYLHREAGFHRFFIALSFFLAGIQLVLLAGNGLLAFVGWEMCGVSS
FT                   FLLIGYAWHRPVATGNALFAFITNRGGDAGFLLGLGLAATWLGGFEWTALSLASKISVV
FT                   NDRLLVIGFVIAALAKSAQLPFSAWISRALEGPTPSSAIFYGAVMIHAGVYLMLRLEPL
FT                   LVQVPDVMFGLVVAGLLTAIYAWLCGLVQTDVKSALIFATLFQVSLMFVAIGLGWTTLA
FT                   LVHLCLHAAWRIWQFLLAPSWLAMTRDRPPPPPAWLRHNQLLYTIALQRFWLDKLSHTL
FT                   LVEPTESFSRDVRALEEHFIDHAIGQPGQGKAVHADRPLVVADGLPGRVLAAVSDVLQH
FT                   IEYRLLLRGKGGMAEKLMHRAGAYLRTLEHLLEQPRYLMMAVMATFVVIL"
FT   gene            633334..634845
FT                   /locus_tag="Daro_0567"
FT   CDS_pept        633334..634845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0567"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45324"
FT                   /db_xref="GOA:Q47IK7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45324.1"
FT                   /translation="MGSAMKPLSEIFWYQQAGLPLLLLLQLLPLFGAAVVFAFKERATA
FT                   VVAGKVFALAELLLAIVTVSHINPLSPSLQLAERFVPLAYHVAVDGLSLLFLLVAALLT
FT                   LLMTLYGMSRGMISPGRLFAVLLLAEAGLAGMLVTVNVAWFAAFSALELWAVVYLLRRW
FT                   ASSRAEIQALARFVQYQAFGWALFAAGCLVLGWGHAEATGGRWSFDLFDLVGAIPVGKF
FT                   QTAAFYLLFYGLAVRTPLFPLHGWLPNMAQHGLIAVAPALMVGVKVGIYGMLRFVLPLT
FT                   PAAVQYWQPYVVGFAMAGVFFTAALAFQQTNLRRLLAFAVVSHTSLLVIGLFSLHESGI
FT                   QGSMLLAANFGLAVTGMWFIVGFVFRRTGTTELHELSGLFERIPFLAIAFLIFGLAIVG
FT                   MPGTPGFDAAHLILEASIDQFGALSTVATALGNVAAAGFLLWAFQKAFLSQAKAGGHDV
FT                   DKTLPMEYLVCGIALAAMLAIGFFTEPWLYLTETASQAAAARFAR"
FT   gene            634842..636299
FT                   /locus_tag="Daro_0568"
FT   CDS_pept        634842..636299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0568"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45325"
FT                   /db_xref="GOA:Q47IK6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45325.1"
FT                   /translation="MNLPLLSLLVFLPLAGAGLIWLLPSRATRPVVALSMIITLALGVA
FT                   ALAAYEPSGARFQLVERVSWIASLNVHYLLGIDGIAVLFLPATALLFLGSLVASWNAVH
FT                   DAPRLHYSLLLLLQTANLGIFCALDTALFFVFWELTLVPLYFLLGRWGVTTGRAAAATR
FT                   YFLIMLAGGIPLLLAFVILAVSQSVPTFDLMALLAAPLPRSTQTAVFLLCLIGFGVKVP
FT                   LVPLHTWLPQFSLAAPGSLTALLVGLKLGAFGLIRFAVPLAPDAALDMHWLLAGLGTVA
FT                   ILYGAVGMLAQSNLRVGLAYASICHVGLAVLGLASYTAQGAQGAVSLLLSFSVATGGAF
FT                   ILLEFLRQRTGSTDIHALGGAAKTMPLLATGFLICGLAGVGMPGTSSFPGEFLLIIAAL
FT                   HSHTGAGMAALFGLSIAAGGFLALYRKAFFGPVERESVAQATDLRPREWAVLVALIVMI
FT                   AGIGIYPGPWIEIVRPAAEVWAAGLVR"
FT   sig_peptide     634842..634925
FT                   /locus_tag="Daro_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.930) with cleavage site probability 0.556 at
FT                   residue 28"
FT   gene            636309..636605
FT                   /locus_tag="Daro_0569"
FT   CDS_pept        636309..636605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45326"
FT                   /db_xref="GOA:Q47IK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45326.1"
FT                   /translation="MPDKRLTTRLMAAVFALLGIVAVIFDWSFVIGRRGFDTADGASAH
