(data stored in ACNUC7421 zone)

EMBL: CP000091

ID   CP000091; SV 1; circular; genomic DNA; STD; PRO; 2726152 BP.
XX
AC   CP000091; AADY01000000-AADY01000014;
XX
PR   Project:PRJNA10646;
XX
DT   12-AUG-2005 (Rel. 84, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Ralstonia eutropha JMP134 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Cupriavidus pinatubonensis JMP134
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Cupriavidus.
XX
RN   [1]
RP   1-2726152
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Goltsman E., Martinez M., Schmutz J.,
RA   Larimer F., Land M., Lykidis A., Richardson P.;
RT   "Complete sequence of chromosome 2 of Ralstonia eutropha JMP134";
RL   Unpublished.
XX
RN   [2]
RP   1-2726152
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Goltsman E., Martinez M., Schmutz J.,
RA   Larimer F., Land M., Lykidis A., Richardson P.;
RT   ;
RL   Submitted (05-AUG-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; e37341fe4aa111751c45a945b2a176dc.
DR   BioSample; SAMN02598255.
DR   EnsemblGenomes-Gn; EBG00001022490.
DR   EnsemblGenomes-Gn; EBG00001022493.
DR   EnsemblGenomes-Gn; EBG00001022495.
DR   EnsemblGenomes-Gn; EBG00001022497.
DR   EnsemblGenomes-Gn; EBG00001022499.
DR   EnsemblGenomes-Gn; EBG00001022501.
DR   EnsemblGenomes-Gn; EBG00001022503.
DR   EnsemblGenomes-Gn; EBG00001022505.
DR   EnsemblGenomes-Gn; EBG00001022507.
DR   EnsemblGenomes-Gn; EBG00001022509.
DR   EnsemblGenomes-Gn; EBG00001022512.
DR   EnsemblGenomes-Gn; EBG00001022515.
DR   EnsemblGenomes-Gn; EBG00001022517.
DR   EnsemblGenomes-Gn; EBG00001022519.
DR   EnsemblGenomes-Gn; EBG00001022521.
DR   EnsemblGenomes-Gn; EBG00001022523.
DR   EnsemblGenomes-Gn; EBG00001022525.
DR   EnsemblGenomes-Gn; EBG00001022528.
DR   EnsemblGenomes-Gn; EBG00001022531.
DR   EnsemblGenomes-Gn; EBG00001022534.
DR   EnsemblGenomes-Gn; EBG00001022538.
DR   EnsemblGenomes-Gn; EBG00001022539.
DR   EnsemblGenomes-Gn; EBG00001022543.
DR   EnsemblGenomes-Gn; EBG00001022546.
DR   EnsemblGenomes-Gn; EBG00001022548.
DR   EnsemblGenomes-Gn; EBG00001022550.
DR   EnsemblGenomes-Gn; EBG00001022552.
DR   EnsemblGenomes-Gn; EBG00001022554.
DR   EnsemblGenomes-Gn; EBG00001022556.
DR   EnsemblGenomes-Gn; Reut_BR0067.
DR   EnsemblGenomes-Gn; Reut_BR0068.
DR   EnsemblGenomes-Gn; Reut_BR0069.
DR   EnsemblGenomes-Gn; Reut_BR0070.
DR   EnsemblGenomes-Gn; Reut_BR0071.
DR   EnsemblGenomes-Gn; Reut_BR0072.
DR   EnsemblGenomes-Gn; Reut_BR0073.
DR   EnsemblGenomes-Gn; Reut_BR0074.
DR   EnsemblGenomes-Gn; Reut_BR0075.
DR   EnsemblGenomes-Gn; Reut_BR0076.
DR   EnsemblGenomes-Gn; Reut_BR0077.
DR   EnsemblGenomes-Gn; Reut_BR0078.
DR   EnsemblGenomes-Gn; Reut_BR0079.
DR   EnsemblGenomes-Gn; Reut_BR0080.
DR   EnsemblGenomes-Gn; Reut_BR0081.
DR   EnsemblGenomes-Gn; Reut_BR0082.
DR   EnsemblGenomes-Gn; Reut_BR0083.
DR   EnsemblGenomes-Gn; Reut_BR0084.
DR   EnsemblGenomes-Gn; Reut_BR0085.
DR   EnsemblGenomes-Gn; Reut_BR0086.
DR   EnsemblGenomes-Tr; EBT00001625025.
DR   EnsemblGenomes-Tr; EBT00001625031.
DR   EnsemblGenomes-Tr; EBT00001625036.
DR   EnsemblGenomes-Tr; EBT00001625042.
DR   EnsemblGenomes-Tr; EBT00001625048.
DR   EnsemblGenomes-Tr; EBT00001625054.
DR   EnsemblGenomes-Tr; EBT00001625059.
DR   EnsemblGenomes-Tr; EBT00001625066.
DR   EnsemblGenomes-Tr; EBT00001625071.
DR   EnsemblGenomes-Tr; EBT00001625077.
DR   EnsemblGenomes-Tr; EBT00001625083.
DR   EnsemblGenomes-Tr; EBT00001625086.
DR   EnsemblGenomes-Tr; EBT00001625092.
DR   EnsemblGenomes-Tr; EBT00001625098.
DR   EnsemblGenomes-Tr; EBT00001625103.
DR   EnsemblGenomes-Tr; EBT00001625108.
DR   EnsemblGenomes-Tr; EBT00001625112.
DR   EnsemblGenomes-Tr; EBT00001625115.
DR   EnsemblGenomes-Tr; EBT00001625118.
DR   EnsemblGenomes-Tr; EBT00001625122.
DR   EnsemblGenomes-Tr; EBT00001625126.
DR   EnsemblGenomes-Tr; EBT00001625131.
DR   EnsemblGenomes-Tr; EBT00001625135.
DR   EnsemblGenomes-Tr; EBT00001625139.
DR   EnsemblGenomes-Tr; EBT00001625143.
DR   EnsemblGenomes-Tr; EBT00001625149.
DR   EnsemblGenomes-Tr; EBT00001625153.
DR   EnsemblGenomes-Tr; EBT00001625155.
DR   EnsemblGenomes-Tr; EBT00001625157.
DR   EnsemblGenomes-Tr; Reut_BR0067-1.
DR   EnsemblGenomes-Tr; Reut_BR0068-1.
DR   EnsemblGenomes-Tr; Reut_BR0069-1.
DR   EnsemblGenomes-Tr; Reut_BR0070-1.
DR   EnsemblGenomes-Tr; Reut_BR0071-1.
DR   EnsemblGenomes-Tr; Reut_BR0072-1.
DR   EnsemblGenomes-Tr; Reut_BR0073-1.
DR   EnsemblGenomes-Tr; Reut_BR0074-1.
DR   EnsemblGenomes-Tr; Reut_BR0075-1.
DR   EnsemblGenomes-Tr; Reut_BR0076-1.
DR   EnsemblGenomes-Tr; Reut_BR0077-1.
DR   EnsemblGenomes-Tr; Reut_BR0078-1.
DR   EnsemblGenomes-Tr; Reut_BR0079-1.
DR   EnsemblGenomes-Tr; Reut_BR0080-1.
DR   EnsemblGenomes-Tr; Reut_BR0081-1.
DR   EnsemblGenomes-Tr; Reut_BR0082-1.
DR   EnsemblGenomes-Tr; Reut_BR0083-1.
DR   EnsemblGenomes-Tr; Reut_BR0084-1.
DR   EnsemblGenomes-Tr; Reut_BR0085-1.
DR   EnsemblGenomes-Tr; Reut_BR0086-1.
DR   EuropePMC; PMC2289816; 18307761.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000091.
DR   SILVA-SSU; CP000091.
DR   StrainInfo; 2875; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Bernardo Gonzalez
CC   (bgonzale@genes.bio.puc.cl)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-PGF
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2726152
FT                   /organism="Cupriavidus pinatubonensis JMP134"
FT                   /chromosome="2"
FT                   /strain="JMP134"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:264198"
FT   gene            127..2562
FT                   /locus_tag="Reut_B3464"
FT   CDS_pept        127..2562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3464"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3464"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62822"
FT                   /db_xref="GOA:Q46VK6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62822.1"
FT                   /translation="MPAGVDDAAKVKAAFLAAVAQGKDSCKLISRAKATELLGTMLGGY
FT                   NIAPLISLLADAEVGTVAADALKKTLLMFDAFHDVKELADKGNANAKAVLQSWADAEWF
FT                   TSRPEVPQSLTITVFKVPGETNTDDLSPAPDATTRPDIPMHALAMLKNKREGAAFQPEE
FT                   DGKRGPIKFIQSLAEKGNLVAYVGDVVGTGSSRKSATNSVLWFTGEDIPFIPNKRFGGV
FT                   CLGSKIAPIFYNTMEDAGALPIELDVSKMEMGDVVELRPYEGKALKNGEVIAEFKVKSD
FT                   VLFDEVRAGGRIPLIVGRGLTAKAREALGLAPSTLFRLPQNPADTGKGFTLAQKMVGRA
FT                   CGLPEGKGIRPGTYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAY
FT                   PKPVDVKTHHTLPEFISTRGGISLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGIS
FT                   FPAGSGLVAFAAATGVMPLDMPESVLVRFKGKMQPGVTLRDLVNAIPLYAIKQGLLTVA
FT                   KQGKTNIFSGRILEIEGLPDLKVEQAFELSDASAERSAAGCSVHLNKEPIIEYINSNIT
FT                   LLKWMIAQGYQDPRSLQRRIEAMQAWLAKPELLAPDADAEYAAVIEIDLADVHEPIVAC
FT                   PNDPDDVKTLSEVAGAKIDEVFIGSCMTNIGHFRAASKLLEGKRDIPVKLWVAPPTKMD
FT                   QKQLTEEGHYGVFGTAGARTEMPGCSLCMGNQAQVREGATVMSTSTRNFPNRLGKNTNV
FT                   YLGSAELAAICSRLGKIPSKEEYMADIGVINQNGDKIYKYMNFDQIEDFKEVADGVNL"
FT   gene            3139..4020
FT                   /locus_tag="Reut_B3465"
FT   CDS_pept        3139..4020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62823"
FT                   /db_xref="GOA:Q46VK5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62823.1"
FT                   /translation="MTLAKALPMQVRLALRRTPLIAALIYCVILVWMYVRQDHFIYFPV
FT                   TADESLWREKAVEAKARIIPGLNAIVVEPPVVDASTKTALFFHGNDGNAFERLSLAKVF
FT                   NTRGYRLVLAEYPGFGPNRGKPSQATIVPSAMALMREISQRWPGRVTLVGESLGSGVAA
FT                   QVAAAMPERVDRLVLITPFSSLRETAARKMWFIPVRLLLKSPFDSSVALANYHGLSAVL
FT                   VAGQDELVGPQAGLALQKQLASRGSSTLLVLPTATHNTWISGMTDAHWDQLLMARTAIS
FT                   SAPLMPLQATGR"
FT   gene            complement(4017..4289)
FT                   /locus_tag="Reut_B3466"
FT   CDS_pept        complement(4017..4289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3466"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3466"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62824"
FT                   /db_xref="GOA:Q46VK4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62824.1"
FT                   /translation="MFRFEYGPSNVYVQLGFEDAEEIPLKAGIVKDITDRIRCAGLTLS
FT                   DAAAMLGTSQSDLLLALCGKLQSFRAAELLAWLDRLSFPLQLKNR"
FT   gene            complement(4523..6124)
FT                   /locus_tag="Reut_B3467"
FT   CDS_pept        complement(4523..6124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3467"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3467"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62825"
FT                   /db_xref="GOA:Q46VK3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62825.1"
FT                   /translation="MPTYDAVIVGSGINSLVCAAVLARSGKRVCVLERNSTLGGCIRTE
FT                   ALHAPGYLHDTLSTAHPLFVTSPGYAELKDDLHQAGLSYANNDTPTGVLLPGNRSLILA
FT                   TSRERNVSAFNALASGDGDAYLAAMQEVEQNAGLVFSLLGNELWSADVAKTVAGRLWKQ
FT                   GVHDTVAFFSPALMSCRSWLETRIRSDLVRALLAPWVLHTGLGPESAMSALMGKVVAFS
FT                   LEAVGLPIVQGGNARTVEAFRQIVESHGGAFHVNADVEDVLVENGSARGVRTRDDRVFM
FT                   GKEIICNVTPGQLYGKLLAPAHVPPALRQQAAEYRYGKGNMQIHLSLSAPPDWPHAHLR
FT                   NVIYLHLTSGLDGVSRAVSEAERGLLPAEGTICVAQPCAVDPSRSPAGGWVLWIQVPEC
FT                   PRTIKGDALGEIDAPADGRWTPEIRERYADRIIDRIARQVPNLKASIVGRTVLSPADLE
FT                   AMNINLVGGDPYSGECSIDQFMVWRPLRGARNHATPVKHLHHIGASTHPGPGLGGTSGY
FT                   HVANALARKRAKSNRT"
FT   gene            complement(6222..6746)
FT                   /locus_tag="Reut_B3468"
FT   CDS_pept        complement(6222..6746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3468"
FT                   /product="Flavin reductase-like, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3468"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62826"
FT                   /db_xref="GOA:Q46VK2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62826.1"
FT                   /translation="MTDARGFRNALGRFATGVAIVTTRTADGEPWGVTVNSFSSVSLEP
FT                   RLVLWSLAKKSYSLEAFRKSGSFVIHVLASDQEDVSNRFARGTDGKFAGISCTDGIGGA
FT                   PVLPGCAAVFQCRNAQQYDGGDHIIFIGEVHHFDTSDRESLLFYQGSYTRAANSLTDLA
FT                   ERIRSEQVAAA"
FT   gene            complement(6820..8109)
FT                   /locus_tag="Reut_B3469"
FT   CDS_pept        complement(6820..8109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3469"
FT                   /product="putative oxygenase subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3469"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62827"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041654"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62827.1"
FT                   /translation="MTTHSFAKITPRKIAIVGAGQAGLLLGCALLHQGYAVTLVTNRTA
FT                   EEVWSGKVMSSQCIFDQALQIERNFGMNQWESQCPSVNGIGLTIPTSDGKGEMAIHWRA
FT                   RLNACAQSVDQRVKMPGWMAEFERRGGDLRIENVEIPQLEALSESHDLVLLAGGKGEIV
FT                   NLLTRNDARSPVRQPQRQLALAYVTGMERSGPFECVNFNLIPGVGEYFVFPALTTKGSS
FT                   ETQACDIMVFEAIPGGPMDRWADVKSADQHLDVCLGILRDYLPWEIERCANVQLTDANG
FT                   ILSGRVTPTVRNPTLTLPSGRIVMGLGDAVMVNDPITGQGSNNATKGALHYFDAILRNT
FT                   DKPFDKAWMQSTFDGLYESYAEPVIRWTNSLLFPPPDHIVRLLATAQHAPRVAQRIANG
FT                   FNDPRDYGSYWFDEDATDAWIAQASQSRAA"
FT   gene            complement(8190..8978)
FT                   /locus_tag="Reut_B3470"
FT   CDS_pept        complement(8190..8978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3470"
FT                   /product="NAD-dependent epimerase/dehydratase:Short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3470"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62828"
FT                   /db_xref="GOA:Q46VL1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62828.1"
FT                   /translation="MQGMEGKTAIVTGGATMIGEAVVSALISAGANVVVVDIDQAGGNQ
FT                   IAQRHPSRCRFAAVDVTSDADIATCITRTVEAFHGIDLLINCACTYVDNGADSTREQWL
FT                   DSYNVNVVGAAMMLKACVPEMKKRGGGAVVNFASISAGVAQSGRWLYPISKAAMQQFTR
FT                   SAALDLAPDNIRVNSVSPGWTWSSVISALSGGDKAKADSVAADFHPLGRLGKPEEVAQV
FT                   VLFLLSDAAAFVTGTDYACDGGYGALGPEGRHAAIQRLMA"
FT   gene            complement(9260..10366)
FT                   /locus_tag="Reut_B3471"
FT   CDS_pept        complement(9260..10366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3471"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3471"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62829"
FT                   /db_xref="GOA:Q46VL0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62829.1"
FT                   /translation="MRRSSSQAPTIQTALEHSDAMPPRQSIEQDAFPDLLAHYPLFRSK
FT                   DVEETQGKVAAVFCPHVLRVVGATQHLRVQHNLVKLHDTAINFLSYGADVDIDPGRLGN
FT                   FYLAQIPVAGHADIQCGAQSLVSDVRTASLLSPDTPTRMHWHQDCAQVLLWIEKAAMEH
FT                   RFALLTGRDPVGSLAFDPSLPQHAGLASPWTQAVLDLARNIDQHGTHWLAFPAAVASME
FT                   DYLLRTLLLLQPHTYTYLLARSAEPARPRHMQRVIDYVHANAETPLTVADLAQIACVSV
FT                   RALEEGFRRHLNTTPVGYLRDVRLDGVRQALIAAAGAEHASITDIAYRFGFTHLGRFAA
FT                   YYKQRFGVSPSATLRGEATERPSGDTRR"
FT   gene            complement(10512..11171)
FT                   /locus_tag="Reut_B3472"
FT   CDS_pept        complement(10512..11171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3472"
FT                   /product="putative ABC-type bacteriocin/lantibiotic
FT                   exporter"
FT                   /note="contain an N-terminal double-glycine peptidase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3472"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62830"
FT                   /db_xref="GOA:Q46VK8"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62830.1"
FT                   /translation="MNQSDCDCEPCEPAEATLCKAPESGMAGTPVRNPAKYPSGADDPF
FT                   LGCLLIINRTWQCPVSPAALVKALSREGHRLTLEFLGSAAANAGWSTELVEMGLDDIAD
FT                   SVLPAILLLRKGKPCVLLERRGYGRFLVALPGWGGGVQEVEREALLAEYSRYAVLAEPV
FT                   TQAHAQAYTAPAPAPIRSTSVPMRRSSPWDRLVAMAHKVLWLQGRHRVEEAAGAGG"
FT   gene            11550..12395
FT                   /locus_tag="Reut_B3473"
FT   CDS_pept        11550..12395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3473"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3473"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62831"
FT                   /db_xref="GOA:Q46VK7"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62831.1"
FT                   /translation="MKIAVTSIQRDRNPWIVEWLAFHMLVGFNQFYIYSHKCRDGMSDT
FT                   LLKLTQRYPIQVYGLESDDKPQLAAYHHAWNTHGQDVDWMAFIDGDEFLFPTAQSSMAE
FT                   ALAPYAGKPLSALAVYWMCYGSSGHIEEPAGLIMENYTRHSARSFQDNRHIKSIVRGGQ
FT                   QIEIASSHLFRTPHGTYDEQMRLITDPIIRDNPDAQPSWDKFRINHYSVQSYSFFKQTK
FT                   QNMGAADFNAAYVRPDEWFHKYDRNECDDGVSYNFLVRLKLKVRELEAAIEEVSLQQAA
FT                   "
FT   gene            complement(12491..12682)
FT                   /locus_tag="Reut_B3474"
FT   CDS_pept        complement(12491..12682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3474"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62832"
FT                   /db_xref="InterPro:IPR025906"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62832.1"
FT                   /translation="MSTSIVSALNAADPGSDPVSLLMLRKTLDLQAQSVASLVQTAAAA
FT                   APVASNPPHLGQNVDVKV"
FT   gene            complement(12917..13342)
FT                   /locus_tag="Reut_B3475"
FT   CDS_pept        complement(12917..13342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3475"
FT                   /product="Molybdenum-pterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3475"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62833"
FT                   /db_xref="GOA:Q46VK1"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62833.1"
FT                   /translation="MITSARNHFSGEVALARHGAVNDEVILRLAGGQEIVATVTSESAT
FT                   RLALAPGKKAAAMVKATSVIVMVDVDASKVSARNAVSGKVTDIKKGAVNTDVTITDDKG
FT                   LAISAIITNSSSDRLGLALGKAAVAVFKASSVIVAVD"
FT   gene            13551..14321
FT                   /locus_tag="Reut_B3476"
FT   CDS_pept        13551..14321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3476"
FT                   /product="Helix-turn-helix, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3476"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62834"
FT                   /db_xref="GOA:Q46VK0"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62834.1"
FT                   /translation="MADVPHLSPKLHLTATHGFALHDSRQPGFRREWHIHDCGMLLWPR
FT                   MGRLRTLWEEMPGESDGRHAATLVRGTAVLLPASTSHLTASEPGRQQHGELYLPPDRLA
FT                   GCRPFGAVRLDAATIAMLEALLAPTISASSASWLVRAIVEQIMASRPLAMPEEPASLAL
FT                   RMVRRFTVALERDLRLPSVDAVAAELGVSVRHLQRACRIEFGVSPVAVRRRMLATHARA
FT                   LIAAGWSAASVSVHLGFASSGHLHRLLRELPDAP"
FT   gene            complement(14340..14825)
FT                   /locus_tag="Reut_B3477"
FT   CDS_pept        complement(14340..14825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3477"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3477"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62835"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62835.1"
FT                   /translation="MTIDTPEARLVAAGFDLPAAPAPRGNYAPFCAIPVGPCRWVSISG
FT                   QVCREDGVAMSGLCRTSDDLEPARRAAEVSILNALAALQLACDGELSRVTQIVRLHGFI
FT                   RASADFGSHPAVLDAASAVLRVAFPDQPLPARSALGVASLPDCAWTEIEIDAIVTAP"
FT   gene            complement(14822..15691)
FT                   /locus_tag="Reut_B3478"
FT   CDS_pept        complement(14822..15691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3478"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3478"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62836"
FT                   /db_xref="GOA:Q46VJ8"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62836.1"
FT                   /translation="MSDVNLIQVFVRRAGGGNPVPLVADARGMSAAQMQAVAAAYGHES
FT                   AFVLPGDDAGCDWRFRFFVPLHEMEMCGHATVGTLWALRQWGRWTTPTARIATISGVVL
FT                   AYWDAARECAWISQPEVRTEILDAHASTRVAETLGLPPGTRTIVNAATSRVKTLVALPS
FT                   VAELDGLQPDFPAMEALCGAIGSTGLYPYAFGTPQDDGRPVVHARQFPKSSGYPEDAAT
FT                   GIAAAALWGYLAGEGALACDGAPAGPIAIWQGDAMGSPSEILVAPRRSDDGEPDGCWLS
FT                   GKAAWSQE"
FT   gene            complement(15684..16676)
FT                   /locus_tag="Reut_B3479"
FT   CDS_pept        complement(15684..16676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3479"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3479"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62837"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62837.1"
FT                   /translation="MPIPSVPSIPSCKARCAVLAIAAGLCFGPAYAETWPTKPVTVVVP
FT                   FPAGGGTDLVVRSIQPMLQRELGQPVVIDNRSGAGGTIGSGYVARAAADGYTAGVVTTS
FT                   THAVSVALYPKLGYNPAQDFAYAGFIGTSPYVLAVNQAWQATDVKALLARLKADKSLHS
FT                   FGSVGVGTVSHLMGEQFQKLAGTPLVHVPYRGAAPAYTDLIGGQVQFMFDNPVGLAPYI
FT                   KARKIAAIATTAPTALLPDVPTFASQGVPGFEQQLWYGIVFPKGTPAPIVARFNAALNK
FT                   VLGDKAVANDLESKGVTARPGTPAALQAAVQKDIPYWGAIAKSVGATGE"
FT   gene            16819..17283
FT                   /locus_tag="Reut_B3480"
FT   CDS_pept        16819..17283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3480"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3480"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62838"
FT                   /db_xref="GOA:Q46VJ6"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62838.1"
FT                   /translation="MRACPSGPSGPSGPHSDVRLMHHAVPRRLAALTCLAVAFAASAAS
FT                   AASSASAADIQAGKALFATRCASCHSVGPSARGAFGPQLNAVFGRRAGSTSDYRYSPAM
FT                   TASGVVWTADTLRAFIKSPGKVVPGTRMRFWGIGNDQQIDDLLAYLQTYR"
FT   gene            complement(17320..18258)
FT                   /locus_tag="Reut_B3481"
FT   CDS_pept        complement(17320..18258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3481"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62839"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62839.1"
FT                   /translation="MSGFPAYRLARPFCAAVLLLAAVHFSTAAHAEDNPPPADPTPASP
FT                   YTFTGHVEAVSRYVLRGATSTYGNGTPLGNAGGDAPESSRPALQWGADLAHESGWSVGY
FT                   WASMINYSYRQLGNSYSDRSVTDFQKDRSIENDFYGAYSGKLPGGIGYTAGMTAYYYIN
FT                   GSHANALETKIGLSYGPVSFNAQTLLNDVVWGNKGDTYWTLVFTQPLPYGMTFTATAGA
FT                   YTYRKEGKYLGTTDTLSGTSCGPGAAFVVNGCYAGNAPVGGAFRHLTLALAAPIPETPF
FT                   NVGIQWILGGKNRFGVSQKNQFLATVGYGFP"
FT   gene            complement(18591..21032)
FT                   /locus_tag="Reut_B3482"
FT   CDS_pept        complement(18591..21032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3482"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3482"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62840"
FT                   /db_xref="GOA:Q46VJ4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR022249"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62840.1"
FT                   /translation="MRRLSWLALSLVLTALFHLMPAALAAEPASAPEADQPPALTHAEA
FT                   ITELKRLQTEQDRIKQSASSVNGTTRLGDLDEGLHQLAKDVDKLTAALTPQRAQLQAQL
FT                   DVLGPPPAAGATPPEMPAVARQRAELNARKVQLDNALKQAAEGKENIENLNAQLAKLQR
FT                   SRMKDQLALRSESILNPQFWAPLFKPSDDDSARLEAFVDEVVPLLKAAWEPEQRGATAL
FT                   LLVLALAVWTLGRRLAERAAAWFCLTRLPETRLRRSALALATALTTVVTTALAVQLVYY
FT                   AFTRGYEPPTDLQDLLGALARLMLTSALIAGLGRALLCTHHPSWRLPAMADPVARALKP
FT                   FPRALAGLLLLAGTLELLNHIADTSVPFTLLGRGLVSLVVVFTIGAALLRANRVRSGLA
FT                   AAGERAEARATLAGMIHAGVTLAVIVALIALLAGYVSFARFVTYELVWFDIVLCTLYLL
FT                   TQLTRDIFESLLSTQHASGRVIRQLFGVDDNRLEQASTLLSGLGTSVLTIVAIIALLTG
FT                   GFGTTPAELLDSLLTVLGGDKLRSYNIMPERIINAVIALSVGIWLLRSVRRWLDAELLP
FT                   RMCMEPGLRASLVTLFSNVGYVLIVLLTLAQLGVKWENLAWIVSALSVGIGFGLQEIVK
FT                   NFVSGLILLTERPVKVGDMVSISGVEGDIRRINVRATEIQLGDRSTMIVPNSQLISQNV
FT                   RNVTMSQSTQGVASLQLTFPLNTDPEQVRDLLLDTYLDNETILDHPVPSVTFSQLAPNG
FT                   ITLSVTGFVANPRIAASTKSDLLFEILKRLRAAGISLTMPQTLRVENLPGMSAEALLPA
FT                   P"
FT   gene            21509..21865
FT                   /locus_tag="Reut_B3483"
FT   CDS_pept        21509..21865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3483"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62841"
FT                   /db_xref="GOA:Q46VJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62841.1"
FT                   /translation="MRPSIRIASAAAVSLALLAAGPASAHDRYHHGGGSQAGVALAVGA
FT                   LVGLAFGAAMATPVVAAPVAVAPAPVAYAPPARVSYAAPAVPPGYCYRGDIGGYVPCGP
FT                   QPGGYYQPPVDYGY"
FT   gene            complement(21862..22845)
FT                   /locus_tag="Reut_B3484"
FT   CDS_pept        complement(21862..22845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3484"
FT                   /product="Twin-arginine translocation pathway signal:ABC
FT                   transporter, substrate-binding protein, aliphatic
FT                   sulfonates"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3484"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62842"
FT                   /db_xref="GOA:Q46VJ2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62842.1"
FT                   /translation="MTASRRQFLRYGTVATAAIATDTLLLAALPGAGAVRAQGRPLLKA
FT                   GDQKGGLRALLESANALRGLSYDIQWTEFPAAAPLAEALNAGAVDCGPIGDAPAIFALA
FT                   AGTRIRLIGANRSDPYGTAILVRPDSPLKNAADLKGKSIGTNRGSIGHFVALKALESAG
FT                   LRPEDANIRFLPPADAKLALTSRSVDAWATWEPYTAMAETSGHARVLVSGRGLWSGLSY
FT                   VAATDTALAAKRVVLADFLQRVVRAQAWSYQHVPEFSGTLARIIGISPEAARLQFERRH
FT                   TQWQKIDDALIAEQQRTADFYLKTALLKQRLDARATFDTGFAVTSA"
FT   gene            complement(22962..23450)
FT                   /locus_tag="Reut_B3485"
FT   CDS_pept        complement(22962..23450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3485"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62843"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62843.1"
FT                   /translation="MSRRKDYSVGAPAESQDGQRRRIDEWMTLVGQHKTTLGFDDWLQQ
FT                   VLDEQHQRAATEAGHGVCQPTSRLLRQGDMLFRLEHGARYRVRHGQESPRVFTCVFDGE
FT                   TPYIAFENVVTGVRFPWITVDGVFRQTELRSMERLDAGDAEKNVEIGGTGPMGQTSPA"
FT   gene            complement(23745..24488)
FT                   /locus_tag="Reut_B3486"
FT   CDS_pept        complement(23745..24488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3486"
FT                   /product="NAD-dependent epimerase/dehydratase:Short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3486"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62844"
FT                   /db_xref="GOA:Q46VJ0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62844.1"
FT                   /translation="MSTTLSGKIAFVTGGARGIGASVVRRLAREGAAVAFTYQSSGAGA
FT                   HALAEEIHAAGGRALAFQADAADAASVTRAVDDAARQFGKIDILVNSAGVLLLGPVDDF
FT                   SLEDFDKTLAVNVRGVFVAAKAALPHMGDGGRIINIGSVNADRIPFAGGSAYAMSKAAL
FT                   KGLVQGMARDLGPRGITVNNVQPGPTNTDMNPEHSDFATSLHGLMALQRHARPEEIAGM
FT                   VAYLAGPEAGFVTGASLNIDGGFAA"
FT   gene            24604..25527
FT                   /locus_tag="Reut_B3487"
FT   CDS_pept        24604..25527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3487"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3487"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62845"
FT                   /db_xref="GOA:Q46VI9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62845.1"
FT                   /translation="MEALNLLESFVHSAETGSFSAAARRLGLTPAAVSKNVARLERHLG
FT                   LRLFHRSTRRLTLTSGGEQFFSQVSNPFSALRDAFAGAAEDAGKPAGVLKVGMALAFGR
FT                   EYLVPLLGEFLALYPGIVPDWHFENRPTDLIRDGFDAAIGGGIELTEGVVARELARTHV
FT                   VAVASPAFMQGKALPRHPSDLLAFDGIVRRSGATGRLRAWTLRNQVGEQAPAEHRARLI
FT                   FDDPEAMAHAAMHGLGIALLPMPHAAPRLESGALMRLLPGWYADNGPIALYYPSRTLLP
FT                   PRTRVFIEFVVDAFRSKGLARRFDGR"
FT   gene            25669..26106
FT                   /locus_tag="Reut_B3488"
FT   CDS_pept        25669..26106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3488"
FT                   /product="DGPFAETKE"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3488"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62846"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62846.1"
FT                   /translation="MRVMVIVKATRQSEAGEMPGTELLAAMGKFNEELVKAGVMLAGEG
FT                   LHPSSRGKRVRFSGSNRTVVDGPFAATNELIAGFWLWQVKSMDEAVEWVRRCPNPMDGD
FT                   SEIEIRQVFEADDFGEAFTPELREQEERLRADIDRKSGNPG"
FT   gene            26223..26951
FT                   /locus_tag="Reut_B3489"
FT   CDS_pept        26223..26951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3489"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62847"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62847.1"
FT                   /translation="MEHTGPVTTVDEIADGIFRISTPVPPQDMPGGFSFNQYLVVDDRP
FT                   LLYHTGPRKLFTQVRAAIERVMPVSRLAYVGFSHVESDECGTLNDFLELAPDAVPLCGQ
FT                   IAAMVSIDDIAIRPARAMADGEVISLGTHRIRWLATPHVPHGWECSMAFEETTRTLLCG
FT                   DLFTQPGDANPPLTEGDILESSEAFRLQMDYYAHSPDTGMHLQRLADLHPATLACMHGS
FT                   AWRGDGAALLGRLSQRLAQR"
FT   gene            27010..27501
FT                   /locus_tag="Reut_B3490"
FT   CDS_pept        27010..27501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3490"
FT                   /product="NAD(P)H dehydrogenase (quinone):NADPH-dependent
FT                   FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3490"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62848"
FT                   /db_xref="GOA:Q46VI6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62848.1"
FT                   /translation="MKTLLIVYHTMTGGTAQMALAAADAASEQPDVTVRLLRAVDAGPD
FT                   DVLAADGYLFATPENLAAMSGLMKDFFDRCYYAALDRVNGRPYAAMICAGSDGQNALRQ
FT                   IDRIATGWRLKSVAPGLIVCTHAQTPERILAPKNIGADDLERCAEVGAGLAAGLALGVF
FT                   "
FT   gene            27553..28206
FT                   /locus_tag="Reut_B3491"
FT   CDS_pept        27553..28206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3491"
FT                   /product="Glutathione S-transferase, N-terminal:Glutathione
FT                   S-transferase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3491"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62849"
FT                   /db_xref="GOA:Q46VI5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62849.1"
FT                   /translation="MLLYAHPFSSYCQKVLIALYENGTPFEFRMLSPEHPDTLAEHAAL
FT                   WPMQRMPVLVDAGRTVVESTIIIEYLDIHHRGPVQWIPPDPDDALEVRMMDRFFDNYVM
FT                   TPMQRIVFDYIRAPGQRDAAGVADARRLLDRSYQWLDRAMAGREWAAAGAFGLADCAAA
FT                   PALFYADWVHPIAPALTNARAYRSRLLARPAFARAVDEARPYRKLFPPGAPDRD"
FT   gene            complement(28231..29184)
FT                   /locus_tag="Reut_B3492"
FT   CDS_pept        complement(28231..29184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3492"
FT                   /product="prolyl aminopeptidase, Serine peptidase, MEROPS
FT                   family S33"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3492"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62850"
FT                   /db_xref="GOA:Q46VI4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62850.1"
FT                   /translation="MPTLRTLYPAIEPYATGTLDVGDGHVIHYERVGTPGAKPAVFLHG
FT                   GPGGGISADHRRLFDPAHYDVLLFDQRGCGRSRPHAGLEANTTWHLVDDIERLRELAGV
FT                   ERWLVFGGSWGSTLALAYAQKHPQRASELVLRGVYTVSQAELDWYYQFGVSEMFPEKWA
FT                   RFQAPVPEAERGNMMAAYRKLLTGDDEAKQLQAARAWSVWEGETITLLPDADNSAKHDD
FT                   AHFALAFARLENHYFTHRAWLEDGQLLRDAHRLAGIPGVIVHGRYDMPCPARYAFALHN
FT                   AWPDADFHLIEGAGHAWTEPGILDQLIRATDRFAQQ"
FT   gene            29407..29482
FT                   /locus_tag="Reut_BR0067"
FT   tRNA            29407..29482
FT                   /locus_tag="Reut_BR0067"
FT                   /product="tRNA-Asn"
FT   gene            29489..29564
FT                   /locus_tag="Reut_BR0068"
FT   tRNA            29489..29564
FT                   /locus_tag="Reut_BR0068"
FT                   /product="tRNA-Gly"
FT   gene            29584..29658
FT                   /locus_tag="Reut_BR0069"
FT   tRNA            29584..29658
FT                   /locus_tag="Reut_BR0069"
FT                   /product="tRNA-Thr"
FT   gene            29819..30553
FT                   /locus_tag="Reut_B3493"
FT   CDS_pept        29819..30553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3493"
FT                   /product="Glutathione S-transferase, N-terminal:Glutathione
FT                   S-transferase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3493"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62851"
FT                   /db_xref="GOA:Q46VI3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62851.1"
FT                   /translation="MPCRQLPGVFVSDLSAYPIASKWPAQHPDRIQLYSLPTPNGVKVS
FT                   TMLEETGLPYEPHLVRFDHNDQLSPEFLSLNPNNKIPAIIDPNGPGAKPLPLWESGAIL
FT                   LYLADKSGQLIPADPAERYETIQWLMFQMGGIGPMFGQVGFFNRFAGKEYEDKRPRDRY
FT                   AAESRRLLNVLNQRLADRSWIMGEQYTIADIATFPWVRNLVGFYEAGELVGIGDFPHVT
FT                   RALEAFVARPAVIKGLDTPHRG"
FT   gene            30692..32032
FT                   /locus_tag="Reut_B3494"
FT   CDS_pept        30692..32032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3494"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3494"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62852"
FT                   /db_xref="GOA:Q46VI2"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62852.1"
FT                   /translation="MPHPRLSVSRSPANAIAAVAIAMALAGCGESAKLPSEAGFGPTPQ
FT                   LPPPDKTLIPTIHIAPAKGWADGARPTAAEGLSVAAFADKLDHPRWVYVLPNGDVLVAE
FT                   TNAPPKPDDHKGVRGWVMKKVQERAGAGTPSANRITLLRDTNGDGVADERSVFLKDLHS
FT                   PFGMVLVGNDFYVADTDAVLRFPYQPGQTSITASPQKVVDLPAGTINHHWTKNIIASPD
FT                   GSKLYVTVGSNSNAGENGIDKEAGRAAIWEVDRKTGQHRIFASGLRNPNGMAWEPSSGA
FT                   LWTSVNERDEIGSDLVPDYITSVRDGGFYGWPYSYYGQHVDTRVKPPAPDMVAKAIVPD
FT                   YAVGAHTASLGMTGAVGNSLPARFQHGMFVSQHGSWNRKPFAGYKVIFVPFDNGRPNGA
FT                   PFDVLTGFVGQNGDAQGRPVGVAVDKRGGLLVADDVGNTVWRVTGAR"
FT   gene            32211..33038
FT                   /locus_tag="Reut_B3495"
FT   CDS_pept        32211..33038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3495"
FT                   /product="UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3495"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62853"
FT                   /db_xref="GOA:Q46VI1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62853.1"
FT                   /translation="MDHTGESFRDFELAGWEDPGVVSRYHEQLTVVTTQSVDALLDSAH
FT                   VGSGQRVLDVASGAGYVAAAAARRGADTVGIDFSATQVELARKTHPGLHFEQADAQDLP
FT                   FDADSFDAVVNGFGMCHLTDPDQALREAFRVLRPGGRIGFTVWDAPERAIGFGAVYAAI
FT                   RAYGSMDVGLPAGPNFFQFSDPPQCISALQNAGFTGAACRQVPQLWRFSAPDQLFDALA
FT                   QGTVRAAATIRAQSPKARDEIRAVLRGTVASYMKGNDFVVPMPAVLAWAQKPA"
FT   gene            33287..34636
FT                   /locus_tag="Reut_B3496"
FT   CDS_pept        33287..34636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3496"
FT                   /product="Protein of unknown function DUF1214:Protein of
FT                   unknown function DUF1254"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3496"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62854"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62854.1"
FT                   /translation="MRPHAALLTVTVAALLCACAHKQERHKQEPVPSASTTADQDVADA
FT                   YVYLLGRLLVLRQEQVDFQKERFRWNEMRHRDVGGVSWANPNLDVVYSEAWIGVDERTC
FT                   MVFSVPLIKGRYYTVQFLNGWGETVANINQRNYPQRAAARYGLCLKGASVELQPDVRRI
FT                   DLPGKTARVLARVEIGKNRKQAVQLQRQIQIRMTGTPRIDPVPATPAFANTRLPGVEAF
FT                   DSAALALDSEPDINPGMEPLQARVRQIAADVAADPAQRERIDRVIRDKAIPQFMQSLTT
FT                   EIGTARNGWARPTVVGQYGSDYKARTRTNFAGIWANTAQEVVYFQGVTDGEGGRLNGAN
FT                   TYTMTFPKADLPAAHVRYFWSVIAVDAVNFRVMENPKKRYLLNKESRLQYGSDGSLTLY
FT                   FAPAKPSGAPDGNWLPTPGRQDYHLTFRTYGPDAAVSGGNWYPPPMVRPR"
FT   gene            34868..35230
FT                   /locus_tag="Reut_B3497"
FT   CDS_pept        34868..35230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3497"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62855"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62855.1"
FT                   /translation="MTTHTESQEPQPRARTVLRRARRAMILLRVLGMCANSVALAQGTL
FT                   PGPSAVTPEQKFPSGYLEAVATGYDNGQAMHPAEGMAPLRPRAAATRVELPPVSSPMGQ
FT                   VRAVTTAAPAPAVPAR"
FT   gene            35323..36189
FT                   /locus_tag="Reut_B3498"
FT   CDS_pept        35323..36189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3498"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3498"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62856"
FT                   /db_xref="GOA:Q46VH8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62856.1"
FT                   /translation="MDIELARTFLQVVRTGSLLAAADKLHVTQTAVTARIKSLESQLNC
FT                   RLFDRNKAGARLTADGQRFLGYASQLVQTWEAACRDLPLPAGLGSMLTFGAEISLGNPL
FT                   VLLWATRLRQQMPDHAVRAEVGDGAELQRKLQSGTLDAALVYQPEYAAGLHVEHLMEEK
FT                   LIQIRSTQRAGSYVYVDWGPEFRRQHDSALPGYARSSLYFNLGPLALQYILQYGGSGYF
FT                   RTRVVQSYLDSGVLERVEDASEFSYPVFLVHAGSPGRQALDDAVRILHDIVREESDWSQ
FT                   RWDFPLS"
FT   gene            complement(36205..36444)
FT                   /locus_tag="Reut_B3499"
FT   CDS_pept        complement(36205..36444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3499"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62857"
FT                   /db_xref="GOA:Q46VH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62857.1"
FT                   /translation="MEVTLWIAGALGLMALGATVTYLIGVAVPEPVFERAQQHGRYAGL
FT                   GGATQKRRGGGKRIRRLRILPAAHPVPRLVPVRA"
FT   gene            36808..37965
FT                   /locus_tag="Reut_B3500"
FT   CDS_pept        36808..37965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3500"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region:Acyl-CoA dehydrogenase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3500"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62858"
FT                   /db_xref="GOA:Q46VH6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62858.1"
FT                   /translation="MQRLIFDAEHESFRESARRFYQREVGPHGERWREQGCVDRDVFRK
FT                   AGEQGYLLMWADEKYGGAGVDDFRYEQILIEENARHGDTGFFGTLHSRLVAPYVGRIGN
FT                   EEQRQRLLPAAARGEKIFAIAMTEPQTGSDLAGIRTRAEDKGDHWLLNGAKTYISNGQL
FT                   ADYVVVVARTDPERSHGLGLFIVERDMPGFQRGRKLRKMGLHSQDTSELFFDNVRVPKS
FT                   NVLGEPGQGFRYLTRHLAEERLIGACGYMASAQVAFDITLDYVKERKAFGRAIGTFQDS
FT                   RFRLAELRAQLDALQTFVDQCVLQHNAGTLTVETAASAKLLTSELQGRVVDEGVQFHGG
FT                   AGYMEEYRICRMYTDARISRIYAGSSEIMKEIIGRSLGLDDRARA"
FT   gene            38172..39641
FT                   /locus_tag="Reut_B3501"
FT   CDS_pept        38172..39641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3501"
FT                   /product="Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3501"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62859"
FT                   /db_xref="GOA:Q46VH5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62859.1"
FT                   /translation="MTKYRQFGAPIGGHGRLPLTVVEPEPDRTVPFPVSSATAAAILAV
FT                   VAGLTAPLAHGASQPLPPDGPCLPPPPKATLTLAQARQDALRCNRDIIAARRGEEASQA
FT                   DIQIASQRPNPVLSVGVQNINPHAGVGSGNLRSKTVDSTFRIDQLIETANKGNLRKDAA
FT                   QKASVAAGEAVQAVVAQQTGAVEQAFYDAVVSQERVQVLSETVALYTRTQQANETRLKA
FT                   GDVSRADVTKLQLDNLRAQNDMRQAMADHMRDKAQLAQAMGVPGTLADNRLVADWPSLD
FT                   EPTPPVDLEIAQRRPDVTAAEARLAAAASARDLARAGRVPDVTVGAQYEHYPISETNTN
FT                   GSGNSYGVFVSIPLFVRHSNGGEARRAEVDYYAALDDRNRVLLEAQNEVERLRNQLEAA
FT                   RLSLRQMRESVVPAAESVAGSAEFAYTKGATGVLDLLDARRALRQTRLDATNAQGDYAK
FT                   ALSAYRTALQSTTTPVSSIPNSQVRTDAPRP"
FT   gene            39625..40833
FT                   /locus_tag="Reut_B3502"
FT   CDS_pept        39625..40833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3502"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3502"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62860"
FT                   /db_xref="GOA:Q46VH4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62860.1"
FT                   /translation="MRRVPNLLSEVFRVSPAGLPARVAALSLCALALAACGKEEAPKAD
FT                   DEPKVTGETVQFPASVKTLPGIAGEAARTGGQRMLNLPGRLGWNEDKTVRVSTPFAGRV
FT                   TEILVQPGATVKAGQPLANLTSSDFGVAQADARKAAADNSVAAKALARQRELYAAGVIA
FT                   QKDLEQSQADAARTAADLARTQAALRQYGGAAGDGANRFSLRSPIDGLVVERNINPGME
FT                   LRPDQPPTAPLFLVTDPTTLWAQVDAGEADLGLFKPGVTVQLISAAYPGETFPGTVVKI
FT                   ADYVDPTSRSIKVRLAVPNADRRLKAEMFVTARLQAASFQGIAVPSKAVFLADNRNYVF
FT                   VRTAPNTFVRRPVKLGVSLPGVSEVVDGIKDGETVVTDGNLYLQDILRDATAVNNARAA
FT                   AKQ"
FT   gene            40847..43966
FT                   /locus_tag="Reut_B3503"
FT   CDS_pept        40847..43966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3503"
FT                   /product="Heavy metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3503"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62861"
FT                   /db_xref="GOA:Q46VH3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62861.1"
FT                   /translation="MISRIVNFALHQKLFVWLGLLIFVGGGLAAFKNLPIEAFPDVSDI
FT                   QVNIITLYPGRAAEEVERQVTIPIETAMAGTPNSVRVFSHTQFGLSFMMVTFNDKATDV
FT                   TARQQILERLRGVDLPDGVHPDLAPLSTAIGEIYRFRLTGKGYTAQELRTLQDWVVEKN
FT                   LRQVPGVADLVTIGGTTKQYEVNPNLARMRDAKISLSQLFTALQRANSNAGGGAVAHGR
FT                   QQFLLRSLGSFRTSADIANVVVAENNGTPILVKDIADVKIGAAPPQGLMGQDDEDDIVS
FT                   GIVVMRKGENPSLVLEALKKKIELLDDQILPKGVKIVPYYDRSTLIDKTLHTVFGNLVE
FT                   GALLVMAVLYLFLANVRAAAIVALVIPLALLSTFIGLTWVGIPANLLSLGAMDFGIIVD
FT                   GAVIVVENIFKRLGELKEQQIQDSKARLYAILQATTEVGRPTVFSMVIIIAAHIPIFTL
FT                   QRHEGKIFAPMAYTVTGALVGSLIISLTLVPLLCHLLLKKNIAHDDNFVVRHCKRVYEP
FT                   MLAWALDHKKMVVGVALGLLVATVGVGKFLGSEFLPELDEGSMWVSFDLPASVSIDEAR
FT                   DQARKLRGVIRKTPEVNTTISKVGRPDDGTDPKLINTVEILVDLKNDKQWRAGYDKRKI
FT                   IEEINHNLRQLPGIEPNFSQPVRDNILESISQIKGQIVIKVQSDSLQHNKQVADQILAN
FT                   VQSVKGVMRAFIDRDGELPQYVLEFDRAQAARYGINVADVQDLMETALAGKAATELWEG
FT                   EKHFSVAVRLKPSERELPNLPNIFMQTADGAQVPLSQLVTFRAASGAMNISRENGQRTT
FT                   SIGIFIHDRDMGSVVKDMQALVKKNVNAEDVKISWSGEFENQERAMARLSIVVPLSVLV
FT                   IFLLLFNAFKSFKSATLIISNIPFALIGGVFALFLTGIPLSVSAAIGFIALFGQAVLNG
FT                   VVMVTYFNQLRDEGMPVRQAVLTGSMDRLRTVLMTALLAMLGLFPMAISRAIGAETQRP
FT                   LAIVIIGGLITATMLTLIVLPTLYEWMVGRNWPDEEVDEPNNRLSDSLSS"
FT   gene            44193..44771
FT                   /locus_tag="Reut_B3504"
FT   CDS_pept        44193..44771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3504"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62862"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62862.1"
FT                   /translation="MMKKWLSAAVCSMMFAAPAGFAVAQTHTGSKADYDTAVKQANDNY
FT                   KAAMGKCDGMKGNAKDVCKAEAKRDRDVAKADAEATRDGTEKAHAKALKTKADRDYDVA
FT                   KEMCDDKSGNDKDVCKKDAKTAHEKALGEAKVEKAAATGTRTDVAEARRDARKDTTDAA
FT                   YKADKERCDAMTGDSKDKCQADVKAKYAR"
FT   gene            44786..45052
FT                   /locus_tag="Reut_B3505"
FT   CDS_pept        44786..45052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3505"
FT                   /product="CsbD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3505"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62863"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62863.1"
FT                   /translation="MPASATIAEHRRPIDDLKEHHMNWEQIEGKWDQAKGKIKEKWGKL
FT                   TDDDIAQINGKRDQLAGRIRERYGYTKERAEDEMKAWENDSRW"
FT   gene            45178..46668
FT                   /locus_tag="Reut_B3506"
FT   CDS_pept        45178..46668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3506"
FT                   /product="ATP-binding region, ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3506"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62864"
FT                   /db_xref="GOA:Q46VH0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62864.1"
FT                   /translation="MMHAAACRDLICHVASETPLIAPRMYAALPAFVSSTFLGYGLYVL
FT                   VTKGVTRVSASFFLLCVTTFAWQGTWVFLFQAEHPDVATLLARLGYLFILFLPTTYYHF
FT                   IAEVTERRQERPILLASYGMSLLLAVMLLTSNKVVAGYYTYFFGDYPKAGPLHPLHLVQ
FT                   TVLVAMRSAWILFEARRNATAERRKRYNLCLVAVVLYSIAAVDYAVNYGYAFYPPGVVF
FT                   VALSLGILALSVVRYDLMHPYSLAATVAHEVRTPLASIRMQAQEMARTWPEVLQGYRLA
FT                   VEHGLCEDRMRPGQLERVSSLVGAITREVDGTSTVIDMALASVTLERLDRSTFAPHGIG
FT                   ECVHEALERYPFQGDDRVRVQVRGIDDAWRFVGSDTLLVYVLFNLLKNALHAIRARGDG
FT                   SIEIAGAAEGPYHVVRFRDTGCGIPANVLPRIFDPFFSTKAHGSGAGLGLAFCRRAIES
FT                   FGGRIECESMPGSHTTFTLKLPRFTPMADSQLRASAAG"
FT   gene            complement(46749..47246)
FT                   /locus_tag="Reut_B3507"
FT   CDS_pept        complement(46749..47246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3507"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62865"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62865.1"
FT                   /translation="MLMRDVIPQVLNRGTAMLTQDLLETPPQKTFHHAIDIYLKDSNAF
FT                   MNTYFARYFEWQGICRERWFHECIHDNLLAAGGVFVTKRAHQEYVEETFPFQRVDCYLN
FT                   TFQVKQCSAYLLFRFCVGGKPVSLGYQQIVFADRDKRISRFPHGIIERVKEYELVLPGL
FT                   AS"
FT   gene            complement(47478..49091)
FT                   /locus_tag="Reut_B3508"
FT   CDS_pept        complement(47478..49091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3508"
FT                   /product="putative 4-amino-4-deoxy-L-arabinose transferase
FT                   and related glycosyltransferases of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3508"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62866"
FT                   /db_xref="GOA:Q46VG8"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62866.1"
FT                   /translation="MEDFSALSGRGNAAQVGTALPTTVQKWPLLANKLAQQQSAASIFV
FT                   IALLAHMILWTLLPSLLLKNASLDIIEALAWGHEWQLGYEKDPPLWPWVTEALTVWPGK
FT                   NLWACYLAAQVCIGTVFVSVWQLGCRIASRREALLGALLLEGIYYFNFPTPEFNDIVLQ
FT                   MPFAALFGWLLHRALTDNRLRDWCLAGFVAGLGLWARYSMGAYLIPMAIFVLLHPVARR
FT                   RLAEAGPWVLVATALLTFLPHMAWIVDSGFISIEYVARRAPEATNGLHYVARLSSFIGA
FT                   QLAALIPMLLLALMLWRWKNPNPQSPSDSREFDRAYLAALAFGPIVFSVILSAMTQRPP
FT                   RVMWAAPLLCYVGLFIATSIRPVLTAQRLRTFGRAWIAVLLLPALLFTLEQVARPYVMG
FT                   KENRSHFPGRSLAAEVTDRWHAETGTPMKYVIGDTWYAGNAAFYSDDRPSALFVHGGYR
FT                   FNPWVTPEKLKKEGAVLVWDAASEGADIPPIIAGQFPGAALQPDVSVRGPASVHQVGIA
FT                   FLLPSKTATPDHGERLATSR"
FT   gene            49418..50248
FT                   /locus_tag="Reut_B3509"
FT   CDS_pept        49418..50248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3509"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3509"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62867"
FT                   /db_xref="GOA:Q46VG7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62867.1"
FT                   /translation="MCLGGLCNRQANQPGLPMPEHPSTELLSRSRQPVYLQLATIFRRQ
FT                   IESGAWVPGAQIPSLDALCRQYGVARMTMHQALSMLDEEGLLERSRGRGTFVKAGSRTQ
FT                   RRVSLSTSWDEAVAVGDAIDTEALVESRGNVALPADLGLPCSGQRAAEYHFLRRLHRAD
FT                   GRPFAMCEVYIEAGVFAREPDAFRHGASVQVLDRFPGLQVSAARQRLTIVAAGAESAVG
FT                   LDLAVGAPVAELRRYACVDDVIVYYARIEFPTEFVCLDFDLLASSGPQSDANPS"
FT   gene            50232..51827
FT                   /locus_tag="Reut_B3510"
FT   CDS_pept        50232..51827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3510"
FT                   /product="Thiamine pyrophosphate enzyme, C-terminal
FT                   TPP-binding:Thiamine pyrophosphate enzyme, N-terminal TPP
FT                   binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3510"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62868"
FT                   /db_xref="GOA:Q46VG6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62868.1"
FT                   /translation="MPTRLESRNRLMETSQAMNGAESLVKTLLSSGVDTCFANPGTSEM
FT                   HFVAALDRIPGMRCVLGLFEGVVTGAADGYARMADKPAATLLHCGPGLANGLANLHNAR
FT                   RAQTPVVNIIGDQATYHRPLDAPLTADTEGWARPVSVWTRTATRAASVGADAAAAVQAA
FT                   RAAPGGVASLILPSDVCWDAGGEVAAPLPPLPVPKVAPDAVQNAARVLRSGQPTLIVLA
FT                   GSALREAPLADAHRIAAATQARLITPMSNARVSRGRGRLAVDRIPYSGDVARDRLAGIR
FT                   NVILVGAQAPVTFFAYPGKSPRPYPEDAVVHVLAREEEDLADALARLADEVGGRNVGLP
FT                   ASAAVAPADIARGAVTSEAVARTLTALLPEQAIVVEESVSFGRAFYPGTVNAAPHDWLQ
FT                   LTGGAIGAGLPLATGAAVAAPGRRVVALQADGSGMYTLQSLWTMAREQLDVTVVLLANR
FT                   KYAILLGELAGVGANPGKTALDMLDIGNPDLNWVQMANGMGVEGARAHDMETFADLFRM
FT                   ANQRKGPFLIELVI"
FT   gene            51974..52369
FT                   /locus_tag="Reut_B3511"
FT   CDS_pept        51974..52369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3511"
FT                   /product="Protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3511"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62869"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62869.1"
FT                   /translation="MPQEGSAAGPDKVYAEMLAAGQFRIQHCQDCKKHVFFPRNICPHC
FT                   GGDALDWTEPEGTGTVYSTSVIRRKAEAGGDYNIVLVDLDEGVRMMSRVEGIAPTSVRI
FT                   GMRVKARVAPGKAEGEPALVVFDPVEG"
FT   gene            52375..53547
FT                   /locus_tag="Reut_B3512"
FT   CDS_pept        52375..53547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3512"
FT                   /product="Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3512"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62870"
FT                   /db_xref="GOA:Q46VG4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62870.1"
FT                   /translation="MSLSSLRGSVAIVGVGQAGLGEAHGKTEMEILVEAAKAAVKDAGM
FT                   SMRDIDGIATASVGATMWVMPVAEYLGIKPKFVDSTMIGGSSFVSHMLPAMMALEAGLC
FT                   DAVLVCYGSNQRTSTVGRAGISKVRAVLDPQPYENPYQPLSPITSYALAAARHMHQYGT
FT                   TREHLAEVAVAARKWAQLNPEAQMRDPLSIEDVLNARMVSDPLSVRDCCLVTDGAGAYV
FT                   MVRADRAKDMAKPPVYVLGNATATWHRQISCMPDVTVTAAKESGERAFAMAGLKPSDVD
FT                   VAELYDAFTINTLLFLEDLGFCPKGEGGHFVSGGGIAPGGRLPVNTNGGGLSCVHPGMY
FT                   GMFITIEAVRQLRGECGDRQVKDAEVAVVHGNGGTLSSQATAILGTAATL"
FT   gene            complement(53645..54646)
FT                   /locus_tag="Reut_B3513"
FT   CDS_pept        complement(53645..54646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3513"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3513"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62871"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62871.1"
FT                   /translation="MNHTLRHPRRQFLKLAPASLLLGGAAATLHAPAARAQAFPAKPVT
FT                   LIVPYPAGGATDVQMRSLALATSKRLGQPIVIVNQPGVGGTLGPATMARTAAPDGYTIS
FT                   VINAALFRLPHIQRVSYNALTDFTFIMGLNSYVYGVSVAADSRWKRVQDLIAYARANPG
FT                   KLSIASVGNGTSGHIATERLARMAGIKVNFVPFKGGADALVALIGGHVDAMIEAGWGAM
FT                   AESGKVRLLAVALNERLKRWPQVPTLKELGYDIAIQSEVGLAGPKGMPPAVVQALHDAF
FT                   KASLSDPGYQQALQAESMPNVYLSTAEYRQYAQTQFASDKRFVEKLGIRLAD"
FT   gene            complement(54676..56253)
FT                   /locus_tag="Reut_B3514"
FT   CDS_pept        complement(54676..56253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3514"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3514"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62872"
FT                   /db_xref="GOA:Q46VG2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62872.1"
FT                   /translation="MNVDHLATLPRAVQHLARVQKTQIAYVFEGRETTYGAFGTHTDRV
FT                   ANGLLAAGLAPGDRIAYLGKNCDHYFELLIGAAKAGVVITPISWRLAAPEVEYIAADCD
FT                   AALLFVGNESVELAQSIASQLPALRGVVAMEDAVVDWPAYQDWRDGQATTPPTHVSRPD
FT                   DVVLQLYTSGTTGRPKGAMLTHRNLTVSAIIAERENIAWLRWVPDDVSLVAMPVAHIGG
FT                   TGWGLRGLLAGAKGIVVRDFDPRRVLDFIANDRISKLFLVPSAIQIVLRDPRARQVNYS
FT                   RLRYLIYGSAPMPADLLREGMEVFGCGFVQTYGMTETTGSVTGLMPEDHASGNTALLRA
FT                   AGRALPWAEVAVVDAAGKHVPPGEVGEVIVRSLQTMAGYWKQPEETARAIDADGWLRTG
FT                   DAGYMDADDYLYIHDRVKDMIISGGENVYPAEVENAIYGHPHVAEVAVIGVPDARWGEA
FT                   VKAIVVPRDGATPDARDILQWARERLAGFKLPKSIDFVDALPRNPSGKVLRRQLREPYW
FT                   QGYTRRVN"
FT   gene            complement(56274..57554)
FT                   /locus_tag="Reut_B3515"
FT   CDS_pept        complement(56274..57554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3515"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3515"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62873"
FT                   /db_xref="GOA:Q46VG1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62873.1"
FT                   /translation="MDFQLPAELVAYLEELDRFIEAEIAPLQAENDNQRFFDHRREWAR
FT                   TDFDNQGLPRPEWEALLAEARRRADRAGHLRFALPPEYGGKGGGNLWMAVIREHLAAKG
FT                   LGLHNDLQNEHSIVGNKPFVLVMRDYGTDAQKAFFIPGMLDETVKLAFGLTEPEHGSDA
FT                   THMATRAIPEKRDGKEGWRIDGEKMWTTGMHTATHCVVFARTSGEDGDARGITAFLVPS
FT                   DTAGVRVEEYLWTFNMPTDHPRVSFTGVWVPADAVLAKAGSGLSVAQHFVHENRIRQAA
FT                   ASLGAAEYCIRESVRYARERKPFGQELARNQGIQFPLVELATRAQMLRAFIRQTAWEMD
FT                   RIPKKEVEKQLSDKVSMCNYTANRLCCEAADLAMQVHGGIGYSRHKPFEHIYRHHRRYR
FT                   ITEGSDEIQMRKVAAYLFGYISRESKA"
FT   gene            complement(57555..57935)
FT                   /locus_tag="Reut_B3516"
FT   CDS_pept        complement(57555..57935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3516"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62874"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62874.1"
FT                   /translation="MQDAPNAADLLRSVTAFLRHAAIPKLSGREAFDARVAANVLDIVE
FT                   RELRLAPDANAAEHDRLRALLGADGTLEALNRQLCEAIAAGLIDLQTPGLAAHLWTTTL
FT                   NKLAIDQPAYSSYRAALQAMEQ"
FT   gene            complement(57935..58939)
FT                   /locus_tag="Reut_B3517"
FT   CDS_pept        complement(57935..58939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3517"
FT                   /product="Aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3517"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62875"
FT                   /db_xref="GOA:Q46VF9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62875.1"
FT                   /translation="MLSSGLHRIARRLDARATGISALRRLSGGANQETWSFSLERADGI
FT                   APMILRRCPPQTARPSGTGAAGFTGMATEAALLDRAARAGVPVPVVRAQLAPADGIGDG
FT                   FIMDLVAGETLGGRIVRDPSLAHARTVLAHQCGRALAAIHRIAHADLPPLREAAAAEEV
FT                   ANYLARHRAGGSAKPVFELAFQWLQRNLPPAPERKALVHGDFRNGNLMVGEDGLRAVLD
FT                   WELAHLGDPMEDLGWLCVNSWRFGHTSLPVGGFGTREDLFAGYEAGGGTVDAARVHFWE
FT                   VFGSLKWGIGCESMAQAPGGGAPRTVERAAIGRRSSETEIDLLNLLAPRQGAR"
FT   gene            59111..59758
FT                   /locus_tag="Reut_B3518"
FT   CDS_pept        59111..59758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3518"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3518"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62876"
FT                   /db_xref="GOA:Q46VF8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62876.1"
FT                   /translation="MKQALTPLEGQEGFAVPRYSRGKRTTERLLEAGRRLLKDRTLDQV
FT                   PIQDICAHAGVTTGAFYSRFDGKESYFRALQTLLVAQLRDGMAQRVALFDAGEKTLREV
FT                   VESLARSNRMWAYRNEGVLRASLIERAITGEDPLKRMNQDYVELVVPRLARLHPAGASP
FT                   ELETRIRFAYQAMVGTLIYTLVNRSGTYRLSDRRLEAEMARAFYLYITQELG"
FT   gene            complement(59755..59967)
FT                   /locus_tag="Reut_B3519"
FT   CDS_pept        complement(59755..59967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3519"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62877"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62877.1"
FT                   /translation="MKPANARGLALARSDIDVLGKEVAGFDPNRYFDQQDLQAARAAAQ
FT                   RWPLLASLLGYDSAVPVLAGNDDHA"
FT   gene            complement(59967..61535)
FT                   /locus_tag="Reut_B3520"
FT   CDS_pept        complement(59967..61535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3520"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3520"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62878"
FT                   /db_xref="GOA:Q46VF6"
FT                   /db_xref="InterPro:IPR017744"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62878.1"
FT                   /translation="MGIWNLYFIVKLYLFHIGRVEPQWLLNILFALALAIRIPNRALAA
FT                   LRQVVAVVAGAALLYWEANLPPFERAISQFSNLQAFTPAYMVELLGRLVSREMLLTALA
FT                   VLVVFLLVNRWVRVTTLVFAALVLVPLWQVLSVGPVVGGGQQAIAGTETAAAGSAPGEA
FT                   GWDARLNAFRQQEAQRSVHFGPLAATPDTQYDIIVLHICSLSWDDLDVAKARDNPLLSR
FT                   FDFLFTNFSSAASYSGPAAIRVLRAACGQPQHKDLYDSAPAECHIFSALADAGFSTRML
FT                   LNHDGHFDNFLQEVEQEVGVPGVKPPSNDGLPVAMRSFDNSPVAGDFDVLQRWYKKRLA
FT                   EGGGPQALYYNTVTLHDGNRLPDTKMSSLESYPLRLSKLLGDVDKVIDMVASSGRKAVI
FT                   VFVPEHGAALRGDANQIAGMREIPTPRIIHVPVGVKLVGLPEGQSPSGKTVTIDTPTSY
FT                   LALSQLISNLVAENPFQPGAQTLDQYAADLPQTQMVGENEVTVTMRDGSGYMVHTPDGV
FT                   WIEGK"
FT   gene            complement(61566..64133)
FT                   /locus_tag="Reut_B3521"
FT   CDS_pept        complement(61566..64133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3521"
FT                   /product="Cellulose synthase (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3521"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62879"
FT                   /db_xref="GOA:Q46VF5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62879.1"
FT                   /translation="MRLPSVSGMWEALRRQLARELGISVSAPAGLWWLRLLFRAPPPGR
FT                   PDVPLHCAVWLSERAHVRLEIGRAHGARIWLQRLLLRAPRAIRPLAADLRQRRQPQAAP
FT                   EPSALRRWFRSWLEPAYFRVKRLRHRLMARLPTVDWHGIANRLEALSPTLGQVPLLMPI
FT                   LLVLAAVSGILLCTTPLPLRDQFLLVVLILTGLFFLRRIPGRLATLSMAALSVLMAGRY
FT                   IWWRLTTTLRFETTVEAVFGYLLLIAELYTWIVLFLGYLQTIWPLNRRPAALSPDPADW
FT                   PTVDVFIPTYNEPLRVLQPTVYAARSMDWPAGKMNVYVLDDGGREEIRAFAEEAGVHYL
FT                   ARDEHSHAKAGNINSALKQTAGEYVAIFDCDHIPTRSFLQMTMGEFLADPNCAMVQTPH
FT                   HFFSPDPFERNFDTFRRVPNEGSLFYGLIQDGNDFWNATFFCGSCAVIKRAPLTEIGGI
FT                   AVETVTEDAHTALKLHRLGYNSAYLRTVQAAGLATENLAGHIGQRIRWARGMAQIFRID
FT                   NPMFGKGLHLFQRLCYSNAMLHFFYGIPRLIFLTMPIAYLYFGLHVIHTSAVLLMAYVI
FT                   PYLMVASITNSRLQGRYRHSFWAEVYESVLAWYIVLPTTMAFVNPRLGKFNVTAKGGQI
FT                   EEDYLDWTISKPYVLLLALNVVGLALGAGRVLFDDSFEASAVIMNMGWALFNLVMLGAA
FT                   IGVAREARQVRISHRIPMRVPATLLLPDGRTLACRTENYSLGGLGLMLPVETRVDPGEQ
FT                   VGVCLSRGKRSYHFPAVVTRNADRHLGVRFEDMDALAEQQLIQCTFGRADAWINWIDEQ
FT                   PVDVPLNGLKEVIEMGYQGLLRLVDAARASVAGIFGRVGPRQP"
FT   gene            complement(64130..64921)
FT                   /locus_tag="Reut_B3522"
FT   CDS_pept        complement(64130..64921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3522"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62880"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62880.1"
FT                   /translation="MKTIAIISAVGGAGRTTITAELASLLRWHGHAPLAIECDPRGLLG
FT                   FHFGLRERVRQGLSNTADWAACGHRSDDGVLFVPWGEPGARAARADIAMRLHEDPHWLR
FT                   RLLQDVDLAGDAVTLVDSAPWPSPFAEQALAAADLALVLLPSLPESCATLAPLRQALDD
FT                   GGIASAYVVTRLQPGRQLHTDVSVLLRATLGDALLPYEIHEDAGVPEALARGECFCRST
FT                   PHSQTAHDLQGLASWVSGWLLNGARAGKGQAGGQVQRGVAP"
FT   gene            complement(64918..65121)
FT                   /locus_tag="Reut_B3523"
FT   CDS_pept        complement(64918..65121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3523"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62881"
FT                   /db_xref="GOA:Q46VF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62881.1"
FT                   /translation="MAIFLGYFIWGVILAVPVTWLVWRFRLLRLLPRWRLPRSRRSVRL
FT                   PAQLRPVVIRGRPWRDIAGGRE"
FT   gene            complement(65128..66843)
FT                   /locus_tag="Reut_B3524"
FT   CDS_pept        complement(65128..66843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3524"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62882"
FT                   /db_xref="GOA:Q46VF2"
FT                   /db_xref="InterPro:IPR017745"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62882.1"
FT                   /translation="MNDTRPARSRNAASSPWLQARHALAIDALPPALAALQPGAVHAVY
FT                   ADASPARDALFWQSAAQLLRARTTVLSSREPAEIGAMLRQHGLDIDSCRTLHSRANVCT
FT                   LRAVPDRTGSDVLLEAMQAMVDQCGAAGGEILLEGAEAFLPWDDATALADAGARLAHWC
FT                   AAQGCGLLLLAAPPDGAETLDLATLARFHQHFAGAARLAQVQGQYVWEVGFWRHKNAVL
FT                   PREVVPLRFSPEDHGLMAGTGNADAADGVPVGLLPPDEHRVIVSRDAVLRERWIPAEWQ
FT                   VVPDNDAVVAAASGAVAATVILHYGDRQELEPLAAQVHKLRHHGGKALKIVVREDKEML
FT                   RQRYELLMITLGANMVILRNTPFARMQTRIDSLQGQVFQRPILPDYKSALSAVLATAAT
FT                   GYLPAAEFIALVRSTLERSTVVRLPHVLLELPLLAEVAHVDALRACQMRDAGDLCTAGS
FT                   NSVYAFFFACRLENVEIACQHVFQRPMSELFSGELRCGDTESILGTLQRLEADIAQRPP
FT                   QDYSGWLAQHANDCADAPASQPVVAGIMPQPSGGQRRRPRSAPQPFSIPIKPQG"
FT   gene            complement(66852..70649)
FT                   /locus_tag="Reut_B3525"
FT   CDS_pept        complement(66852..70649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3525"
FT                   /product="TPR repeat:Cellulose synthase operon C,
FT                   C-terminal:Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3525"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62883"
FT                   /db_xref="GOA:Q46VF1"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62883.1"
FT                   /translation="MSRALTPLVLTVVSALAVPAMAQQAEKPSPEMTQLLAAARMWEAK
FT                   NRTDIARGILDKALLIDPNQPDALMLLGLIEIRSNRPLEADKILRTLRQRAPNHPATLE
FT                   LEDAYRIATRDKQEMARIRLLARAGKSEEAIAWLRQLFPRGAPRGELAVDYYRIMAGTP
FT                   AGRTASIAELRARVRQDPDDLRLAMALASLLTDREATRQEGLGILYRIVQRPDGDRKSA
FT                   LEMWRRTLYGVSDDPAYFKWFELYVKEVPDDTSARQTLAELAKKGGAASPASQARRRGE
FT                   QQLARGNVREAETALESANRKRRNDGETLGNLGLVRLRQGRHDEARELFARAEQLDSGN
FT                   RGKWHSLKDTARFWGTVAKAREANAQGKPAQGEALAREALALQPGNANARGVLADALIA
FT                   QNKLPEAEALLRETLAGPEPDIGTLRTLVKLLNDSQRSDEVGPLIASTGSRLKGSADEL
FT                   RSLRADLLSLQGEQLLAQRKQSPALARLEESIRLAPNDPWTRFTLARAYRDLALPALGR
FT                   RVMEDGLAASPTSEMRYAIALYLNSVDDIDAASSVLAGVPEAERSDSMRRLAGNLQAQR
FT                   LLREARQLVAAGREQEAEDKLRAAADAARDDPQMLASVGREWIAIGQPDTGLRLVRDWL
FT                   DAHPQDPAIDVRIRYGELLASAERDDELRAWIAESSALPGITPEQRADFDDQLLRLALR
FT                   DTDRRIADGDLKGAERMLYAVPAAQQNDRRWLLELADLREAQGDYDGAAQAAREVLTTH
FT                   PQDADARLTVARMLERQGKDDQALEEVRAVLADTPEDDIDTRLAVARRFTAMRREDEAL
FT                   AVVTPLRERFPERSDVTMQAGRIAQSRGDFNGAAVLYREARVQEQRENEIPRPQGTSAE
FT                   RALGALEARREGQVSTAVLFSNKSGDPGISRLNATEIPLYVRIPNGYTGHAFFHADTVL
FT                   LDAGTLPADSLPGSRDFGKIRALGNNGLGPISQSDRGVALAAGYEFNGAYNSWRADIGT
FT                   TPLGFTLQTVVGGFRYRAEMGPASATVDISRRAVTSSLVSYAGATDPRHVDAQTGAVTP
FT                   AESWGNVVRNGIHARYARDVGRFGLFADLGYGVYTGTNVLTNQEFTVRTGFDVPVFVRR
FT                   DQRITSGVVLNYWRYAENERFYTFGHGGYYSPQKYLSFLIPLDWTGRRGLLSWRLRGSV
FT                   GMSSTYEKSMDIYPTRPDLQAMVGGAQYEGGSGGGFSYTVGGIVEYRFAPHWVAGAGFD
FT                   IDRSRDYAPNRAFAYLRYFFERQQGAVPYPPTPVRPYSTY"
FT   gene            complement(70634..71812)
FT                   /locus_tag="Reut_B3526"
FT   CDS_pept        complement(70634..71812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3526"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3526"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62884"
FT                   /db_xref="GOA:Q46VF0"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62884.1"
FT                   /translation="MWRALPGLTRWLAAGALACACVAALPAHAATCGWADWDTFKRTLI
FT                   SADGRVIDASTDDKVTVSEGQAYGLFFALVANDRTTFDKLLAWTENNLAQGDLIAHLPA
FT                   WIWGRIPADKAKDGKETWGVIDTNSASDADLWIAYTLLEAGRLWNERRFTALGTLTARR
FT                   IMREETAAMRGLGRTVLPGPVGFSLSEGRWRVNPSYVPLQVMRRLAVLLAKESGWDQLV
FT                   ASSLKVILETAPRGFSPDWAEYDNSRGFLPDTATKAESAYNAIRVYLWAGTLAADDPQR
FT                   ARMLQQFMPLADYVAAHGYAPERVDTQTGQPGPDSGNAGFSAAVAPYLAALGRTDQARA
FT                   QAQRTRELTAREPLGYYSQALALFGLGHLDGLYRFAGDGALLPAWKTGCPAR"
FT   gene            complement(71814..74312)
FT                   /locus_tag="Reut_B3527"
FT   CDS_pept        complement(71814..74312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3527"
FT                   /product="Cellulose synthase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3527"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62885"
FT                   /db_xref="GOA:Q46VE9"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62885.1"
FT                   /translation="MCIRRSIGSTLSRTVERLVLSSRPASPTAGNQRLERRRDADAPTG
FT                   DASTVRMNRKRPSAMPRSAYAQTPRRRLLSASLALMMLSAPTWPWHGVLAAPTSAATST
FT                   TAAAAPQPAETPPALPTATSTQVLTLRQMGSYGPIALRGVDDDRSLDVGVRLDEVVTAA
FT                   KLKLVFTYSPALIFPLSHIKITLNDEVIASVPLEEKEAGRLVTREIELDPRFFTDFNHL
FT                   TVQLIAHYTMDHCEDPLHSSLWADISPATTLTLSKAHMTLPDSLALLPAPFFDRRDNRR
FT                   VTVPFVLPANADAATLRAAGVVASWLGALASYREARFPVARSAPADTDSIAFVLPGALP
FT                   AGIALPEIKGPSVSVMPNPASPHRKLLVIAGRNPQELQTAANGLVLSKTAMAGSSSQVQ
FT                   SVDIGNPRQPYDAPAWAPTDRPILFKELVSDPQQLQVAGYNPNPIRVNLRVPADLYDWT
FT                   RSNVPLNVRYRYTAPPTYNDSVISIDINDQLVRSYRLKPLAMKDDQNLVSVPLLSGSSV
FT                   SAANLIGIPAFRVGSNNQMQFNFHIDSQKTGLCTSTATNVARAAIDPDSTIDFSAFSHY
FT                   TGLPNLAFFANSGYPFTRLADLADTAVVMPDAPTALDQEALLTLLGHMGKWTGLPSLRV
FT                   SVVPAAQIDSVRGRNLLIVGTGSAAGVLGKWGKSLPMLIERSRTEITLRDQRSHAWSNW
FT                   LSGIEEDPITPTGRAILTADGPLAALVGFQSPYAEGNSVVALTATEDGRVADLLDSLEN
FT                   PGKVAQMRGDLTVVRQDQVDGLRLGERYYVGDLPWYARVWVRVSAFPSLMAIAGLLAGL
FT                   VVALSLFWTLGKLAARRNGG"
FT   gene            74709..74990
FT                   /locus_tag="Reut_B3528"
FT   CDS_pept        74709..74990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3528"
FT                   /product="D-galactarate dehydratase/Altronate hydrolase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3528"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62886"
FT                   /db_xref="GOA:Q46VE8"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62886.1"
FT                   /translation="MIHVVLHDAKDTVAVAVVEGIQAGTRLNAWIMDEDKIITVTALQP
FT                   IPIGHKVALCDMSPNDTVYKYGIDIGKVVAPIKAGEHAHVHNIKTKRW"
FT   gene            75051..76226
FT                   /locus_tag="Reut_B3529"
FT   CDS_pept        75051..76226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3529"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3529"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62887"
FT                   /db_xref="GOA:Q46VE7"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62887.1"
FT                   /translation="MSVIDQNTTFWGYRRDNGRVGVRNHVIILPLDDLSNAAAEAVAAS
FT                   IKGTMAIPHPYGRLQFGPDLDLHFRTLIGAGSNPNVAAVVVIGIEDGWTKRVVDGIAKT
FT                   GKPVVGFGIEGHGDHQTIMRASKAAKEYVQYATALHRVECPISELWISTKCGESDTTSG
FT                   CGANPTVGNAFDKLHPLGTTLVFGETSELTGGEHIVAARCVNDTVRHEFMAMFERYQGM
FT                   IDRWKTSDLSESQPTKGNIAGGLTTIEEKALGNIQKIGKKCTVDGVLDKAEEPTHPGLW
FT                   FMDSSSAAAEMVTLCAAAGYVVHFFPTGQGNVIGNPIVPVIKLCANPRTVRLMSEHMDV
FT                   DCSGLLQREQTLDQTGDKLLECMLATANGRWTAAEALGHREFVLTRIHESA"
FT   gene            76223..77161
FT                   /locus_tag="Reut_B3530"
FT   CDS_pept        76223..77161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3530"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region:D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3530"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62888"
FT                   /db_xref="GOA:Q46VE6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62888.1"
FT                   /translation="MMKRICISEFMDPAAVQALTPGFDVRYEPGWVDQRGALLDALAGA
FT                   DALIVRNRTQVDAALLERAPALRVVGRLGVGLDNIDVAACRDRGIRVIPASGANARSVA
FT                   EYVVTTAALLLRGAYLGSAEVAGGKWPRARLSEGREALGKTLGLIGFGDIGRQAAALAQ
FT                   AFGMRVVAHDPMLAPDDPVWSATGVVCMTLDALLAQSDAVSLHVPLVAATRHLMNAQRI
FT                   GAMKRGAVLINTARGGVVDEGALAGALLEGHLAGAALDVFEAEPLPADSVLADVPNLVL
FT                   TPHIGGVTREANARVSMMIAEKVRQTLEALP"
FT   gene            77158..78174
FT                   /locus_tag="Reut_B3531"
FT   CDS_pept        77158..78174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3531"
FT                   /product="(R)-2-hydroxyacid dehydrogenase"
FT                   /EC_number="1.1.1.272"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3531"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62889"
FT                   /db_xref="GOA:Q46VE5"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62889.1"
FT                   /translation="MSRIPMEKLEVLARSALRRAGASQLQSHATAAALVRADAMGLASH
FT                   GVSRVPMYVGHLRHDRVDGQAVPTVRSTRASAVLVDAACGFAFPACELAIAEAMRRARE
FT                   TGVGVGAVTNSHHFGAAGLPLHTVARAGMVGIAMGNSPAAMPAWGGKRALFGTNPIAAA
FT                   FPRQGRLPVLIDLSLSEVARGKIMVAAKQGKPIPPGWALDEHGQPTTDARAALRGSMLP
FT                   AGGVKGAMLALMVELLVTTLAGAQFGAEADSFFTDAGNRPRIGQLFLVLDPGAFAGSDV
FT                   YGERVEALLQVMLDDTGTRLPGARRYALQTEAQQHGIEIPEAQLAELLSLAGEEVKA"
FT   gene            78250..79275
FT                   /locus_tag="Reut_B3532"
FT   CDS_pept        78250..79275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3532"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3532"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62890"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62890.1"
FT                   /translation="MHRGLIRPALRLAARALVALSAVSTLAWLAASPAAAQTSGPAPAA
FT                   SDYPSKPIRYVVPFSAGGLTDIMARLVGQQLAEEWKKPIVVDNKPGGNANIGADQVAKS
FT                   PADGYTWLAVTLTHASNVTLFPKLPFSMQKDLVAVARIASSPMLVVVPANSPIKSMKDL
FT                   AAAAQKARLNAGSSGNGTPPHLTLALFESQTRTNMTHVPYKGGAPSMTDLIGGQLDVVF
FT                   SNFPESIAYVKGGKLRALAVTTRERHPQLPDVPTVAEAGFPDLIVENWTGLMMPSGTPR
FT                   PIVEKVTASVGRLLQTDGMRERIVAAGFTPAPQSPPFNEYFNTEVTRWAKLIEEKHIRV
FT                   E"
FT   gene            79413..80153
FT                   /locus_tag="Reut_B3533"
FT   CDS_pept        79413..80153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3533"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3533"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62891"
FT                   /db_xref="GOA:Q46VE3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62891.1"
FT                   /translation="MGARFEAGSAIGGVLYKDVKQAILAALAGGEWKPGEVIPSERKLI
FT                   ERFGVSIGTLRKAIDELVAENILIRHQGRGTFVATHRLEDHFFRFFRIVRQDGHREYPT
FT                   VQLARFRRAKADKDEAAALGLAVGEPVFRFTNVLSLEGKPVMIDAITVPEERFKALSEK
FT                   QLRERPNTLYNFYQDAFGINIIRTEERLRSALADEDDEALLGVPVGSPLLKILRVASSY
FT                   HDERIEYRVSRLDTTGHEFVLSQP"
FT   gene            complement(80293..81426)
FT                   /locus_tag="Reut_B3534"
FT   CDS_pept        complement(80293..81426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3534"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region:Acyl-CoA dehydrogenase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3534"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62892"
FT                   /db_xref="GOA:Q46VE2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62892.1"
FT                   /translation="MDFTYSEEQQMLADSLRRFIDTEYTFDARRKSSRAGEALDRNLWN
FT                   KLAEMGVLGLTVPADFGGFGEGAASQLVVQRELGRGLVLEPVTPSGVMSAAILSAYGSL
FT                   QQKEEWLPAIASGERIVTLAYLEPTTRYRPETARASAERSGSGYVLNGTKSLVWHGASA
FT                   DAYLLTARIAGSNDVALFLVPRDSAGLTVTGYPTIDGLRAADLSLQNVTVSADALVGQP
FT                   ADGLAALGVGMEHGVAALCAEGAGAMEKLIEITGEYLATRQQFGKPLAAFQALQHRMAD
FT                   MLVQKELALSMAYVAVQAIDETDPARRRRMLSAAKVTLARAGRYVGQQAVQLHGGMGMT
FT                   DELSVGDYFKRLTMLDQLLGDSDYHLQRFGEVMETAA"
FT   gene            complement(81440..82633)
FT                   /locus_tag="Reut_B3535"
FT   CDS_pept        complement(81440..82633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3535"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3535"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62893"
FT                   /db_xref="GOA:Q46VE1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62893.1"