FT                   YIGTFWFVLALITLSTLIAEPKLRKSVGSLLAIILAICLFGPLLYMLLAKQFA"
FT   gene            complement(636609..636947)
FT                   /locus_tag="Daro_0570"
FT   CDS_pept        complement(636609..636947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0570"
FT                   /product="PhnA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45327"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45327.1"
FT                   /translation="MSGLPTCPKCNSEYTYEDGDNYVCPECAHEWPKTAVEASEEKRVW
FT                   RDANGNELQDGDSVTVIKDLKIKGSSSVVKVGTKVKNIRLIEGDHDIDCKIDGIGAMQL
FT                   KSEFVKKA"
FT   gene            complement(636960..638651)
FT                   /locus_tag="Daro_0571"
FT   CDS_pept        complement(636960..638651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0571"
FT                   /product="Sulphate anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45328"
FT                   /db_xref="GOA:Q47IK3"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45328.1"
FT                   /translation="MKIAFHPKLLDCLPTYNRTQLGQDIAAGITVGVLALPLAMAFAIA
FT                   SGCSPTAGIWTAIVAGLITSLLGGSRVQIGGPTGAFIPIIYGIVAIHGFSNLLGATMLA
FT                   GVFLLAMGLARMGQLIRFIPVTVVIGFTNGIAVVIFLAQIKDFFGLKIESLPAEFFHRI
FT                   KTLAAYADTVDLPTLGLASACFIFLLSYNWLAQRIAILRRAPGPLAVLVVGTLVSYIFD
FT                   LPVETIGSRFHGIPQELPHFGLPDLSIHDFGQLISPAITIALLGAIESLLSARVADGQI
FT                   DDRHDPNQELVAQGLANIVAPLFGGFAATGAIARTTTNVKSGGRTPIAGIIHAFVLLGV
FT                   VLIAAPLASYVPLATLSAIVMVVAINMGEWHEFRELQRYTYNYRIILLATFIVTVLFDL
FT                   TIAVELGMVLACLFFIYRMSELTRVERRPLREEASEPQFLYPDGTMRVAAWQLFGSLFF
FT                   GAVNKLEALLDPAAGHPEVVILDMTQLIQLDTTGLEGLESLLDKLKKRGCTLLVCGLNS
FT                   QPGSLLYRSGFVDHLGDDNVCPDLSSALQRAYILLPNLMGSHEEDY"
FT   gene            638757..638951
FT                   /locus_tag="Daro_0572"
FT   CDS_pept        638757..638951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0572"
FT                   /product="Helix-turn-helix protein, CopG"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45329"
FT                   /db_xref="GOA:Q47IK2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45329.1"
FT                   /translation="MENRTARLTILIDPQKKKIFEEICAANDLTSSQVVRRLVRQYIID
FT                   NAGSRELPDWLKPNNKAGD"
FT   gene            complement(638948..639274)
FT                   /locus_tag="Daro_0573"
FT   CDS_pept        complement(638948..639274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45330"
FT                   /db_xref="GOA:Q47IK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45330.1"
FT                   /translation="MLKPSIRPPRPQLTGPIFAYALADVFGLSCVGIGASWFAAGKGAI
FT                   IANFPTSMAEAVICTAGGAAVMLWSVARILREIAKQAPEMQARYDAYIAANHPDKIRPS
FT                   SETD"
FT   gene            complement(639692..641782)
FT                   /locus_tag="Daro_0574"
FT   CDS_pept        complement(639692..641782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0574"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45331"
FT                   /db_xref="GOA:Q47IK0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45331.1"
FT                   /translation="MSRKILVTSALPYANGAIHLGHLVEYIQTDIWVRFQKMSGNECWY
FT                   VCADDTHGTPIMLRAEKEGITPEQLIARVHGEHSRDFAGFHVGFDNYYSTHSDETRDCA
FT                   NDIYLKLRAAGLIETRTIEQYYDPVKQLFLPDRFIKGECPKCGAKDQYGDNCESCGAAY
FT                   APTDLKEPYSAISGAKPELRTSEHYFFKLSDPRCEAFLRQYTSRDNGVLQNEAANKMQE
FT                   WLGAPGENKLTDWDISRDAPYFGFEIPDAPGKYFYVWLDAPIGYMGSFKNLCARNGLDF
FT                   NEYFKPDAKTELYHFIGKDILYFHALFWPAELAHAGFRTPTKIFAHGFLTVDGAKMSKS
FT                   RGTFITAESFLKTGLNPEWLRYYYAAKLSATMEDIDLSLDDFVARVNSDLVGKYVNIAS
FT                   RSAGFITKRFNGQLAPATAELPAIKGIQEAASRIAELYEAREFGKAMREIMALTDAANQ
FT                   YVDSVKPWELAKQEGKEVELHAACTNALNLFRLLTVLLKPILPIVAEKVEKFLNIAPLH
FT                   WADTQSLLAGGHAINAYEHLMTRVDPKLIEKLVEANKESLAPAPEAQSQQRHAEHQQNE
FT                   VTAESPWEPFCNIDDFMKVDLRIVRIANAEHVEGADKLVRLTLDVGNNETRNVFAGIKA
FT                   AYDPAQLIGRLTVMVANLAPRKMKFGLSEGMVLAASDGEGKTPGIFLLSPDSGAQPGMR
FT                   VK"
FT   gene            641979..642662
FT                   /locus_tag="Daro_0575"
FT   CDS_pept        641979..642662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0575"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45332"
FT                   /db_xref="GOA:Q47IJ9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45332.1"
FT                   /translation="MNFAVVEDSRSQAEVLKALLKSEGHQVEVFAEGKLCIEALKSRSF
FT                   DFFVIDWNLPDIGGDEVLKQVREHCGWEVPVLFCTARTDEEAAADILRLGADDYVPKPI
FT                   RYMEFLARVQSLLRRRKPRSSTLRFGSIEIDLEGRRICLGGLDVELTQREFELAVILLR
FT                   NVGRVLSREELLTSVWSKEAGVDTRTVDTHASRLRKKLGLAGESGLMLSSVYGQGYRLD
FT                   TVQQA"
FT   gene            642739..643830
FT                   /locus_tag="Daro_0576"
FT   CDS_pept        642739..643830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0576"
FT                   /product="Protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45333"
FT                   /db_xref="GOA:Q47IJ8"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45333.1"
FT                   /translation="MSLSEQQIKAALSAAVDPNTGKDFVAGKAVKNIKIDGDDVAFDIE
FT                   LGYPAKTQIDPIRKQVIAAVRSVPGVGNISANVYTKIVAHSVQMGVKLMPGVKNIIAVA
FT                   SGKGGVGKSTTAVNLALALAQEGASVGILDADIYGPSQPQMLGLAGQQPESKDGQSMEP
FT                   LEAYGLQAMSIGFMVDVETPMVWRGPMVSQALDQLLGQTNWHDIDYLIVDMPPGTGDIQ
FT                   LSLAQKVPVTGAVIVTTPQDIALIDARKGLKMFEKVNIPILGIVENMSIHICSKCGHEE
FT                   HIFGEGGGEKMCKDYDVEFLGSLPLEMAIRQMADGGKPTVVGDPDSRTAEIYRGIARRV
FT                   AVKIAEKAKDMTSKFPNIVVQNT"
FT   gene            643902..644468
FT                   /locus_tag="Daro_0577"
FT   CDS_pept        643902..644468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0577"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45334"
FT                   /db_xref="GOA:Q47IJ7"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45334.1"
FT                   /translation="MTIKSDKWIRRMAAEHGMIEPFSPELVREANGQKIVSYGTSSYGY
FT                   DIRCAREFKVFTNINSTVVDPKNFDPKSFVEIESDVCIIPPNSFALARTMEYFRIPRSV
FT                   LTVCLGKSTYARCGIIVNVTPFEPEWEGHVTLEFSNTTPLPAKIYAGEGCAQVLFFESD