FT                   /translation="MDLRFTAEEQAFREEVRAFVQANLPEDIRNKVLNHQRVEKDDYVR
FT                   WHRILHAHGWGAPTWPKEWGGTGWNALQRLIFEIETLRAGAPRMLPFGLTMIGPVLMKY
FT                   ASQEHKERFLPRIPTVEDFWCQGYSEPGSGSDLASLKTRAVRKGDKYIVNGQKTWTTMA
FT                   HFADWIFCLVRTDPEAKAQEGISMLLIDMKSPGVTVRPIKTLDGGHDVNETWFEDVEVP
FT                   VENLLGEENKAWTYAKYLLGHERTGIAGIGHCHRELRQLKHYAAQTTDGAGRPLIEDVR
FT                   MRDKISRIEMDIMALEMLLLRVATQSGGQPGPEASIVKIRGSEIQQDLAMLMMEVAGPN
FT                   AWPYSPTWLEPGVEEPVSGPEWASSASSTYYDMRKTSIYGGATEVQKNIISKMILGF"
FT   gene            82846..84438
FT                   /locus_tag="Reut_B3536"
FT   CDS_pept        82846..84438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3536"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3536"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62894"
FT                   /db_xref="GOA:Q46VE0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62894.1"
FT                   /translation="MTCGKCVAVHSSTHLAHSNPDRAASIMSSFRPEFIHDIPRHWATQ
FT                   TPQAPCLHESGNVISYGDLWRRIESARDWLAAQGVGEGDRVMVVGENCNEMVVTMFACS
FT                   TLHAWPIQVNARLSAREIDNIRDHAQPALVLFTGHVSDVAAAHGRRLDAKVTACPVYDE
FT                   GMTVVRAATAPDRVPAGQARKVATLIYTSGTTGAPKGVMVPHEGLAHFARISATSRNMG
FT                   QADVAYGALPMSHIFGIATVLLATLYGGASLFLRPRFDADEVFDALESPGVTILQGVPT
FT                   MFTRIMAVAQQRERKTYPRLRYLYTGGAPLDPTLKGDVETYFGQPLHHGYGITEYAGSL
FT                   FITRMEAPRADCSAGYIVEGVEINITDGDGNLLPAGERGQIRVRGPGVMLGYYRNPDQT
FT                   AEALLPGGWLNTGDLGYLDADGALFISGRSKDLIIRSGFNVYPIEVESVINAFPGVRQS
FT                   AVVGRNTSDGNEEVVAFIEMQDGVEPDRAKLDAYLRDSLAPYKRPAEVRVIDVIPTTAS
FT                   GKLLKQPLRALLG"
FT   gene            84531..85499
FT                   /locus_tag="Reut_B3537"
FT   CDS_pept        84531..85499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3537"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3537"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62895"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62895.1"
FT                   /translation="MKRWMTVAAMMATLLHGAAWAADAYPSRPIKLIVGYAPGGPVDTA
FT                   ARIYADQLGRALHQPVVVDNRAGASGAIAADLTAKSAPDGYTLYFVASPTMTMTPLIQR
FT                   SVNFNPLKDFTYIGLITDYTNVLLVNKDFPAKNVGELVDYARKHPDDVSFGSAGVGASN
FT                   HLSAELLAQMSHVKMLHVPYKGNSPAMADVMSGKVTFMFDITGTAIGHINGGKVRALAV
FT                   TSKTRNPALPNVPTMIESGLKDYDLTGWYALIGPQKLPADVVDKLIKAQKTIGDDPAFK
FT                   QRMTAGGYDLNISGPKPLADRIQRELKLWGGVVKTANIQAD"
FT   gene            complement(86097..86960)
FT                   /locus_tag="Reut_B3538"
FT   CDS_pept        complement(86097..86960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3538"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62896"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62896.1"
FT                   /translation="MTQNSQLDHLRTWIGRSESRTETLTPEPVIGLAATFDLDTEAVVR
FT                   GPLPPLWHWLYFLPRAPQRDIGADGHPALGGFMPPVPLPRRMWAGSELSFERPIHVGDT
FT                   VTRTSTIQDVQHKSGRSGELWFVAVDHELSVNGQIAVRERHDIVYRAMPEIGKPQPPRP
FT                   RLEHTAQWQRTLRADPVMLFRYSALTFNGHRIHYDREYTRDVEGYPGLVVHGPMQAMLM
FT                   LDLVAREQPQAHVRRFGFRGLAPLFDQDIITVGGTADPAQAGKLILWTGDDAGGQAMQG
FT                   WAEIES"
FT   gene            complement(86978..87817)
FT                   /locus_tag="Reut_B3539"
FT   CDS_pept        complement(86978..87817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3539"
FT                   /product="HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3539"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62897"
FT                   /db_xref="GOA:Q46VD7"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62897.1"
FT                   /translation="MSTAVTYLFVPGDRPERFDKAAAAKPDVMVLDLEDAVHPDAKPAA
FT                   RQAIADWLAAGAAANANVRINDSAAAGFAADIEWLRSLPKGTPLAGLMVPKAEDAAALA
FT                   AITEVLRGINPEAELIAIIETALGLHQVDAVATANGVARLAFGSLDYAVDLGCSHTRDA
FT                   LAYARARIVLASRVAGLTPPVDGVTTALKDESVLADDVAYARALGFGGKLCIHPAQLGA
FT                   VRAGFLPSPEQLDWARRVLEATASGSHAVQVDGKMVDRPVIEQARRLLALAQPSAAH"
FT   gene            complement(87828..89201)
FT                   /locus_tag="Reut_B3540"
FT   CDS_pept        complement(87828..89201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3540"
FT                   /product="MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3540"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62898"
FT                   /db_xref="GOA:Q46VD6"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62898.1"
FT                   /translation="MSADHTYPTRQLCEFLARFTLADVPAPVIERTKDLFLDWIASAIA
FT                   GKDAPAVCKIQEFAAAMGPSTGDAEVFVDRRRTSPYFAALINGASSHVVEQDDVHNGSV
FT                   LHPAAVVFPAVVAAAQAEGKTGAEVLLASIAGYEAGIRIGEFMGRSHYRIFHTTGTVGT
FT                   LAAAAAVAKLYNLDAEGINQALGSAGTQAAGLWEFLRDAADSKQLHTAKAAADGLQSAW
FT                   LARAGFTGAKQILEGAQGMAAGMSSDANPACLTDGLGTRWATAETSFKFFASCRHTHPA
FT                   ADALKVLMQREGVSADQIASVTTHVHQGAIDVLGPVVNPTTIHQAKFSMGTVLGLVAVH
FT                   GHAGLPEFEQHALQDAKVACFRGKVEMELDDEINAAYPRQWIGRVTVRTTDGRTLAARV
FT                   DVPKGDPDNTLSRPELEAKALQLGAFRHGATEAEMRVIIARVWALESAPTVNDWLPAR"
FT   gene            complement(89265..90464)
FT                   /locus_tag="Reut_B3541"
FT   CDS_pept        complement(89265..90464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3541"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3541"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62899"
FT                   /db_xref="GOA:Q46VD5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62899.1"
FT                   /translation="MTASTPNGIRPLDGIRVVSLEHAVAAPFATRQLADLGARVIKIER
FT                   PGVGDFARGYDETVHGQSSYFVWLNRGKESLTLDLKDAEAQAILHKLLADADVLVQNLA
FT                   PGAAARMGLDFDTLHPRYEKLIVCDISGYGDAGPYRDKKAYDLLIQAAAGLVGLTGGPN
FT                   EPSRAGVSIADISAGMYAYSGILSALLQRGRTGKGLRVQVTMLETMAEWMNQVLYLGHY
FT                   GGKPPARVGASHPTIAPYGIHRTANGSVIFSVQNEREFANFCEIVLGNRELAQDERFSS
FT                   NTARVRNRPELTTIIEDRFSTLTVAQVEELLDQAQIANAPMNDIEGVWNHPQLQARERW
FT                   RKVETPNGTVDALLPPANLSGVEPAMGAIPALGAHTASILAELGYGASDVEALAAKKVV
FT                   "
FT   gene            complement(90473..91642)
FT                   /locus_tag="Reut_B3542"
FT   CDS_pept        complement(90473..91642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3542"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region:Acyl-CoA dehydrogenase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3542"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62900"
FT                   /db_xref="GOA:Q46VD4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62900.1"
FT                   /translation="MFADQDQDQLFPEIREAVRDLCAGFDSAYWQRIEEQNGFPEEFVQ
FT                   ALTHAGWLSALIPEAYGGSGLSLTAASVIMEEINRNGGNSGACHGQMYVMGCLLRHGSE
FT                   EQKKRWLPGIASGELRMQSMAVTEPTTGTDTTKLKTTAVRKGDKYVVNGSKVWISRVQH
FT                   SDLMLLLARTTPLDQVKRKSEGLSVFVVDLREAIGKGLTVRPIRNMVNHETNELFFDNL
FT                   EVPAENLIGEEGKGLKYILDGMNAERILIAAECIGDGYWFVERASNYARERIVFDRPIG
FT                   QNQGIQFPIARSYVNVEAASLMRYKAAALFDAGKPCGKEANISKLLAADASWEAANVCL
FT                   QTHGGFGFAAEYDIERKFRETRLYQVAPISTNLILSYVAEHVLELPRSF"
FT   gene            92577..93062
FT                   /locus_tag="Reut_B3543"
FT   CDS_pept        92577..93062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3543"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62901"
FT                   /db_xref="GOA:Q46VD3"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62901.1"
FT                   /translation="MKAIISDEAAFAVFVGSRFPYYRARWQVAAANNGMAWNWAAFFFG
FT                   PFWMAYRRMYWQVGVYAIVLCAEPVLHALFHVQMPDVLARPLAYAMALVLGFYGNQLYR
FT                   MHAESTIQRLRDYHWSPEVVNDSLARCGRTSWPGVAAMALLIAVMLVSLRPLARLVA"
FT   gene            complement(93099..94001)
FT                   /locus_tag="Reut_B3544"
FT   CDS_pept        complement(93099..94001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3544"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3544"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62902"
FT                   /db_xref="GOA:Q46VD2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62902.1"
FT                   /translation="MHYDLTDLRLFLNVGETENLTRAAERSFLSLPAASTRIKQLEEAF
FT                   QTQLLIRQVKGVRLTPAGDTLLHHAREVFRELECLHSDLRPYAKGVKGKVRLLANTTAT
FT                   NSFLATGLSRFLSENPDVDVELEEHLSQEIVSAISAGAADLGIVAGEVATQDLDVMHLC
FT                   SDELIVIAPVNHPLPQFKRLHFADLLDTCRFVGLNQFSAIQSFLDRIASGMGKRISLRI
FT                   QVGSFDAVCRMVEAGAGIAIVPNSCARRYASRKVLRFISLEDEWARRELRLCRRPGREL
FT                   PQFAETLIQYLVDAAREPV"
FT   gene            94195..95109
FT                   /locus_tag="Reut_B3545"
FT   CDS_pept        94195..95109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3545"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3545"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62903"
FT                   /db_xref="GOA:Q46VD1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62903.1"
FT                   /translation="MSGLMAGKVALVTGAGGGIGRGIALAMAAAGAKVVVNDLGVSMTG
FT                   EGGDAGPAQRVVEEIRAAGGEAVANTDSVSTWNGANAIVQCALDNFGRIDAVVNNAGNL
FT                   RDRMFFKMNEEEWRSVIDVHLHGTFFVSRAAANYFKDQEGGAFVHMTSTSGLIGNLGQA
FT                   NYSAAKLGIAALSKSIALDMQRFNVRSNCIAPFAWSRMTSSIPAETPEEKARVAKLQKM
FT                   EAGKIGPVAVYLASPSAAEVNGQIFAVRANEIILMSQPRPVRSVHMSEGWTPESIGEIA
FT                   MPAMRNSFFKLERSPDVISWDPI"
FT   gene            95111..96346
FT                   /locus_tag="Reut_B3546"
FT   CDS_pept        95111..96346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3546"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3546"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62904"
FT                   /db_xref="GOA:Q46VD0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62904.1"
FT                   /translation="MAPAMQGALAGVRVLDLSRILAGPWCAQNLADLGAEVIKVERPRV
FT                   GDDTRSWGPPWLPDPEGQPSRDATYFAGANRGKQSLTLDIASPEGQAIVRELAAKSHIV
FT                   LENYKVGDLKRYGLDYESLKAINPALVYCSITGYGQTGPSAHKPGYDFIFQGIGGLMSV
FT                   TGERDDLPGGGPQKVGVAVVDVLTGMYATVAVLAALRHAERTGEGQHIDMALLDAVVAV
FT                   GATPIIAQRITGQAMPRYGNAHANMVPYHVFATSDGYMIVAAGNDGQWQAYCRGIERPD
FT                   LAVDERFATGSGRIIHRELLVPMLEAHMRTRPTALWVEALEAQGIPCGPINDYAQVLDD
FT                   PQVRHRELQVDLVRKDGAICPTVKSPLRLSTTPVQYDAPPPRLGEHTERVLAEVLGLSA
FT                   ERIAALREQGVV"
FT   gene            complement(96434..97582)
FT                   /locus_tag="Reut_B3547"
FT   CDS_pept        complement(96434..97582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3547"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3547"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62905"
FT                   /db_xref="GOA:Q46VC9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62905.1"
FT                   /translation="MHIVATPAHRHPVPGMPRSIAAPGPALAGTAGTVMTTLAAAPAPA
FT                   RHTIAIHHVQQIVLGVRRLGGDIDALLRRAAISPALLASPTARVTQDQYAALIRTLRRI
FT                   TRDELWGLLSRPVPPGVFAQAASAMIHCATLEEAIQAGLRQYRLHIGDFTPRLHRSNDG
FT                   KTASVQLQAHAPATPCHVFAESTFVFHAYGLINWLVARRVPLARVDLSAGAPKGQTDTE
FT                   RIFNTTVRYGQPCTALHFDAAWLRLPVMQDATGLGEFLREAPHKLLVRYRDNSCLAERI
FT                   RLHLRSHLDDELPSLEQMAQMLRLTPQTLRRRLRDEGRGYQNIKDNLRRDVAIGMLERS
FT                   DLSLQQVALRLGFSEPSTFHRAFKKWTGVAPGEYRQLASAGS"
FT   gene            97923..98927
FT                   /locus_tag="Reut_B3548"
FT   CDS_pept        97923..98927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3548"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3548"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62906"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62906.1"
FT                   /translation="MQANRRSALQRLGAGLLALGGVATGLLGAGSAMAQVAFPSKSVRL
FT                   VVPYPAGGATDVLARAIADGLGKAWKRPVVVENRPGASSMIGSEVVARAEPDGYTALLT
FT                   ITTLVQAPSLYTKAPFDPVKDFAPVSELGTTNLVFAVNGAVPATNLKEFIALVRAKPKQ
FT                   YSFGSYGTGSSGHLYGEIFNETAKLDMIHVSYKGEAPELNDLLGGQVPSAVISVMGAKP
FT                   HNASGRLRALAVTGASRSPQLPDVPTFKEAGIAGMDSLGWFGLLLPAATPRAIVEKFSA
FT                   DVNKVLADPAVRARMNELGVILTGSTPDAFAQTVQSDYVRWGKVIRTHNIRLD"
FT   gene            98941..100668
FT                   /locus_tag="Reut_B3549"
FT   CDS_pept        98941..100668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3549"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3549"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62907"
FT                   /db_xref="GOA:Q46VC7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62907.1"
FT                   /translation="MKSASTSQPYRSPAWPAGLPASLHAPRTSLFYNLEVAARRYPDKT
FT                   AIQYFGTAISYAALLDEVERMAGYLQHTCGIQPGDRVVLFSQNCPQFIAAYYAILRAEA
FT                   VVVPANPMWLEAELEHVVADSGAVAVFCGSELYDRVAPLHGKALRHVIVHHYAGMLHDD
FT                   GGLPVPAWLREPAPALSAAPSGAMPVTWEAACNAGQLPRPHEAGYDTLCMLAYTSGTTG
FT                   NPKGCMHTHGTMMSSAVGSQVWRSSTPEAVVLAVAPMFHLLGMQNCMHSPIYLGATVVL
FT                   MPRWERSLAADLIERYRVSVWGAPPAMLVDFFAQPGVTQRDLSSLAFLGGGGAAMPDAV
FT                   ANMLQERFGLPYVEAYGMTETASFLLSNPRQKPKRECLGIATFGVDARVVDPETLAELP
FT                   QGEIGEIVAHGAQVMLGYWNNPEANEESFVEIDGKRFLRTGDLGFMDEEGYFFMRDRLK
FT                   RMINASGFKVWPAEVENLLYGHPAIHEACVIAARDDHRGETVKAVVALRAESRGTPEAD
FT                   PERIMAWCRERLAAYKVPRIVEFVDALPKSATGKIQWRALQEEAMQPAGLGKTGMEGR"
FT   gene            100707..101687
FT                   /locus_tag="Reut_B3550"
FT   CDS_pept        100707..101687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3550"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3550"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62908"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62908.1"
FT                   /translation="MQKSRRTWLAQAGTLAGAAMLGNVGQAVAQNYPSKPIRMVVPYPA
FT                   GGGTDTVGRMIGQRLAEAWGQPVVVDNKPGASGMLGNDIVAKATPDGYTVLLAITALIQ
FT                   SPSLYKRTPYDVNKDFTPVSLIAKSSDLFVVPNRVQANTMREFIAQAKAGKLSYGSYGN
FT                   GTSSHLHGELLRQQAGIELTHIPYKGAAPLLNDLLGGQVDSAFVDVTSAYPYLTSGKFK
FT                   ILGITGTQRYKAIPNVATFAEQGLQGFEPSGWFALFLPANTPKDVTARLAAETARIVKL
FT                   PEITQKLAGMGLQPVGSAPQELAAVVSGDMPKWAKIVRDAHIQLD"
FT   gene            101731..102510
FT                   /locus_tag="Reut_B3551"
FT   CDS_pept        101731..102510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3551"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3551"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62909"
FT                   /db_xref="GOA:Q46VC5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62909.1"
FT                   /translation="METIRYAVEDGIATLTLDYPARKNALNGVMRREIGDVMHELRQDT
FT                   SVRALILTGAGTDFCSGGDISSMQGEISAAQGRQRLGNIHPWLETLINLEIPVISAVDG
FT                   AAFGAGFSLALTADIILATPRARFGLPFLRLGLIPDCGVFYTLPRMVGLQRAKALMFSM
FT                   RELNAEAAQEQGIVMEIVPADSLQERARAMARAFTEASPVALALTKKALNASLNQDLHS
FT                   MLAMEADGQGIAFATEYRQEAANRFLSKQPPRYRWPD"
FT   gene            102676..103866
FT                   /locus_tag="Reut_B3552"
FT   CDS_pept        102676..103866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3552"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region:Acyl-CoA dehydrogenase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3552"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62910"
FT                   /db_xref="GOA:Q46VC4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62910.1"
FT                   /translation="MGSPELNATAAASTEAPWMTEDLVLFRDTVRRFVERELAPNESRW
FT                   AEQGYIDRDVWRRAGQIGLLCASIPEEYGGGGGTFAHEAVITQEMARGICTSLGNNVHS
FT                   GIVAHYLLNYGTQAQKEKWLPQMASGEMVAAIAMSEPGAGSDLKSVRTRAVREKTENGD
FT                   CYRINGAKTFITNGYHADLVCLIAKTDPEAGTRGVSLIMVETRDLPGFRRGRILEKIGQ
FT                   KGQDTAELFFDDVLVPCENLLGEQEGQGFYQLMQQLPQERMIIALGAVASMQRAIELTT
FT                   DYVRERKVFGQPLLDLQNTRFKLAECKTNATIAATFVNDCMVRLMEGKLDAATAAMAKW
FT                   WCTQRNCEIIDECLQLHGGYGYMLEYPIARMYANARVGKIYGGSNEIMKELVARTL"
FT   gene            104270..106192
FT                   /locus_tag="Reut_B3553"
FT   CDS_pept        104270..106192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3553"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3553"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62911"
FT                   /db_xref="GOA:Q46VC3"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62911.1"
FT                   /translation="MDIFGHYATRFEARKEEEYSIQEYLDICKKDPTAYATAAERMLAA
FT                   IGQPELVDTHHDPRLSRLFFNKVIRVYPAFRDFYGMEDTIEQIVAFFKHAAQGLEERKQ
FT                   ILYLLGPPGGGKSSLAEKLKALMEEVPIYALKGSPIHESPLGLFSPEEDGKILEEDYGI
FT                   PLRYLSTIPSPWAVKRLQEFNGDITRFRVVKLRPSVLSQIAISKTEPGDENNQDISSLV
FT                   GKVDIRKLEDFPQDDPDAYSYSGGLCLANRGLLEFVEMFKAPIKVLHPMLTATQEGNYK
FT                   GTEGFGAIPFDGIILAHSNEAEWQTFKQDKNNEAFLDRIYIVKVPYCLRVSEEVKIYDK
FT                   LLRSSSLAAAPNAPSTLKMMAQFAVLTRIKEPENSNIFSKMRVYDGESLKDVDPKAKSY
FT                   QEYRDYAGVDEGMNGLSTRFAFKVLSKVFNFDNTEVAANPVHLLYVLEQQIEREQFPPE
FT                   QEAKLLSYIKEYLTTPYVEFIGKEIQTAYLESYSEYGQNIFDRYVVFADLWIQDQEYRD
FT                   PNTGEILDRNALNDELEKVEKPAGISNPKDFRNEIVNFVLRARAHNGGKNPVWTSYEKL
FT                   RMVIEKRMFSTTEDLLPVISFNAKSSREDQEKHENFVNRMVEKGYTPKQVRLLVEWYLR
FT                   VRKSS"
FT   gene            106230..107492
FT                   /locus_tag="Reut_B3554"
FT   CDS_pept        106230..107492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3554"
FT                   /product="Protein of unknown function DUF444"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3554"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62912"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62912.1"
FT                   /translation="MGTVIDRRENGGNKSAVNKQRFIKRYREQIRQAVAKAVSGRKIMD
FT                   IEQSGQVSIPVKDISEPIFHHGPGGRREWIHPGNKKFVRGDSFDRQQQGGGGTGSRASD
FT                   SGEGEDDFVFTLSREDFLNFFFEDMALPDLAKRHLAKIAEVRKVRAGYSIDGTPSNLSI
FT                   LRTMRSSIGRRIALSSPYQKRLRELEDAYNEALEKEGPYADSALELMKEMRHLRACIDR
FT                   VPFIEKLDLRYNNRVLKKRPQAQAVMFCLMDVSGSMDESRKDLAKRFFMLLYLFLKRNY
FT                   ERIDVVFIRHHTVAKEVEEEDFFHSRESGGTVVSSALKLMVEVIHDRYPPSQWNIYCAQ
FT                   ASDGDNWAGDSELCGRLLRESILPLVQYYAYVEVASEEPQNLWEEYLTVKGQFEHFAMQ
FT                   RIISPDEIYPVLHDLFQKRAA"
FT   gene            107628..109181
FT                   /locus_tag="Reut_B3555"
FT   CDS_pept        107628..109181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3555"
FT                   /product="SpoVR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3555"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62913"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62913.1"
FT                   /translation="MAYLSTGSEWTFELINRYDREIARIAGEFGLDTYPNQIEIITAEQ
FT                   MLDAYASAGLPVGYSHWSYGKHFLASERSYQRGHMGLAYEIVINSNPCIAYLMEENTLP
FT                   MQALTIAHACYGHNSFFKGNYLFRAWTNADAIIDYLLFAKNYVAECEQRYGEQEVELLL
FT                   DSCHALQNYGVDRYKRPKKLSITEEQARQTERENYLQMQVNDLWRTLPKHRSHALAADD
FT                   DAVEPEGTFPPEPQENLLYFIEKNAPKLAPWQREIVRIVRKIAQYFYPQRQTKVMNEGW
FT                   ATFWHYTIIHQLYEEKLVNDAFMLELLQAHTNVIYQPPYHSPYYSGLNPYTLGFLMFQD
FT                   LRRMCENPDDEDRYWAPEIAGSDWRTTLDFAMRNFKDESFLLQFLSPRVIRELKLFSVL
FT                   DDDRENKLRVTAIHNDEGYRMIRQLLASQYDLSGMEPNIQVTNVDVGGDRSLTLRHQQS
FT                   DRRPLSHNFDEVIRHVTRLWGFNVRLEVAYEDGRRELKYECKPERRHRKVPGGGLSLAA
FT                   "
FT   gene            complement(109244..110236)
FT                   /locus_tag="Reut_B3556"
FT   CDS_pept        complement(109244..110236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3556"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3556"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62914"
FT                   /db_xref="GOA:Q46VC0"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62914.1"
FT                   /translation="MHNTYSDALDALLRDLCQPATVRAIEQGADTAPLWQALLESGFAD
FT                   CLLPESADGAGLSLSDVAPVLYVLGRHAMPLPLAQTLFARALLHAHGVQAPAEPIALAS
FT                   FDDESPATLVADARHAGWFLVQTGTRCVLLPASTAGAEPTGAHADLTVRLRRPDIQAEQ
FT                   AFELPAGTLRTIGACLHAAQMAGALSQVMDMTLQYANDRLQFGRAIGKFQAIQHQISEM
FT                   AEHVAASRLAAQIACEGSGSTPDPARAAIGKLRASDAVTPVAAIAHAVHGAIGITEEFD
FT                   LQLYTRRLHAWRVADGSDRWWSRVLGELVCAEPSRGAVELVRDWCETAG"
FT   gene            complement(110263..111423)
FT                   /locus_tag="Reut_B3557"
FT   CDS_pept        complement(110263..111423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3557"
FT                   /product="Acyl-CoA dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3557"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62915"
FT                   /db_xref="GOA:Q46VB9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62915.1"
FT                   /translation="MTALLSTFQLTSLPPHAMAFREQVRAFLAEQMPKLPPEVRARSWM
FT                   GFDAAFSRALAARGWVGITLPAGYGGAGLDPFSRFVLVEELLAAGAPVSAHWIADRQSG
FT                   PLILRYGNAAQKAKYLAAICRGEAFFCIGMSEPNSGSDLASVATRAVRQADGTWLLNGR
FT                   KIWTTNANHCHYMIALVRTSGTPQDRQTGLSQVIVDLSAPGVTVRPIQDLTGDAHFSEV
FT                   SFEDVVLAPDALVGQEGSGWEQVNAELAFERSGPERLYSSVVLLDTWLAALRRLPEARR
FT                   DTVTAGRLVGHLAVLRSMSLAVTARLAAGESPVVEAALVKDLGTTFEQSIPALVEAALG
FT                   DEPALAADGALYRTLAYVTQIAPSYSLRGGTREILRGMIARGLGLR"
FT   gene            complement(111444..112427)
FT                   /locus_tag="Reut_B3558"
FT   CDS_pept        complement(111444..112427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3558"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3558"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62916"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62916.1"
FT                   /translation="MKAKTLMKTMAALVPALLASATALAQDGAGFPAHPIRLVVPFPPG
FT                   GPTDLVSRVIAKRMTDELGQQVLVDNRPGANGNIAAEIVAKAPADGYTVLYNTSSIALS
FT                   PALYSKLTYDVRRDFAPVVLTAMVPLVLEVNAQLPVQNVKEFIQYAKAHPDKLTYGSAG
FT                   NGNVTHLAAFLFLQANGLNAVHAPYKGSAPALTDLAGGQVQFMTDTINSSLPFIRDKRM
FT                   RALAVTSSTRSSQLPDVPTVAETVMPGFEVGAWQGMMVPAKTPPEIVRKLNAATMKALA
FT                   NPETRSALAAQGAEPRGSTPEAYASYLSAEMTRWRKVVKDSGATLD"
FT   gene            complement(112491..112958)
FT                   /locus_tag="Reut_B3559"
FT   CDS_pept        complement(112491..112958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3559"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62917"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62917.1"
FT                   /translation="MTKSDLPRLGQGFYWQDLKEGQAFRTFRRTVTETDLVNFISVTGM
FT                   VEAIFIEDGYDGGAIGGRPVPGALTYTLIEGFILQTMIQGTGLAMLELTQQILAPVVVG
FT                   DTVWATVTVTGIRPTSRSGRAVVDSAIEVFNQRNEKVMTYTARRLLAGRAD"
FT   gene            complement(112955..114178)
FT                   /locus_tag="Reut_B3560"
FT   CDS_pept        complement(112955..114178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3560"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3560"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62918"
FT                   /db_xref="GOA:Q46VB6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62918.1"
FT                   /translation="MLPLAGIRVIDLSTVVMGPYASQWLADLGAEVIKVEPPEGDSTRR
FT                   TGPAAEAGMAAIFLGVNRSKKSIVLDLKQPAAQEALDRLLSGADVLMHSMRPQKLAALG
FT                   LAPANVKARHPQLVYVSLLGFAEEGPYGGRPAYDDIIQGLAGNAALMAAQTGSSRYFPT
FT                   IAADKTSGLVAALSICAALAGRARGDGQGTMVEVPMFESMVAFNLVEHFYGRHFEPPRG
FT                   GTGYPRVLAPLRRPYQSADGHVCMMPYTDAHWRDFFRAAGRPELAADARFTDISARTAN
FT                   IETLYEITGEIVGGHSTAHWLELCESLQIPVARINELDDLPDDPHLRATGFFEPVEDAA
FT                   MGTLRFPGAPVRFDGTRAPIGVPPRLGEHSAELLAQAGLTQQDIDGLYATGAARGTSGS
FT                   KNDTKETA"
FT   gene            114281..115174
FT                   /locus_tag="Reut_B3561"
FT   CDS_pept        114281..115174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3561"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3561"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62919"
FT                   /db_xref="GOA:Q46VB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62919.1"
FT                   /translation="MDLRQLQQFVALAETGNFHRAAERLHMAQPPLSISIRKLEEQLGT
FT                   ALFVRTPRGVRLTQAGEAALQDARRALFHAGQARAAAMAAAQGERGALRIGFVGSATYA
FT                   LLPKLIPAFRAAHPGIELVLHESTTANILDQLEKHRLDAGLVRFPILSSGGYTLTPLES
FT                   DVFVAAVPADSPHAKEESIPLKALAAEPFIMHPAAAVPNLHAVSMMLCQQAGFVPRVAQ
FT                   EAVQVQTIISLVESGLGVALVPSVATRYANRRVRFLPLSSPRPAGRIGIAFAARADDAD
FT                   RQVERFLGAALEAVGG"
FT   gene            complement(115250..116431)
FT                   /locus_tag="Reut_B3562"
FT   CDS_pept        complement(115250..116431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3562"
FT                   /product="regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3562"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62920"
FT                   /db_xref="GOA:Q46VB4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62920.1"
FT                   /translation="MGEHPTTDDDFHRLVDCIYESAMDVAAMPAALDLFSRYTATGSPR
FT                   YLIWDKLSGHARLGVTPHGCFTSGVSLPDGVIPPSDPGQPSYAGPALAIAGDAEPMADS
FT                   VATAVAVSRDGDELEQGIRLIDTAEICVLMSGTSTGHSHVSRSVRERRLAHVMPHWARA
FT                   ARLQQRNFELSGLASLGLAGLDTLDFGVMVLQADMRVRYANSWAEALVQADSNLSLEQG
FT                   LLHARDPSLQSVLHGLLEGAVRGRGADAASGSWMHITSGGQPVPIIVVPLVSRQPVEGP
FT                   WQLPAAMMLLGNSESRSVLDAAVLTSLFGLSRKESIIAIRLAAGETLNEIAEREFLSPH
FT                   TVRVHIRDTLRKTGTHRQSELVRLLHLLPGVNLVRAGAISAARPKGGRQGKSR"
FT   gene            complement(116826..119114)
FT                   /locus_tag="Reut_B3563"
FT   CDS_pept        complement(116826..119114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3563"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3563"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62921"
FT                   /db_xref="GOA:Q46VB3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62921.1"
FT                   /translation="MRPFTPDARSLLLAALLLPLILILVPGRAVHAAPANPLAAAIRQA
FT                   DAQNAPASAPLAQSLDQVIVTLQDDTQRKALLEQLQALRSGLNASASAPVAAASSPGLI
FT                   GAVAQALDEVDTHLRKDHGPWHYWRWRSQFAAEEWRDGATLQGTRSGLVSLREFAAVIG
FT                   GWALCGWLLWEIGHRIRVRRRIRAETTVALVRKPRAGLPDVPSWMDVGIYMLRRIGPWI
FT                   AAFGLTVLLAYRHYSQSPASMAAVMVAHAIVAGAIASAVCQVIFALFRTAHRRTAVRQL
FT                   LVHSPWLLFCTGALAALGNSATDPRITTTLGTNLSALISTGANVAAAILIGVFALRFRR
FT                   QVGQLIAQRPLEFRQSHPAMTDLLRLAGQAWHLPVLAVVVASVIGTVLAAGHADVFLRR
FT                   TVASVSLFVVALLLTLIAGRSPKAKVRAPRIRDRRRSAYLERFGRFAMALVRVVIWISV
FT                   IELGTRIWGTSVLHLVEASPAGRHIAESVLSVTATVLLAWLVWLLIDTAITQALSPTYG
FT                   RAAQPSMRAKTILPLVRNASFVALLVIAMMVVLANLGVNVTPLLAGAGVVGLAIGFGAQ
FT                   SLVQDLITGLFIVIEDSIAIGDSIELPDHAGVVEGMTIRTVKLRDGKGALHTLPYSQIK
FT                   AVKNLSRGYGYAVFNIGIAYQSDLDRALELIRTTGAQIAHDHRYSHKLLSGLDILGLDR
FT                   FDPSGPVVLAQFKTRPLMQAEITRAFNALLKRQFDTNGIRMASPSLTIQLDGGTAGAAS
FT                   VEAVMPRTE"
FT   gene            119397..120182
FT                   /locus_tag="Reut_B3564"
FT   CDS_pept        119397..120182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3564"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3564"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62922"
FT                   /db_xref="GOA:Q46VB2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62922.1"
FT                   /translation="MELNASVSAIVTGGASGLGAATARALAAHGVRVALFDLNVEKGEA
FT                   LARELGGVFCQVNVTSEAEVEAGFAKARAAIGQERILVNCAGTGNAIKTASRSKEDPSQ
FT                   IKFFPTDAFERIVQINLIGTFRCIARSAAGMLTLDHTASGDRGVIISTASVAAQDGQIG
FT                   QASYSASKAGVVGMTLPIARDLSGEGIRVNTILPGIFNTPLLQGAPENVKAALGASVPF
FT                   PKRLGQPQEFASLAVEMCRNGYFNGESVRLDGAIRMAPR"
FT   gene            120264..121844
FT                   /locus_tag="Reut_B3565"
FT   CDS_pept        120264..121844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3565"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3565"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62923"
FT                   /db_xref="GOA:Q46VB1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62923.1"
FT                   /translation="MDFSYLATLPHAVRHFAGLRPDAVAYAFEGRQTSYAEFERNTSRV
FT                   AQALLAAGVRAGDRIGYIGKNCDHYFEAWLGAAKMGAVMTPASWRLAGPEVEFIIGHCD
FT                   AVMLFVGPESTAMVQGLLPALPMVRQVIAMEAGGSQDWPVYTDWRDAHPATLPDHQPDA
FT                   HDVVLQLYTSGTTGRPKGAMLTHRNLTIGTEVSERESIPWSHWTADDISLVAMPVAHIG
FT                   GSGWGLRNLLSGAKGVVAREFDPRAVLDFIEYERISKLFMVPAAMQIVLRDPRARSVDY
FT                   SRLKYLLYGAAPIPAALLREGIEVFGCGFVQQYGMTETTGTVVALPPEDHTTEEVPRMR
FT                   AAGKPLPGVELKVVDYEGRELAPGEVGEVVVRSAHNMSGYWKQPEETARTIDADGWLRT
FT                   GDAGYLDAEGYLYIHDRVKDMIISGGENVYPAEVESAIYGHPIVADVAVIGVPDEKWGE
FT                   AVKAIVVLKAGQAADRESIVAWTRQRLAGFKVPKSIDFVDALPRNPSGKLLRRKLREPF
FT                   WDGMGRQVN"
FT   gene            complement(121923..122915)
FT                   /locus_tag="Reut_B3566"
FT   CDS_pept        complement(121923..122915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3566"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3566"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62924"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62924.1"
FT                   /translation="MKSARRKVLATVIAAGAAAMFAGVPALAQGEYPNKPITIVVAYPA
FT                   GGDVDVLARMFAEKLAPRLKQSVVVENRTGAAGTIGSAYVSRANPDGYTLLLAPNTVAI
FT                   APLVLKPGTGASYDVQRDFTPISQIGTQSLFVVVNKGTGITKVSDLVARVKAGKVETYA
FT                   TPGNGSPMHIMGELFNKSAGVKINQVPYRGLAPAIVDVLGGQVPVTFVTYGAVSQYVGN
FT                   GTLVPIGVADSKRSPFAPNVPTLAEQGYKDVEIGAWQALLGPKGMPPELVRTLNGHVNE
FT                   ILKMPDVVSRMATIAVTPSGGEPAVLQKLLAADTARYTKIVKEFGIQAD"
FT   gene            complement(123095..124186)
FT                   /locus_tag="Reut_B3567"
FT   CDS_pept        complement(123095..124186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3567"
FT                   /product="Porin, Gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3567"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62925"
FT                   /db_xref="GOA:Q46VA9"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62925.1"
FT                   /translation="MKLARIAAGLLAASPLLASAQSVTLYGVVDTGVEYVSNVGANGYG
FT                   LTRVPNNTATVPSRWGLRGTEDLGGGLKSIFVLESGFAPDTGSANQGGRLFGRQALVGL
FT                   SNQYGQLSFGRQYTMLFWATLDSDILGPNVYGSGSLDSYLPNTRADNAVSYKGTFGGFT
FT                   VGATYSFGRDAVNAGPSPAGTNCAGENPADKKACREWSAMVQYATNWWGVHTAYDSQRG
FT                   GPGAFGGLTNSNLTDDRLSVGGYMILSRTKLGAGWLRRDNEGSATRISDLYYAGASYDI
FT                   TPAINLAGQVYYLNYHGSDNKAWLYALRGTYAFSKRTSVYATAGFIDNGGQLAASVSGG
FT                   SPGSNPKPGANQFGTMLGIKHIF"
FT   gene            124691..125581
FT                   /locus_tag="Reut_B3568"
FT   CDS_pept        124691..125581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3568"
FT                   /product="Alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3568"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62926"
FT                   /db_xref="GOA:Q46VA8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62926.1"
FT                   /translation="MEQNDYQEGCPPSQAMLAALDSGFAQRVVQIGGGAQVSYRSGGNV
FT                   GPVIVLLHGISSGAPSWLPCASLLAAHARVLAWDAPGYGDSTPLAQAEPKAADYAQRLR
FT                   EWLRTLGVRPDLIVGHSLGALMAAAYVAEADEAGLPAQLLLLSVAQGYGAPGKEDKSRE
FT                   VARQRLDALASLGVEGLAERGPGRLLSGGADAGAQAWVRWNMRRLRADGYRQAVAMLCG
FT                   DDIDAYLARRPASVPARIGCGSQDIVTTPVACGMLAERFNLPFDPVPDAGHACYIDQAA
FT                   ATARLIRSALPAANR"
FT   gene            125752..126099
FT                   /locus_tag="Reut_B3569"
FT   CDS_pept        125752..126099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3569"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62927"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62927.1"
FT                   /translation="MKPVPTQAEMEQSAMDSLSYNPNLVPWERPAPNNVAGKGHIEQPG
FT                   KVANIIWQTRADAPSAYENKLGDALEAAFEGGAQTPADIVRAFNATDFLCLDGQVWTEE
FT                   RFLAELRRLGA"
FT   gene            126148..127215
FT                   /locus_tag="Reut_B3570"
FT   CDS_pept        126148..127215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3570"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3570"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62928"
FT                   /db_xref="GOA:Q46VA6"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62928.1"
FT                   /translation="MESNKQARAEARLNSGLRNYWYPVAASWAVTHAPIGITRLSQNIV
FT                   LWRDNAGQVHALEDRCPHRGARLSMGWNLGDRVACWYHGVEVGGDGQVKSVPAVDSCPL
FT                   EGRTCVRSYPVQEQAGAIFLWFGDQAPQEGEGSPDALRLPEELVSEEHSHFLCVAHWDC
FT                   NYRYAIDNVMDPMHGAYLHAVSHSMACGEKSATMQIRETDHGLIFEKVGQRGVNFDWVE
FT                   FGETGTLWLRLAIPYRDKVGPGGPFGIVGMATPVDEDHCMVFFWRTRHVQGWQRDAWRF
FT                   LYRNRLEQLHWDVLEQDRVVLESMAPQARDHEMLYQHDAGITRVRRLLKRRAEQEIADE
FT                   PVAMLKAAGGVANHA"
FT   gene            127208..127978
FT                   /locus_tag="Reut_B3571"
FT   CDS_pept        127208..127978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3571"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3571"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62929"
FT                   /db_xref="GOA:Q46VA5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62929.1"
FT                   /translation="MPEANNNGLLAGRKVLVTGAARGLGLAFVKSLTEAGAAVAMADIL
FT                   ADRLQQEADALRARGFKVVAVPVDLSDPASVQACADAAIKGLGGLDGLVNNAAVTDSGG
FT                   RDASAIDVATWDRVMNVNVRGTWLMTTACLPALKASGRGAVINLASDTPLWGAPNLLAY
FT                   VASKSAIIGMTRSLARELGRDQITVNAVAPGLTLVEATEYVPQHRHDLYREQRAIQREQ
FT                   LPDDVCGAVLFALSDLARFVTGQTLAVNGGFVMH"
FT   gene            128019..128555
FT                   /locus_tag="Reut_B3572"
FT   CDS_pept        128019..128555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3572"
FT                   /product="Cupin region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3572"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62930"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62930.1"
FT                   /translation="MSDLSQPANIKRSWEQPDGASFDQWMESRVARFSTRKYDWDALKF
FT                   QADYDPKYRRAQMRYLGTGGTGVAADTNTVPSENFTFSTMIIPAGHEGPMHIHTDVEEV
FT                   FFVMRGKIKLILEKDGERFETILTDRDLVSVPPGVYREEINIGDEDALMCVMLGAKKPI
FT                   TPTYPPEHPLSKIKR"
FT   gene            128602..129459
FT                   /locus_tag="Reut_B3573"
FT   CDS_pept        128602..129459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3573"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3573"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62931"
FT                   /db_xref="GOA:Q46VA3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62931.1"
FT                   /translation="MTALQPATATQSTAEFPDKYIVPGLERGLRLLGEFNSKDRAISAA
FT                   ELARRLQVPRSTVFRLLTTLEMLGFVERAEGGRDFRLGMAVLRLGFEYLASLELTELGR
FT                   PLLERLRDEIGYPCNLVVRDGRSIVYVAKAVSPRPFASTVNVGTRLPAHATVLGRVLLE
FT                   DLSLDELRALYPEPRLEAFSERTPASVDALYELVQHDRERGYVLHEGFFESSISTIAAP
FT                   VRDRTRKVVAALGATIPAAHIDPAQLDSMVEKVRETAGELSRLLDYRPALKSSGGKVVN
FT                   LYRE"
FT   gene            129465..130268
FT                   /locus_tag="Reut_B3574"
FT   CDS_pept        129465..130268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3574"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3574"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62932"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62932.1"
FT                   /translation="MSMIELDGKVAVVTGGSSGIGLATVELLLEAGAAVAMCGRDESRL
FT                   RSAEAQLRQRFPNCRLYAATCDVLKPEQVAAFAANVQSTLGNVDMLVNNAGQGRVSTFA
FT                   NTEDAAWMEELQLKFFSVIHPTRAFLPQLEQSGQGAIVCVNSLLAQQPEPHMVATSAAR
FT                   AGVLNLVRSMATEFAPKGVRVNGILIGLVESGQWRRRFDARPEEDRNLDWAAWTARLAQ
FT                   QKHIPLGRLGLPVEAARAILFLASPLSSYTTGSHIDISGGHSRHA"
FT   gene            130261..131967
FT                   /locus_tag="Reut_B3575"
FT   CDS_pept        130261..131967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3575"
FT                   /product="Thiamine pyrophosphate enzyme, C-terminal
FT                   TPP-binding:Thiamine pyrophosphate enzyme, central
FT                   region:Thiamine pyrophosphate enzyme, N-terminal TPP
FT                   binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3575"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62933"
FT                   /db_xref="GOA:Q46VA1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62933.1"
FT                   /translation="MPNQQQYEQQQVTVGCAITAFLEQCGVKAAFGVISIHNMPILDAM
FT                   GERGHIRFVPARGEAGGTNMADACARTTGGLGVCLTSTGTAAGNAAGAMVEALTAGTPM
FT                   LHITGQIETPYLDQSLAYIHEAPDQLTMLKAVSKAAFRVRSADTAISTIKLAVQTALTA
FT                   PTGPVSVEIPIDIQAALIDMPVDLKPLPVPQHQPSAHAIDALAERLANAKRPMLWLGGG
FT                   ARHASKQVKRLLDLGFGVVTSTQGRGIVAEDDPRSLGAYNLHKPVEQFYQSCDAMLVVG
FT                   SRLRGNETLKYELKLPRPLLRIDADPASEGRCYQSDYFVSGDAALALDALADRLEGRMQ
FT                   IDPTFADDLRRAHDTAVNALIDGLGPYSALVQALQQAVGRNFNWVRDVTVSNSTWGNRH
FT                   LQIFDSRAGVHALGGGIGQGLAMGIGAAVGAAATASGKKTFTLAGDGGFILNLGELATA
FT                   VQERADMVIVLMNDKGYGVIKNIQDAQYGGRRHYVDLHTPDYAQLCQSLSLRHRRVSSL
FT                   DDIGAALQEATAETGPFLLEIDMLSIGSFKTVFAGPPVNKQAPIAAPATTA"
FT   gene            131980..132786
FT                   /locus_tag="Reut_B3576"
FT   CDS_pept        131980..132786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3576"
FT                   /product="Aspartate dehydrogenase:Homoserine dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3576"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62934"
FT                   /db_xref="GOA:Q46VA0"
FT                   /db_xref="InterPro:IPR002811"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011182"
FT                   /db_xref="InterPro:IPR020626"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46VA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62934.1"
FT                   /translation="MSMLHVSMVGCGAIGRGVLELLKADPDVAFDVVIVPEGQMDEARS
FT                   ALSALAPNVRVATGLDGQRPDLLVECAGHQALEEHIVPALERGIPCMVVSVGALSEPGL
FT                   VERLEAAARRGNTQVQLLSGAIGAIDALAAARVGGLDEVIYTGRKPARAWTGTPAAELF
FT                   DLEALTEPTVIFEGTARDAARLYPKNANVAATVSLAGLGLDRTSVRLLADPNAVENVHH
FT                   IEARGAFGGFELTMRGKPLAANPKTSALTVFSVVRALGNRAHAVSI"
FT   gene            132850..134325
FT                   /locus_tag="Reut_B3577"
FT   CDS_pept        132850..134325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3577"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3577"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62935"
FT                   /db_xref="GOA:Q46V99"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62935.1"
FT                   /translation="MKTQEVLPICIAGEWRLGTGDRYATRYPATGEVVAELNAASLADV
FT                   EEAVQGAQRAFETSGWARRKPHERAAVLYRVAELIRAQAEPLAQRQRLDNGKPISETRA
FT                   LVASAASTFQFFAAACETLEEQITPQRGECLTMSVYEPMGVVAAITPWNSPIASEAQKM
FT                   APALAAGNAVVVKPAEVTPLMALELARICDEAGVPKGLISVLPGKGSVIGDAITKHPLV
FT                   RRVSFTGGTTTGKHIAHIAADKMMPVSLELGGKSPTMVFDDADLDHAVNGVLYGIFSSS
FT                   GESCIAGSRLFVARSQYEPFIERLAAGAAHLRVGDPADERTQMGPLITDRHRDSIESYV
FT                   AMGVQDGGQLRTGGLRPDVAGLPNGYFYTPTIIEGLDNHARIAQEEIFGPVLVAIPFDD
FT                   EDDLIEQANDSVYALAAGIWTRDYKRAWRVARAVQAGNVWINTYKQFSISAPFGGWRDS
FT                   GLGREKGRLGILQYMEQKSVYWGLNEQPLPWAN"
FT   gene            134348..135322
FT                   /locus_tag="Reut_B3578"
FT   CDS_pept        134348..135322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3578"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3578"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62936"
FT                   /db_xref="GOA:Q46V98"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62936.1"
FT                   /translation="MIKVLGIDEIVYGADDFDACRGFFSDWGLTIKRDDAQGLDFETLN
FT                   GCRVLVRRIDDATLPPAIEAGPTLREVVWGVETQASLDHIADAIADAPGFVKLGEGDTL
FT                   RIGCTDPNGLAVRFQVTRKHEVQVECALMNTWNDKPRLNQRSPIYERAVPIEVGHVVFF
FT                   VKDVKATERFYVEKFGFVPSDRYPDRGAFLRCAAEGGHHDLFLLQLPEPKAGINHVAFT
FT                   VRDLHEVFGGGMHMSRKGWDTQLGPGRHPISSAYFWYFKNPAGGLIEYYADEDQLDEHW
FT                   EPRAFEPGPTMFAEWAIEGGIDGNTRRQKNAGGPAGKFLTEKR"
FT   gene            135407..136363
FT                   /locus_tag="Reut_B3579"
FT   CDS_pept        135407..136363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3579"
FT                   /product="Ferredoxin:Oxidoreductase
FT                   FAD/NAD(P)-binding:Oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3579"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62937"
FT                   /db_xref="GOA:Q46V97"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62937.1"
FT                   /translation="MSAHKTLTMRVQAMRYEARGIVSLELQDPDGATLPEYGPGAHIDL
FT                   HLGNGLVRSYSLCGAPEVRDRYTVGVLQDRNSRGGSRYVHEQLRVGATLNVSAPRNNFE
FT                   LDESAAHTVLVAGGIGVTPIVCMARRLAELGRSFTLLYCARTRAEAAFVDSLSAYGDAV
FT                   RFHFDDEAGAPPDMKAMLAGQDAQTHLYCCGPGPMLNAFEAACEAHGYPNVHIERFAAD
FT                   PSTESVQEGEYVVQLSRTGSLVKVPSGKSLLDALLEAGLDVEHSCREGVCGSCETAVLE
FT                   GCPDHRDSVLSNSERASNKTMMVCVSGCKGSRLVLDL"
FT   gene            136534..137970
FT                   /locus_tag="Reut_B3580"
FT   CDS_pept        136534..137970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3580"
FT                   /product="General substrate transporter:Protein of unknown
FT                   function DUF1228:Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3580"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62938"
FT                   /db_xref="GOA:Q46V96"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62938.1"
FT                   /translation="MAASASIVTTAEGAAGFADSRSTSAAGSAGGVTRGNIIARIERMP
FT                   GNAMHIRARLLIGLATFFDGFDVIAIAATLPLLIAKWSLTPGQIGFLIAAPSVGQLVGA
FT                   LVFPALAERFGRLRSIGWSAGIIGLMSIACGFAPSFEIFAVLRIVQGLGLGGELPVAAT
FT                   YINEVTRAHGRGRFVLLYEVVFPIGLMVSNGVGAWLVPHYGWEVMYFLGGVPLVLFFIL
FT                   RRVVPESPRWLAEKGRMEEADSALRAFEARARTPLPPVGDTSAFDAMTHHPRRRVRDLV
FT                   SKAYIGRTLAVWMLWATCGFIQYGLSTWLPTVYKTVYHAPLQLALNLAAGASVLGVVGS
FT                   LVCAMIVDKVGRKPVINVSFLLCALSLVLAGVFHASNVYVVATLCALAMGFLASGFITA
FT                   YVYTPELYPTSVRAMGCGLGGAWLKLAAIFAPSLIASTIGSGDLSGAFLSLAAVPFLAA
FT                   ITVHFLGIETKGQVLEELEV"
FT   gene            complement(138234..139490)
FT                   /locus_tag="Reut_B3581"
FT   CDS_pept        complement(138234..139490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3581"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3581"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62939"
FT                   /db_xref="GOA:Q46V95"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62939.1"
FT                   /translation="MPHRLTMRIAMNENTHLVCAGRHPERFGGVVNTPIFRASTILAGS
FT                   MAEWEEMKRARAAEEPGATTYGRYGTPTTQALEEAVAGLEGGYRSLVFPSGLAAVSTAL
FT                   TALLSAGDHVLVTDSAYSPTRAFLERVLARFGVEVETYDPVGGTPIEALLRANTRVVYV
FT                   ESPGSETFDIQDIPAIAAAAHRHGAYVVMDNTWGTPLYFKPFAHGVDVSVQAATKYIVG
FT                   HSDAMLGVVTCNRETWPLIKQTTHDMGQTAGPDDIYLALRGLRTLAVRLQRHWQSGLRV
FT                   AQWLELQPQVEAVLHPALPSHPGHALWKRDFTGACGLFSVVLRTNSKASLAAFIDALEH
FT                   FGLGVSWGGYESLVIPFTPGMGRTGHRWPHQGQAVRLHVGLEDTEDLIDDLRRGLLALS
FT                   ACDSEAENEKSGSGEICHS"
FT   gene            complement(139541..140557)
FT                   /locus_tag="Reut_B3582"
FT   CDS_pept        complement(139541..140557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3582"
FT                   /product="D-cysteine desulfhydrase"
FT                   /EC_number="4.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3582"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62940"
FT                   /db_xref="GOA:Q46V94"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62940.1"
FT                   /translation="MKKISDRIASFSRLQLVGAVTPLEKLDRLSRMLGRDVYIKRDDTT
FT                   PLAFGGNKLRKLEFLAADALSKGADTLVTAGAIQSNHVRQTAAVAARLGLRCHALLENP
FT                   INTTDVDYLRSGNRLLLDLFDAHGEPVATLDNADAQLQALAERLRGDGYQPYIIPIGGS
FT                   NPLGALGYVHAGLEMAQQADAMGVSFAAVVLASGSAGTHGGLALALAHAMPDAQVVGIT
FT                   VSRPVEAQAPKVAGLIDGTAELLDIEVPAELRLELWDEYFLPRYGEPNRAALDAIRLLA
FT                   RTEGVLLDPVYTGKAMAGLLDGVMRKRFAGEGPLLFLHTGGAPALFAYRDALPAVLI"
FT   gene            complement(140653..141378)
FT                   /locus_tag="Reut_B3583"
FT   CDS_pept        complement(140653..141378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3583"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3583"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62941"
FT                   /db_xref="GOA:Q46V93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62941.1"
FT                   /translation="MIALEGVSKWYGQFKVLDACSTRVEKGEVVVICGPSGSGKSTLIK
FT                   TVNGLESFQQGVISVDGVSVGDPKINLAQLRSRVGMVFQHFELFPHLSILDNLSLAQVK
FT                   VLKRGKDEAREKGLKLLERVGLKAHAAKFPAQLSGGQQQRVAIARALSMDPVAMLFDEP
FT                   TSALDPEMINEVLDVMTGLAREGMTMICVTHEMGFAKKVANRVIFMDSGSIIEDTGKDA
FT                   FFGDPKSARAKEFLAKILH"
FT   gene            complement(141433..142104)
FT                   /locus_tag="Reut_B3584"
FT   CDS_pept        complement(141433..142104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3584"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3584"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62942"
FT                   /db_xref="GOA:Q46V92"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62942.1"
FT                   /translation="MDRIMSPFDLIIHASPVLLQGAAITVKFALASMIFGLLVGIVVAI
FT                   MGISASPVLSGIARAYVSVMRGTPLLVQMFVVYYGLPDLGINLEPTTAGILTLTANAGA
FT                   YLSESMRGAILGISRGQWSAAHSLGLSHLQTLRYIVCPQALRLAVPSLGNTLISLIKDT
FT                   SLVSVITVTELLRSSQEIIASTFQPLPLYLSVAAIYWLLSTGLSWVQRRIEARLTLRVT
FT                   R"
FT   gene            complement(142178..142978)
FT                   /locus_tag="Reut_B3585"
FT   CDS_pept        complement(142178..142978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3585"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3585"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62943"
FT                   /db_xref="GOA:Q46V91"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62943.1"
FT                   /translation="MKLLQSLLQSALLATVLGFTAPAVHAEDLLDTVKASGVLKVGMEG
FT                   TYPPFGYRNGQGQLDGFDVAVARAVADKMGLKVQFITTEWSGIIAGLQAGKFDVIVNQV
FT                   SMTPARKQALDFTQPYVYSAVQVLQRSNDKREFGSLDALKGKSVGVTLGSNYADLAKSV
FT                   PGIQVQTYPGTSENLRDLAAGRIDAALNDRLMLPYLIKNANLPLRTGALLAGTKLEMGI
FT                   PYRKGNPKFAKAIDDALIALQQDGTLRKLSIEWLGTDASQPLAQ"
FT   gene            complement(143420..143767)
FT                   /locus_tag="Reut_B3586"
FT   CDS_pept        complement(143420..143767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3586"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62944"
FT                   /db_xref="InterPro:IPR021439"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62944.1"
FT                   /translation="MKDKLLMLRPGFFQGSEGPFYCGDAIAVEGLLSFFPQLRSEIDVE
FT                   YIDAPRPRQAIVELIGEANQSAPVLVLGAGRTPVDDSVEIRMHGQTQFIDSPDHIRRYL
FT                   SSQYGVARPAS"
FT   gene            144066..145055
FT                   /locus_tag="Reut_B3587"
FT   CDS_pept        144066..145055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3587"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3587"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62945"
FT                   /db_xref="GOA:Q46V89"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62945.1"
FT                   /translation="MSKNKTQTRANGGLVAVVVYDGLSLFEYGCAVEVFGLPRPEMGDE
FT                   WYRFATCSAEPGTLRGVGGIQVQADGGLELLSKAKTIIVPGWRSIDAVVPPELCRALQK
FT                   ANKRGARVMSICTGAFVLAAAGLLDGKRATTHWRHATALAERYPEIRVEADVLYVDAGD
FT                   VLTSAGSAAGIDLCLHLIRRDFGPRAANQVARRLVMPPHREGGQAQYIAEPVSKRSSAS
FT                   LAPLLDTVRATLGEDWPIVRMAKQAAMSGRTFQRHFVNMMAMPPGEWLLIERISRARVL
FT                   LEETGLSMDDIAVQVGFGAAATLRNHFRTRLGTSPGYYRRRFSASDEH"
FT   gene            complement(145163..146839)
FT                   /locus_tag="Reut_B3588"
FT   CDS_pept        complement(145163..146839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3588"
FT                   /product="Protein of unknown function DUF442"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3588"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62946"
FT                   /db_xref="GOA:Q46V88"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62946.1"
FT                   /translation="MQPRALTNDLSVSQQIVPDDVHALAAFGFRSLICNRPDGEGPDQP
FT                   NFQEIERKASALGLQAHYLPVESGKVSDEQAQAFGQLLDSLPKPVLAYCRTGTRSATLW
FT                   ALSQSVIRPLPDIIERAAAAGYDLKGVVRRIANGGRTPVDVADASHAVVIIGGGAAGIA
FT                   VASSLLARKPGLDIAIVDPADIHYYQPGWTLVGGGVFEPAHTARTMASVLPRGVAWIKA
FT                   AVAAFEPERNAVILDGCRVVKYEQLIVCPGLKLDWDAIEGLPETLGRNGVTSNYRYDLA
FT                   PYTWNLVRELTRKGGGKALFTQPPMPIKCAGAPQKAMYLSADAWRRAGILDRVDIDFCN
FT                   AGNVLFGVADYVPALMQYVERYGIALNFGETLVKVDGAARRATFRLAADGGDPKLVERE
FT                   FDMLHAVPPQKAPDFIRVSPLADAAGWIDADPATLRHKRFDNVFGLGDAGNMPNAKTAA
FT                   AARKQAPVVAHNVLATRGEATGEARYDGYGSCPLTVERGKIVLAEFTYGGKVAPSFPGW
FT                   LIDGTRPSRLAWWLKERILPPLYWQGMLKGREWLATPELQG"
FT   gene            complement(146867..147763)
FT                   /locus_tag="Reut_B3589"
FT   CDS_pept        complement(146867..147763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3589"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3589"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62947"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62947.1"
FT                   /translation="MTPTMPSPSQMEIEAFFDPDTSTLSYLVLDRATLQCALIDSVLDY
FT                   DPKSGRTRTASADRLVERVQSLHATVQWIVETHVHADHLSAAPYLKRRLGGQTAIGSHI
FT                   TTVQQVFGKLFNSGADFARDGHQFDRLLNDGDTFNIGGLQMRAMHTPGHTPACMTYVVS
FT                   DGNDTAAFVGDTLFMPDYGTARCDFPGGDARTLYRSINKVLSLPQDTRLYMCHDYQPGG
FT                   REMKYMTTVADERENNIHVRNGISEEEFVAMRQARDATLSMPTLILPSVQVNMRAGELP
FT                   PPEDNGVRYLKIPLNAL"
FT   gene            147986..149296
FT                   /locus_tag="Reut_B3590"
FT   CDS_pept        147986..149296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3590"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3590"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62948"
FT                   /db_xref="GOA:Q46V86"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62948.1"
FT                   /translation="MDRKATLQALLSYLEQENQPMIVLDTDYRILAANTAYRRQFGAVD
FT                   RPYLGQHCYRISHGYDVPCDQAGEHCPMRKAFETRGPDRVLHIHHTPRGPEHVNVELRP
FT                   ILDEDQQVVAYVERLSTVRSASARASAEGLVGRSEAFNTALEAVQRVAPSSLPVLLLGE
FT                   SGTGKEMFARAVHEASSRAGGPFVVVDCSGLTEALFESELFGYEKGAFTGAIARKPGLV
FT                   ETADGGTLFLDEMGDVPLSMQVKLLRLIESGTYRRVGSVETRRADFRLVAATHKPLDEM
FT                   VSQGLFRQDLYFRIAAFPIHLPALRERLDDIPLLAESILQRGGGAGDQLHLSAEALARM
FT                   RAYHWPGNIRELRNVLDRARLYADDGVIRAKDLPPGLVETGMAPVTRPGPADGWRTDDE
FT                   ALRERVRQFRGTRRDLAQALGMSERTLYRRLRDLGIR"
FT   gene            149661..150482
FT                   /locus_tag="Reut_B3591"
FT   CDS_pept        149661..150482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3591"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3591"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62949"
FT                   /db_xref="GOA:Q46V85"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62949.1"
FT                   /translation="MQDIVATSAALGAVVGLILALTGAGGAILAVPLLLFVLRLSVAEA
FT                   APVALLAVGLSAAVGAMLGLRAGVVRYRAALLMAVSGTLFSPIGLWFAHRLPNGPLTLL
FT                   FAAVLALVAWRMFRQAAGSKVPQAAEAARSMQPCRLDNQTGRFVWTALCTRALALSGAG
FT                   AGFLSGLLGVGGGFVIVPALKKATNAPLHTIVATSLAVITLVSASGVITTAIAGRMDWQ
FT                   VGVPFAAGAMLAMLGGRLLASRLSGARLQQGFAVVAGLIAIGMVAKVVMAS"
FT   gene            complement(150681..151205)
FT                   /locus_tag="Reut_B3592"
FT   CDS_pept        complement(150681..151205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3592"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3592"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62950"
FT                   /db_xref="GOA:Q46V84"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62950.1"
FT                   /translation="MTRNTGPATGQQAQPPSPADDSPWTDLDEAGNGLTVDNFLTTMLS
FT                   QLITRLRSTVTQPYAEQFGLTVPEWRILALLAHARTLPFSELVVQSTSDKALVSRTLRL
FT                   LEERGLVHLETEGNTPRKKLICSVTDAGIALHDEVMPLARRGQAEVIRQLAPEERRAVY
FT                   LGLRKLLKGQG"
FT   gene            151553..152539
FT                   /locus_tag="Reut_B3593"
FT   CDS_pept        151553..152539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3593"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3593"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62951"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62951.1"
FT                   /translation="MKRDRRLFLAATAMAALALAAGSTAAAAAYPTKTVTMVVAYPPGG
FT                   DTDAMARLYADKLSARLKQPVIVENRPGAAGVVGTSFVSRAPADGYTLLYTPNPFTLAP
FT                   MVLKLAPASSYDPLHGFTPVIQTAVQAVLLVANPAAGVKTVPEMIAAAKAGKNFTYGSP
FT                   GAGSPMHIAGEMLNRAAGVKIQHVPYKGVAPAVNDVVAGHVSFAYVTLGPVAQYINTGK
FT                   LIPLAITDAKRSALLPNVPTLAELGYKDVVVGAWHGVMAPKGTPAEVVKVLNEQLNEVI
FT                   RLPDVTEKMATFGAIPVGGAPSALDKVNASDYERLGRVIRDMGISAE"
FT   gene            152559..154883
FT                   /locus_tag="Reut_B3594"
FT   CDS_pept        152559..154883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3594"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3594"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62952"
FT                   /db_xref="GOA:Q46V82"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62952.1"
FT                   /translation="MQHKTQEAGMSESIVGASTPQVTAREKVMGRAQYAGDIKLPGMLH
FT                   AKVLRSPHPHARIVSIDTAAAKALPGVKLVVTGRDTPTRLWGPHRKEQRILAVGVVLHV
FT                   GEEVAAVVAVSEEIARDALDLIRVAYEELPALLSPEAALADGAPEVHAGTRNIGHEMHI
FT                   ERGDVEAGFAEAAAVYEATYDMHSQYPGYLEPMASVATQDGNGRLTVYASTQSVFLARS
FT                   RLAEALDRPASTIRVVQATTGGGFGAKIVEENNSLICAFLATKLDRPVRMVNNRLEDFQ
FT                   GARASVPAKVWLRIGLSANGMIVAKDVRITAECGAYAGLAGDVMHVSAMRSDNMHRVTN
FT                   VRSHAVLAYTNNPPRGAFRGFGGQQMQFPLNCHLTVLAGMIGMDPIEVHKRNAIGRGET
FT                   SVHGWQIGSTGMQECLEMTRKAIGWDAKREAPRGTGTRRRGVGIAAAMHVSGNRTLGNW
FT                   DGSTILLKLNEDGRVMLQTSECDMGQGANTMLSQICAQEMGIPLSHVTVMAPDTDTSPF
FT                   CLGSLASRVTIISGNAVLRAAREAKQKVMALAAEKFGVDADSLVFADGRISVPGQPDKS
FT                   ATLAEIARLHIFRHGGEGIHVRATYDAPTVMHDANYYGNIAPAYSFAAQAVEVEVDTCT
FT                   GRVTVIDSFVADDCGKAINPLAVHGQTHGATVQAIGWTLYEHLRYEDGRLQNGNFADYT
FT                   MATADALPMLRTDLVESNDPNGPFGAKGASETAILPGAAAIANAVYHAIGVRIHSLPIT
FT                   PEKVLAALREREEMEKESAHA"
FT   gene            154876..155742
FT                   /locus_tag="Reut_B3595"
FT   CDS_pept        154876..155742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3595"
FT                   /product="carbon monoxide dehydrogenase, medium subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3595"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62953"
FT                   /db_xref="GOA:Q46V81"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62953.1"
FT                   /translation="MRDFEFLEPATVGEASRMLADLGDNCRAYAGGTALMLGMRQRMVT
FT                   PSHVVYLGGLDALRGITFDPKQGLRIGALTLHAEVARSPIVQGHYPVLASMASRVANPQ
FT                   VRNQGTIGGNFCYADPATDPPGCLMALGAQIVLSGPGGERVLAIEDFLVDYYVTALTPG
FT                   EIVTEIRLPAPAAGADGRYARFLRTAAEHRPLASVALSVRREGGFCVEARLAVGASTPI
FT                   PARLHRAESLLSGKTVTAELAAEAADIVAADINAVSDMRGTEDFRRHIVRTVARRTIAD
FT                   LFGVAAD"
FT   gene            155752..156228
FT                   /locus_tag="Reut_B3596"
FT   CDS_pept        155752..156228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3596"
FT                   /product="Ferredoxin:(2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3596"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62954"
FT                   /db_xref="GOA:Q46V80"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62954.1"
FT                   /translation="MNKVTIDVTVNGEEHTVEVPARRMLSDLLRDDLNLTGTKRGCETG
FT                   ICGACTVLVDGEAVKSCLMLAAQVRGRHVMTVEGLAADGELHPLQQCFMECGGLQCGYC
FT                   TPGFLMTSCALLANNPNPTEEEVRHGLNGNLCRCTGYVGIVESILSAAEKMRGN"
FT   gene            156218..156982
FT                   /locus_tag="Reut_B3597"
FT   CDS_pept        156218..156982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3597"
FT                   /product="Carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3597"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62955"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62955.1"
FT                   /translation="MEIEKTLVTAVPPARVWELMLDPNVMGACVPGMESIEVISDVEYI
FT                   AHMAVKIAFINARFRLHTKIVETRAPHYLRTEGTGEDASVASSLRQTSEMFLTEQEDGS
FT                   TQLRIKVQVDVLGRLGTFGLSVMKTKADRMWDEFGANLLARLSPQAGQAVAAAVPAATP
FT                   AATAPAAMPAAAPASVAAHNGHAASAPVWNGNGHGGGNGGFLSRLFGRAPVQRGPVSDI
FT                   CVELRRRDETIVVRWPAQHGEQCAAWLRDYLK"
FT   gene            157173..157997
FT                   /locus_tag="Reut_B3598"
FT   CDS_pept        157173..157997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3598"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3598"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62956"
FT                   /db_xref="GOA:Q46V78"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62956.1"
FT                   /translation="MTTESPPEDAQDKYIVPGLERGLRLLGEFSSRERTLSAAELARRL
FT                   KVPRSTVFRLLATLEMMGFVERTDGGREFRLGMAVLRLGFDYLASLELTELGRPLLDRL
FT                   RDEIHYPCNLVVRDGRSIVYVAKSVAPRPFASTVNVGTRLPAHATVLGRVLLEDLSLDE
FT                   LRALYPESHLEVFSDSTPRTVEELYDMVQRDRERGYVLQEGFFEASISTIAAPVRDRTG
FT                   KVVAALGATIPASRIDPDQLDNMVEMVRGAAAELSRLLDYRPPEPPRPFGLG"
FT   gene            158010..159041
FT                   /locus_tag="Reut_B3599"
FT   CDS_pept        158010..159041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3599"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3599"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62957"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62957.1"
FT                   /translation="MQQSNTSPRKKMSVTCTRRRWLTTVATTLLATAGMAMQHAEAACA
FT                   NVRIVVPFPAGGPADQLARTLSHGLQQRHADVPYIVDNKPGANGNIGIDAVRRAAGDGC
FT                   TLLVVPAGNLTINPTLFPALSYQVERDFRPVSLLASSPNVLAVHPSVKANSVQDLIRLA
FT                   RQSAQAGSPMGYASPGVGSGLHLAGELFRHKANVTLMHVPYKGTTQALNDVVGGQVPVL
FT                   LGTWPTLAPFIQSGKLRALAVTQSKRSPAAPDVPSLAEQGVTGIDVSSWYALVVPRATP
FT                   AAAVDSLASEVRALLGTTVVRAELQRQGMEPIASTPDALAARIREETAAWAKLIREYDI
FT                   KAE"
FT   gene            complement(159055..159891)
FT                   /locus_tag="Reut_B3600"
FT   CDS_pept        complement(159055..159891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3600"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3600"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62958"
FT                   /db_xref="GOA:Q46V76"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62958.1"
FT                   /translation="MPKQSPDIDNNADTDDAKDQQLVSPVIRGLRLLRFIAEGGSTANL
FT                   SEVGRRIDVNRVTVMRLLATLEHEGMLERLPQGGHEIGFGFLKLASRVLAANDLTTFAR
FT                   RVLARLSGSLQLSAYLVVRDGGHALYLLRDMPNTSLVSNIQVGSRVAAHLTTPGRMLIA
FT                   DLPPEELRALLGDDPLPTVTGQSPATHARLADILAADRERGCAWSFSAFEAGIDSCAAP
FT                   VRDATGEVIAAISVAGPQQRFETDNTLRERVEREVKAAARDLSALLGDRASSGRQR"
FT   gene            complement(159954..161162)
FT                   /locus_tag="Reut_B3601"
FT   CDS_pept        complement(159954..161162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3601"
FT                   /product="Salicylate 1-monooxygenase"
FT                   /EC_number="1.14.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3601"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62959"
FT                   /db_xref="GOA:Q46V75"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62959.1"
FT                   /translation="MPTAIETRSADGAPPTGRKQADNMTSLKIGINGAGIGGLAAAIAL
FT                   RKLGMDVTVYEQAARFARVGADINLTPNAVRALDGLGVGEALRETAARPTHRISRTWDT
FT                   GEETSRLPMSDEAEQRYGAPQLTMHRADLMTALEGALPAANVKLGHKAVAIERNDNGTT
FT                   VRFADGGEDKVDVLVGADGIHSVVRTALFGQESPIFTGVVAYRAVVPAERLAGVPNLNA
FT                   FTKWWGTDPTSQIVTFPLNRGRDIFIFATVAQESWRNESWTTPGRVEDLRSAYAGFHPE
FT                   ARALLDACDDVLISALYVRDPLPTWSDGHVTLMGDACHPMMPFMAQGAGMAIEDGVVLA
FT                   RCLADAAQDGYAAVPSALARYQRARHERTSRIQIGSRSNAWLKEGGNADWVYDYDAWNV
FT                   ALG"
FT   gene            complement(161411..162031)
FT                   /locus_tag="Reut_B3602"
FT   CDS_pept        complement(161411..162031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3602"
FT                   /product="regulatory protein, LuxR:Response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3602"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62960"
FT                   /db_xref="GOA:Q46V74"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62960.1"
FT                   /translation="MSGNPSIVYVLDDDEIVLWLYRELLQHHGVVLRPFTSPRAFLDSY
FT                   APSPCECLVCDLRMPELCGLGVQNELLSTGDCLPIIFVSGHAEVSSVVEAMRVGAFDFL
FT                   EKPVDGERLVQTVRAALEHSRGLHARRLAMSERRKRLATLTPKEREIAEHVASGKSSRQ
FT                   ISEALNISVRTVENHRARVTEKLCITSVAELVRLLYDLPDPGV"
FT   gene            complement(162810..164045)
FT                   /locus_tag="Reut_B3603"
FT   CDS_pept        complement(162810..164045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3603"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3603"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62961"
FT                   /db_xref="GOA:Q46V73"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62961.1"
FT                   /translation="MHLEFSEQDLQFRDEVRAWIDEAYDAELRAMMAQSKNGYLDKAGQ
FT                   VRWQKALYARGWAAPNWPEAYGGPGWSPTQRHIFQSELAAAGCPPVSPMGLKMVAPVIM
FT                   KYGTDAQKARFLPPILKSDVWWCQGYSEPNSGSDLASLQLRADLATDGDGAHYLLNGSK
FT                   IWTTHAQWADWMFCLVRTSRDARRQEGISFVLVDMRTPGITVAPLPTLDGPVPGQQEVN
FT                   QVFFDNVRVPVENRIGEEGMGWTYAKYLLEFERGGTYGPTLRKQLAKVAAIAADQPGDD
FT                   GKTLLEDAGFRRKLAQLHLRAAGLQAVELKLFSGVESGKSIGAASSMLKLLGTEAMQAI
FT                   SELAVEAAGPAALPFVQDTWAEVQGREAPPRVGPDYAAVLAPRYFNYRKASIYGGSNEI
FT                   QRNIIAKLMLGL"
FT   gene            complement(164089..165234)
FT                   /locus_tag="Reut_B3604"
FT   CDS_pept        complement(164089..165234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3604"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3604"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62962"
FT                   /db_xref="GOA:Q46V72"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62962.1"
FT                   /translation="MDFQFSEEQSMLRDTLARYLADHYDFEARRAAERSEAGWRPDCWR
FT                   AFARELGILGAGFPEALGGLGGGAPEHMIVMEQFGRHLVLEPYLSTVVLGGGALVHGNK
FT                   VLAEQWVPAIIGGEATFGWAHAEPASRYCRHDVQSSATHDSRGYVLSGHKSVVAGAPFA
FT                   THFVVSARTSGKRRDTDGITLFWVPRDTPGVTLREYPTIDGNRAAEVLFDQARVPASHV
FT                   IGTEGQALPLIEQLSDAALVALSAEANGTMARMLADTIDYARQRKQFGVAIGSFQVLQH
FT                   RMADMAMQLEQSLALTQVAAMQAPAPERERALAACAAKAQAGQAGRFIGQAAVQIHGGM
FT                   GVTDELAVGHYFKRVTAIDLQFGSAEHHLGRYADLLYPAAA"
FT   gene            165506..167050
FT                   /locus_tag="Reut_B3605"
FT   CDS_pept        165506..167050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3605"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3605"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62963"
FT                   /db_xref="GOA:Q46V71"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62963.1"
FT                   /translation="MHPYVHAQRTPDKPAVIMGDGTVVTYRELDEHSNQVARLYRDHGL
FT                   QPGDRVAFLIENHPRLFELCWGAQRSGITFICLSTRLNVADAAYIVRDSGAQMLITSRA
FT                   QAEIAAALTEQVPGLKGYLMLNGTLPGYTPYETTLAQYPTWRIDDETTGGDMLYSSGTT
FT                   GRPKGVYAPPASPQIDTPTSLTALCQKLYGFGPDMRYLSPAPLYHAAPLRYNMSVQALG
FT                   GTSIVMDHFDAEQFLRLVQEHRITHTQVVPTMFSRMLKLPAETRGSYDVSSLQVAIHAA
FT                   APCPVQVKEQMIEWWGPVVWEYYAGTEGNGVTVVSSREWVERKGTVGRAMIGKLRICDA
FT                   DGKLMPNKQPGTIYFAEGRQFVYHNDPAKTAESRHPEHAEWSTIGDIGYVDDDGYLYLT
FT                   DRKANMIISGGVNIYPQEAENLLMTHPKVMDVAVIGVPNEDFGEEVKAVVQPASMADAG
FT                   PALAAELIAFCRENLSGIKCPRTVDFEAELPRLPTGKLLKRVLRDRYWAGHANKLV"
FT   gene            167143..169986
FT                   /locus_tag="Reut_B3606"
FT   CDS_pept        167143..169986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3606"
FT                   /product="regulatory protein, LuxR:Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3606"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62964"
FT                   /db_xref="GOA:Q46V70"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62964.1"
FT                   /translation="MPARIAARGKADRMRSTILPMASNEETVRRPVPGSGTGALAAKLR
FT                   PPLLTPYQVERSAICDTICAAGFVRLVLVRAPAGFGKTTTMLQCRARLEAAGVPTVWLT
FT                   LDRADNDATRFLGSLEVALSPVLEGAPKRPSDHAGADAGEQALALMDRVARHHGAFTLF
FT                   LDDFEALQNPAVVGLVWQLVESLPPGARAVVGTRWVPETGLGRLRARGELLEIEPAQLR
FT                   FSASETESFLRHARGLKLEQAAISALHRRTEGWPTALWLASVSMERRAQPETFIAGFSG
FT                   SNAAIADYLVEDVFHHLPEPVRDFLLRTSILDQLCGPLCDALYQWGPQPPAVADADAPA
FT                   GNSADILAWLERANLFLLPLESERYGERGTGEQSQQWYRYHSLFSSFLRGQLTQTMPQA
FT                   VAELHMAASRWYEGQGRPVPAIEHAIAAGALDHALQLLDGSAGGLLAQGRMRLLTRWLE
FT                   MVPPAELARWPKLQIARAWAVSFTRGPAEAIALLQASSTEDATGELLAHVRALRHMLLN
FT                   MMDRFDEARAFARNELPPLPMGYAFPDAILATSMARLAAVSGDYVEARRLLAVARQAVR
FT                   GSDSNFNKIFSESVEGLIDLRQGRLQQALGRFRIAARTMLPNRFGPTNGNAMACILLAE
FT                   GLYETGDSDRSGRLLNVYLPLSRDLGLADQIITGHLVLARIAFERGEVDQAHEWLAALE
FT                   HLGHHRGLTRLVMSAMLERARLALRQGNRHAAEEALQRAGDPALWRTRPGVSSFASDVE
FT                   DITVGRLRLALHVEPTAQVREAVERELAAAVSNQLMRRALKLRILLAQAYQRTGDGAQA
FT                   LVVMAEALRFGAAEGFVRIFADEGDEVRRLVAQACARQGGNLPSAYVERLLGACGQGPD
FT                   VAPSGQAAPAPLVEPLTPKEQKVLQLLAEGFSNVAMAQRLFVSETTVRTHLRNISAKLH
FT                   ASNRTQAVAIARQLGLL"
FT   gene            complement(170015..170686)
FT                   /locus_tag="Reut_B3607"
FT   CDS_pept        complement(170015..170686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3607"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3607"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62965"
FT                   /db_xref="GOA:Q46V69"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62965.1"
FT                   /translation="MKVSQAVESRKSVRGFLPNPIDPDTIRRVLAAAARAPSGGNLQPW
FT                   HIHVVGGEAMDRLMDIMRQRVTEAPGGEEREYDIYPRELVSPYRDRRFEVGEALYRSLG
FT                   IPREDKQRRLAQFANNFAFFGAPLALFCSVDRRMGPPQWSDLGMYLQTVMLLLREEGLD
FT                   SCAQECWAIYPQTIGGFLSLPPERMLFTGMAIGYEDPEAPANQLRAPRAPLEAFTEFMG
FT                   I"
FT   gene            complement(170699..171574)
FT                   /locus_tag="Reut_B3608"
FT   CDS_pept        complement(170699..171574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3608"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3608"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62966"
FT                   /db_xref="GOA:Q46V68"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62966.1"
FT                   /translation="MTPSNPTFETLCYAVEDGVATITLHRPDQLNAFTGQMMQDLIAAF
FT                   DATDADDNVRAVIVTGSGRAFCAGADLSAGGATFDFEKRYGAKPETAHRDGGGRVSLRI
FT                   FRSLKPVIAAVNGAAVGVGVTMQLPMDIRLASTDAKFGFVFARRGITPEAASSWFLSRV
FT                   VGISTALEWCYTGRVFSAQEALERGLVRSLHAPEDLLPAARAIAREIADNAAPVSVAIS
FT                   RQLIWRMAGASHPMEAHKLDSRAIQSRGRSADVKEGVSAFLEKRPAAFPERVSQDMPDF
FT                   FDWGGEPPFA"
FT   gene            171739..172710
FT                   /locus_tag="Reut_B3609"
FT   CDS_pept        171739..172710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3609"
FT                   /product="2-nitropropane dioxygenase precursor"
FT                   /EC_number="1.13.12.16"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3609"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62967"
FT                   /db_xref="GOA:Q46V67"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62967.1"
FT                   /translation="MKTRITEMLGIRYPIIQGGMQWVGYAEMAAAVSNAGGLGILTALT
FT                   QPTPEALAEEIRRCREMTDRPFGVNLTLLPSINPPPYARYLDVIIESGVKVLETAGNNP
FT                   KEHIARAKAAGMKVIHKCVAIRHALSAERLGVDAVSIDGFECAGHPGEDDVPGMVLIPL
FT                   AARKLSIPVIASGGIADGRGMAAALVLGAEGVNMGTRFCATQEAPIHDNIKQALVAASE
FT                   RDTNLIFRTMHNTARVLKNAISDEVVSIERRPGGAQFEEVRHLVTGQRGKAALVAGEPD
FT                   GGIVSAGQCVGLIDDVPSCEELVARMVAECREQLGTASRYFG"
FT   gene            172715..173164
FT                   /locus_tag="Reut_B3610"
FT   CDS_pept        172715..173164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3610"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3610"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62968"
FT                   /db_xref="GOA:Q46V66"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039298"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62968.1"
FT                   /translation="MAEADIAAMSTGEDVETMPEGFVALRQLDGYMGHFGQLYANVPKR
FT                   ILAVRVGEHHLNNLGIPHGGMLATLADTAIGMMMQIETERKNNAVTVNLSLDYLDAARV
FT                   GDWLEARVEFDKLGSRLRYGTCRVMSGERCLLRATAIFAVLGPRT"
FT   gene            173280..174458
FT                   /locus_tag="Reut_B3611"
FT   CDS_pept        173280..174458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3611"
FT                   /product="Thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3611"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62969"
FT                   /db_xref="GOA:Q46V65"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62969.1"
FT                   /translation="MAEAYIVGAVRTAGGRKGGKLAGWHPADLAAEVLNALLDRTGADP