FT                   EICETSYKDRGGKYQGQEGVTLPKI"
FT   gene            644540..646768
FT                   /locus_tag="Daro_0578"
FT   CDS_pept        644540..646768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0578"
FT                   /product="ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45335"
FT                   /db_xref="GOA:Q47IJ6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45335.1"
FT                   /translation="MRFHFPIIIIDEDFRSENTSGFGIRALAEAIEKEGMEVVGVTSYG
FT                   DLTSFAQQQSRASAFILSIDDEELALEPEETLAELRAFVKEIRNRNAEIPIFLHGETRT
FT                   SRHIPNDVLRELHGFIHMFEDTPEFIARNVKREAQAYLDSLPPPFFRALTHYAADGSYS
FT                   WHCPGHSGGVAFLKSPVGQMFHQFFGENMLRADVCNAVEELGQLLDHTGPVAASERNAA
FT                   RIFNADHLYFVTNGTSTSNKIVWHSTVAPGDVVVVDRNCHKSILHAIMMTGAIPVFLMP
FT                   TRNNFGIIGPIPKSEFAWESIQKKIAANPFITDKTAKPRVLTITQSTYDGILYNVEDIK
FT                   DMLDGRIDTLHFDEAWLPHAAFHDFYGDYHAIGADRPRCKESMIFSTQSTHKLLAGLSQ
FT                   ASQILVQDADNYKLDRDIFNEAYLMHTSTSPQYSIIASCDVAAAMMEEPAGTALVEESI
FT                   AEALDFRRAMRKVDEEWGADWWFKVWGPDDLSEEGIEEREAWMLKPGERWHGFNNLADG
FT                   FNMLDPIKATIITPGLDVDGDFADEFGIPAAIVTKYLAEHGVIVEKCGLYSFFIMFTIG
FT                   ITKGRWNTLVTALQQFKDDYDKNQPLWKVLPEFVQKNPRYERVGLRDLCTQIHSVYKHN
FT                   DVARLTTEMYLSDMVPAMRPADAFAKMAHRDIERVPVDALEGRVTAVLLTPYPPGIPLL
FT                   IPGERFNKTICSYLKFAREFNARFPGFETDVHGLVKGGDGSYYVDCVR"
FT   gene            complement(646778..647269)
FT                   /locus_tag="Daro_0579"
FT   CDS_pept        complement(646778..647269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0579"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45336"
FT                   /db_xref="GOA:Q47IJ5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45336.1"
FT                   /translation="MPEIILIAAVAKNRVIGKDNTLIWNLPEDMAHFKALTAGQTVVMG
FT                   RKTWESLPPRFRPLPGRRNVVISRQADYAAPGAEVANSLENALQLASTAESVFIIGGEQ
FT                   IYKQAMAVADRLEITDVDLEPAGDAWFPEIAATDWSVTQKNTPPSQSGTGFSFVTYRRK
FT                   "
FT   gene            complement(647278..648735)
FT                   /locus_tag="Daro_0580"
FT   CDS_pept        complement(647278..648735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0580"
FT                   /product="glycogen synthase (ADP-glucose)"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45337"
FT                   /db_xref="GOA:Q47IJ4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45337.1"
FT                   /translation="MSSLSILFATSEMAPWVKTGGLGDVAAALPAALRKAGHDIRVLLP
FT                   AYPALKQAFPTATTVAELPAFAPGLPASRLLAAQTGKLELLLLDCPELYDRPGNPYLDA
FT                   TGRDWPDNALRFGLLSRVAARLGQPDSPLSWQPDIVHANDWQTALAPAYLHYQGGAASV
FT                   VTVHNIAFQGCFGREMLAALGLPEHAWRFDGVEYHDQLSFLKAGLQLASQISTVSPTYA
FT                   REIQDEHFGYGLAPLLRHRSAELRGILNGVDTDLWNPATDPVLATGYAANRLAAKRTNK
FT                   AALQTEMGLEVTADRPLFGVISRLTSQKGLDLLLTVAEGLPELPAQLVVLGSGDKLMEA
FT                   GFVELAKRFPAQIVVKIGFDEGLAHRIEAGADCFVMPSRFEPCGLNQMYSLRYGTPPIV
FT                   RATGGLADTVVDVCEDTLADKSANGFVLDGDTPHALWLTIEHVCRTWQDKKLWQRIQQN