FT                   ALIEDVIMGCVSQVGEQAGNVARNAILASRLPESVPGTSVDRQCGSSQQALHFAAQAVM
FT                   SGAMDIVIAAGVESMTRVPMGLSSQLPAKNGFGVPKSPNVEQRYPGVQFSQFTGAEMIA
FT                   RNYGFSREDLDRYALQSHQRAAAATRAGRFNAEIVPVEVRLADGTRNGEMHTADEGIRA
FT                   DATLESIGSVKLIAEGGRVTAATASQICDGAAGLMVVNEAGLKKLGVKPLARVHHMTVI
FT                   GHDPVIMLEAPLPATQHALKKAGMNINDIDLFEVNEAFAPVPLAWLKATGADPERLNIH
FT                   GGAIALGHPLGGSGAKLMTTLIHSLHTHGKRYGLQTMCEGGGLANVTIIERL"
FT   gene            complement(174768..175442)
FT                   /locus_tag="Reut_B3612"
FT   CDS_pept        complement(174768..175442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3612"
FT                   /product="Phosphoglycerate/bisphosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3612"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62970"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62970.1"
FT                   /translation="MATLFLVRHGQASFGAANYDCLSETGRQQARWLGEYFRDRGIGLK
FT                   RVVAGTLVRQRDTASEILSAMGAAASSIESHPGLNEYDGEALYRSYTGGADHRAHQNGD
FT                   YNDYWRTFRAAYHAWTQDSLADMPESWTEFGTRIHGALTHACEGTAREDAILVVSSGGA
FT                   IGRAAADLLGAPAQTAIELNLQFRNTGFCEIIVGRGTRRLLSFNSVPHLELPDRRSAQT
FT                   FA"
FT   gene            complement(175641..176372)
FT                   /locus_tag="Reut_B3613"
FT   CDS_pept        complement(175641..176372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3613"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3613"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62971"
FT                   /db_xref="GOA:Q46V63"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62971.1"
FT                   /translation="MVQNRIIIRIIQVQTMRDMTTGDAFPSSSFPRVETPSILQPPRQR
FT                   RARETEQALLSAGRELLAQRDFAAVSVAQIAAACQVSVGAFYGRFRDKMAYFEALRTLV
FT                   IEETADSVDRYLVQQRWEDVPTRTVLEKAMRFLVLGVIGNRGVIRASLRHASTRPEEWL
FT                   PHRQNGDAVVERMVLLLVPRLSLPAAEAEQRVRFAMQAVFSMLVNAVLNDTGPFHLEDE
FT                   RLPGEMSRMLMGYLGVEDTPA"
FT   gene            176565..177632
FT                   /locus_tag="Reut_B3614"
FT   CDS_pept        176565..177632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3614"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3614"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62972"
FT                   /db_xref="GOA:Q46V62"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62972.1"
FT                   /translation="MVECLHAQGVRSGSDKEKQDMKTSKNEPQFRPNRIRRALIALAAA
FT                   PLAIAAGTVHAAWPEKPIRLVVAFPPGGPVDTHARLLAEKLQPLLGQTIVLDYKAGAAG
FT                   NIGSDNVAKSAPDGYTLLLANTGQMAINNSLYPRLQYSMPKDFAPVARTALIPLVMVVN
FT                   NNVPARSLKEFISFAKANPGKLNFASGGNGGISHLMPEMFKQASGTFIVHIPYKGSAPA
FT                   LTDVMGGQAQMMADSIPLFTQYIKAGKVRALAVTSKQRSPALPDVPTMEEGGLKGFEVV
FT                   GFYGMLAPAGTPKEIVTRLSDALHKVLSDPDTKAKLEQQGAEPAWQSPEAFTATIVAEQ
FT                   KRWGQAVKVSGAKID"
FT   gene            complement(177669..178121)
FT                   /locus_tag="Reut_B3615"
FT   CDS_pept        complement(177669..178121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3615"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62973"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62973.1"
FT                   /translation="MPASCFVPLVRRARRAAIVRKAPAAAAAFAMALTGACASIESSTM
FT                   RDLLDSWKGIPIDDAKAQWGPPQAVQAVPGGTAYVWQDIVPQPAKPPTTEAHDAGVEAP
FT                   RPPGRCERRLVAGPDDAVMWGEWSGDACCVTTLVGYCAGLKHRTRQ"
FT   gene            complement(178243..179835)
FT                   /locus_tag="Reut_B3616"
FT   CDS_pept        complement(178243..179835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3616"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3616"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62974"
FT                   /db_xref="GOA:Q46V60"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62974.1"
FT                   /translation="MQDIFPPPSDRLSGKARFADAHALAAALSRPIVFVDLETTGADAQ
FT                   HDRITEIGVVEVGPEGIQEWDTLLDPGVSIPPFIQRLTGITDETVQGQPTFASIAEALA
FT                   ERLQGRLFVAHNARFDYGFLKNEFRRAGLTFRADVLCTVRLSRSLFPSAARHGLDAIIA
FT                   RFDLQPRARHRALADAELLWQFWQKIHALYSVELIDAATGALVKRASLPAGLEETALDD
FT                   VPDTAGVYLFYGDNDAPLYIGKSVHLRQRIGAHFSGDYRLGKDMRLARLVRRVEWRETG
FT                   GEIGALLLEASLVKTMQPLHNQMLRGSARLYTWELPPELPVPRLRSDADTDFSRRGNLY
FT                   GAFASRGAAQAWLRRLADEHRLCQATLTLEKTARAGNPCFARQLHRCEGACVGEEASPS
FT                   HRARIATAMAEARLKRWPFDGPAAWPEVSGTQTWWHVAEDWCYLGSVQTLEDVTTLLAA
FT                   PARFDLDTYQILASRLQQWMPNAVPLTSTRSFELALCEAPAPDDRSPPNLPQGPGRSKA
FT                   PVRRQPSPGLFDD"
FT   gene            180337..181864
FT                   /locus_tag="Reut_BR0070"
FT   rRNA            180337..181864
FT                   /locus_tag="Reut_BR0070"
FT                   /product="16S ribosomal RNA"
FT   gene            181928..182004
FT                   /locus_tag="Reut_BR0071"
FT   tRNA            181928..182004
FT                   /locus_tag="Reut_BR0071"
FT                   /product="tRNA-Ile"
FT   gene            182016..182091
FT                   /locus_tag="Reut_BR0072"
FT   tRNA            182016..182091
FT                   /locus_tag="Reut_BR0072"
FT                   /product="tRNA-Ala"
FT   gene            182390..185209
FT                   /locus_tag="Reut_BR0073"
FT   rRNA            182390..185209
FT                   /locus_tag="Reut_BR0073"
FT                   /product="23S ribosomal RNA"
FT   gene            185392..185504
FT                   /locus_tag="Reut_BR0074"
FT   rRNA            185392..185504
FT                   /locus_tag="Reut_BR0074"
FT                   /product="5S ribosomal RNA"
FT   gene            186400..187998
FT                   /locus_tag="Reut_B3617"
FT   CDS_pept        186400..187998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3617"
FT                   /product="Drug resistance transporter EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3617"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62975"
FT                   /db_xref="GOA:Q46V59"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62975.1"
FT                   /translation="MTSTAQSGHGSGQVLPFRESLLAMLGVAFVSMLVALDQTVVGTAL
FT                   PTVVAELQGFEYYAWVATSYLLLSVITVPIFGRLGDYYGRKPFVLASIVVFSVASALCG
FT                   MATSMPFLVAARGLQGIGGGMLVGTAFACIPDLFPDSHVRLRWQVLMSAAFGVANAIGP
FT                   SLGGILTEWYGWRAVFYVNLPVGVLSLWFVWRYLPHLRQQSHSGPIRVDWLGALLIGVG
FT                   LGCMQMSVELLPQRGVDWLTAGLLAVAVAALVGLWQWERRCANPILPLDMFRNPGVAPL
FT                   LQLAVLVGFTMFAVLIYAPLLLQGGFGYSPRDAGLLVTPLVVCITVGSIVNGRIITRIR
FT                   RPNAMLFAGFGMLAAGCLALSQATRGMPHSLLLAIMLVAGFGLGFIMPNLTVFAQQTVG
FT                   REHLGIATAMLQSLRMVGGMIGTAMVGTMVSRSYTAGVEQSLAAVNAQGWLTRMADPQV
FT                   LIDKAAQAGLLTELQQAGHNGALLLEQARVSLVTAIHFGLVIAAAAALIGLWRARRVPP
FT                   VRLVRAGQQPAMAAD"
FT   gene            188054..188515
FT                   /locus_tag="Reut_B3618"
FT   CDS_pept        188054..188515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3618"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3618"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62976"
FT                   /db_xref="GOA:Q46V58"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62976.1"
FT                   /translation="MELERQSLAVLQQFGRTYRAYAAAFEQRIGLPLPRWRILFALHLQ
FT                   EDAIAQKALAERVGMDPGALTRQLKALEELGWVLRNTSERDNRVTHVTLSATGRDVVEG
FT                   KMPLRSAFLQDVLENVPESTMGELSRGLAQLEAGIADAVARAAEMADAD"
FT   gene            complement(188538..189197)
FT                   /locus_tag="Reut_B3619"
FT   CDS_pept        complement(188538..189197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3619"
FT                   /product="regulatory protein, LuxR:Response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3619"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62977"
FT                   /db_xref="GOA:Q46V57"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62977.1"
FT                   /translation="MTLRILLADDHPLVSTAARDLLQTQAGWEVCGMATSATDLLCCAQ
FT                   ALRPDVVITDYHMPGPGDSDGIRLISTLRRHYPAMAVIVLTMITNPMILRSILKSRVHG
FT                   LLLKDAPPSELVTAVVRIQRGFDYVGKSALEILTRSDPDSLIEPGQPVPQRMSVRETEV
FT                   IRLYLSGRSVSEIAGIMCRSVKTISRQKNCAMQKLGANNDRELFECAARQGILLPS"
FT   gene            complement(189571..190527)
FT                   /locus_tag="Reut_B3620"
FT   CDS_pept        complement(189571..190527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3620"
FT                   /product="regulatory protein, LysR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3620"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62978"
FT                   /db_xref="GOA:Q46V56"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62978.1"
FT                   /translation="MRHVSTKLLHVFVLVMEYRDLSAVAACTQGRVPTVAYSLARLREI
FT                   TGDPLFVKRNGTLEPTPHALRLEQTARQILAKWNQLVRPNDLVTEKSHQGRRLSIGFSS
FT                   SIGDPVITEILTTLCERFPHDSFVTRPVIADATLAESLDSGELDCAFVVDGGHNPAKVL
FT                   PHNILATPRRLVSAMRAGSADDTESDWILLQEDCEAGSPLRSFLARQASTPGHRETVVP
FT                   SWHTQITLLHSAGGICPVLDFNVPLVTRDRKTRLLAPPSSFPEWAALHFWAPERARDKG
FT                   ALRDIMDVGSAVLRDPLKAIDNRRKVRQEPPRHAAAA"
FT   gene            191438..191725
FT                   /locus_tag="Reut_B3621"
FT   CDS_pept        191438..191725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3621"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3621"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62979"
FT                   /db_xref="GOA:Q46V55"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62979.1"
FT                   /translation="MNRRYSEEQIRTYLAEAASGVPVRELCARYGFSDASFYGWRARYG
FT                   QPGQGDARDGRKLRELQEENARLKSMLADALLKLELLRNRTGRNGSGKDR"
FT   gene            191703..192179
FT                   /locus_tag="Reut_B3622"
FT   CDS_pept        191703..192179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3622"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62980"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62980.1"
FT                   /translation="MAAGKTADLHLLIPDPCGPAGVPGCACANRAQSRSVSLSIVICRK
FT                   VCMLAGTGLLAAQVWAAADVARPAPMVAPPPPRMLDSATSTVESPDGTLSVPQRQRCQS
FT                   LLDQINALPVGEQWSTGKPSVTTADGRTYPTLERQADRKRLEEAYRQECTQQSR"
FT   gene            192287..193678
FT                   /locus_tag="Reut_B3623"
FT   CDS_pept        192287..193678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3623"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62981"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62981.1"
FT                   /translation="MHRFRHIFAWCLGLMLLAPFGGPMAQAPLSHAQLDQLTAPVALYP
FT                   DALLSQVLMAATYPADVASAAQWSKANASLSGDAATKAVSNQPWDPSVQSLVAFPSVMD
FT                   MMGREPQWVQSLGDAFLAQPNDVMDSVQRLRRQAQQAGSLKTTEQQRVVTQTTGATTVV
FT                   QIEPVNPQVVYVPAYNPTVVYGAWPYPAYPPAYYPPPPGSVFATSLVAGIGFGLGVAAV
FT                   NSLWGGFNWGSHDVNINVNRYNNINVNNRLDVNRSNVNWQHNPANRGNVPYNNANVRNR
FT                   FDQQRQAGIANRPQVGQFGTPRPGAGGGGVQRPGAGGQADAREQARERAAQSFQSRTGQ
FT                   SMPGHGGGGVADRGRQGAENRPGANGGGVQNPRPAGADRQRADQAQARDRARNANRNSA
FT                   LRDAGNGDRVRQQSQRVAAQPARGTPQRQGFGGEGGGFHGAGGRQGGGVHGGGGGGGHL
FT                   GHGRR"
FT   gene            193681..194523
FT                   /locus_tag="Reut_B3624"
FT   CDS_pept        193681..194523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3624"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62982"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62982.1"
FT                   /translation="MMRKTMSAMRALVAVVALSAGAPVLAQQMYATPDAAAEAVGDAIS
FT                   RSDDDALRHVLGNDFHKLLPPSGVDSDDVYEFLAAWARHHAIQPDGERRALLTVGESGW
FT                   TFPAPLVEQKNGWHFDLQAGEREVLRRRLGRNELVAMETLLQLADAQERYAQQVGGGRY
FT                   ATQLVSSPGKTNGLYWPSTSQENASPLGPDALAMVPETPVDSAFYGYHYRAIAPPKGSN
FT                   AKYAFVAWPAQYGQSGIHTFLLGSDKTFYERDLGAGTATRAKTIRSFSPDGWQRVSDR"
FT   gene            complement(194575..195351)
FT                   /locus_tag="Reut_B3625"
FT   CDS_pept        complement(194575..195351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3625"
FT                   /product="Cyclic nucleotide-binding:Bacterial regulatory
FT                   protein, Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3625"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62983"
FT                   /db_xref="GOA:Q46V51"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62983.1"
FT                   /translation="MSDPASPSCSLCLFRHVCRHAPAAGTRPDAEKPLQPAHLIVPAGD
FT                   AIFRQGRPVTAVFPLRQGSAKQVYESPLGWRQVTGFSLSGDVLGLEPNEAPAHSVSALA
FT                   LQDTECCVVPVEALRAHMANAGFRDSVQAVMRHQAERERILLVAVGSMKAAQRLAMLLL
FT                   DLDAEHRRRGGADSALTLAMSRTDIASLLGLTLETVSRLLSRFASVGLISVRQRRLRLI
FT                   DRDGLAAVYADLDPMPRPGPATIGSLAGTGNEPRPF"
FT   gene            195600..196688
FT                   /locus_tag="Reut_B3626"
FT   CDS_pept        195600..196688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3626"
FT                   /product="Esterase, PHB depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3626"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62984"
FT                   /db_xref="GOA:Q46V50"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62984.1"
FT                   /translation="MAKSLATDWQAQFRRMSRAQAQTEAQVKSWLERIESLSPLAPRRR
FT                   IRTPHGVPLSPRYPVPQLPGSWESHRLRLAPQPGELVPQLSYHLYVPASAKHRFRGPLP
FT                   VVVMLHGCRQTPDDLAAGTRMNALAEREGFIVAYPQQPLRRQLQRCWQWFDLAAGEGGR
FT                   EAQAVAALIDALARRHDVREDQVYLAGMSAGAAMAAVVALRYPERVAAVGLHSGVVVGA
FT                   ADNPGAGLRAMLHGSEADPAWLVDAVGATPGGPELPAIVVHGLDDDAVHPVNGRLLARQ
FT                   FLAYNRLEDRLRGIEEADIDLPAGHFHEARFGRWSRDLVTLVEVEGLGHAWSGGDGDYS
FT                   YHSATGPDASAMMWEFFREHSR"
FT   gene            complement(196774..198084)
FT                   /locus_tag="Reut_B3627"
FT   CDS_pept        complement(196774..198084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3627"
FT                   /product="General substrate transporter:Major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3627"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62985"
FT                   /db_xref="GOA:Q46V49"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62985.1"
FT                   /translation="MSTTSSTAPITGAPAQPARSLTGQDYKTLSLAALGGALEFYDFII
FT                   FVFFATVIGQLFFPPSVPDWLRQLQTFGIFAAGYLARPLGGIIMAHFGDLLGRKKMFTL
FT                   SILLMSVPTLLMGLMPTYQTIGLLAPMLLLVLRILQGAAVGGEVPGAWVFVSEHVPERH
FT                   VGYACGTLTCGLTAGILLGSLVATGINSVFTPAELADWGWRVPFLIGGVFGITSMYLRR
FT                   WLHETPVFAELQKRKALAAEMPLKSVVRDHRGAVVVSMLLTWMLSAGIVVVILMTPTFL
FT                   QKLYGFDARTALIANSVATLCLTFGCVISGALADRIGARRTLFFGGLLLAASAYALYTT
FT                   VQTRPDLLVPLYALAGFLVGTIGAVPFVLVNAFPAQVRFSGLSFSYNLSYAIFGGLTPM
FT                   VVTLMLKNDPLAPAHYVVAICALGMVTALFVKDRPRG"
FT   gene            198397..202311
FT                   /locus_tag="Reut_B3628"
FT   CDS_pept        198397..202311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3628"
FT                   /product="Protein of unknown function DUF748"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3628"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62986"
FT                   /db_xref="GOA:Q46V48"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62986.1"
FT                   /translation="MEIKSSIQFATATPRRKLALRVAGGVVAALAMFGLAGYFGGPPLI
FT                   KSLIEKNATEALGRKVTLGEAHVRPFELAATLTDFTIYERDGKTPAVTLGELEADTSLA
FT                   SVWHLAPVVDSLHIDRLAVHVVREADGRLSFADIQDKLAAQPPKPPDAKPARFSVNNIA
FT                   VTGSSVAYEDKVAGSNVRVDNLTLTLPFLSNLPHDVEIVTRPTLSAHVNGTPLALDGTV
FT                   LPFADSRETHLNVNFDGLDVARFMPFAPKLKDADVKHGLLDTRLTLGFRQQKDKQDIFV
FT                   SGTAALRELDVRTLAGAPLISNGKLAFDIDRVEPLARQAHLRSVDIDGLNVAAVRRADG
FT                   SLNLATAFVPQAAPAAKSAPAAPASAPAASAPAKEAAWRYAVDRITLRQAHIGFEDALA
FT                   LSGPGKLAVGPIDAQVNGLVSAEADKATKLQATITVANGQTLTHMGELSMRQSTLAGTL
FT                   ETAGLQPQGFASWWPRELRAQFGNTAINAELHYRMSWAQPVFQFVLEKSRLELANVRVA
FT                   TREPVVMPTVAVPASQPAARKVLAERTERASRARRARETDIEGANLPLLQAEKVVLDDI
FT                   GLDLAKQTFEAGQLAVTSPQIAATRDYRGQLLEMARIWATESKEQAKVQRSRQATAGTT
FT                   AENGTTPPPAAGGWKVRLGKVGLEGGWARLADYAPAEVNRGRPVIHQYRNIGLSTGAIT
FT                   WPLTTAAVPVKLHAETGKRGVVGIEGNVLPAAPAGQLQLDLRDVDLAPVQPYVGDRLNA
FT                   ALRSGTLTVKGKVAYSAPPGKPTAARFTGNAQVANVRTVDRVTGDDFLRWRTLAVSGID
FT                   FNMDDSKGPMRVALNNIALSDFYARVILNANGRLNLQDVMAGGAAKGEAQPATSLTQAN
FT                   PASAPAAASAPAASPPPQAAAGPKPQVLIGGVSVNKGNINFSDFFVKPNYSANLTGMKG
FT                   SVSKVSSGDPTPADLVLNGRLDDDAPVSISGKINPLGEQLYLDIAAKASGVELTRLTPY
FT                   AAKYAGYPITKGKLTVDVAYKIDHGKLDASNHLYLDQLTFGDKVDSPDATKLPVLLAVS
FT                   LLKDRHGVIDVNLPVSGSLSDPEFSIGGVIVRVIVNLLAKAITSPFALIGSAFGGGSGE
FT                   ELGYVEFAPGTSTLAPAAKEKIATVAKALNDRPSLKLEISGRIDPATDEAGARRAWLDA
FT                   RVAEQKRRDLRKSAQEGDEASDSEAGEQGADVKVSKQEYPKYLEEVYKRASVKKPRNFI
FT                   GMAKSLPPEEMERLLMENATVSETDLRHLADQRALVVKQALERDGKVPEDRLFLTAPHL
FT                   NADGIKDKGAPNRVDFSVRQ"
FT   gene            202462..202656
FT                   /locus_tag="Reut_B3629"
FT   CDS_pept        202462..202656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3629"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3629"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62987"
FT                   /db_xref="GOA:Q46V47"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62987.1"
FT                   /translation="MQDQLEEAVAYKTWVCVICGWVYDEEQGWPDDGIAPGTRWEDIPD
FT                   DWRCPECDVGKAEFAMIEL"
FT   gene            complement(202904..203086)
FT                   /locus_tag="Reut_B3630"
FT   CDS_pept        complement(202904..203086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3630"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3630"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62988"
FT                   /db_xref="GOA:Q46V46"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62988.1"
FT                   /translation="MWHFQAHDLVFLIPMALVGVIAMGSIPVTARYLRISCRTMGALIG
FT                   ALVAVLVLEALPLLI"
FT   gene            203358..203861
FT                   /locus_tag="Reut_B3631"
FT   CDS_pept        203358..203861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3631"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3631"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62989"
FT                   /db_xref="GOA:Q46V45"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62989.1"
FT                   /translation="MELHMHSHHYVRRSPDWTAAAVSGLAAGALLLVVELFWSTMVSGV
FT                   NPWGTTRMIAAILMGRDVLQTSLFSVGTVAAALLIHFVLGAVLGMVLAVIIAPFQLDSS
FT                   IRMILLAGAVFGLAVYLFDFHVMTRFFTWFADARGWHTLVGHLIFGMVAAVCYWKLESK
FT                   DVSH"
FT   gene            204167..205501
FT                   /locus_tag="Reut_B3632"
FT   CDS_pept        204167..205501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3632"
FT                   /product="Cytochrome c oxidase, subunit II:Cytochrome c,
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3632"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62990"
FT                   /db_xref="GOA:Q46V44"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62990.1"
FT                   /translation="MAMAIVLVVIVVASVLFHFMSPWWATPLASNWKQMDDTLTITLVI
FT                   TGVFFIVINLFLAYMVWRFRHDAPRHDAQPGHRADYHPENRKLEIWLTIGTALGVMALL
FT                   APGLFVYADYVRPPREAMVLEVIGQQWQWAFRFPGKSGQLGTSDPRFISGTNPLGLNPD
FT                   DPRGQDNIVISGPEVHLPLNRPVKVLLRSRDVLHDFYVPPFRARMNMVPGMVTSFWFTP
FT                   TQAGRFEILCAQLCGVGHYNMRGMVVVEEPAAFDAWLAKQPTFALTLAKAAAPPATAPV
FT                   PAAGAAAGVDPALLERGRALAQSKGCAGCHSIDGNPGVGPTWKGLYGRTETFADGSTAP
FT                   VNDDFLKEEITNPQARLVKGFGPVMPKIALTDDEIGALMAYIRSQGSGADTGAAPPESA
FT                   SAGAPTGATAAAETSSQAASSASGTYTTSNAAVVPPSASPKAATK"
FT   gene            205512..207269
FT                   /locus_tag="Reut_B3633"
FT   CDS_pept        205512..207269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3633"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3633"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62991"
FT                   /db_xref="GOA:Q46V43"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62991.1"
FT                   /translation="MAYADDADHHAPQSFWTRYVWSQDHKVIAVQYTITAIVVGLVGVA
FT                   LSNLMRMQLGFPGKFDFIDANRYYQFVTMHGMIMVIYLLTALFLGGFGNYLIPLMVGAR
FT                   DMVFPFLNMLSYWVYLLSVIVLLASFFVPGGPTGAGWTLYPPQAILPGTPGYEWGIILM
FT                   LVSLGIFIVAATMGGLNYVTTVLQARTEGMTLLRMPLSVWGIFMATILALLAFPALFVS
FT                   AVMMLLDRTLGTSFFMPAMVSMGQQLNYKGGSPLLFQHLFWFFGHPEVYIVALPAFGIV
FT                   SDLVSVHARKSIFGYRTMVWAILAIGVLSVVVWAHHMFVSGMNPYFGFFFATTTLIIAI
FT                   PTAIKVYNWVLTLWRGDIHFTVPMLFAIAFISTFVIGGLTGLFLGNVSVDIPLSNTYFV
FT                   VAHFHMVMGVSPILVVFGGIYHWYPKVTGRMLDDTMGRVHFWTTFIGTYAIFFPMHYLG
FT                   VLGMPRRYYAYENYAFIPESAHVMNMYISIAAFIVAAAQLLFVFNLAWSLWHGRKADGN
FT                   PWRAASLEWQTPETPPAHGNWGPHLPVAYRWAYAYSVPGAKEDFIAQNAPPEAGGAEPE
FT                   PHASRGAVA"
FT   gene            207266..207913
FT                   /locus_tag="Reut_B3634"
FT   CDS_pept        207266..207913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3634"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3634"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62992"
FT                   /db_xref="GOA:Q46V42"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62992.1"
FT                   /translation="MNAEAVYKVSRDDFGGNPSGGGHTRNGQAGGAPASIGLWVFMGVV
FT                   TVLFALFLTAYAMRMDSPDWQRIALPWQVWLSTALLTAGSVAMQAAVRLARAGRMAGAR
FT                   QAMRLGGLGAAAFVASQLWAWLALHAVHVGPASNPAGSFFYLLTAMHGLHVLGGLAGWA
FT                   YAAGFRGSGEGAVLRMTLCARYWHFLLAVWVVLLAALGWLTPEIVRYICGTA"
FT   gene            207938..208633
FT                   /locus_tag="Reut_B3635"
FT   CDS_pept        207938..208633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3635"
FT                   /product="probable cytochrome-C oxidase subunit III
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3635"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62993"
FT                   /db_xref="GOA:Q46V41"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62993.1"
FT                   /translation="MSSNVSTQPDAPGAVATGLRGLVADWSSDQRAFKVSWGKAMMWIF
FT                   LLSDTFVFSCFLTGYMTVRMATTVPWPNPSEVFGLRIGGHDVPLLLIAIMTFVLITSSG
FT                   TMAMAVNFAYRRQRRQCALLMLVTALFGATFVCMQAFEWTKLIVEEGVRPWGNPMGAPQ
FT                   FGSTFFMITGFHGLHVSCGVIYLLIVATKVLRGRYEVTGNYQIVEIAGLYWHFVDLVWV
FT                   FIFALFYLW"
FT   gene            208642..209007
FT                   /locus_tag="Reut_B3636"
FT   CDS_pept        208642..209007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3636"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3636"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62994"
FT                   /db_xref="GOA:Q46V40"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62994.1"
FT                   /translation="MASTPTSAAPAPAHGHEDTAHTGQQHPIGLYLKIWLLLFVLSTLS
FT                   YMVDYVGFTGYLRWTLILLLMVLKAGLIVAVFMHMAWERMALICAILVPPLCLLILVWL
FT                   MAEEANYTFLTRGIFFH"
FT   gene            209017..210240
FT                   /locus_tag="Reut_B3637"
FT   CDS_pept        209017..210240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3637"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3637"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62995"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62995.1"
FT                   /translation="MHPATEAILRFNQGRDPERFTRKLAAIAADPFAFFRGTNHLYVAS
FT                   LRNEDALLDAPTTYVCGDLHLENFGSFKGDNGLVYFDLNDFDDALLAPLTVDVVRVLSS
FT                   VMVAAGQIGLSDEDAQRASEAMLAEYAAVLQRGKPRWLERATAIGMVATLLRRVKRRRR
FT                   GELVAERAQMRKGRQRLVCDGRHALPADKAARQRALQILSAYSGQAHGHRFRAEDVARR
FT                   VAGIGSLGLERYVVLAHDERAGGMPRLIDIKRAAPSAWDNLPNRAQPRWSSDAQRVATV
FT                   QQIMQAASPALLSPVEMGKASYLVKSLQPTADRVNLAHCDSAAALREVLETMAHAAAWA
FT                   HLRGCGHHAADRIEQLQEFAAGARWRKSVLRLARHGHAVSLAQWKAYAEDYRKAISGAA
FT                   PESAGGAQ"
FT   gene            complement(210256..211683)
FT                   /locus_tag="Reut_B3638"
FT   CDS_pept        complement(210256..211683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3638"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3638"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62996"
FT                   /db_xref="GOA:Q46V38"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62996.1"
FT                   /translation="MYQDLALYIDGEFIKGGDRKEQDVLNPATQEVLGKLPHASRADLD
FT                   RALAAAQRAFESWKKTSPLERSKILRRVGELARERAKDIGRNITLDQGKPLAEAVGEVL
FT                   VCAEHADWHAEECRRIYGRVIPPRQPNVRQIVVREPIGVCAAFTPWNFPFNQAIRKIVS
FT                   AVGAGCTLILKGPEDSPSAVVALAQLFHDAGLPPGVLNIVWGVPSEVSTYLIESPIVRK
FT                   ISFTGSVPVGKQLAALAGAHMKRVTMELGGHSPVLVFDDADIEPAAEMLARFKLRNAGQ
FT                   VCVSPTRFYVQEKAYDKFLARFTEVIGSIKVGNGLEDGTQMGPLAHERRVFSMEQFLDD
FT                   ANQRGGKVVAGGSRIGDKGYFFAPTVVTDLPDDAKLMVDEPFGPVAPVTRFKDTAEVLR
FT                   RANSLPFGLASYVFTNSLKTATEVSNGLEAGMVNINHFGMALAETPFGGIKDSGIGSEG
FT                   GQETFDGYLVTKFITQV"
FT   gene            211983..213032
FT                   /locus_tag="Reut_B3639"
FT   CDS_pept        211983..213032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3639"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3639"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62997"
FT                   /db_xref="GOA:Q46V37"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62997.1"
FT                   /translation="MDGNTGSRAGGERKPIALALQGGGMHGAFTWGVIDRLLEDGRLEI
FT                   EGISATSAGAMNAAVLAYGMLKGGPDGGRQALHDFWEAISSSAERYSPFRWVPSWMKGG
FT                   HSFGLDSSPLYAMADMVLRIMSPYQFNPHNMNPLRDVLASQVDFEALRRQCPCHLFLCA
FT                   TNVETGKIRLFTGPELSIEAVLASTCLPTLFQSVTVDGQHYWDGGYVGNPAIFPLIYQC
FT                   KTNDVVIVHINPIVRPGVPRSAADILNRVNEVSFNSSLMREMRAIAFVTSLIQQGKVDR
FT                   AEMKEMRIHSVRNDETMAALSVSSKYNADWKFLCSLRDKGRDHAGTWLEHNYEHVGQRS
FT                   SVDISGEFL"
FT   gene            complement(213060..213674)
FT                   /locus_tag="Reut_B3640"
FT   CDS_pept        complement(213060..213674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3640"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62998"
FT                   /db_xref="InterPro:IPR009218"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62998.1"
FT                   /translation="MNRIQTRFESLWSRCGGRRAQDTYQELAQYYEGPGRYYHTLYHVR
FT                   RCLRDLDWGHTRIPDVDTVELALWCHDVIYVPGASDNEARSAQWFLGRADGQIAEADRI
FT                   AAMILDTTHMRVPSDPAGCFTVDIDLATLGSHNARFRRNAKLLRAERPDLDDTAYDKAE
FT                   RKYLSRLLTRPRLYHTDLFHDRYEAAARRNLALRLAQPAPG"
FT   gene            complement(213700..217116)
FT                   /locus_tag="Reut_B3641"
FT   CDS_pept        complement(213700..217116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3641"
FT                   /product="adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3641"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ62999"
FT                   /db_xref="GOA:Q46V35"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ62999.1"
FT                   /translation="MRCTNCGFENLAKANFCEECGAGLPRTCPQCGEPAGPTAKFCRGC
FT                   GAALAGLAASQPSASAQVAAPVQYTPPHLAERILAERAAMEARGEAAGERKTITALFAD
FT                   MAGSTALTQDLDPEEARRLIDPVATLMMEAVHHYEGYVAKFLGDGILALFGAPIAHEDH
FT                   ALRALYAALRMQEAMRRHSDRVRLELGIPLQIRVGIHTGEVVVRSIRKDDLHTDYDPVG
FT                   HTIHIASRMEGVATPASILISESTHKLTEGYFEFKALGTTHVKGVREPLPVYEVLGLGP
FT                   LRTRLQVAAHRGLARFVGRQAELEQLHAALDLAKAGSGQIVGVVGEAGVGKSRLFHEFK
FT                   ARSRQGCLVLETFSVSHGKAFAYLPLIELLKNYFQVAAQDNDRVCREKVTGRLLTLDRS
FT                   LEPHLPYLLYLLGSSDPDSTLPTMDATIRRQRTFEAIAQLLVRESQNQPLALIFEDLQW
FT                   LDSETEGFLNILVDHVPAASILLQVNYRPEYAHEWHGRGAYTQLHLEPLGPAEAQGLLT
FT                   ALLGDDRSLVPLKRLILDKTEGNPFFMEEVVQTLTEEGVLLGVSGSFRIEQAPALLHIP
FT                   TTVQGVLAARIDRLPVAQKELLQTLAVIGKEFSLSLIRHVTGADDNALRPLLTALQAAD
FT                   FIYEQPAFPDVEYAFKHGLTQEVAGHSLLTERRSALHERTAHAIESLFPGRLKDYCGEL
FT                   AHHYSLSGNVPKAIEYLHYAGQQALERSALPEAIGHLGDAIALLKRLPDTPERLRQELS
FT                   LLLTLGPALIATRGQAATEVEANYRRALALCEQGEPTPQVFSAQLGLWAFYQLRAQYNV
FT                   SLPLGRRLLGMAIRSQKPDQLAEGHRVQGSTTFRLGQISAARDHMEQVLTVQRPDQSSY
FT                   DFLLGYGRDPAVHAMATLGWILWYQGLPDLARARSLEALALSRQRPDAFNLALCLIFAA
FT                   EVHVCRREVQQVREFAEAATDISGEQGFPIYLAWGKVLQGWAMAERGIHQAGIALMLEG
FT                   LDAYAATGASLARPSLLGLLADAHSMAGDFRTGLALVDEAMSITEQTGERLDASGLLRQ
FT                   KGELVLAESGDGTLACEEAEDCFHKAIAMARQQGARSLELRAALSLARLWRRKGKADAA
FT                   RQVLAGIYGVFREGFDTLDLKQARAFLDEVG"
FT   gene            217254..218744
FT                   /locus_tag="Reut_B3642"
FT   CDS_pept        217254..218744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3642"
FT                   /product="Multi antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3642"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63000"
FT                   /db_xref="GOA:Q46V34"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63000.1"
FT                   /translation="MKPDARLTTGPISRTLLMFSLPVLGSNILQSLNASINSVWVGRYL
FT                   GEAALTATSNANIILFFLLGVVFGISMANTIMIGQAVGARDLGEARAIVGTSTTFFVLL
FT                   SVAASIFGFIFTPDILAAMQTPHDAAPLAVTYLRIIFVALPFMYFYNFVMMTLRGAGDS
FT                   RTPFYFMLLSAVLDVVLNPLLIFGVGPLPALGIAGSALATLIAQLTSLVAMIALLYRRR
FT                   HFLLLHREQLALLKPDPAIIRALVAKGLPMGLQMVVISSSAIVMMSLVNAYGSQTTAAY
FT                   GVASQLWTYVQMPALAVGASVSSMVAQNVGAGLWHRVTRITRVGLLFNLAMTGALVGLV
FT                   YLFDRNSLGLFLGTDSVAIGIAQHINLIVLWSFILFGFTIVIFGTVRATGAVMAPLVIL
FT                   FLSMWVIRLPFAWSVGKNWGADAIWWSFPLGSVVSVALAAGYYRLGNWRASHILPVPAH
FT                   APEAVGQAPDTSMGTPCEDAGPVSEADDMPPRTVETVR"
FT   gene            219168..219629
FT                   /locus_tag="Reut_B3643"
FT   CDS_pept        219168..219629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3643"
FT                   /product="Protein of unknown function DUF1468"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3643"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63001"
FT                   /db_xref="GOA:Q46V33"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63001.1"
FT                   /translation="MRIRSQKDFASGLMFILVGLGFSWVARGYSMGTAAKMGPGYFPFL
FT                   LGLVLAVLGALVLISSLSSKGEQDHLARWDLKTLLWILGSVVLFGLLLKPLGMVLSVFV
FT                   LVLVSSMASHEFSWKGALLNSVVLVLISLGAFVYGINLQMPVWPAFITG"
FT   gene            219642..221144
FT                   /locus_tag="Reut_B3644"
FT   CDS_pept        219642..221144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3644"
FT                   /product="Protein of unknown function DUF112,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3644"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63002"
FT                   /db_xref="GOA:Q46V32"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63002.1"
FT                   /translation="MELIEHLSLGFSTALSLQNLAYAFLGCVLGTLIGVLPGLGPLATI
FT                   AMLLPVTYTLPPVAALIMLAGIYYGAQYGGSTTAILVNLPGESSSVVTTIDGYQMARRG
FT                   RAGVALATSGLGSFFAGCVATLILAAFATPLSELAFKFGPAEYFSLMVLGLIGAVVLAS
FT                   GSLPKAVAMIVLGLLMGLIGTDVNSGAARFSFDVPELTDGIDFVALAMGMFGFAEIIAN
FT                   LEQKEARETFTDAVTNLWPTKDDFKRMAPAVLRGTLLGSALGILPGGGAALASFAAYSL
FT                   EKKTSKYSHEFGKGAIEGVAGPESANNAAAQTSFIPLLTLGIPPNAVMALMVGAMTIHN
FT                   IQPGPQVMTSNPALFWGLIASMWIGNLMLIVLNLPMIGIWVKLLTVPYRFLYPAILVFC
FT                   GIGVYSVNNQTFDVFMAAGFGVIGYLFLKLKCEPAPLLLGFVLGPMMEENFRRSLLLSR
FT                   GDFTVFVTRPLSMGLLIAAAALVAVVALPSIKAKREEAFQEE"
FT   gene            221357..221650
FT                   /locus_tag="Reut_B3645"
FT   CDS_pept        221357..221650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3645"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3645"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63003"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63003.1"
FT                   /translation="MKSPSLDRVFSRIFILKLVHASPSTVMNLVDRLREYGIELNIRSL
FT                   RPILRSLMIARAITAELVEGSGRVYCITDSGRDELDRYLSHLDVLKRDGGVE"
FT   gene            complement(221732..222526)
FT                   /locus_tag="Reut_B3646"
FT   CDS_pept        complement(221732..222526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3646"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3646"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63004"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63004.1"
FT                   /translation="MFRLKTSIVLSLAIAATAALSACGGGGDDGVAARVGLSKPTVRVI
FT                   HAIPGGPNVDVLQNGAKTNLLNEPYKFVSTYRSVDEGNQLFSFNVAGTSTELGRATINT
FT                   HTGHKYTAVAMPGSESAADVVQIDDPFEKGLFSDKARVRALNASFNAQNVDIYLTTPAV
FT                   DLNSVTPTFAAVAFKSAVPASGQDSIDLNGGTYRLRITTAGSKTVIFDSGTLTLANNAD
FT                   WLITTLPVDGIKATLPNRIKVLVARGDDESQAGLELVTQPSQ"
FT   gene            complement(222795..223874)
FT                   /locus_tag="Reut_B3647"
FT   CDS_pept        complement(222795..223874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3647"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3647"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63005"
FT                   /db_xref="GOA:Q46V29"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63005.1"
FT                   /translation="MLNQDVWGRAIKEASMQQPDNTAITAITDTPAANSYPVMVLLVDD
FT                   QAMIGEAVRRALASEPDIDFHYCATPDDAVAVAERTRPTVILQDLVMPGVDGLTLVRRY
FT                   RDNAATRDIPIIVLSTKEEAAMKSAAFSAGANDYLVKLPDSIELVARIRYHSRSYLNLL
FT                   QRDEAYRALRQSQQQLLETNLELQRLTNSDGLTGLSNRRYFDEYLNAEWKRAQREQSQL
FT                   ALLMIDVDAFKAYNDTYGHVAGDEVLRRVAAVLRDNCSRPADLPARFGGEEFSMVLPST
FT                   SPGGARLFAEKVRRAIESLGIAHSGADTGGFLTVSIGAAVLVPEDGQPSSRLVEVADAG
FT                   LYEAKRNGRNQVVMAWPRA"
FT   gene            complement(223922..224947)
FT                   /locus_tag="Reut_B3648"
FT   CDS_pept        complement(223922..224947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3648"
FT                   /product="Protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3648"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63006"
FT                   /db_xref="GOA:Q46V28"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46V28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63006.1"
FT                   /translation="MKVGIVNDSALAVAALRRAIALDPAFEIVWVAGDGEQAVQLAASH
FT                   TPDVILMDLLMPVMDGVEATRRIMAATPCPIVVVTTDLGRNATQVFDAMGHGAIDAVDT
FT                   PTLTESDAKLTAGPLLRKMRNIGRLVAGRAAPRPAITEMPGTLAASRLVAIGASAGGPA
FT                   ALAKLLGALPADFCAAVVAVQHVDEAFAPGMADWLDSQCALPVRVAAPGETPQAGTVLI
FT                   AGTNNHLRLLGSNRMAYTEQPSEYLYRPSIDVFFESVVEYWRGQAIGVLLTGMGRDGAS
FT                   GLKAMRDHGCLTIAQDQATSAVYGMPKAAAAMGAASEILPLTAIAPRLVQACCSVRPPP
FT                   G"
FT   gene            complement(224944..227235)
FT                   /locus_tag="Reut_B3649"
FT   CDS_pept        complement(224944..227235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3649"
FT                   /product="Response regulator receiver:CheW-like
FT                   protein:ATP-binding region, ATPase-like:Hpt"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3649"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63007"
FT                   /db_xref="GOA:Q46V27"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63007.1"
FT                   /translation="MNADQLRDASLLELFALEAESQAEVLNAGLLALERDPAAASHLDA
FT                   CMRAAHSIKGAARIVGLDGGVRLAHAMEDCLVAAQGGMPLSAAHIDALLQGTDLLQRIG
FT                   QPPDGDPAWADRQGRTQIDAVVQRLQALPGGNLPTAPVAPPVSVAEPEPPSLPVLPVAD
FT                   ALAPSPPSMPSAATGPEQQERMLRVGAESLDQLLALSGEAMVESHWLRPFAKAMLQARR
FT                   QQARALQALDTLRDALAGSGADAGAMAALSDARQLLEDGAQHLSQRQEELDQYEHRTAR
FT                   LARRLYDTALACRMRPLSDGLAGYARMVRDLARSLGKAAHLELVGAGTQVDRDILEALD
FT                   APLAHLLRNAVDHGIEPSDVRVAQGKPAEGRILLQARHNAGRLVIEIGDDGAGVDLAAL
FT                   RQAIVRRRLASEDTAARLSEAELLEFLLLPGFSMRETVSEVSGRGVGLDAVQEMVRRVR
FT                   GSLRLAQSPGGGLQFHLELPLTLSVVRALLVEVAGEAYAFPLGHVLSAASVPRHDVAQT
FT                   ESHQHFQYTGRAVGLVSAAQVLQRPEHPLDGDHIPVVIIGEQERVYGIAVDRMLGERLL
FT                   VVQPLAPALGKIKDIAAGALTDDGTPVLIFDVDDLVRSVEKLVTDGRIEHVRQTGTAIA
FT                   QVRRKRVLVVDDSLTVRELERKLLASRGYDVAVAVDGMDGWNVLRAEPFDLVITDIDMP
FT                   RMDGIELVTLIRKEPRMQQLPVMVVSYKDREQDRQRGLEAGADYYLAKGSFHDAALLDA
FT                   VHDLIGEAST"
FT   gene            complement(227232..227909)
FT                   /locus_tag="Reut_B3650"
FT   CDS_pept        complement(227232..227909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3650"
FT                   /product="CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3650"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63008"
FT                   /db_xref="GOA:Q46V26"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63008.1"
FT                   /translation="MADAQTLPANVQIDDCWRRIGVRGDGSCTLLATHIHCRNCPTYSR
FT                   AATALLDGQAMTGLPVARPHSEPDAEPAGSGLSCLIFRVGEEWLALPTEAIGEVTAPCP
FT                   VHSLPHRRDAAVLGVASVRGSLLACLSLARLFGTGEESDTQAGARQGQRFLVLGQGRGA
FT                   IALPVAEVSGVRRLRNNALLPLPATLARASTRYSQALFEDQGRNVGLLDAALVRQALTR
FT                   SLA"
FT   gene            complement(227912..229162)
FT                   /locus_tag="Reut_B3651"
FT   CDS_pept        complement(227912..229162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3651"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3651"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63009"
FT                   /db_xref="GOA:Q46V25"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63009.1"
FT                   /translation="MSTATHIEALLRARIGLDARSIGPGALERALRERQAALQAHDEAA
FT                   YWNLLHSQPDEFQALIEAVVVPETWFFRHREALMALGRFAAERVFGDHARHLRVLSLPC
FT                   ASGEEPYSIAMALLDAGIPAARFRIDALDISARALARARAGIFGSNAFRGAPLDFRERY
FT                   FTPCPGGYALDARVRELVQLRLGNIVDANLLAGEAPYDFVFCRNLLIYFDADVQRRAVQ
FT                   TLARLTASDGMIFVGPAEASLLSAQGLPSAGVPLAFAFRKATPGEARSEQPLQASAAPA
FT                   PAGMPPRPVSLRVQPAPAVREPAPVRAPRAAAPTPTPLARISALADRGDLAAATAACEA
FT                   LIASQGPSADACCMLGVLHDAAGLTSSARDAYRRAIYLDPGHQEALHHLAALLDTEGDH
FT                   AGAARLRQRAQRHTRTA"
FT   gene            complement(229159..229647)
FT                   /locus_tag="Reut_B3652"
FT   CDS_pept        complement(229159..229647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3652"
FT                   /product="CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3652"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63010"
FT                   /db_xref="GOA:Q46V24"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63010.1"
FT                   /translation="MKLFLLFRLGHDHYALDATEVAEVLPLTALKQIPGSPAWVAGVLS
FT                   RQGQSVPVIDLRALATGVPAALRTSTRTVLVHYRRTPCDAPRLLGLRLEHATETLRCEP
FT                   ESFVDTGIDAGTARYLGPVRHDEQRGLVQWVRVNALLPDDVHANLFDAARDVCQASAP"
FT   gene            complement(229675..231294)
FT                   /locus_tag="Reut_B3653"
FT   CDS_pept        complement(229675..231294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3653"
FT                   /product="Histidine kinase, HAMP region:Bacterial
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3653"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63011"
FT                   /db_xref="GOA:Q46V23"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63011.1"
FT                   /translation="MNHWTIRTRILASFTFILLVMALMGVVAYNRLSAIERETNLMLKD
FT                   ALPGLNYSTGIRGAWGEVYVLAWETVKAGTESQRQGYQQQSAEVRQRLDRLEQQYESTI
FT                   TRDNDRATFNQYKAARSRYDQLALPLTQSASWKGGEAAEALLRGEANQHWAEVRRLAQT
FT                   LVDDNNAVNEKAAHGINAAVSSAKIGIEVALLVAVAMSAICGYLLLRAITVPMRSIVGL
FT                   LAGIRGGDLRLRMALGRGDEFQDVEQGFNQMTGELTSLVGQAQRSAIQVTTSVNEIAAT
FT                   ARQQQATATETAATTTQIGATSREISATARDLVRTINEVSNAAEQTAGLAGTGQVGLSR
FT                   MEATMQHVMDAAGSVNAKLATLNEKAGNINQVVTTIAKVADQTNLLSLNAAIEAEKAGE
FT                   YGRGFSVVATEIRRLADQTAVATYDIEQMVREIQSAVAAGVMGMDKFSEEVRRGMSDVT
FT                   QVGDQLSQIIGQVQSLAPRVLMVNEGMQAQAGGAEQINQALMQLSEAAQQTVESLRQSS
FT                   QAIDELTLVANELRSGVSRFKV"
FT   gene            231549..232877
FT                   /locus_tag="Reut_B3654"
FT   CDS_pept        231549..232877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3654"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3654"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63012"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63012.1"
FT                   /translation="MVAKSGAKAAGASPDGETDPLTGVGNRLGFLKRLEARLHSEAVPR
FT                   CALLLIGIDDFRAFNDMHGHAEGDLILQGVARRLRDASPRDAVIGRIGSDEFSVLLPSI
FT                   SDPTLVRHVGAAILSMLTAPHEHSGRRHHVLASVGACVMPAAGDLASDALAAASLALAR
FT                   AKHDGGRTIRFFKPQMRQDVTTRLSLVQALHEAYAQRQFELHYQPQVDLRTGHIHGAEA
FT                   LLRWRHPTRGLLAPASFIDALAASSVASDVGMWLLQTACAQARAWSLTLPQAPRVAINL
FT                   FAAQLAESRLVTEVRHVLRSLELPPAGLEIEITETIALQQGDEVSDQLQALRRDGVTLT
FT                   CDDFGTGYASLSFLKSFPVDRLKIDQSFVRNVTQDPVDAAIVRSVINVGQSLQIGVVAE
FT                   GVETVEQRDFLLANGCWEAQGYLYGRPMPAERLTEHLREQSGN"
FT   gene            233084..235909
FT                   /locus_tag="Reut_B3655"
FT   CDS_pept        233084..235909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3655"
FT                   /product="putative Chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3655"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63013"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63013.1"
FT                   /translation="MPRSGEIPAYKVLSAQDIPKRWAMYGDIRRLSAVTGLALQFLDSM
FT                   PRFLSPDRNSVSRHRSLKAGAAPLLPMLAVMAGVALTLAPWPVQAQLSPLGDPGAQVGQ
FT                   VDPPTRVATLTDAAGNLSFAPAGSDEWAAAGLNRPITTGDRLWVDNGGRAEVHAGSVAI
FT                   RLGSATAVSVLNLDDNATQVKLTQGTLQLRVRALPPDQPVEIDTPNLAFVPREPGDYRI
FT                   DVAPDGSTTTVTMRHGRAAIYGESRSLEMQRGQRMRFAGTDLADAGQGDLPPEDEFDRW
FT                   TASRDAREDASPSARYVPRDMPGYAALDGYGDWQDDPGYGAVWYPRVVQTGWAPYSTGH
FT                   WAWIAPWGWTWIDDAPWGFAPFHYGRWAYIGTRWGWVPGPRVPRPCYAPALVGFVGGAG
FT                   PYGGVRVGGGPGVAWYPLGPRDAYRPVYRASPGYVTRINRVTVNNVTIDNRFRREPHPN
FT                   RDVPGAISGMPARNFVEGRPVPRNMRGNEWRNLPQGEGRGAPPVAPVKGSLLGAAPSRS
FT                   LPPQARQGFERQAIAARPPGQPAHDDLARRFAREGGVVSGAGPVWRGGDARPRGMDGHG
FT                   AANVRMSQVAPTARPGLPPPRQDDNAMRRPPAGAERGSPPSGGDGWRGNGRGQTTRPDQ
FT                   AQGFAQMPDAQRQAQDMQRQQQQAIQRQQMEQQRQRHDAQDQAQAIQHDQQQGIQRQQM
FT                   ESLRQMQEQQRQQSDQRNMQSQRQQADQQRQQADHQRQMADQQRQQEAVQRQQVEQQRQ
FT                   QVERQRQMQDQQRQQMDQQRQQEAAQRQQIDQQRQQAERQRQMQDQQRQQMEQQRQQAE
FT                   RQRQMQDQQRQQIEQQRAMQEQQRQQQAMQRQQMEQQRQMQEQQRHAQEQQRAAQEQQR
FT                   AMQEQQRAVQEQQRRQQDQQRQMQERQRQQQQQQQQQQQQQQQTDQQRQQQRAHHDRGQ
FT                   TEARNEGDRRQ"
FT   gene            complement(236015..237196)
FT                   /locus_tag="Reut_B3656"
FT   CDS_pept        complement(236015..237196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3656"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3656"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63014"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63014.1"
FT                   /translation="MQNKTFRRLFPLAATAATIAAAMLASGAALAQEVVKIGYTGPLSG
FT                   GAALYGKNVLSGVQMAVDEINAAGLDVKGKKVKLEVVALDDKYSPAEAAINARRLVQQH
FT                   KTPAVFVPHSGGIFALQAFNEQEKFLVMAYSSVPRITDAGNKLTIRIPPAYTGYIEPFV
FT                   KAQMKRYGKNVALAPADHDYAKAWVQAFVPAWEGAGGKVVGNNPMSYTKATDFYSGVSR
FT                   AITDKPDVMFVGGPSEPTALVVKQARELGFKGGFIIMDQAKMDEMAKVTNGLSMLEGSI
FT                   GVLPLVNDGRPAAQNFNAKYKKLHDGRDATTEMSLNYTMVYALAGAMKLAGTTSDAVAI
FT                   RAKMPDAMKALPKDVNPNEVEGIDAKGGSVADTVVGWVQNGKISPVRLSELAK"
FT   gene            complement(237256..237963)
FT                   /locus_tag="Reut_B3657"
FT   CDS_pept        complement(237256..237963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3657"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3657"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63015"
FT                   /db_xref="GOA:Q46V19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63015.1"
FT                   /translation="MLQLERVSLSYGSFRALDNITLHAGAGELVVLLGANGAGKSSIFL
FT                   AMSAIYRISGGSMRFDGRELSGMKPSQIVQAGLVHCPEGRKLFPAMSVEKNLTLGAYVH
FT                   RRDSAGIRKTLDEVYEMFPILRQKKDDAAGSLSGGQQQMVALGRALMSRPRALLLDEPS
FT                   LGLAPLVVKQMFEIIQRINRAGTTVLLAEQNAYAALGIAHRAYVIEGGRIVMEGDRDSL
FT                   LKDEGIRKAYIGG"
FT   gene            complement(237950..238714)
FT                   /locus_tag="Reut_B3658"
FT   CDS_pept        complement(237950..238714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3658"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3658"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63016"
FT                   /db_xref="GOA:Q46V18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63016.1"
FT                   /translation="MLEIRNLTKKFGGLTAVNDVSVKFEQGHINAIIGPNGAGKTTFFN
FT                   LIAGTHAPSSGQILLKGQDVAGLRADQIARLGVARTFQATALFDRATVLDNLIVGHRLR
FT                   TRSGLGDVLFNTRRLREEERLCRDKAEAALDFVGLTHLAHEIAADITQEARKRVAFALA
FT                   LATDPEMLLLDEPAGGVNPEETVGLAELIRKMVRHGKTVCLIEHKMDMIMRLADKIMVL
FT                   NYGEKIAEGTPAQIQQDPHVIEAYLGADHVAA"
FT   gene            complement(238707..239732)
FT                   /locus_tag="Reut_B3659"
FT   CDS_pept        complement(238707..239732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3659"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3659"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63017"
FT                   /db_xref="GOA:Q46V17"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63017.1"
FT                   /translation="MKALQGKTGWTLLLALAIAFPQIAPNSYYLTVMTLAFIYAIATLG
FT                   LNLITGYTGQLNLAHGGFMAIGAYTLGILTVDHQVPFWLAFALSGVVCMVVGYFVGLVS
FT                   LRLKGHYFSIFTMCIGYIIYLLIEKWESLTHGTVGLIGIPVPAAIGPVTFDSVPAQYYL
FT                   VLAFLAIGTFLMHRIVTSLLGRSFMAVRNSDALAEALGINLMRTKVLSFVLSVGYAGFA
FT                   GALYAGQVRFLGPDIARTDLTFDMVMAMLVGGTGTLFGPLLGAVLVPWVTQTLQFLQDY
FT                   RMLVFGPVLILLIIFFPDGIVGSWLKKQARKAAAARRGNRPTAAAPAAAPVPTRAGADH
FT                   A"
FT   gene            complement(239743..240606)
FT                   /locus_tag="Reut_B3660"
FT   CDS_pept        complement(239743..240606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3660"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3660"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63018"
FT                   /db_xref="GOA:Q46V16"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63018.1"
FT                   /translation="MALFLQQILNGLTLGGVYSLVALGLTLVYGILHVPNFAHGAFYMA
FT                   GAYVSYFLMTSFGVNYWLAMVGAAVVVAMLSMLADRLVFHPLRNAPELHDMIAAIGILL
FT                   FLEAGAQALWGADFHRMPTPYGQVVDLFGLTAPLQRLLIIVAAFALMVLLHLFLTRTMT
FT                   GATIMAMAQNREGAALVGIDATRVTLLVFAISGALAAIAATLYAPINLVYPSMGNLVIT
FT                   KAFVIIILGGMGSIPGAIAGGLIIGMAESFGGFYVSTDYKDIIAFVLLVVILSIRPQGL
FT                   FAGKAA"
FT   gene            complement(240710..241078)
FT                   /locus_tag="Reut_B3661"
FT   CDS_pept        complement(240710..241078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3661"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63019"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63019.1"
FT                   /translation="MPLPCNPRHGCSSGITSMPRALLAAMTRRLFRCAEYWTGFLDWPF
FT                   SPMQKSMKTNDRAGIITLPRHGVAGHDRNRGATAQTASHRRQTMQHQQYVPVHERNARP
FT                   AHGAAPTAAPLAAAHAPD"
FT   gene            241180..242109
FT                   /locus_tag="Reut_B3662"
FT   CDS_pept        241180..242109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3662"
FT                   /product="regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3662"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63020"
FT                   /db_xref="GOA:Q46V14"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63020.1"
FT                   /translation="MKRSTSIPAPPPDAAHVMPAMPCAAAHLAHNAYTADDRNFVTALA
FT                   RGMELLRAFGPHDDYLGNAELSRRTGIPRPTVSRLTYTLASLGYLSYIESMEKYRLGQG
FT                   AMVLGHRYISGAGIRDIAQPLMQSLAFATDCTVALAMPDRHAMVYLESCQPRGALVIRL
FT                   APGARLPMATSAMGRAWLAGLDSAHREAALAELERHYGARWASVRSKIERSLRDHARRG
FT                   FCVAHAEWDRTVSGAAAPLRLEGSGEVLALNIGGAATRLSPEILESNLGPRIRDLAQTL
FT                   QARLWQAGAGRQGSTRTAAATSDACESN"
FT   gene            242143..242955
FT                   /locus_tag="Reut_B3663"
FT   CDS_pept        242143..242955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3663"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3663"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63021"
FT                   /db_xref="GOA:Q46V13"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63021.1"
FT                   /translation="MQVKDKTVVVTGAATGIGRALALAFAQAGARGVAIADLNAAGAAT
FT                   VAAEVQAAAPDCKVFAQAVDVSDEAAVQSLADEATRRFGRIDVFCSNAGIILRKGLDAS
FT                   AEEWQRIWDINVMAHIHAAKAVLPQMLERGDGYFVNTVSAAGLLSQIGSAPYAVTKHAA
FT                   IGFAEWLSITYGDRGIKVSCICPQGVQTNMLFGESGERKGFLQEGSVTAEHVAAATLEG
FT                   IAGERFLILPHPEVLEYYRRKGQDYDRWLRGMRRLHDKVMQEFGGIAV"
FT   gene            243020..243994
FT                   /locus_tag="Reut_B3664"
FT   CDS_pept        243020..243994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3664"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3664"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63022"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63022.1"
FT                   /translation="MRVSSVAAVALVAAAVFSAPAVQAQAYPNKPIRMVVGFPSGGAPD
FT                   TLARIVSEKISPSWGQPVVVDNKPGAGGNIGAEAVAHAPADGYTLAMGTVGTHSINGAL
FT                   YSKMPYDMVKDFTPVILVATTPNVLVVHPGVPAKNVSELIALAKARPGGLTFGTPGVGT
FT                   SLHVAGELFNSMAGVKITHVPYKGRAMAIPDLLGGHITMMFDNLPSALPVVKEGKLRAL
FT                   GVTSAKRSPSAPDIPTLAEQGLPGFEADSWFAIFAPANTPKDVVAKLNAEFNRIYSLPD
FT                   VQAKLKTLGLDPVLGTPEKLAAYQRSEIAKWAKVVKESGAKAE"
FT   gene            complement(244020..245420)
FT                   /locus_tag="Reut_B3665"
FT   CDS_pept        complement(244020..245420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3665"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3665"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63023"
FT                   /db_xref="GOA:Q46V11"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63023.1"
FT                   /translation="MSSHQGLPHPQRSWAILTVFCGLIMAVLDGSIANIALPSIARQLQ
FT                   SEPSNTIWVVNAYQLTVTVCLLPLSSLGDIFGYKRVYRAGLATFLVGSLLCALAVNLPM
FT                   LVAARVLQGLGGAGIMSVNTALVRFIYPPTRLGRGIGLNALVVGVTTAIGPSLGALILS
FT                   LASWQWLFAVNVPVAIFALALSRSALPDTAPQPREFDYPSAVLSAVVFGLFILGVDGLG
FT                   HASLRIAGAAAVGGAIVLGWVLVRRQHGRPSPLVPVDLFASRAFTLAVGTSFCSFMTQM
FT                   LSFVALPFYFEYQLGRSLHETGLLITPWPLTVALMAALSGRLSDRYPASILAGAGLALL
FT                   AAGLLGLALLGRDATSLDIAWRMAICGLGFGLFQSPNNRAMIGATPPERSGGASGAQAT
FT                   TRLLGQTTGTAVVALLFSFDQTGAGRLALYAAVGMATLGAVISLSRLRDGSSPRHAGTA
FT                   VIRDEPDA"
FT   gene            complement(245531..248920)
FT                   /locus_tag="Reut_B3666"
FT   CDS_pept        complement(245531..248920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3666"
FT                   /product="Response regulator receiver:ATP-binding region,
FT                   ATPase-like:Histidine kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3666"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63024"
FT                   /db_xref="GOA:Q46V10"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63024.1"
FT                   /translation="MQQLFDSTRVSLASAFDTLADNARRQQHLYSATIAVLIALVVFAA
FT                   IVLVALEADKHLSRQHNQVAGYVGSISQRLESEAAFLRRSVLSVRRYHESGSAQSPDAA
FT                   TVQSVRATGVARISDKIAGHDYYLLATAATRHAWGPAMPTQLARLQQIALGTLATQQAF
FT                   GLDHWVYVLSLENDSAAILARQPSAAQVTVPIQPALIDTLRGIITQALLDRTGHAVPPG
FT                   GEQLWAGPVRDPLTGAMVMLSLGAAYTGDTPTVLLAACVPVVDFLAQLDRPGDTALLAL
FT                   LNPADAAIDVAAPALPVEGPVVSAVMAQARRQPHNVSHYTRRGVLMVQPLQPGFGVLVC
FT                   FLPYGLLVPALAPELAVILSVALLLIGAIVLSARYWDRQMLRRTHSEAARALENEILNQ
FT                   ILVSATPVGLCIVRQRDYSVLTSNQLAQALLRLDKANALPAQVTEAFERQPPGAEASQP
FT                   APINNFTVPAPGDDAAAQRYLQVTYAPARYHDDKVLFCAVQDITTQQALEQQLRTAQQA
FT                   TEAMMRARSSFFASMSHEIRTPLNALIGNLELLARSPGLEGHAQRLHVLGTAAEGLRRI
FT                   VNDILDFSKIDAGKLELVDKPFRLAEALEGLALTYAPMATVRGIRLQLQLAPELDREVC
FT                   GDGMRLTQVVNNLLNNAFKFTTSGRITLSGSYGAGADGRHMLTCRVGDTGIGMPAALVE
FT                   RIFQPFVQGDDVATGRYGGTGLGLSICARLCELMGGSIGVQSVQDVGSAFTILVPLAPT
FT                   VDDAAFATVSDIPPARHGSVMVLSQDGKTGDCIEAWLTTAGWRPHVLASLAAAREHLET
FT                   HRPQAIVATEEFDPGALESLHAVSCAPVIWMTPDGPHRPRRRAPGVVEVSSFSHEALLA
FT                   CVATATAGLPDPPALASTAGIAGGPVVSASLPDTTGLTVLVAEDNPLNQTLVSEQLRIL
FT                   GYQPIITDNGKQALAVVESTHVDVVLTDIHMPVMNGHALLDALRELRPDLPVLAFSALA
FT                   QQEHSEDWQQRGFKGYVTKPASLHELGQALQGVREASIASANQERYARLLRKQLQSDLP
FT                   ALAQVLGANDVDALQAWAHRAASGFRIVRQNNLYAHCREVERLCLDADRWSPAIAAAGD
FT                   VLRVLAQRYAGEGPPVSPTAMA"
FT   gene            complement(248928..249575)
FT                   /locus_tag="Reut_B3667"
FT   CDS_pept        complement(248928..249575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3667"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3667"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63025"
FT                   /db_xref="GOA:Q46V09"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63025.1"
FT                   /translation="MNGPLIRVAVADDHPLVVTALRDCLHRSARFHIACECTGGSELVQ
FT                   ALDRQPADIAITDFCMGHGDATLDGFNLLNRLARRHRGTRIVVVSAQSNAAIIRRAVKL
FT                   GARAFVSKEDELEETLRACFHVMTSESCYYSPSIRAILDDAAMVDAPATDLTLRELEVV
FT                   RLYAQGMQLNEIAAKLGRSVSTISSQKTVAMRKLGVNTNTDLIRYAYENGLI"
FT   gene            250217..250567
FT                   /locus_tag="Reut_B3668"
FT   CDS_pept        250217..250567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3668"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63026"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63026.1"
FT                   /translation="MPPACTFFCVAQSRAAHAPAARMRRSHDLTEDAMATRPFSEFSPE
FT                   EQQQFAQVCGQMGMAPDDFDVTDELNGNALRRISVRRLSTEASSAYQAGGTEWVEEFES
FT                   DLECGLFGRVTV"
FT   gene            complement(250591..250884)
FT                   /locus_tag="Reut_B3669"
FT   CDS_pept        complement(250591..250884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3669"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63027"
FT                   /db_xref="GOA:Q46V07"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63027.1"
FT                   /translation="MDFTPQIVPNLLNGLEWSGCALAMSGSLLVALHNRASRWGWIAYL
FT                   CSNLVWSVFALVTGTYGLFVQQLGFTATSCYGLYRHTKYHRELDQKAAHAAA"
FT   gene            complement(251063..251506)
FT                   /locus_tag="Reut_B3670"
FT   CDS_pept        complement(251063..251506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3670"
FT                   /product="BLUF"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3670"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63028"
FT                   /db_xref="GOA:Q46V06"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63028.1"
FT                   /translation="MLVRLLYASRARQAIDAATLDAILTTSLERNPRHGITGVLCHGNG
FT                   IFLQALEGDRQEVSRLFQAITRDPRHHDLVLLQYEDICEREFAGWAMGHVNAARINTAT
FT                   LLKFSARAELDPFCTSGQASLALLKELIAGASVVARTAERGRP"
FT   gene            complement(251526..252269)
FT                   /locus_tag="Reut_B3671"
FT   CDS_pept        complement(251526..252269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3671"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3671"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63029"
FT                   /db_xref="GOA:Q46V05"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63029.1"
FT                   /translation="MTDKDAAHHGAKHKTSDAAPGESSVSDRIRSRLLAARERFHANDN
FT                   IARYIEPGELDALQEEVQARLEEVLRALVIDVDQDHNTRETARRVAKMYLKEIFAGRYA
FT                   KAPAVTEFPNVEQLSELMIVGPLRVRSACSHHLCPIIGKLWVGVMPNQHSNLIGLSKYA
FT                   RLAEWIMCRPQIQEEAVAQVADLLQEKMNPDGLAIVMEAEHFCMHWRGVRDTDAKMTNS
FT                   VMRGSFLKDGSLRREFLALLNRNGK"
FT   gene            complement(252711..253970)
FT                   /locus_tag="Reut_B3672"
FT   CDS_pept        complement(252711..253970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3672"
FT                   /product="arsenite efflux membrane protein ArsB"
FT                   /note="TC 3.A.4.1.1; TC 2.A.45.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3672"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63030"
FT                   /db_xref="GOA:Q46V04"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63030.1"
FT                   /translation="MSSVSAVLIWAIAALTTAGVLLRPFRLSEAFWAVAGAVLLCVGGL
FT                   LAVPDALAAVMRGLDVYLFLAGMMVSSELARKTGLFDHVAALAVRRAGGSARALFLLVY
FT                   GFGTLVTAFMSNDATAVVLTPAVLAATRAAKVQNPLPHLFACAFIANAASFVLPISNPA
FT                   NLVIFGTRMPPLAGWLAHFALPSLVAVVTTLAALYWTQREALAERIASDVPVPPLSLQA
FT                   WLTAVGIVLTGVALLAASLRGSDLGWPTCAAGAATLLIVCATKRDLLAPALREISWGVL
FT                   PMVAGLFVLVAALEHTGVIHWLADIIQAASRQDSLARLWGIGAAVALIGNVANNLPAGL
FT                   IASSALAAGHASNAVTGAVLVGIDLGPNLSATGSLATLLWLTALRRDGHMVTAGQFLRL
FT                   GAVVMPTAMVPTLAVLALAR"
FT   gene            complement(254026..256065)
FT                   /locus_tag="Reut_B3673"
FT   CDS_pept        complement(254026..256065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3673"
FT                   /product="Penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3673"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63031"
FT                   /db_xref="GOA:Q46V03"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63031.1"
FT                   /translation="MKKFAVKAGGAALALAAAGVLLAGFAAVVSLRQLPPVDALREYRP
FT                   DVPLRIFTSDNVQIGEFGSEHREFIAFDKMPRQMTQALLAAEDDQFYEHDGIDIPGMFR
FT                   AALANLGKGYSQGASTITMQVARNFYLSREKTLARKWYEILLAWQIDRTLSKDRILELY
FT                   MNQVYLGEHAYGFGSAAHAYFGKPLDGLSLAETAMLAGLPKAPSTMNPVVNFARAKRRQ
FT                   EYVLGRMLALGMISQDQYRDARSAQLDIAPDNAGQFAGHAEYVAELARQLARDRFGDEA
FT                   YTRGLNVYTTVSSVRQTMAYDAVRRGLEGYGKRHRLASPAGAPQAALVSLDGDTGAIEA
FT                   MVGGADFDTNRFNHATQALRQPGSTFKPFIYAAALEHGVSPGTLINDAPLDNNSRWQPS
FT                   NDDGRFLGAVTVRQALAESRNLPAIRTLQAIGIPYAVEFASRFGFSTKRLPRFLPLALG
FT                   TGTTSPLRLASAYAVFANQGHRVEPYLISRITDSEGHVLFAADNATEPPRVISERNAFV
FT                   MDSLLRSVVDDGTGAGVRRYLHREDVAGKTGTTNDSVDGWFAGYAGNVVTVAWMGYDDN
FT                   HSLGAHEFGATTALPIWASYMEGRMAGTPVAERAAPSGVVRSSGDWTYAEYADGRQGIA
FT                   SLGFPAPLPAPAQDAAATPVASEAVGLPGQPAAPAASRDDRASL"
FT   gene            complement(256076..256966)
FT                   /locus_tag="Reut_B3674"
FT   CDS_pept        complement(256076..256966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3674"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63032"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63032.1"
FT                   /translation="MSSLMRRALAATLVTASGFACYWTYLTVNQARLLFDARRRPPRDL
FT                   PDGIIGYSHIVPGGMLRGYIYHAPGERVRDLLFYLPGRGEDVLETLQFARWLPPGMGFA
FT                   TFDYRGLGHSDGQPSEAAAVADASQFLLHLRRVFPGTRAHVVGRSLGTGVAIQLADLQD
FT                   FESLQLITPYDSMLELVRKRFPLVPLRQLMRHHFDSISHCKKVVQSTKVLLAETDDVVP
FT                   HACSERLVAAWPAPVVLETMHGTDHFTIVERQETWLALCEFARQVQHDPLPDTPRTAPT
FT                   DHDESGVPLPLPRFR"
FT   gene            257141..257383
FT                   /locus_tag="Reut_B3675"
FT   CDS_pept        257141..257383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3675"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63033"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63033.1"
FT                   /translation="MSEQKHEQLRAEEAQAMQRVVDATRQVQVAFSALQSQYPPQGSGK
FT                   PSKMALQTFDAALQALEDAQATFDEILNDLLDEKR"
FT   gene            complement(257465..257875)
FT                   /locus_tag="Reut_B3676"
FT   CDS_pept        complement(257465..257875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3676"
FT                   /product="Protein of unknown function DUF779"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3676"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63034"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:Q46V00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63034.1"
FT                   /translation="MPRVSADSAGATPVTVTRVVATPAALALIGELRARHGPLMFHQSG
FT                   GCCDGSAPMCFGAGDLIVGDSDVCLGEIGGAPFHMTRAQFEYWQHTRLVIDVVTGAGGM
FT                   FSLESGTGKRFLTRSELFSDEEAAVLAAQPPL"
FT   gene            complement(257884..258912)
FT                   /locus_tag="Reut_B3677"
FT   CDS_pept        complement(257884..258912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3677"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3677"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63035"
FT                   /db_xref="GOA:Q46UZ9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3S1L"
FT                   /db_xref="PDB:3S2E"
FT                   /db_xref="PDB:3S2F"
FT                   /db_xref="PDB:3S2G"
FT                   /db_xref="PDB:3S2I"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63035.1"
FT                   /translation="MPAMMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTD
FT                   LHAADGDWPVKPTLPFIPGHEGVGYVSAVGSGVSRVKEGDRVGVPWLYSACGYCEHCLQ
FT                   GWETLCEKQQNTGYSVNGGYGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKGLKV
FT                   TDTRPGQWVVISGIGGLGHVAVQYARAMGLRVAAVDIDDAKLNLARRLGAEVAVNARDT
FT                   DPAAWLQKEIGGAHGVLVTAVSPKAFSQAIGMVRRGGTIALNGLPPGDFGTPIFDVVLK
FT                   GITIRGSIVGTRSDLQESLDFAAHGDVKATVSTAKLDDVNDVFGRLREGKVEGRVVLDF
FT                   SR"
FT   gene            complement(259029..260549)
FT                   /locus_tag="Reut_B3678"
FT   CDS_pept        complement(259029..260549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3678"
FT                   /product="Aldehyde dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3678"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63036"
FT                   /db_xref="GOA:Q46UZ8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63036.1"
FT                   /translation="MNMAEIAQLGVTNPYKQQYENYIGGAWVPPAGGEYFEAITPITGK
FT                   PFTRVPRSKQEDVDAALDAAHAAKAAWGRTSTTERANILNRIADRIEANLTLLAVAETI
FT                   DNGKPVRETMAADLPLAVDHFRYFAGCIRAQEGGISEIDAETIAYHFHEPLGVVGQIIP
FT                   WNFPLLMATWKLAPALAAGNCVVLKPAEQTPASILALMEVIGDLLPPGVVNVINGFGLE
FT                   AGKPLASSPRISKVAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLAADDA
FT                   YFDKALEGFAMFALNQGEVCTCPSRALIQESIYDRFMERALKRVAAIRQGHPLDKGTMI
FT                   GAQASAEQLEKILSYIDLGRKEGAQCLAGGERNQFDGDLAGGYYVKPTVFKGHNKMRIF
FT                   QEEIFGPVVSVTTFKDEEEALAIANDTLYGLGAGVWTRDGARAFRMGRGIQAGRVWTNC
FT                   YHAYPAHAAFGGYKQSGIGRENHRMMLDHYQQTKNLLVSYSPNALGFF"
FT   gene            complement(260788..261105)
FT                   /locus_tag="Reut_B3679"
FT   CDS_pept        complement(260788..261105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3679"
FT                   /product="Protein of unknown function UPF0060"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3679"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63037"
FT                   /db_xref="GOA:Q46UZ7"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46UZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63037.1"
FT                   /translation="MNTIALYLLTAVAEILGCYLPYLWLRQGASAWVLLPGALSLALFA
FT                   WLLSLHPDASGRVYAAYGGVYIGVAVLWLWLVDGVRPSAWDLAGVGVAFGGMAIIVFQP
FT                   R"
FT   gene            261255..262250
FT                   /locus_tag="Reut_B3680"
FT   CDS_pept        261255..262250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3680"
FT                   /product="putative hydrolase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3680"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63038"
FT                   /db_xref="GOA:Q46UZ6"
FT                   /db_xref="InterPro:IPR011217"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63038.1"
FT                   /translation="MPLRSLRAVLAAGIMAVSVTTVCAQGTVPPRVQSYPVPAGAHPHD
FT                   VAPAPDGAVWYTAQSTGELGRLDPATGKTIHIPLGEASAPHGVIIGPDGAAWVTDGGQN
FT                   AILRVDPGTHGVKRFPLPAGQANVNLNTAVFDTRGRLWFTGQNGVYGELDPASGHMRMF
FT                   DAPRGRGPYGIAVTPKGDVYFASLAGDYIARIDTATGAAQVMTPPTPKSGPRRIWSDSK
FT                   GTLWISEWTAGKLGAYDPGTARWREWKLPGDSPHAYAMYVDEQDKVWLSDWGRNAVLRF
FT                   DPQAGKFETFTSPRPDANVRQMLGRPGEAWAAESGTDHLVVYRFGTGAPR"
FT   gene            complement(262284..263528)
FT                   /locus_tag="Reut_B3681"
FT   CDS_pept        complement(262284..263528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3681"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3681"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63039"
FT                   /db_xref="GOA:Q46UZ5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63039.1"
FT                   /translation="MRGTADTTRSDPRQTARQIRLLFVLQCISMGAMEMSGPFWPIHLR
FT                   AMSSSDAVFGFAGIAVYVGPMLGIVLTSTFWGRIGDRYGHKPMMVRALAGLCLTQLALA
FT                   WSQDVWTILALRFLQGACAGYIAPAQAYGVSIESPLRRGRLFAFLQVSTNVGSLLGAVA
FT                   GGLILDVASFYWINVIAAALCAACAAAVATCLPTVPPAPSAPPVATSTGHGVARYSPQM
FT                   LILLGTMGLLLISRMMPQTPFSIYVSSVFAVSNWVVGLCYGLLALGFIVSAAPWARYFE
FT                   GRQADDALRRIGCVVAACAALAAVAAVTRSIAVFVAVYFLWGLLLGATTPVLTAMISRA
FT                   AGDAGQGQLLGMTQSVTQMSAIAGITLGGWLSQTAGLQYTYAFVCAAYLMTLLPMIVLQ
FT                   RRRAPLISPRPVDRA"
FT   gene            complement(263528..265441)
FT                   /locus_tag="Reut_B3682"
FT   CDS_pept        complement(263528..265441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3682"
FT                   /product="IucA/IucC"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3682"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63040"
FT                   /db_xref="GOA:Q46UZ4"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63040.1"
FT                   /translation="MLNLQSASRTTTATDDPAANGEADTAFSRRNALRRLVRCLFAEGI
FT                   LDKTRLVLAPHGRQAWFPLWKQQAIVYFDDLEAAPADTFLNHGSITLLRADGMHLPLDT
FT                   HEALIDALRDSFDFAPRDVGVDGLKADMLNSVRNDANVRMHRQGWATALRSDMAEAGVV
FT                   RLTDYLRRHVSTRDAAMLLDQWGALEGHPYYPTWKAKPGLRDDEVLALSPECQARVNVR
FT                   IGALRADMAYVERMPHVQDAHAWFATQFPSLWQAWKTGLNARGLCESDWLPMPIHSWHL
FT                   NAHVRSAYANEIADGILIVDGPDLPTLPTMSFRTVLPATPQTAPFIKLPVALWMTSEQR
FT                   SLQAKSIHMGPRISALIEHILKTEDGFGRTLEIFPEEIAWHYRNALTKDDAPGKHLSVV
FT                   FRASVPALDRDDGCLPVTVAALFTERPDGGGPLFTELVEAGAGDVTAQDAAQRWFRQYA
FT                   RTVTRPVIAIYLLYGIALEAHQQNTQVLFDANGQAQRLLVRDFGDGRTYAPLLAARGLT
FT                   LRPYAWPGILPTVFDGDIEPVRTFVIDACFVSHLHEIALGLFHTYGFSTARLWEILREE
FT                   TIAAFDAVQARVDPAFWAEEQRIFLEDPWSTRSLLRMHLLKYSDYRLQHGLTNPLRQGK
FT                   EA"
FT   gene            complement(265447..266580)
FT                   /locus_tag="Reut_B3683"
FT   CDS_pept        complement(265447..266580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3683"
FT                   /product="Ketopantoate reductase ApbA/PanE:NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3683"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63041"
FT                   /db_xref="GOA:Q46UZ3"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63041.1"
FT                   /translation="MSAPPLCVTVCGGGRTGHLNAILFAQRPGVRVKLLTRNHHIAARQ
FT                   DAVLTGLLPDGATLTASAGMVTDDPAVALRDADIVIITVPAHARPSLLREIVAHLPEGK
FT                   AVYVGAIPGFCGFDWLAGALLAQRPNAVIWGMKDVPHTAFALDPGVSVRMGGVKQRLYV
FT                   GCHAREQRAARQALLSHLNRLYDASVELLDSYLEITLTPGNPIMHSAVIYGLIGPYGQW
FT                   HGRALPTPLCWWTDCPELSAYFLERADEESQRLCQAVARRLGVDLSSVKPLRQEIVDAY
FT                   GDQIQDPSTMLSVLRTNRAYADIEAPLVPTSGGYLVDTSSRAFHEDVAYGLATLVEMAR
FT                   RLGVDTPHLREIFEWNVTYMGGLRGSALDYFPEFWPR"
FT   gene            complement(266577..267620)
FT                   /locus_tag="Reut_B3684"
FT   CDS_pept        complement(266577..267620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3684"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3684"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63042"
FT                   /db_xref="GOA:Q46UZ2"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63042.1"
FT                   /translation="MILWKVSDLIGNTPMLGIPVPDKDSVLLLKVEKNNPGGSMKDRMA
FT                   RNMVLAALKSGRLQPNGVIVESSSGNTGIGLALAAIEFGLRFIAVVDHHAAPDKIAVMR
FT                   ALGAEIRYVEGNFQENEVAVVERQRLAAEIASQTPGAVFMNQSDNAANAGGYLEFVRET
FT                   FAQAREVNAFVGCVGTGGSMTGIARGVKQFNPDAVTIAVEPSGSIVFGMPGHPYYQSGT
FT                   GTPQGDTVGLVLDYSCIDMGVQVTDAQAFETARYVARQTGLLVGGSTGGAIYKALEAIH
FT                   DSQIRGNVVVPVADGGEKYLHTVFDEDWLRARNLLAPQVWQRLDAWLGKATCRDEVAPD
FT                   VLRLNAA"
FT   gene            complement(267633..269081)
FT                   /locus_tag="Reut_B3685"
FT   CDS_pept        complement(267633..269081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3685"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3685"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63043"
FT                   /db_xref="GOA:Q46UZ1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042152"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63043.1"
FT                   /translation="MTASLTTNAPSDQTMWTDHDSVRALPDRYRTVPPGQLPPFWDPVI
FT                   ARMLRNAPHLLAAAVAQYGSPLNVLWPHALRNNVAALRAVLATHCVQAEIFYGAKVNKS
FT                   QALVKAAVMAGVGIDVSSRHELRDALRAGADALRICATGPAKTEAFHEQLLAHGALISV
FT                   DSLEELDDVCACLRRAPAGRHARVLLRYCPDSARGSRFGMAADTVVQGLKHIASATERL
FT                   AFEGFHFHLSGYGWETRAQALRELLPLIDAADSMGLTTTMIDIGGGLPVRYVDPDVYTE
FT                   FLQSQRPEHYRNGIVPASFYPYGGHIDAATWLDDFLNAPCTAGQSIAAWLRAGGVTLAL
FT                   EPGRCLAAQAGITVFRVTRSKPLGDGRHVVFVEGSSFSACETWFASEFLADPAWISAVP