FT                   GMRRDFSWTHAANEYVALYRDAIATRA"
FT   gene            complement(648738..650318)
FT                   /locus_tag="Daro_0581"
FT   CDS_pept        complement(648738..650318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0581"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45338"
FT                   /db_xref="GOA:Q47IJ3"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47IJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45338.1"
FT                   /translation="MNPIDSPAWRALAAHAEAIRPLHLRDLFATDPQRFELFSLHHDGL
FT                   LLDYSKQRVSVETMALLRAYAETADVTGWRRRMLDGESINHTEGRAVRHMSLRAGDQAP
FT                   AEVRAALARQQAFCESIHNGVWRGFSGERITDVVNIGIGGSDLGPRMAALALSARQQPD
FT                   IAVHFIANVDSADIAPLLASLNPRTTLFIVASKTFTTLETLTNARTARDWLLATAGQES
FT                   AIARHFVAISTNLELTKQFGIADDNVFEFWDWVGGRFSIWSAIGLSLALAIGWKNFEQL
FT                   QAGARAMDRHFIDTPADENLPLTLALLSLWNTNFLGASTEAMLPYSQSLHLFPAYLQQL
FT                   EMESNGKQIDRDGKPLNIATSPVIWGESGTNGQHSFYQLFHQGGHLIPADFVALREADF
FT                   PLPGHHASLLANCLAQSAALAFGQTAEEVRAAGIPEALIPYKVFPGNQPSNTLLLPSLD
FT                   PYTLGQLLALFEHKVFCLGVLWNLNAFDQWGVELGKQLAGQLTPLIEGNGDLSAFDSST
FT                   RGLITALKG"
FT   gene            complement(650315..652885)
FT                   /locus_tag="Daro_0582"
FT   CDS_pept        complement(650315..652885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0582"
FT                   /product="Alpha-glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45339"
FT                   /db_xref="GOA:Q47IJ2"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45339.1"
FT                   /translation="MTGTVYNLEVNPLLPERLERLEELANNLWYSWDRPTQGLFASLSH
FT                   SLWKATNHNPKAFLKRADQKRLEAIAEDPVFLGALNRVVSSYDTYHEMPNMAHVHGQPF
FT                   ADDDLIAYFCAEFGFHESLPIYSGGLGILAGDHCKAASDMGLPFIGVGLLYRQGYFQQT
FT                   LTADGHQQATYNDSDFDDLPVTPLLDADGREVLVAVDFPGRTIQAKVWEVTVGHVRLIL
FT                   LDTWLPINSARDREITHRLYGGDKTTRIEQEILLGVGGTRALAALGLKPTVWHVNEGHA
FT                   AFLILERIRGLIKGGLPYAAALEAVASNVVFTTHTPVPAGHDHFPEEMIRNYFSAWCHD
FT                   LDLSCEHLMNLGAEPGKTDFNMTALALRGSRHHNGVSRIHGDVSADICRYLWPQILPEE
FT                   NPMDYVTNGVHLPTFLAPEWFETFEHYLGIGWQERQTQPGNWHGIDDIPDATYWSIRQQ
FT                   LKSKLLKLVRERIREQHHRNQGSPSHLDRLLKYADPDNPNILTIGFARRFATYKRAALL
FT                   FQDPTWLREIITQANRPVLFLFAGKAHPADLPGQEIIRKIAEMAKLPEFEGRILLVEGY
FT                   DLHLSRSLVAGVDVWLNNPIYPLEASGTSGMKAAMNGALNLSVLDGWWGEGYDEGDGGI
FT                   ANGWAIKPVPGHLSDVQRDAEEARTLYELLQDQVIPTYYRTGPMGYSPEWVAMSKRSIS
FT                   TISPRFNVTRMVSEYVKKFYSPAAVHGRHFAQADFAVARNVADWKAKVRAAWSGVRLQR
FT                   IDTPERRLKFGGSVRIELAVQLNGLRPEDVTLEALFGRPGRDGGIGRVRHYPLTCDGQN
FT                   DHGEMRYQLELTPELCGKLEYRIRIFPTHASLTHPLETGLMIWL"
FT   gene            complement(652882..654855)
FT                   /locus_tag="Daro_0583"
FT   CDS_pept        complement(652882..654855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0583"
FT                   /product="alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45340"