FT                   PRTVGARPVQAYIAGHSCLDEDVLTNRLLPFGGLPHPGDLLVYANTAGYQMDLLENEFH
FT                   RHPMPRRVAAQCGDAGRVSFSLDQ"
FT   gene            complement(269098..271362)
FT                   /locus_tag="Reut_B3686"
FT   CDS_pept        complement(269098..271362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3686"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3686"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63044"
FT                   /db_xref="GOA:Q46UZ0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63044.1"
FT                   /translation="MPVPGQTALAAPLTTTRSFQTTSTLPGIAAACPRPAWRGLAPSLA
FT                   MAGLLALTTLDPARAQDGATATGNVSAQTLPEVRVTADASPEDLPAPYAGGQVARGARL
FT                   GVLGNTSIMKAPFNVSSYTAQMIQDQQSPTLADAVNKDPSVRFTGLPGGNIDNFYIRGF
FT                   PVGEGNSGEIAFDGLYGVAPNYRVFTDYVERLEVIKGPAAMLYGMSPNSGVGGVINIVP
FT                   KRAHEDLASVTASYASDTQFGGHVDLSQRFGESREWGVRFNGSYYQGDTPMDNQSRKAG
FT                   IGALSLDYQGKQLRASLDVIGQQEKIDAPGRAFIMGPGLQAIPGAPDGRRNVTQPWEWT
FT                   RGTDESLLFRTEYDINDHLTVFADAGGGWTQLSRLFGTTPQIVNAQGDTLSTPTYYKFK
FT                   VDRATYDAGLRSRFDTGPLRHAVTFQASAYADSLDRANTTGTPVASNIYNPVVRPAQGL
FT                   PAPDSVPKVSDNDQTGFSLADTMSALDDRVLLTLGVRQQRIRSRNFGATGAVTSSYEES
FT                   ATTPMAGLVVQPWKRVSLYANYVQGLSKGDVAPPTASNSGEVFAPYKTTQYEVGTKVDF
FT                   GRFSATLAAFQISKPSGQLGGNVFSVNGEQRNRGLELNLFGQVAPGVRLLGGVALIDGE
FT                   ITRSGTAAAVGKDPIGVPRVQANLGAEWDLPWVAGLTVSGTMIYTGRQYVNQLNTASLP
FT                   SWARFDLGARYRTRITGKTTTFRANVLNVFDRNYWSGVTSWGGFSQAAPRTVMLSATVE
FT                   F"
FT   gene            271526..272005
FT                   /locus_tag="Reut_B3687"
FT   CDS_pept        271526..272005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3687"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63045"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63045.1"
FT                   /translation="MASPSLLAETMNDIPETSALARHDARGYGIAVLPISFFRQSEEVD
FT                   MEGVWILTELIASDGCWLAPIPVEASHGIVMDGNHRLRAAMRLGLKCLPCIPLCYGDAR
FT                   ICVRDWHSGEPFDTRCILHTVAAGALLPHKSTRHFFEPSLPRTSIPLERLRTQGR"
FT   gene            complement(272271..273185)
FT                   /locus_tag="Reut_B3688"
FT   CDS_pept        complement(272271..273185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3688"
FT                   /product="Dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3688"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63046"
FT                   /db_xref="GOA:Q46UY8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63046.1"
FT                   /translation="MTTPQELKQIISEGLLSFPVTDFDTQGNFRPETYVKRLEWLAPYG
FT                   ASALFAAGGTGEFFSLTPDDYSNVIRTAVETCAGKVPILAGAGGPTRVAIAYAQEAQRL
FT                   GAKGILLMPHYLTEACEEGIANHIEEVCKAVNIGVIVYNRANSRIGADLLERVVDRCPN
FT                   LIGFKDGVGEIEAMVRVRRKLGDRLAYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPR
FT                   TAMEFYRAVAADDHATIGRLIDDFFLPYLDIRNRRQGYAVSIVKAGARLVGYDAGPVRA
FT                   PLTDLTADETEKLDALIRKLGPQ"
FT   gene            273554..274930
FT                   /locus_tag="Reut_B3689"
FT   CDS_pept        273554..274930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3689"
FT                   /product="D-galactonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3689"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63047"
FT                   /db_xref="GOA:Q46UY7"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63047.1"
FT                   /translation="MNASPTSTSTTAAGSAATARRTNIRYWILAMIFIVTTVNYADRAT
FT                   LSITGPAMREAFGFSAVQMGYIFSAFSWAYVMAQIPGGWLLDRFGARRIYAASICLWSV
FT                   FTLLQGWVGVFASMGAVMTVLFMLRFAVGLAESPAFPANAKVVASWFPTSERGTASAIF
FT                   NAAQYFAAVVFTPLMAWVTHSWGWHHVYLWMGVIGMALALLWLKVMRSPADHPAVNRAE
FT                   LEHIEQGGGLIHMNEGAARGAGKAAAPAGWFYARQLLSNRMLAGVYLGQYCINVLTYFF
FT                   LTWFPVYLVQARGMSILKAGFVASLPAICGFLGGVLGGMISDALLRRGHTLTVARKVPI
FT                   VAGMLLSVSMIACNYVDAEWLVVGFMALAFFGKGIGALGWAVVADTAPKEVIGLAGSIF
FT                   NTFGNIAGIVTPIAIGYILSVTGSFNGALVFVGVHALVTVLSYLVIVKDIRRVELRHPQ
FT                   "
FT   gene            274948..276522
FT                   /locus_tag="Reut_B3690"
FT   CDS_pept        274948..276522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3690"
FT                   /product="galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3690"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63048"
FT                   /db_xref="GOA:Q46UY6"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63048.1"
FT                   /translation="MSEHDSQAVKAPLYIRIHPEDNVAIVANDGGLPAGAAFPCGLVLQ
FT                   EAVPQGHKVALSDLKQGDAVVRYNVVIGYALKDLPRGSWVNERVIEMPVAPGLTDLPIG
FT                   TRVPAPLPPLEGYTFEGFRNPDGSVGTRNILAITTTVQCVSGVVEHAVRRIREELLPRY
FT                   PNVDDVVGLEHTYGCGVAIDAPDAVIPIRTLRNIALNPNFGGTAMMVSLGCEKLQPDRL
FT                   MPAGTIPIQTGAGEVQVGVVCLQDEQHVGFASMIASIMTMAETHLERLNARRRETCPVS
FT                   DLVVGVQCGGSDAFSGVTANPAVGFATDLLVRAGAAVMFSEVTEVRDGIDQLTARAATP
FT                   EVADAMIREMAWYDRYLERGRVDRSANTTPGNKKGGLSNIVEKAMGSIIKSGRAPISGV
FT                   LSPGEKLKQKGLIYAATPASDFICGTLQLAAGMNLHVFTTGRGTPYGLAEVPVIKVATR
FT                   SDLARRWHDLMDVNAGRIATGEATIEDVGWELFRLMIDVASGRKKTWAEHHKLHNALAL
FT                   FNPAPVT"
FT   gene            complement(276855..277619)
FT                   /locus_tag="Reut_B3691"
FT   CDS_pept        complement(276855..277619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3691"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3691"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63049"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63049.1"
FT                   /translation="MARKLDNKVALVTGGTSGIGLATAQRFATEGAHVYLTGRRQAELD
FT                   TAVKSIREAGGNATGVRVDSTKLGELDALYAQIKEEQGHLDVLFANAGGGSMLPLGSIT
FT                   EEHYDDTFDRNVKGVLFTVQKALPLLAQGASVILTGSTAGSAGTAAFSVYSASKAAVRA
FT                   FVRSWILDLKDRRIRVNTISPGATRTPGLLDLAGDDITQRQGLADYLAAQIPMGRLGEP
FT                   GEIASAALFLASEDASFVNGVELFVDGGQQQV"
FT   gene            277757..278674
FT                   /locus_tag="Reut_B3692"
FT   CDS_pept        277757..278674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3692"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3692"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63050"
FT                   /db_xref="GOA:Q46UY4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63050.1"
FT                   /translation="MPKLPDFEGLAMFAKVAEEGSFTAAARVMGVSVATVSRGVARLEE
FT                   RLGARLFNRTSRELSLTGFGQTICDKAGAIYRQAEEAESAAREMSVQPRGLVRLAVPMS
FT                   FGLRWVAPLLPGFFRAYPEVSIDMHLSDASVDLVADGYDAALRIAALPDSSLVVRRLCA
FT                   VTQFVVASPAYLKREGRPAHPRELADRSCLSYAYRARSDVWRFTNAVGEEESVMPTGPL
FT                   RVTNSEALLPTLLDGLAIAELPEFIAGEYLADGRLETILTDWSLTKGGLYFVTPSARAR
FT                   PAKVAALSDYFAEHLSEPTWRWPR"
FT   gene            complement(278705..279625)
FT                   /locus_tag="Reut_B3693"
FT   CDS_pept        complement(278705..279625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3693"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3693"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63051"
FT                   /db_xref="GOA:Q46UY3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63051.1"
FT                   /translation="MLDYAALSALAAVIREGSFERAARALSVTPSAISQRIRLLEEKVG
FT                   CTLVVRDQPCRPTETGRRLCQHIDRVRLLEQELQEALPALAPQGLARVTLPVAVNADSL
FT                   ATWIAPAIARFAAENPVLMDVAVDDQDHTTEWLRCGAVLAAVTATARPAAGCNSSPLGS
FT                   MRYRAAASPGFMRRHFADGVGAGSLAKAPSLVFNTKDELQARWARRLCHRHVELPRHTL
FT                   PSAHAFVSAAIAGMGWGLHPESLIEPYLDDGALVELVADTPLDVPLHWQHARATSGLIE
FT                   GLSREVLAAARVALLPPLSAKVFPR"
FT   gene            279699..280349
FT                   /locus_tag="Reut_B3694"
FT   CDS_pept        279699..280349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3694"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3694"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63052"
FT                   /db_xref="GOA:Q46UY2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63052.1"
FT                   /translation="MNSLPDTASLALSIALQGLALSLGLIVAIGAQNAFVLRQGLRRQH
FT                   VGSVVLFCAAADALLIAAGVMGMAQALGDRPGLARALAVAGSVFLAIYGWQALQRARQS
FT                   HQLKAADGVDGLGRGAVLAQAAAFTLLNPHVYLDTVLLVGSIGAQQPAALRGWFVAGAS
FT                   AASLFWFGLLGFGARWLAPWFARPKAWRVLDGVIAMTMFVLSALLVRHVFNAV"
FT   gene            complement(280591..281571)
FT                   /locus_tag="Reut_B3695"
FT   CDS_pept        complement(280591..281571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3695"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3695"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63053"
FT                   /db_xref="GOA:Q46UY1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63053.1"
FT                   /translation="MDIREKKTPPTLAPGQTSNPATSLPPRTVEGLRDLVVSIGRDQAE
FT                   VKLGAKALTVLAHLVERPEEVAVRTITDLANSLDVNASTLTRLATRLGFEGFAEFQGVF
FT                   RNSMAQRHRHFYSQQAERLVGADNTGMPGGVSPEVGAVVQLAHESIQNVERFVARLSAE
FT                   ELRGAAELLAEAPRVRVHGLRQFSALASFLCYGLSMIRSDVGLLDAHGLGVAEGLAQLQ
FT                   RGDVVVVMSVAPYTRSVAEAAAAAAESGLTVIAITDTSASPLAAAARHAFFIPHESSFF
FT                   SNSMGAYLIFCEGLLNLAATKLGKRSLRALARREQMIAALDIETE"
FT   gene            complement(281504..282592)
FT                   /locus_tag="Reut_B3696"
FT   CDS_pept        complement(281504..282592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3696"
FT                   /product="Peptidase C45, acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3696"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63054"
FT                   /db_xref="GOA:Q46UY0"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63054.1"
FT                   /translation="MPAIAFIDISGSPFQAGQALGRFGASAVRDHLLHTDAWRSVMRWR
FT                   GTEQAALMAAQVQARFPRIWDELKGLADGLGLPLEDTFLWNCRGDVWAMSPDGCTTVQV
FT                   PGAHRRRISHNEDGDPGFSGHCAIAQCHIAGSPGFASFVYPGSLPGHTFAATELGLAMT
FT                   VNNLRYRNTTAGVPRMVLTRAVLDAPDLDKALAVLRDNPHAGGFHLTLGHCRSTALLSV
FT                   EFSAYGCSVLDITQTSMHANHAIHPQMRDHPQIVTGSSGHRQMRGDTVIADAARDGREI
FT                   DPLELLADTAHPSFPIYRDDPHDSDGENTQATADMRVGPTCIEWEVYEQPGTAPRYRMI
FT                   NGHTREEDATDAGARPDVQSRH"
FT   gene            complement(282606..283334)
FT                   /locus_tag="Reut_B3697"
FT   CDS_pept        complement(282606..283334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3697"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3697"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63055"
FT                   /db_xref="GOA:Q46UX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63055.1"
FT                   /translation="MSMVNFKGVTKRFGQTTVLDQVDLSIDKGEVVVLIGPSGSGKSTL
FT                   LRCINALETIDDGDLVVGGISVLDRAAKVREIRLEAGMVFQQFNLFPQMTALENVAFGP
FT                   RQVRGTTKADAEAVARDLLAKVGLAARADHYPGELSGGQQQRVAIARALAVKPQLMLFD
FT                   EPTSALDPELRQEVLRVMQTLADEGMTMVVVTHEMAFARKVGTRLIFMEHGRITVDGSP
FT                   VDVLDNPPNQRLQDFLQHVE"
FT   gene            complement(283331..283987)
FT                   /locus_tag="Reut_B3698"
FT   CDS_pept        complement(283331..283987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3698"
FT                   /product="L-glutamine ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3698"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63056"
FT                   /db_xref="GOA:Q46UX8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63056.1"
FT                   /translation="MEFDFSVITDALPALLQGARLTVAITLAGLVGGTLVGLLFGLMRA
FT                   YGNAWVQNIAFTYVELVRGTPIVVQVMFIYFALPVLLHVRVDAMTAAVASIIVNSGAYI
FT                   AEIVRGAFLSVPRGLREAGLALGLPPWRVLAFVVGPVALRRMTPPLGNQFIVSLKDTSL
FT                   FIVIGVGELTRQGQEVMAANFRAVEIWTAVAALYLCMIGAMTFVLRTMEKRMRIL"
FT   gene            complement(284013..284759)
FT                   /locus_tag="Reut_B3699"
FT   CDS_pept        complement(284013..284759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3699"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3699"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63057"
FT                   /db_xref="GOA:Q46UX7"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63057.1"
FT                   /translation="MKLFAKFASAVCLAASLVAHAAHAEQLLVAVDTAFVPFEFKQGDK
FT                   YVGFDIDLWDAIARDLKLDYKLQPMDFNGILPALQTRNVDVALAGITIKEDRKKVIDFS
FT                   DGYYDSGFMLMVPSSSTIKGPNELKGKSLALKTGTSAADYAKSNFAGTDLRLFPNIDNA
FT                   YLELRTGRVDAAMHDTPNVLYYIHTAGKGQVKAVGPQMMAQKYGIGFPKGSPLVPKVNE
FT                   ALAKIRADGRYAAIYKKWFGVEPANM"
FT   gene            complement(285232..286230)
FT                   /locus_tag="Reut_B3700"
FT   CDS_pept        complement(285232..286230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3700"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3700"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63058"
FT                   /db_xref="GOA:Q46UX6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63058.1"
FT                   /translation="MHSMRLSQIQDFIAVAEGGSIRAAARTRDVSAPALTKSIRQLEDE
FT                   LHVPLLTRTTRGVVLSHYGEAFLRRARLIATEARRATEEMTQMLGARTGTVRIGVTGGP
FT                   AHLLLPAALNRFRRQHPEVQVYIDSGRSAVHLQDLRAGLIDVAVSPIPDEGIDHDFICE
FT                   PLYNNDSVVVAHQDHPLRHARTLRELVGSEWILTTCRMHGPGAAIMDAFRAQDLPLPRV
FT                   AVRCDTFNLIQALLQNRRLLCMVARQLMQDRVGASTGLAVLPIEDPLPSHTVCLIYRAD
FT                   SPMPPVVASFAAQLRREAHYLINMPDSPLKRPGAPPEPRDDKPVETADIAV"
FT   gene            286378..287184
FT                   /locus_tag="Reut_B3701"
FT   CDS_pept        286378..287184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3701"
FT                   /product="regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3701"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63059"
FT                   /db_xref="GOA:Q46UX5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63059.1"
FT                   /translation="MNLPVEQFIAERRREDPSFGGLLAKGFALLRCFIDEPRPLGNGEL
FT                   AQRLQLPRATVSRICRTLFELGYLDWDPKLDKYFVSAQVLALGYPYLTGLQVRHVARPL
FT                   MQALADRIEGAVSMGVAHRLDVTYLQSCTHNEGTPARPGTGAVRSVLSTAMGRAYLCTL
FT                   SKAEFESLMTSASEERPEEYAAFYDTLCHNVAHYPKRGFALNEGDAGIGVHGVGVYSRI
FT                   RYLNRPLLFNCALPGSQVRRGTMEKKIAPLLMEMVRSIEAATGLQQ"
FT   gene            287233..289410
FT                   /locus_tag="Reut_B3702"
FT   CDS_pept        287233..289410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3702"
FT                   /product="CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3702"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63060"
FT                   /db_xref="GOA:Q46UX4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63060.1"
FT                   /translation="MVDLNSLLYPRSIAVIGASTQPDKVGGMPIRLLRELGYAGRIYPV
FT                   NASAAEVQGLPAYGSLSDIGEPVDLAIIAVPASASQDVMAQLAGNGTRAAVVFTSGFAE
FT                   AGGAGVQMQERLARSAQQAGITLLGPNCLGAMNLRERVFATFSPIALSGTPPVGEVGLV
FT                   SQSGAFGAYAFALAREAGLGLSHWVTTGNEAGLQVADVIEWLAHDPNTRVILAYIEGCR
FT                   DGARLRRALAAARAAGKPVVVTKVGTTEAGARSAQSHTASLAGEDAVYQAVFEAYGVHR
FT                   AHTLEEFFRLGYVLSRGRRPATWQRTSGGDADVGTPLGIVTVSGGVGIMMADRAEELGL
FT                   PLPPMPDDAAAALRTAIPFASTANPIDVTGQIVAQPRVFMDAIADVARSGAYGSVAVFL
FT                   AGGANAPRFWPELQQAIGALSEAADAAPLMVSGLVDDDKRAWLEARGCLVFREPGHAVE
FT                   AVATLARAAALEDARGDDAIEGQAQSDPQDDLLRDIPPAATALSEYEAMRLLAEAGVPV
FT                   APHDLARDAEEAVRIAERLGYPVVVKLCSREILHKSDVGGVALNLANAQAVRDAFGRMA
FT                   QAVAGLRTDKGTPVALDGVLVARMVRGWGEVMVGVRRDPVFGLVALAGIGGTAVEIFRQ
FT                   TACGLAPLSREQARAMLHASRVAALCEGHRGHPQVDLNAAAQVLASVSQLAAELGDRLD
FT                   TIEINPFIVTAPGLVAADAVVTLRADSHGAL"
FT   gene            289505..290506
FT                   /locus_tag="Reut_B3703"
FT   CDS_pept        289505..290506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3703"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3703"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63061"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63061.1"
FT                   /translation="MQLQTHLTARRMVLRGLGALAATAFCAVAPTAHAGAYPDKPIRLV
FT                   VPFPAGGGTDVVGRLVAAGLSKDLGQTVVVENIAGATGTIGSAQVARSAPDGYTLVLGI
FT                   SATHAIAPAIFPKLPYDPVRDFVPIGRLFYGGNVLIAGPAFKGRDLPALIAAAKRPGAD
FT                   LAYGSWGNGSGGHLAGESLNVLSGIHLRHIPYKGVNPMLTDVIGGTLPVAMSDLAGTLP
FT                   LIRSGKVRALAVTGSERSPALPDVPTFTESGVAFGVDSWFALFAPARTPTDIVDRLERA
FT                   LAAAMRDPAIKAQADSLGMRYTPQPRNAFAAQMRSDVTSWAALVKSSGAAQE"
FT   gene            290553..291863
FT                   /locus_tag="Reut_B3704"
FT   CDS_pept        290553..291863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3704"
FT                   /product="Protein of unknown function DUF1214:Protein of
FT                   unknown function DUF1254"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3704"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63062"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63062.1"
FT                   /translation="MNHPAPQLFSAPVYSSSQEALVAAAALPVVIYGYPLIETLRTCRI
FT                   QTSVSTATGYGRAPVNTLSASERQWTHEDRDVVTPANDLLYFCGWINLADGPVTLRVPP
FT                   LPERDRYYVVELLDAWTNNFENLGPRNVSAEGSTVTLVGPGQQATGSHVVACPTSLVWL
FT                   LGRVLVQGPADLAAAHAFESGFALDAPAKTMPECLRAWSDTGNEALDFFQNLFNALREY
FT                   PPAEREQGVLTLLRKAGLKLEGEIDIAGLRAEVRAGLENAYRQALQVIEAHTRSQGRKS
FT                   WGYSMKLGLYGDDWLQRACTAMKGLGALRADEAIYAMADFDADGEPLRGEHMYELRFPP
FT                   GMLPPAQAFWSVSLYGEDRFFSANEIGRYAVGDRTPGLRLEPDGGLVIPISHQRPAQAE
FT                   NWLPAPAGSFYLILRLYHPAPAFIEGQYRIPAVRRVS"
FT   gene            291876..292889
FT                   /locus_tag="Reut_B3705"
FT   CDS_pept        291876..292889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3705"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3705"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63063"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63063.1"
FT                   /translation="MKLKTDDYPISRRAMLARMRDLLLLGAAPALAPWSALAQAYPSRT
FT                   VRLISPYGPGGSNDTSARLLAESLSRKYGQQFVVENKPGAGTRVANETLARAAPDGYTL
FT                   LWAAAPFAINTAAGLPQQYDIHKDFVAVGPRVVGPVFLIVKADSPARTVADFVRMARAK
FT                   SGGATFASPGAGSGPHLTAELFAAQAKFKVLNVHYRGDATAYTELLAGRVDATLTAITS
FT                   ALPFIKAGQLRVLAVASEQRTPVYPDAPTFAEQGFPGVVGYGWFGLLAPARTPAAIVQQ
FT                   INRDASAVLADSDVRNKLTALGLQPEPGDSASFARFIDEEVRKWGTVIKTSGVVLE"
FT   gene            complement(292921..294174)
FT                   /locus_tag="Reut_B3706"
FT   CDS_pept        complement(292921..294174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3706"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3706"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63064"
FT                   /db_xref="GOA:Q46UX0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63064.1"
FT                   /translation="MQDLEERAVALVTGTGIEAIDDGVWLLHGQGQSFVADVGGGLLVV
FT                   DSGPGGRVTAGMIEALRTQSSLPVLAICYSHGHMGYNAGLQQWLDHAAARGEPAPRVLA
FT                   HVNVLARQARYRETSRMQERMAEIQFRRPAGAMAGKLGYTAPTETFADSVTIGQGNGRA
FT                   EILWAPSETDDAIAVWLPGRRLLYGGPAVIDSIPNVGTPFRTLRDTVRWAETLERMAAL
FT                   GPRTVVREFGPTLRGAEECERVLCQTARALRWLRAEVVRLMNAGCNERQMLAALKPPAE
FT                   LFDQPWMRPTYGDPSYIARDIYRSENGWWDRNPTSLHPAAPEQAAAEIAAAVADHDALI
FT                   RHAQSLAARGEIQLALHVVDVLALAPGDAPTLAEARRLKAGWLRQRAGEVRSYVSRSLY
FT                   GAAADMLEHGAADTFGIH"
FT   gene            294569..295786
FT                   /locus_tag="Reut_B3707"
FT   CDS_pept        294569..295786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3707"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3707"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63065"
FT                   /db_xref="GOA:Q46UW9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63065.1"
FT                   /translation="MASRQDLPLAGIRVAEFGQFIAAPGAAMMLADLGADVVKVEALRG
FT                   DSARRFDGTSAQSPMFLAYNRGKRGIALDLRSSGGMEAARRLALASDVVLHNTRHGVME
FT                   ALGLDAATLRAEKPELIHASISGFGTRGPSRSRPGLDIAAQAESGMMSVTGEAGGQPLK
FT                   AGFALIDAATALAAANAILAALFRRLRTGKGETIETSLLQVGVQLQAQLWAEFQCSGAL
FT                   PVRSGNSQPKAAPAADVIAVADGHVVLSAYLDEHWARLCEAIGNPALAQDPRFASNALR
FT                   VQNRPALLAILHDALRHLSGDAARALLERHQVVVGVVRDYHQVGASSDVRASGILRAVG
FT                   NGEGDLLELPGLPFSMESLQGDGIPAVPRLGQHTTEVLTELGYGATEIDELACAGAIGC
FT                   EQGVTA"
FT   gene            295783..296469
FT                   /locus_tag="Reut_B3708"
FT   CDS_pept        295783..296469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3708"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3708"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63066"
FT                   /db_xref="GOA:Q46UW8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63066.1"
FT                   /translation="MSEAAITSPVLLERHAGWTEIVLNRPERRNAIDIALASALATAID
FT                   SVNADDSTRAVLLRGADGAFCSGLDLKALQAEPDGMAKFAQVWERVHLSLLQSEKAWIV
FT                   ALERHAVNGGAALALAGDLMVCGAGAFLQIGEIRLGMAAPRNAAWLALRHSEAVAARLC
FT                   LLGDRVPAADLLRLGVATEVTDDTQVLDRARDLATTIAAFPAGGVTAIKRGMRAASTRM
FT                   ARDTHD"
FT   gene            296483..297706
FT                   /locus_tag="Reut_B3709"
FT   CDS_pept        296483..297706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3709"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3709"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63067"
FT                   /db_xref="GOA:Q46UW7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63067.1"
FT                   /translation="MSESITTDSEASLEAFRREVRDFVAQALPEIVREKVRLGLEVSKD
FT                   EMVAWQHRLAERGWLAPHWPRDWQGLGWSAERRAVFQEELVLAHAPETGGISIEMIGPI
FT                   LIRYGTPAQQQYFLPRILNLEHWWCQGYSEPNAGSDLASLKTHAVRKTRADGTEVYVVN
FT                   GSKIWTSYAQYADWIFCLVRTDSAARAQQGISFLLIDMRSPGISVRPLVGIHGWHLFNQ
FT                   VFFDDVEVPVDHRVGDENAGWTIAKSLLEHERLNLARVAENRRRLVKVRAIAAEVEEAG
FT                   QPLMERPWFARRYRELDVRLEALAATVLRFRQRARAGERLGPETGMLKLLGSRLIQDIE
FT                   NLAVDALGPGTLAYDRAAHFEPAAPRSGQSAYSAAASARRFVTRGYTIAGGSSEIQHEL
FT                   LAKQVLGL"
FT   gene            297733..298890
FT                   /locus_tag="Reut_B3710"
FT   CDS_pept        297733..298890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3710"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3710"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63068"
FT                   /db_xref="GOA:Q46UW6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63068.1"
FT                   /translation="MSDSHDDRRMLRESVRRYVERDYGFEQRRAALAEPGGFSRRHWQA
FT                   FAEFGWLALGLPDACAGFGDASDQAVLAEALGCAQPAEPWLANAALCGPLLAACGDAAH
FT                   AVTAAAMAEGRTMLALAAWEAQGRYDAFDVATSAEPRQSAGPIDWMLDGRKTLVLGGGC
FT                   ADILLVLARNSGQRRDRDGLTLFAVPAGTRGVAIEALPTYDGRQTATVTLRRVSVPDSA
FT                   RVGAVGGAWPSVEAAIDRATTMACAEAVGTMARAFELTRDYLVTREQFGRPLSANQVIR
FT                   HRLVDLYVSVEQARAITEAAAAALQGDAAARMRAVSLAKAFVSVAGRALGEDAVQLHGA
FT                   VGMTDEMEVGHCYKRLAALANLFGDADWHYERLSAVDPADQALAA"
FT   gene            298985..299980
FT                   /locus_tag="Reut_B3711"
FT   CDS_pept        298985..299980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3711"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3711"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63069"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63069.1"
FT                   /translation="MFSQHTGIRRAGAALAVPLALASAAAAHAEAPYPNRPIRVVLPSG
FT                   AGTVTDQTARLIAERLSTSLKQPVVIDNRPGANGIIASETVARAAPDGYTLLFTYSATL
FT                   TVNPWTTPSLPYDPLKDFTPIARPSAPGGNLLAVSASVPVHNLQEFLAYVKASKSELAY
FT                   CSWGVGSGGHLAMEYLKAKTGIRLRHIPYKTATQCSNDLAAGHVTIGITDSVSSIPHLK
FT                   SGRIRGIAVSGPERLLPTPDVPTMTEQGVPFQQASWVALFGPKGLPAPIVARLNAEVNR
FT                   VLQSPEDRERFTSMNLKPAAPTSAAELGKLVSSDLAAWGEVVKIAGLKAQ"
FT   gene            300021..301073
FT                   /locus_tag="Reut_B3712"
FT   CDS_pept        300021..301073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3712"
FT                   /product="Porin, Gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3712"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63070"
FT                   /db_xref="GOA:Q46UW4"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63070.1"
FT                   /translation="MKARQWMAMGATGAALAAGNAAAGTMQLFGVVDASLEYAKGSDSV
FT                   VRMREGQQAASRWGIRGIEDLGGGLKANFLVESGFNIDTGTEFFGNNRLFGRQAYMGLS
FT                   DGWGEFRLGRQYTPSFYALLRLDPFLLNGAVSPFNLLSATASQGTGHVAYGARFDNAVQ
FT                   YFSPNWGGFSFTAAVAPGEVPGAPRSGLNFGMNATYEAGNAYAFYSYQGMYTGANVPVD
FT                   TTLTSNHFIGGSYRFQPIEVGLLFSTASSNRPDTRSARHYGVTFSWTVTPRDTFKAAAV
FT                   KRQILGGGERPLAVTLGWDHDLSKRTTAYLRAVLVHNSPGGSVTNNSIAIDPGSGDDAR
FT                   SVSVGLRHRF"
FT   gene            complement(301080..302657)
FT                   /locus_tag="Reut_B3713"
FT   CDS_pept        complement(301080..302657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3713"
FT                   /product="Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3713"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63071"
FT                   /db_xref="GOA:Q46UW3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63071.1"
FT                   /translation="MTITGEMLIGASAVRGSSEPFHAINPATGETLEPEFHASGTDDVA
FT                   RACELAEGAFDTFRATSPDQRARFLEAIADQIEALGDALIERAHAESALPIARLQGERG
FT                   RTTGQLRLFASVLRAGRWQTATLDRALPERTPPRPDLRMQKIAIGPVAVFGASNFPLAF
FT                   SVAGGDTASALAAGCPVVAKAHPAHPGTSELVGRAIRKAVADAGLPEGVFSLLTGAGHT
FT                   VGTELVAHPAIQAVGFTGSRSGGLALMQVASNRAQPIPVYAEMSSINPVFLLPEALSAR
FT                   GEAIARELADSLVLGVGQFCTNPGLLLALEGPALDRFRAAAGAAVTAKPAGTMLTPGIQ
FT                   RAFEHGITSLSDIPGLARTATGQASTGPNQACAAVFETTAQRFIADPRMHAEVFGPSTV
FT                   LVVCRDGEDLLAVAQQLEGQLTATVQADRGDYALAAQLLPLLERKVGRILFNGYPTGVE
FT                   VSYAMVHGGPFPATSDTRTTSVGTTAMDRFLRPVCYQNVPAELLPPALQDGNPLDLWRL
FT                   KDGHPAKG"
FT   gene            complement(302791..303534)
FT                   /locus_tag="Reut_B3714"
FT   CDS_pept        complement(302791..303534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3714"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3714"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63072"
FT                   /db_xref="GOA:Q46UW2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63072.1"
FT                   /translation="MTMPDAQMTSPAPLRRRGRTLAEEVVSGLTERIRQGQLKPGDKLP
FT                   TESEVMATFGVSRTVVREALSRLQASGLVETRHGIGTFVLARPAETPSPFRIDTAAMGT
FT                   AMDVLAMLEFRVSLEAEAAGLAATRRGDEHLAAMRRALDSMKRNTTEGSDAVGADFEFH
FT                   LSIARATGNRYFTDIMGHLGTMLIPRSRLQVNTQERAQYLERVHVEHENIYDAIERRDP
FT                   EAAKAAMRMHLTNSRERLRKASAAA"
FT   gene            303685..305055
FT                   /locus_tag="Reut_B3715"
FT   CDS_pept        303685..305055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3715"
FT                   /product="D-glucarate dehydratase"
FT                   /EC_number="4.2.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3715"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63073"
FT                   /db_xref="GOA:Q46UW1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63073.1"
FT                   /translation="MNATQAAIPGIPGNSAATPVVTELTVVPVAGHDSMLMNLSGAHGP
FT                   YFTRNIVILRDSAGHTGVGEVPGGEGIRQTLEDARTLVVGQPIGQYQAVLNRARAAFAG
FT                   RDAGGRGLQTFDLRIAIHAVTALEAALLDLLGKHLQVPVAALLGEGQQRDAVEMLGYLF
FT                   YIGDRRRTTLDYRTEPDAGNDWFRLRNEEAMTPEAVVRLAEAAYERYGFNDFKLKGGVL
FT                   RGDEEMEAIIALHERFPKARVTLDPNGGWLLADAIRLCRDKHGVLAYAEDPCGAEDGYS
FT                   GREIMAEFRAATGLPTATNMIATDWRQMGHAVRLQSVDIPLADPHFWTMQGSVRVAQMC
FT                   AEWGLTWGSHSNNHFDISLAMFTHVAAAAPGRITAIDTHWIWQDGEHLTRDPLKIEGGM
FT                   VQVPKTPGLGVELDMDALARANALYQEKGLGARDDAIAMQFLIPGWNFNNKAPCMVR"
FT   gene            305112..306116
FT                   /locus_tag="Reut_B3716"
FT   CDS_pept        305112..306116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3716"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3716"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63074"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63074.1"
FT                   /translation="MIKLSTLLRRCAGAGIALAAVAMAVAGGTATAASPAWPQKPVSVV
FT                   VPFPAGGSTDTIARMLAVPLNEKLGQPFVIDNRPGATGAIGATFVKRAPADGYTMMVAS
FT                   IGVYAVNPFLQKNLGYDPAKDFDLLTVAVRAPNVLVANPNFPAKTLQELVSYMKKNPGK
FT                   VSFATSGAGSSDHLTAALFWQKSATEGLHVPYKGGAPAISDLLAGQVDVSFQNINAALQ
FT                   HIRSGKLRALAVTSDKRASVLPNVPTMAEGGVKDVEVYSWQGVAAPRGLPADVKSRLHG
FT                   ALVGALNEPKMRDKLAENGFEVVGNTPEQFAQFENQELKRWKTVIEQGKITIE"
FT   gene            complement(306132..306983)
FT                   /locus_tag="Reut_B3717"
FT   CDS_pept        complement(306132..306983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3717"
FT                   /product="Protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3717"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63075"
FT                   /db_xref="GOA:Q46UV9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63075.1"
FT                   /translation="MPLPADFHGMAFAAVMLSALMHASWNAIVKVGGDRLSSMALIDTF
FT                   CLLAAAPLLFFVPLPAPQVWPFLMATVALEVGYKLSLVAAYNRGDFSQAYPLMRGSAPM
FT                   MVAIILLLTGSERLGPGGYAGIALICCGLVSLVRWRQQAPDLLGFALLAGACLAGGTVI
FT                   DGTAVKRYGEVFTYIVWLQALSHIFMPSYAFARRGQALVTLLRSEWKRAWIGGVNRVGS
FT                   YALMLWAMTLAPVAKLAALRESSVIFAALLGHFLLREPFDRRRLAATALVLAGIITLQL
FT                   AR"
FT   gene            complement(307063..308199)
FT                   /locus_tag="Reut_B3718"
FT   CDS_pept        complement(307063..308199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3718"
FT                   /product="2-aminoethylphosphonate--pyruvate transaminase"
FT                   /EC_number="2.6.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3718"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63076"
FT                   /db_xref="GOA:Q46UV8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46UV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63076.1"
FT                   /translation="MIRGNDPILLTPGPLTTSLATKQAMLRDWGSWDAAFNAITGSLCE
FT                   DLVRIVHGEGTHVCVPMQGSGTFSVEAAIANVVPRDGKVLVPQNGAYCQRILKICKVLG
FT                   RAHVELPIPEDRPATAAAIEAALKKDPSITHVAQVHCETGAGVLNPLPEIAAVCARLGK
FT                   GLIVDAMSSFGAIEIDARTMPFDALVAATGKCIEGVPGMGFVLVKKTVLEGSQGNSHSL
FT                   ALDLYDQYTYMQKTTQWRFTPPTHVVAAFRTALDQFLEEGGQPVRGERYRRNYETLVQG
FT                   MAVLGFRPFLSPDVQAPIIVTFHAPADARYDFRTFYEKVRSRGYILYPGKLTQVETFRV
FT                   GCIGAIDDNEMRNVVSAIGETLREMGISMQPEGRVRAA"
FT   gene            308542..309240
FT                   /locus_tag="Reut_B3719"
FT   CDS_pept        308542..309240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3719"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3719"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63077"
FT                   /db_xref="GOA:Q46UV7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR017723"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63077.1"
FT                   /translation="MSIQAPLASEISILQSQSLTTLVQRELETRIMSGGLVPGAKLNEI
FT                   EVAGQLNVSRGPVREAFRALEQAGLLRMEKNRGVFVRAISLQEADEIYELRAVLDEHVG
FT                   RALAAHATAEGVRELRAFIEGLARASTDGDVDAYTRLNLRFHDRMVELTGNGKLVDTYR
FT                   RLVKELALFRREALSGNSAAMPDSTREHREIVSAIAARDADLAGRLMREHVERGRARLH
FT                   AAVAPAQANA"
FT   gene            309276..310580
FT                   /locus_tag="Reut_B3720"
FT   CDS_pept        309276..310580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3720"
FT                   /product="phosphonoacetate hydrolase"
FT                   /EC_number="3.11.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3720"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63078"
FT                   /db_xref="GOA:Q46UV6"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR012710"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023116"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63078.1"
FT                   /translation="MKTEPSPALIVVMPESQALPRTVTVNQRTYQWMQQPVVVVCVDGC
FT                   EYDYLQAAAASGSAPYLKRVLAEGSAFQGKCVVPTFTNPNNLSIVCGAPPAVHGICGNY
FT                   FFDRTANGGKGEEVMMNDPKYLRAGTILAAFADAGASVAVVTAKDKLRRLLGHGMRGIC
FT                   FSSEKADQATVEENGIDGVLELVGMPVPDVYSAELSEFVFAAGVRLMETRRPDLMYLST
FT                   TDYIQHKFAPGSDGANAFYAMMDKYLARLEALGCVVALTADHGMNAKHDDATKAPNVIY
FT                   LQDQLDAWLGRGVEAGGARVILPITDPYVVHHGALGSYATIYLPEDVDAAAIRAQLAGL
FT                   PGVEDVMDNAEACARFELPTDRVGDLVVVSEKHVVLGTSHARHDLSGLDAPLRSHGGVS
FT                   EQTVPLVFNRTTAGIPGKAVLRNFDIFDVALNHLH"
FT   gene            310617..312080
FT                   /locus_tag="Reut_B3721"
FT   CDS_pept        310617..312080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3721"
FT                   /product="Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3721"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63079"
FT                   /db_xref="GOA:Q46UV5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017656"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63079.1"
FT                   /translation="MNAPQFPDKAVSPQFRAEALRIDGQKVVRERVIEVRNPYDGTLVG
FT                   TVPKATVEDVRRAYEVAHGYRSTLTRYERAAILNRAAALLRERTEEASDLITLESGLSK
FT                   KDSIYEIGRVADVLGFAATETLRDDGQMFSCDLTPHGKRRRVMTQREPLLGAICAITPF
FT                   NHPMNQVAHKVAPSIATNNRMVLKPSEKVPLSAYYLADLLYESGLPPQMLQVITGDPRE
FT                   IADELITHPLVDLITFTGGVAIGKYIANKAGYKRVVLELGGNDPLIVLDDADLDRASDL
FT                   AVQGSYKNSGQRCTAVKRMLVHEAVAARFTELVVEKTRAWRYGNPMDRSVDMGTVIDAQ
FT                   AAELFEARVNEAVAQGARLLIGNKRNGASYSPTVLDRVDPSMTVVREETFGPVSPIITF
FT                   RDVDDAIRISNGTAFGLSSGVCTNRMDDFTKIANSLQVGTVNLWEVPGYRIELTPFGGI
FT                   KDSGLGYKEGVQEAVKSFTNLKTVTLPWG"
FT   gene            312170..312925
FT                   /locus_tag="Reut_B3722"
FT   CDS_pept        312170..312925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3722"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3722"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63080"
FT                   /db_xref="GOA:Q46UV4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63080.1"
FT                   /translation="MLAEQRQKHILNQLAATGALAISALVTELGVSRETIRRDLNALAE
FT                   RGLLVLTHGGALAPNRTEPDTQTRAAINAEGKRAIGQRAAELVPDGASLILDYGTTTHA
FT                   VAQALQGHHNLLVYTNDLSIALLLGRRNGNRVIVLGGELQDNEDATHGWDTIEQVSRYH
FT                   TDFAFVGIGGVTPRGEICDFSRGAAELRSRMLLAADVACVLADYTKFGRNTGVNIRHFD
FT                   QAAWLITDMAPEPPLAEALRQAGPKLLIA"
FT   gene            complement(312949..314043)
FT                   /locus_tag="Reut_B3723"
FT   CDS_pept        complement(312949..314043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3723"
FT                   /product="Fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3723"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63081"
FT                   /db_xref="GOA:Q46UV3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63081.1"