FT                   /db_xref="GOA:Q47IJ1"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015178"
FT                   /db_xref="InterPro:IPR015179"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45340.1"
FT                   /translation="MTHAVTLLLGVHAHQPVGNFPEVIEDAHQRCYRPFLETLHAYPDF
FT                   RFAVHFSGWLLDWLRERHPADMALLADMVKRGQVELFSSGDTEPVLAAIPHRDRVGQLK
FT                   TLNDKLTGWTDVKPTGAWLTERVWESSVVPALAETGIRYVTVDDYHFFCTGKAADELDS
FT                   FFSTEEDGTRLDLFPISEALRYRLPFSPAHEVIAYLESLADRNQAAAIYFDDIEKFGIW
FT                   PETYDWVYNRGWLKALIEGVLASPKIRTGTYADFHANNVTRGIVYLPTTSYSEMNEWTL
FT                   PMPAAGIYSSFLATEKAAGRGDLHRPFLRGGIWRNFLTRYPEANWMHKRMQGLSARLGE
FT                   IANPPQALVDELYRAQANDAYWHGLFGGLYLPHLRRAVWNNIIALEAELDAQHLRPALA
FT                   SVDLDFDGKTETIAHTAALQVVIRNDGLATAHELSSYPLKHNFGDTLRRYHEHYHDKIA
FT                   HGPSEHSGEGIASAHDIVRFKHPISAEDIVPDALPRALWLDKLDGATLGDYVQAEGSLS
FT                   FARPHITKTYTLEDSTVAITWQLNGLAGHHFETALNLAMPSCDGFLGRYMLADGSIPSG
FT                   FGLPLHLPAATTLSLDDGVLGGRLMLQTSLAGEIHGQPHQTVSQSEAGFEKIMQAVELR
FT                   LGWTIPDNCQTLQLQLNIEPRP"
FT   gene            complement(654865..656520)
FT                   /locus_tag="Daro_0584"
FT   CDS_pept        complement(654865..656520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0584"
FT                   /product="Glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45341"
FT                   /db_xref="GOA:Q47IJ0"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q47IJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45341.1"
FT                   /translation="MADLAFLWHMHQPDYRHPDSGEFLLPWVFLHSIKDYTDMAAHLER
FT                   HPNVRCTVNFVPVLLDQIEDYADQFDSHQWRDPLLRIADSADPEQLSPADRDWLLDMAF
FT                   RCHAPTMLEPFAPYRRLRDLLDFVRAHDGNGLNYLSGHYFADLATWYLLAWCGESLRRS
FT                   GTVIPELMAKGSAFSFDERQALLAELGHAIQGIIPRYRALAERGQVELSCTPGTHPLAP
FT                   LMIDFNAAREALPDCPLPAAPEYPGGRSRVEAHLGEARESHHRRFQQTPAGLWPAEGAL
FT                   SMPFLKQIAESGFRWTASSQGVLRHSAGNDARTTVAWQAPEGIPGDITLFFRNEHLSDL
FT                   IGFEYAKWHGRDAAQHFMTELKALHLQDDRNLIPVFLDGENAWEYYPYNGWYFFSDLYD
FT                   ALSKNPGIRTVTLSEAAASQHERRARLPRLTAGSWVFGTLSTWIGNPDKNRAWEMLCDI
FT                   KQCADRALDGERLSDETRHEVLRRLAICESSDWFWWLGDYNSPQSVACFDMLFRENLKA
FT                   LYRLLNLPLAASLDHPISKGGGEPESGGTMRRAT"
FT   gene            complement(656520..657842)
FT                   /locus_tag="Daro_0585"
FT   CDS_pept        complement(656520..657842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0585"
FT                   /product="Glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45342"
FT                   /db_xref="GOA:Q47II9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47II9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45342.1"
FT                   /translation="MPMSTSCPHQPYCEMREQTDMRFISHLTRNTFAIILAGGRGTRLK
FT                   QLTDFRSKPAVPFAGKFRILDFTLSNCVNSGIRKIGVATQYKAHSLIRHIQRGWSFLDG
FT                   RFDEFIQLLPAQQQIDETQWYQGTADAVYQNLHFLRRYQPDHILVVAGDHIYKMDYGRM
FT                   LAHHVKHHADMTVACIDVPLDEAREFGVMGVDEQDRVIDFVEKPQNPPAIPGQPDRALA
FT                   SMGIYIFNTKFLFEQLERDAMTKGSNRDFGKDIIPYIVPRYRVFAHRFADSCVGSDNHR
FT                   PYWRDVGTIDAYWEANMEMTKVTPELNVYDRDWPIWTYQEQIPPAKFVFDDEDRRGTAV
FT                   DSLIAGGCIISGASVKRSLLFSSVNVHSWASVEDSVVLPDVDIGRHAVLKRCVIDKHCR
FT                   IPEGMVIGVDPEEDRKRFHVSPKGITLVTAEMLGQGAAEGR"
FT   gene            657897..659762
FT                   /locus_tag="Daro_0586"
FT   CDS_pept        657897..659762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0586"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45343"
FT                   /db_xref="GOA:Q47II8"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47II8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45343.1"
FT                   /translation="MQHADALYLFNEGRNNQAYRLLGAHADISGTTFRVWAPNASRVSV
FT                   VGDFNGWHGDVHQLHPLGESGVWEIAVAEAHTGNLYRFEITNRHTGDKLIKSDPYGRGF
FT                   ELRPGSAAYVVPPSMHVWGDADWLQQRAGWDWQQAPVNIYEVHPGSWMRHPDGKPYLWG
FT                   ELAERLIPYALAQGYTHLELLPITEHPLDESWGYQTTGYFAPTSRYGSADELRAFVDAC
FT                   HQAGLGVLLDWVPGHFPQDDWALARFDGTALYEHEDPRLGLHADWGTHIFNYGRHEVRS
FT                   FLMSSAHWWLSEFHFDGLRVDAVASMLYLDYSRKHGEWLPNKFGGRENLEAIDFLKQLN
FT                   AMVHGDFPGALTIAEESTAWPMVSRPTYVGGLGFSMKWNMGWMNDSLRYFHRDPIYRRW
FT                   HHSELTFGQIYAYSENYVLPFSHDEVVHGKGSLLGKMPGDTWQRYANLRLLLAWQVLTP
FT                   GKKLMFMGCEFGQQGEWSEGRELDWGSLANPENAAAQRLSADLNRLYRDLPALHTQDFS
FT                   ALGFEWIDCNDSEHSVLSWLRWGKDGSFVVVVFNFTPVPQPAYRLGVPEAGTYVELLNT
FT                   DSAFYGGSNLGNGGALTATKGEWMGRPANLEVTIPPLGAVVLRRE"
FT   gene            complement(659823..660164)
FT                   /locus_tag="Daro_0587"
FT   CDS_pept        complement(659823..660164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45344"
FT                   /db_xref="UniProtKB/TrEMBL:Q47II7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45344.1"
FT                   /translation="MSGFDHYAKDTEEIEAEIVRKGIVLGIDWSDQAAVRALAREAFDH
FT                   LAEDLKVASNSPVDYRLMAKVDLFGLAGIMLKTMTKSAGQGIESHGGPAWKAFAGALWA
FT                   EAQLRGLNE"
FT   gene            complement(660226..660603)
FT                   /locus_tag="Daro_0588"
FT   CDS_pept        complement(660226..660603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45345"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:Q47II6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ45345.1"
FT                   /translation="MKMKFALTGIAAAIILSGCVVAPAPMSRPYYREPVMVAPPPPRVE
FT                   YMGAPPVVGQVWINGFWNWAGNRHEWVPGRWEAPRPGQQWVPHRWEQDNGRWRLQGGGW
FT                   EEHRGHHDHDDHDRHDRRDWR"
FT   sig_peptide     complement(660538..660603)
FT                   /locus_tag="Daro_0588"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.648 at
FT                   residue 22"
FT   gene            complement(660723..661475)
FT                   /locus_tag="Daro_0589"
FT   CDS_pept        complement(660723..661475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daro_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daro_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ45346"
FT                   /db_xref="UniProtKB/TrEMBL:Q47II5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="