FT                   /translation="MEAAISTFGDVGRARGRLEWRVLSRTPALKNPMIDALKSTALLTL
FT                   LPASLLCSGPARAACTSTPGMPYLQAIDTIAAESNLAVGATIPGTARHYTLTGKCDYGE
FT                   PYQVPGAVIVACYYGSGKEVMPGVYSTGVSGLGIRLRNAAGEPMLNAAGRSCDTRGASL
FT                   GTLNADMTYSVSVSTEFVKTGSIAAGALDPSQTRFGFGVYHGNGLGGTSNYIGFSGMLQ
FT                   VRQIACNATYPAAVRLPRVKASTLASAGATAGATPFAIVLNCNGTARVGVSFDAAGGST
FT                   VKSAQAGVLGPANEGAPGAAGGVGVQLTDARTNPVPLQQSNPVGTIDANAPATYAYALR
FT                   YFALAPHAKPGVVSGAMTFTFDYQ"
FT   gene            314269..315612
FT                   /locus_tag="Reut_B3724"
FT   CDS_pept        314269..315612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3724"
FT                   /product="glutamate dehydrogenase (NADP)"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3724"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63082"
FT                   /db_xref="GOA:Q46UV2"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63082.1"
FT                   /translation="MNSPSLDAFLAGVARRDPGQPEFLQAVKEVMMTLWPFVERHPRYA
FT                   DQALLERLVEPERVIQFRVAWTDDQNRVQVNRAFRVQHSSAIGPYKGGMRFHPTVNLSV
FT                   LKFLGFEQTFKNALTTLPMGGGKGGSDFDPKGKSDAEVMRFCQALVTELYRHLGPDTDI
FT                   PAGDIGVGAREVGFMAGMMKKLSNQSACVFTGKGLAFGGSLMRPEATGYGTVYFAQEML
FT                   HRRGMDFDGLRVLLSGSGNVAQYAAEKAIELGAKVLTLTDSGGVLHYPEGMTTEQLAEV
FT                   MAFKNEERGRLSDFAARHGMKFEAGRTPWHVPADVALPCATQNELDGNDAETLLGNGVI
FT                   CVAEGANMPSTLEAVDRFVDAKILYAPGKASNAGGVATSGLEMSQNAMRLSWHHAEVDE
FT                   KLHAIMKDIHQNCIHHGQKDGGYVNYVEGANIAGFVKVADAMLAQGVI"
FT   gene            315923..317395
FT                   /locus_tag="Reut_B3725"
FT   CDS_pept        315923..317395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3725"
FT                   /product="chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3725"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63083"
FT                   /db_xref="GOA:Q46UV1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63083.1"
FT                   /translation="MAGSTNIFSQHESRYTPGTSLMQAQPLDRIYRRADRMMLAIIWGL
FT                   VAVSLAIGWYYGTMGVTFTVGLPLAVAFTLTALAAPGRLPTRLMAGAVLMAFSALQIHQ
FT                   SMGRTEFHFSVFVLLSVLLAYRDFRPILVGAVTIALHHLSFNYLQAWGWGPVCFTEPGL
FT                   GMVVLHAAFVVAQTAMLASLAWRMGRDAMAAEELASLAMTISSESGCLTLSPQEAPARN
FT                   KIARTFGDTLDAVRGTLVQVRDSARELDAAAAHILDGNTALSQRTRDQQQAVERIAEGV
FT                   TDLTRLAHAAADSAAAARTLANAASNVATRGGAVIDSVIYTMGEINDSSARIAEIVGVI
FT                   DGIAFQTNLLALNASVEAARAGELGRGFAVVAGEVRTLAQRSAGAAKEIRALIAASVNH
FT                   AHEGADLVATAGGTMTEVVDSIAKLSALVEELARMAEHQRADTDRIGVDINAIDRAMTE
FT                   NSAHVTETAVAAQRQQAQTTQLTGALEVFRLV"
FT   gene            317825..319075
FT                   /locus_tag="Reut_B3726"
FT   CDS_pept        317825..319075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3726"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3726"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63084"
FT                   /db_xref="GOA:Q46UV0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63084.1"
FT                   /translation="MSHMLVIGAGITGVTTAYTLAKLGYRVTVLDRQDYPAMETSFANG
FT                   GQLSACNAEVWNNAGTLLKGLKWMMKRDAPLLLNPRPSWHKYSWLGEFVGHLRGYRANT
FT                   IETTRLAIAAREHLFAMAEREQIDFNLERRGILHFYHDRPSFDAAGRTNRMLMEGGLER
FT                   YAVTPEEIRTIEPTLQGSYYGGYYTPSDSTGDIHKFTRGLARACERLGVTFVHGVDVKA
FT                   VDQRSDGVVMRVAASEAAVAAGQDGGEREIKGTAVVVCAGVGSRHIAAMLGDRLNVYPV
FT                   KGYSITVHLDDVRSVNNAPYVSLLDESAKIVTSRLGADRFRVAGTAEFNGHNRDIRADR
FT                   IAPLVSWVRRNFDIETSRAVPWAGLRPMMPDMMPRVARGRAARVFYNTGHGHLGWTLSA
FT                   ATATMIGQTIATSHPVH"
FT   gene            complement(319082..320593)
FT                   /locus_tag="Reut_B3727"
FT   CDS_pept        complement(319082..320593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3727"
FT                   /product="Helix-turn-helix, Fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3727"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63085"
FT                   /db_xref="GOA:Q46UU9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63085.1"
FT                   /translation="METLSDAGDNVLGNYDSVARRAMESLFRTFENFSEGTIVVDVNGR
FT                   VVWINKRYAARFGFADPQEAVGLDCERVIPNSLMREVVDTGKPILLDIMEAGREPMIVM
FT                   RLPIKDDDGNTVGAVGFALFDELKALTPLLSHYTRARDELAATRRTLEQTRRAKYTFAS
FT                   FVGNSPATLEVKRLARRAAQVDAPVLLLGETGTGKELLAHAIHAGSLRADRPLVTVNVA
FT                   AIPEALLEVEFFGAAPGAYTGAERKGRVGKFELADGGTLFLDEIGDMPLALQSKLLRAL
FT                   QDKEIEPIGSNRIIRSDVRIIAATSADLPALVEAGKFRADLYYRLNVVPICLPPLRQRQ
FT                   ADLLPLAYAILEEICRRTERDAPVLSDCALSLMGEHDWPGNVRELRNTLERLVMLHDGG
FT                   AVDASMLAPLLGRRAVTAPAAVAASAPSPDAMTATEPVLPADPPAYADAMAQYEAAYLS
FT                   QALAASGSNVPRAARAIGISRAAFYKKLVAHRAAGRIAPAGTAES"
FT   gene            320882..322273
FT                   /locus_tag="Reut_B3728"
FT   CDS_pept        320882..322273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3728"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3728"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63086"
FT                   /db_xref="GOA:Q46UU8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63086.1"
FT                   /translation="MSFVIVVAALAFLMLAAYRGYSVILFAPLAALGAVLLTDPSAVAP
FT                   AFTGIFMEKMVGFVKLYFPVFLLGAVFGKVIELSGYSRSIVAAAIRYIGSSRANAVIVA
FT                   VCALLTYGGVSLFVVVFAVYPFAAELYRQSNIPKRLMPGAIALGAFSFTMDSLPGTPQI
FT                   QNIIPTTFFKTTAWAAPVLGVAGALFIIVVGLSYLEWRRRAAMAKGEGYGTSLLNEPEP
FT                   IETAQLPNPLLAIAPLVLVGVSNFVLTRMIPQWYGTTAGLELPGLAKPVTVPVASVVAI
FT                   WAVEGALLLGILLVVVTAFGTVRQRFAEGSKAAVGGALLAAMNTASEYGFGGVIAALPG
FT                   FLVVGDALHSIPNPLVNAAVSVSALAGITGSASGGMSIALAAMGDTFIQGAQAAGIPME
FT                   VLHRVVSMASGGMDTLPHNGAVITLLAVTGLTHRDSYRDIFAVTTIKTLAVFFVILVYY
FT                   MTGLV"
FT   gene            322324..323100
FT                   /locus_tag="Reut_B3729"
FT   CDS_pept        322324..323100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3729"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3729"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63087"
FT                   /db_xref="GOA:Q46UU7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63087.1"
FT                   /translation="MNTLNGKTALVTGSTSGIGLGVARALAEAGANIVLNGFGDVDAAL
FT                   DTIGATGAQVVHHPADMRKADEIGAMIAMANERFGALDILVNNAGIQHVSPIESFDAQK
FT                   WDDIIAINLSSGFHTTRHVLPGMRARNWGRIINIASVHGLVGSAGKSAYVAAKHGLVGL
FT                   TKVTALETAGTRVTCNAICPGFVLTPLVQKQIDDLAAREGIAIDAARARLLGEKQPSGQ
FT                   FVTPEQLGGLALMLCSPLAAEVRGATWVADGGWTAQ"
FT   gene            complement(323214..323639)
FT                   /locus_tag="Reut_B3730"
FT   CDS_pept        complement(323214..323639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3730"
FT                   /product="Phasin"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3730"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63088"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63088.1"
FT                   /translation="MTTPPNPFADFTKMFEQFKLPGMDMSAVMEARRKDIEALGEANKL
FT                   AYEGMQALIQKQTEIFGEAMQQIQSAAQQMSTGSNPVEAMAQQNEFVQKALHQALENMR
FT                   ELAEMARKSQADAMAVIGNRAQQNLQEAGALLKPKSS"
FT   gene            323947..325488
FT                   /locus_tag="Reut_B3731"
FT   CDS_pept        323947..325488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3731"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3731"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63089"
FT                   /db_xref="GOA:Q46UU5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63089.1"
FT                   /translation="MKNFGIGVRLGIGFGVVLVLCALMSAFGIMRLQQVAERTHDMMQQ
FT                   PLTKERLVSDWYRLMHTSVRRTTAVAKSADPSLGAFFAKETKASLEGIAALRDKMQPML
FT                   TSEAEKAAFAKILQVREPYNASRDKITKLKQEGLTEEANAVLEKEFVPAGDAYLAEIQK
FT                   LLDIQRTSIDATAAEINTIYVNARNSLILLGVLVLAIGVGFAVWLTRGIIRPLGHAVDI
FT                   ARTVASGDLTSDIRVDSQDETGQLLHALSEMNTNILHIVRDVRTGTEAIASGTSQIAVG
FT                   NTDLSQRTEEQASSLQQTAASMEELTSIVRQNADNAKQASALAVNASEIAAKGGDVADK
FT                   VAETMEEINGASKKVVDIIAVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRS
FT                   LAQRSATAAKEIKALIGDSVDRVEKGSTLVAQSGQTMLEIVEAVRRVTDIMGEISAASA
FT                   EQSAGIEQVNQAVTQMDSVTQQNAALVEEAAAAAGSLEEQAQRLKQAVATFRIAA"
FT   gene            complement(325542..326897)
FT                   /locus_tag="Reut_B3732"
FT   CDS_pept        complement(325542..326897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3732"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3732"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63090"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63090.1"
FT                   /translation="MFRQSVLASAIALACLGLSPSLQAQTAFPATLAGHAVLPAQTYLP
FT                   VPKDAPADLQLSGKFTTAQRADAPGTVEGKSNGRPTGVSLPFQGQPAQGHSGIKRMADG
FT                   TFWVLTDNGAGAKANSPDFMLYLNHYKVDFASGKFQRLKTVFLHDPDKKVPFRIVHEGS
FT                   KARYLTGSDFDTESFQFAGGSLWIGDEFGPFLIQADLNGKVLAVFETKVDGKVVRSPDH
FT                   PAITAPGAPDGTVKFEVRRSKGFEGMASSPDGSKLYALLEGALWNEASRAYESEDGKPY
FT                   LRVLEFDVKQRAWTGRHWKYVLEAGHHAIGDFNMIDATTGLIIERDNGEGTPDKACPAG
FT                   QKRTDCFDDVAKFKRIYKIELTDANAGAPVRKIGYIDLLRMADPNHLARKPLTDGVLAF
FT                   PFFTIENVDVVDATHIVVGNDNNLPFSSSREPNRADDNELVLLEVGEFLKAR"
FT   gene            complement(327052..327606)
FT                   /locus_tag="Reut_B3733"
FT   CDS_pept        complement(327052..327606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3733"
FT                   /product="phospholipid-binding protein, PBP family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3733"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63091"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63091.1"
FT                   /translation="MKTTPLLHCAVAVLGLAGTSIVQAAPMTVSSTAFAENAVIPAAHG
FT                   GNTPANCGGQGVSPPVAWRGLPAGTKSVAIFMFDPDGAMGLGVSHWVAYNIAADRGHLK
FT                   QGEGQKDGAGITVGKNVSGEAAYRGPCPPVGDVPHHYIVTVVATDLEPGALPAGLTRDE
FT                   LMAALKGHARGGASVLGRYGR"
FT   gene            complement(327765..328688)
FT                   /locus_tag="Reut_B3734"
FT   CDS_pept        complement(327765..328688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3734"
FT                   /product="Phenylacetic acid degradation operon negative
FT                   regulatory protein paaX"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3734"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63092"
FT                   /db_xref="GOA:Q46UU2"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63092.1"
FT                   /translation="MATRSATQPVSPQVARLARGLKLGANSMLVTLFGDVVAPRPQALW
FT                   LGSLIRLAEPFGINDRLVRTATFRLTSDDWLNATRIGRRSYYGLSEAGLQRCLHAGKRI
FT                   YAGDAPDWDGRWTLALVRGDARATIRQRLKRELLWEGFGAIAPGVYAHPNADANSLGEI
FT                   IRAAHAQDFVAVMDATSLETFSIRPLQTLMHQTFKLGDVASAWQALLRRFSPVLADAHA
FT                   MTPADAFFVRTLLLHEYRRVLLRDPNLPEQLLPTDWPGRTARDLCRDMYAALLDASEDY
FT                   LREVVEVSEGTLANATRLLRRRFAMA"
FT   gene            328817..329800
FT                   /locus_tag="Reut_B3735"
FT   CDS_pept        328817..329800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3735"
FT                   /product="Phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3735"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63093"
FT                   /db_xref="GOA:Q46UU1"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63093.1"
FT                   /translation="MYAQLVDTGATRLRAMEEMDPQEREFQARVDAGIKIEAKDWMPEA
FT                   YRKTLIRQISQHAHSEIIGQLPEGNWVTRAPTLERKAVLLAKIQDEAGHGLYLYSAAET
FT                   LGASRDELLGDLHSGKAKYSSIFNYPTLSWADIGAIGWLVDGSAIINQVPLCRCSFGPY
FT                   ARAMVRVCKEESFHQRQGYDILLKLCQGTAEQKQMAQDALNRWWWPALMMFGPSDADSP
FT                   NSAQSMKWRIKLFSNDELRQKMVDQTVPQAEYLGLTIPDPDLKWNEERGHYDFGAINWD
FT                   EFYNVLRGNGPCNRDRLRTRVKAWDDGAWFREALVARADKQERAAA"
FT   gene            329856..330137
FT                   /locus_tag="Reut_B3736"
FT   CDS_pept        329856..330137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3736"
FT                   /product="Phenylacetic acid degradation B"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3736"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63094"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63094.1"
FT                   /translation="MKEWPLWEIFIRSQHGLAHKHVGSLHAPDGEMAINHARDVYTRRN
FT                   EGVSVWVVKAADVVASSPGDKGPLFEPANSKVYRHPTFFPMPEEVKHI"
FT   gene            330164..330916
FT                   /locus_tag="Reut_B3737"
FT   CDS_pept        330164..330916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3737"
FT                   /product="Phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3737"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63095"
FT                   /db_xref="GOA:Q46UT9"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63095.1"
FT                   /translation="MDQHKFEYLQRLGDTTLVLGQRLSEWCGRGPALEEDIALTNVALD
FT                   LVGQTRLWLGYAAEVEGVGRNADQLAYLRDAHQFRNLLLVEQPNGSYADTLARQFLFDT
FT                   WHYFLLERLQHSTDARIAEIAAKSLKEVTYHVRRSGDLVVRLGDGTEESHRRMQDAFDD
FT                   LWMFTGELFESDAAEVALVAQGVAVDPASLAESWQRHVGEVLEEATLRIPAGNWSQTGG
FT                   RQGRHTEHLGYLLAEMQFLQRAYPGARW"
FT   gene            330922..331437
FT                   /locus_tag="Reut_B3738"
FT   CDS_pept        330922..331437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3738"
FT                   /product="Phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3738"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63096"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63096.1"
FT                   /translation="MSAQVLERASVAQLWDWLEQVPDPEIPVISVVDLGIVRDVAWIDD
FT                   ACVITITPTYSGCPAMTVIRDDIERVLGAQGIDRISVQTRLAPAWTTDWMSPRGKASLS
FT                   GYGIAPPAQQVIDISGISRKASPALVVACPHCGSRHTRLVSQFGSTACKALYRCGDCKE
FT                   PFDYFKAH"
FT   gene            331456..332532
FT                   /locus_tag="Reut_B3739"
FT   CDS_pept        331456..332532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3739"
FT                   /product="Phenylacetate-CoA oxygenase/reductase, PaaK
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3739"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63097"
FT                   /db_xref="GOA:Q46UT7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63097.1"
FT                   /translation="MSKFHELTVASVTRETRDAVAVTFAVPEDLADTYRYVQGQHLTLR
FT                   AGIGGEDVRRSYSICSAVQDRRLRVAIKRVDGGMFSNWANDALQPGMTLEVMPPSGHFH
FT                   VPLSDTHSKHYVAFAAGSGITPMLSIIKTTLMTEPDSRFTLFYGNRASSSVLFKEELED
FT                   LKDTYLERFNLVFILSREQLDIDLFNGRIDGEKVRALLRHWVRPQDIDVAFICGPHSMM
FT                   EEVSQALQENGVDKARIKRELFATSIPAARPAAHAHKQLGQQQCEVTVIQDGRTRQFTL
FT                   EKNKETILDAALAQGIELPYSCKGGVCSTCRCKRIEGEVDMDVNFALEDYEVARGFILS
FT                   CQSYAVTDKLVIDFDQET"
FT   gene            332597..334261
FT                   /locus_tag="Reut_B3740"
FT   CDS_pept        332597..334261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3740"
FT                   /product="Phenylacetic acid degradation protein paaN2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3740"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63098"
FT                   /db_xref="GOA:Q46UT6"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63098.1"
FT                   /translation="MSHPFFTRHQALLDQATQAIAERGYWSPFPEMPSPRAYGETANAD
FT                   GKAAFEARLNKPFALTQPGTVGQAGKEVSPYGTELGVTYPKPDLDQLFAGVAAGMPAWR
FT                   KAGPEAWVGVSLEILHRLNRRSFEIAYAVMHTTGQAFMMAFQAGGPHAQDRGLEAVAYA
FT                   WDEMRRIPKRAVWEKPQGKNEPLRMEKQYTVVPRGVGLVIGCCTFPTWNGYPGLFASLA
FT                   TGNAVVVKPHPGAILPLAITVEVAREVLQEAGFDPNLVTLVANDPTERMASTLALRPEV
FT                   RLIDFTGSTANGDWLERNAHQAQVYTEKAGVNQIVIDSTSDFKGMVRNIAFSLALYSGQ
FT                   MCTAPQNIYVPKGGIDTPEGHLSFDQVASAIGEVVGKLTGDAAKAVELIGAIQNDGVVQ
FT                   RIEASRSLGEIVIDSRALQHPEFPGARVHTPLVLKVDASDEGKIMQELFGPISFVVATE
FT                   DTAHSIDLARRGAKEHGALTLSAYTTNDGVADAISDAAEEAGVALSFNLTGAVFVNQSA
FT                   AFSDFHATGANPAANASLSDAAFVANRFRVVQSRKHI"
FT   gene            334348..335694
FT                   /locus_tag="Reut_B3741"
FT   CDS_pept        334348..335694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3741"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3741"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63099"
FT                   /db_xref="GOA:Q46UT5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63099.1"
FT                   /translation="MVQRTSHPDELEPIERASRDELQALQLERLKWSVRHAYDNVPHYR
FT                   KSFDAAGVHPDDLKSLSDLSKFPFLAKQDLRDNYPFGMFAVPREKVARVHASSGTTGKP
FT                   TVVGYTARDIDTWASVVARSIRAAGGRPGDLVHVSYGYGLFTGGLGAHYGAEKAGCTVI
FT                   PMSGGQTEKQVQLIREFQPNIIMVTPSYMLNLIEEMMRQGMDPAESSLKVGIFGAEPWT
FT                   DAMRAEIEARAGIDAVDIYGLSEVMGPGVACECIESKDGPVIWEDHFYAEIIDPVTGEV
FT                   LPDGEEGELVFTSLTKEALPVIRYRTRDLTRLLPPTSRSMRRIGKITGRSDDMLIIRGV
FT                   NVFPSQIEELILKAPALAPQYQLVVTRDGHLDKLEVRVEARPQSSGLSGNDRAALEQQL
FT                   KEQIKTYVGVTTRVQVLDAEGIERTSVGKARRVLDMRPKVTHEQPVGAI"
FT   gene            335803..336117
FT                   /locus_tag="Reut_B3742"
FT   CDS_pept        335803..336117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3742"
FT                   /product="Protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3742"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63100"
FT                   /db_xref="GOA:Q46UT4"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63100.1"
FT                   /translation="MDAQQLGLETLQQHPDFIRLANGRARLGWSLTVVMLAIYFGFILL
FT                   LAFAPATLGTPLGGGVMTLGIPVGVGIIVAAIVLTAVYVRRANTELDPINERLRKECQA
FT                   "
FT   gene            336114..337778
FT                   /locus_tag="Reut_B3743"
FT   CDS_pept        336114..337778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3743"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3743"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63101"
FT                   /db_xref="GOA:Q46UT3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63101.1"
FT                   /translation="MKPTLRKLPLLIMSLASGAALAAPAIQGEVTRRPLNWSAIVMFML
FT                   FVLFTLGITRWAARRTKSASDFYAAGGGLTGFQNGLAIAGDMVSAASFLGISAMMFDKG
FT                   YDGLIYALGVVAGWPIILFIVAERLRNLGRYTFADVVSYRLSQKPVRITAAFGTLTVVI
FT                   MYLVAQMVGAGKLIELLFGTSYESAVVVVGLLMVLYVLFGGMLATTWVQIIKAVLLLGG
FT                   VTFMAFMVLAYFDYSPEAMFAGAAKVHDKGLAILSPGGLVSNPIDAISLGVGMMFGTAG
FT                   LPHILMRFFTVADAREARKSVLYATGFIGYFYVLILVVGFGAIVMVGSDPAYRDAAGKL
FT                   IGGSNMVAVHLAHAIGGDLFLGFISAVAFATILAVVAGLALSGASAVSHDLYANVFRKG
FT                   QANEKDEIRVSKAATLVIGLLAMVLGVLFEKQNIAFLSGLVLAIAASVNFPVLFLSMFW
FT                   KGLTTKGAVAGSLAGLASAVALLVLGPTVWVGLLHHDKPIFPYANPALFSMTLAFVSAW
FT                   LVSVLDNSAQAAAERRRFGAQFVRSMTGIGAAGASQH"
FT   gene            338114..338446
FT                   /locus_tag="Reut_B3744"
FT   CDS_pept        338114..338446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3744"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63102"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63102.1"
FT                   /translation="MTYSLSRADVDSITDTELARSTTRLLPQWPDIPDDFREGNVYTRM
FT                   AEARLLDYPMPAITLTFLPGFDDAAACAAIDRCVAAHLKAFDPGHEHRIAGVGYMISKV
FT                   CTITGG"
FT   gene            complement(338571..339563)
FT                   /locus_tag="Reut_B3745"
FT   CDS_pept        complement(338571..339563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3745"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3745"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63103"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63103.1"
FT                   /translation="MRPLTVVRSLASLLFVAGSLGTLPGRAEANIASTFPQKPIRMVVT
FT                   FPAGGGTDALARLIGTDLSKTLGQPVVVDNRPGASGNIGAEFVAKSPADGYTLLIVNSS
FT                   FAINPGVFRKLQFDPKNDFNAVITFASVPSVISVPQNSGLRTFKDLLAAGKSATPPSYA
FT                   SCGNGTPQHLAGELLKMSARIDMLHVPYKGCAPAIADVLGGQAEVSINTLPNTVPYLKS
FT                   NKLRALAVTSKSRSPLLPDVPSVSELGVTGYEVDQWFGILAPAHTPPEIVQKLNAEIAK
FT                   AVAKPEIKASLAQLGFATTTSTPAEFQKLVNGDIDRWQKLASKINLIAD"
FT   gene            complement(339607..340959)
FT                   /locus_tag="Reut_B3746"
FT   CDS_pept        complement(339607..340959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3746"
FT                   /product="Glycosyl transferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3746"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63104"
FT                   /db_xref="GOA:Q46UT0"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028579"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46UT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63104.1"
FT                   /translation="MPDGVHCVTVTNDSTLDLGVARFTDALRNGANAGSVPQPASRRHL
FT                   AAKLDGQPLDEGAYEAILRDAIAGRYTAQELTAFLTAATRSLDDREVVALARARTRFTA
FT                   RIEWDEPIVVDKHSMGGIPGSRITLIVVPIVAAYGLAMPKTSSRAITSAAGTADAMETV
FT                   ARVDLTHDDVRRCVAQARACIAWNGRLNHSVIDDVMNAITRPLGLDSRRWAVASILSKK
FT                   ATAGATHVIVDIPYGPQTKLSARADADALAGLFEEVGKGLGLHVRALVTDGSRPIGRGV
FT                   GPALEVRDVRQVLENHPDAPMDLREKALRFAGEIIAFDPRVASAAQGMRIATALLDEGS
FT                   ARAAFDRIVATQGIRPDPVAPGAHTHVIVAPAEGRVAAINGWQISGIARAAGAPRSAGA
FT                   GIDLLCTIGERVAAGEPLYRIHAESAADLATAVAMTGPAGEASTAVRVDPD"
FT   gene            341767..342312
FT                   /locus_tag="Reut_B3747"
FT   CDS_pept        341767..342312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3747"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3747"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63105"
FT                   /db_xref="GOA:Q46US9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63105.1"
FT                   /translation="MATKKQESPVTITPSDEVDVERLAHLVKDAARAYIRALQLRLAQH
FT                   SVSYGHWTILRILWRHDGLSQRELSERAGVTEPTTFSAVKALEALGYVERMHLPGNNKK
FT                   VHVFLSKAGRALRRKLEPLAEEVNAISVEGVTEEDVMTTRRVLISIAEKLVADEAALAE
FT                   SGRRVPSTQEVGRLLADL"
FT   gene            complement(342405..343238)
FT                   /locus_tag="Reut_B3748"
FT   CDS_pept        complement(342405..343238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3748"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3748"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63106"
FT                   /db_xref="GOA:Q46US8"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63106.1"
FT                   /translation="MYDIFSTDKLIDLWLTEDIGICDLTVQTMIEPGETGTFCMNAREP
FT                   MIIAGIDVAARIFARYDPSLSIDVRAADGDKVEKGAVLLNVSGNARSVLTAERTALNIM
FT                   QRLCGIANLTARYADEIAHTKARLIDSRKTTPGLRALEKHAVTCGGGLNHRLSLDNGVM
FT                   IKDNHIAVCGSIAAAVARVRRKLPVLTKLEVECDRLDQVREALDAGVDVIMLDNMSLPD
FT                   MKEAVQIVNGRTKVEASGGIRLETIRAVAETGVDYISTSKITQSAPAVDIGLDDA"
FT   gene            complement(343623..345689)
FT                   /locus_tag="Reut_B3749"
FT   CDS_pept        complement(343623..345689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3749"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3749"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63107"
FT                   /db_xref="GOA:Q46US7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63107.1"
FT                   /translation="MHYSPDAIRTIALLGHAGCGKTSLAEALLHKGGALHAPGSVERGS
FT                   TVSDFDPLERKYHHSLTSAVLHVDFRNTRIYLIDTPGYPDFSGQAISALPAVETAAIVI
FT                   NAQTGIEMTTRRAMAWAQARKLCRMIIVNGIDGEKVDLPALLADIQEAFGKECLPINLP
FT                   AAGGSQVVDCFFNPAGEADFLSVPAAHDALVDQVIEIDPELMELYLEQGEAIQPEQLHA
FT                   PFERALREGHLVPICFTSAATGAGVPELLDAFVRLLPNPTEGNPPMFYRSVGEGSDAAE
FT                   RKKEVRAEPVPDKHVLAHVFKIVMDPYVGKMAVFRIHQGTVTRDSQLYIGDARQPIKVA
FT                   HLLLLQGKEHEEVPRAGPGDICAVAKIDEIGFDAVLHDANEDGNIHLIPLEFPTPIYGL
FT                   AIEPARRGNEQRMAEVLHKLSAEDPCLRVEHPPGTNETVLLGLGEFHLRCVMERLTEQY
FT                   KLEVVTRPPRIAYRETIGGSAEGHHRHKKQTGGAGQFGEVMLRVDPLPRGTGFEFVDAV
FT                   KGGAIPGQFIPAVEKGIRQALECGPLAGFPMQDVRVTVLDGKSHPVDSKEVAFATAGRK
FT                   AFVDAVLKARPSVLEPVVDIEVMMPDSSMGDVIGDLSSKRGQVHGTRTGAANTVIVAGK
FT                   VPLSELNDYQSRLNSLTGGHGSYTIQFSHYEGVPPGQQDKMAAKHKAQADTGA"
FT   gene            complement(345881..347320)
FT                   /locus_tag="Reut_B3750"
FT   CDS_pept        complement(345881..347320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3750"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3750"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63108"
FT                   /db_xref="GOA:Q46US6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63108.1"
FT                   /translation="MEAVATRNLLTGGHATAPQRPYDPAYDPLRTPTPGQGREYAPTYW
FT                   IGTAGEPPADDGPITHDIDVDVAIIGSGFTGLTSAIFLAQEHGIKATVLEANRVSWGCS
FT                   TRNGGQAQCASGRLKRSQWIQRYGLDTALRLHEEVCDGMQTFKSLIKDIDCDPQPGGHL
FT                   YIAHRAKAMPALEKEAKVLRDIFKYDARIIDADTVRREYVDDKEAAGAMHEPEGIGIHA
FT                   GKLAFGYLRRARELGVKVHPSSPVTGWETRNGVHYLRTPGGIVRARSVGVATGGYTSQS
FT                   LHPQLKNRLFPILSNSIVTRVLTPAEIEACNFRTHQVITDTRILRHYYRLMPDGRLQIG
FT                   SRSAITGHDAPQDQYRQKLVDDMYRKFPSLRGIQIDYSWWGWVDVSHDMMPRITQPDPS
FT                   QSIYYALGYGGNGVMYSAQAGKRLAALIAGKGDSLPPLPIFRSSLPFPNVREMVESQMF
FT                   APFRRFGQRFLYHWYHFKDEV"
FT   gene            complement(347337..347741)
FT                   /locus_tag="Reut_B3751"
FT   CDS_pept        complement(347337..347741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3751"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63109"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63109.1"
FT                   /translation="MSKPSTTPVGTDLLQAFNDAWNRHDIDALMSFMADDCAFHGVAGA
FT                   DLLGRSFVGRDAVREGFMLAWQTFPDASWTEGEHFVSGDRGVSESTFRGTRADGARIEA
FT                   RMVDVFTFHDGKIAVKNAYRKDRPPVTNAA"
FT   gene            complement(348008..349549)
FT                   /locus_tag="Reut_B3752"
FT   CDS_pept        complement(348008..349549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3752"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3752"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63110"
FT                   /db_xref="GOA:Q46US4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63110.1"
FT                   /translation="MTSKLTPPMWDQLFQQHAHSGLSLQGKIRQMLVSAILDEQLPQGV
FT                   PLPSSREMSAQLRVARNTVVLAYQQLVDEGYLISRERSGYFVNPDILGTRVSGVASLRG
FT                   TPQPDTHGSARPDWDRRFVFRPTHQRNIVKRHNWRDYPYPFIYGQYDPVLFPTADWREC
FT                   CLKALSVLDIHEWAQDMIVRDDESLVQQIRTRVLPRRGVWAGADEIVITVGAQQALYLL
FT                   SDLLASPDTPVGIEEPGYPDARNIFGRHTSKLIPLPIDAEGVIPSDALRACDYVYVTPS
FT                   HQCPTTVTMPLARRQALLRQAEEADFVLIEDDYESESRFEGDPTPTLKSLDRNNRVIYV
FT                   GSLSKSLAPGLRIGYIVGPAELIAELRGARRLMLRHPSAYIQRAFSLFLSLGHYDAHLR
FT                   RLSAAHRARAETVLAALAAHMPEFRPVPIAGGASCWIEGPAWLDADALARLAELQGVLI
FT                   EPGSVFFMGEPAPRNGFRLGYSSIAPERIEPGIRVLASVARELHAAIPARGASAA"
FT   gene            complement(349615..351051)
FT                   /locus_tag="Reut_B3753"
FT   CDS_pept        complement(349615..351051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3753"
FT                   /product="gamma-aminobutyrate:proton symporter, AAT family"
FT                   /note="TC 2.A.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3753"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63111"
FT                   /db_xref="GOA:Q46US3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63111.1"
FT                   /translation="MTQTPQPSSGLSHGLKQRHMTMIALGGVIGAGLFVGSGVVIKSAG
FT                   PAAVLSFLITGLLVVLVMRMLGELACAMPGGGSFYEYAREAWSDRPAVGNLASFLTGWM
FT                   YWYFWVIVVALEAVAGADLVRYWLPDVPNWTISLVLLVMLTLTNLISVKSFGEFEFWFA
FT                   SIKVAAIMVFLFVAGVYVLGLAPGAHGMNVANLTANGGFMPNGIVPVLTGAVAATGFYF
FT                   GAEIVTIAAAETAEPQKAVARATNSVITRVLVFYVGSVLLVVCLVPWNATGIATPYVSA
FT                   LNVMGIPAAAQIMNAIVLTAVLSALNSGLYASSRMLFALTKRGDAPRSLARVSRNGVPT
FT                   RAILVATLFGYGAVVMSYVSPDKVFAFLVNSYGTVAIFVYILIAVSQLRLRARLEREAP
FT                   HLLKVRMWCYPYLTWLAIFGMLAIVVAMAFIPDQRTPLALGVASLGLLVSAYIVRHLFR
FT                   RGVQQVVPLAEMPRPDLHEY"
FT   gene            351364..352191
FT                   /locus_tag="Reut_B3754"
FT   CDS_pept        351364..352191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3754"
FT                   /product="regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3754"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63112"
FT                   /db_xref="GOA:Q46US2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63112.1"
FT                   /translation="MNELRLAKSDARPDGDTPALRLFGLLEVIATKDHPFNLQALVEET
FT                   GLPKPTLHRMLQQLEAAGMVQRNGDGRHYGTGLRLRRLAENLLLNNTSHGARHMVLRKL
FT                   VEEVGESCNLTAFSSGEVLYLDRVETAAPLRFYLHPGSRVPAHCSATGKLFLAQLTPAQ
FT                   RQRLLAHAELERYTANTLTDHVELEAEIERVKRDGYAMDDEEFLPGLLCIGVLVPAVDG
FT                   GKSNLGLALQAPVMRVTHEKALQMLPALQRAARALAAIEAESGTAWGGADEDE"
FT   gene            352305..353273
FT                   /locus_tag="Reut_B3755"
FT   CDS_pept        352305..353273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3755"
FT                   /product="cobaltochelatase CobS subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3755"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63113"
FT                   /db_xref="GOA:Q46US1"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63113.1"
FT                   /translation="MVPVRSLFGIDSGLMVPAFSERDDHVPEIDPAYRFQPEVTLAILS
FT                   GFMRDRRVMVQGLHGTGKSTHIEQVAARLNWPCVRVNLDGHISRLDLVGKDAIVIRDGQ
FT                   QITEFQEGIVPWALQRPVALIFDEYDAGRPDVMFVIQRILERDGKFTLLDQNRVIRPHP
FT                   SFRLFATSNTVGLGNLNGLYHGTQLLNHAQIDRWNVVATLDYLPHAEETGIVLARVPEL
FT                   DNTDGRELVDAMVALAALTRRGFAAGDVSALMSPRTVISWAENCQIFRDPALAFRLTFL
FT                   NKCDEAERPVVAEYYQRCFGNLPGEAAGQAASNATRPEPAQ"
FT   gene            353270..354991
FT                   /locus_tag="Reut_B3756"
FT   CDS_pept        353270..354991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3756"
FT                   /product="CobT protein"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3756"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63114"
FT                   /db_xref="GOA:Q46US0"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q46US0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63114.1"
FT                   /translation="MSAAAAAQRLRRRQRQDALSGAAVRALTGDAALHFRDGRLWREMR
FT                   PVPQHAPHLRTDPDIDSAACLRGAADGAALRHAHSDATLHRSLCPEDAVERLLFEMLEQ
FT                   LRCETRVPRGMAGVEANLRHRFLAWSRAFHRSGLTEGQLGILLYTVAQIAWSRLSGEPV
FT                   LDETEDLIEATRAAIVPVLGTSLAGLRAHRHDQPAFAEHALALARAVAQMVHSEAPNAG
FT                   EDDDAAASAARAGFALWLDFEEEQPETFALADSGHSRVLAEAKDGYRVFTTRYDREVRA
FT                   ATLVRRALLDEYRTQLDARIARAGVNVARLARRLRAALALPRVDGWSFGEESGRIDGRR
FT                   LAQLVSSPAERRLFRLEAHRAHADCVVGFLVDCSGSMKARAEPLTLLLDLLTRALDEAG
FT                   VATEVLGFTTGAWNGGRARADWLARGRPAHPGRLNETCHMVFKDATRSWRRSRTDITAL
FT                   LKPDLFREGIDGEAVEWACARLHATGKARRILLVLSDGSPMDTATGQANDASYLDNHLK
FT                   AVVARHEFLRDVEVLGLGVGLDLSPYYRHALAVDLSQPVDMAMLDEVANLLAARRR"
FT   gene            complement(355012..355371)
FT                   /locus_tag="Reut_B3757"
FT   CDS_pept        complement(355012..355371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3757"
FT                   /product="Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3757"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63115"
FT                   /db_xref="GOA:Q46UR9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63115.1"
FT                   /translation="MIQITFLTNHGKTVSAPPDSNLLRVSLREQGGIPFKCGGGLCGTC
FT                   KCRIETGHEHTDAVKPKEKKLLTEQELAGGFRLACQTFIRGDIAVSWQPREMARGPAQA
FT                   GANTPAPQSECSSSA"
FT   gene            complement(355409..355726)
FT                   /locus_tag="Reut_B3758"
FT   CDS_pept        complement(355409..355726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3758"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3758"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63116"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63116.1"
FT                   /translation="MFVLLTSRPGQFRTEPTDGMTAVEAYDYVFYGKRTARFVIAELAA
FT                   DTKVRVQEETPPGIVNLVPTKFLEKYDTLDAARSALRELAQFGTMDIALVPTPVTAGGQ
FT                   P"
FT   gene            complement(355728..356084)
FT                   /locus_tag="Reut_B3759"
FT   CDS_pept        complement(355728..356084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3759"
FT                   /product="Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3759"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63117"
FT                   /db_xref="GOA:Q46UR7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63117.1"
FT                   /translation="MPTVTFHKQGQTYTDEVKPQTNLVVRAGIRQFPYPNLRYECGMGK
FT                   CSKCACRVIAGAEHLPPPNWKEKKQLGDRLEQGYRLACQLWIEHDIELAQDDLPAPASA
FT                   TAGTVAVPADSVDA"
FT   gene            complement(356144..357691)
FT                   /locus_tag="Reut_B3760"
FT   CDS_pept        complement(356144..357691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3760"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3760"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63118"
FT                   /db_xref="GOA:Q46UR6"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63118.1"
FT                   /translation="MSQQVVIGAAHWIYLAGVAVIVLTMILRANVVVPSIVGTALVVFA
FT                   LTGSPVSALAGVFSASLVAAKELFNIFLVIAFMTALLNALKTLRSDIRMVEPFRMVMKN
FT                   GHSAFFILAGITYVISLFFWPTPAVPLVSAILLPAAIAAGLPPLAGAMAIAIAGQGMAL
FT                   SSDYVIGVAPGISAKAAGAAVSAAVVADRALALSIITGSIALCLAYLTMRKHIVPASGA
FT                   LLDRWQARAGGTAAQAGHIEGSGTFDKAEIARGTAHSEPLATDSNIEASLSMVARRRVK
FT                   WSKCFAIVTPIAFLAVVAIMVLPKLGTGVQDLKGGDAAALVGGVAAVLMMLATLAAEGP
FT                   RRMLDVCPEHITDGFVFAFKAMGSVLPIAGFFFVGAGETAAQILGLPPGKAPSLLFELI
FT                   QAYQHTIPDNHVLVAFGVLLVGMITGIDGSGFAGLPLTGTLAGALGPVVGFDPATLAAV
FT                   GQMGAVWTGGGTLVAWSSLIAVAGFARVPVLEAVRALLIPVLIGLTCSTVAAMLLWS"
FT   gene            358055..358987
FT                   /locus_tag="Reut_B3761"
FT   CDS_pept        358055..358987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3761"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3761"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63119"
FT                   /db_xref="GOA:Q46UR5"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63119.1"
FT                   /translation="MQHITDAMIDAHVSPEDARQVMEAAFASFGRGDAAMQERIRTEAG
FT                   GVKLSTLGAVIPQQGFAGAKVYTTINGQFSFVILIFSTEDGRPLASFDAGAITRLRTAA
FT                   CTTLAAQRLVRPGARTLALFGAGTQGVQHARQLSATLGLQRILVSDPHADAGMPARLSA
FT                   QCGIPVVVSEPDAAVAEADIVVTASRATTPLFAGASLRPGAFVAAIGSSLPHTRELDDT
FT                   ALRRAAAVVVEWRPQSTREAGDIVLADPQALPTEKIVELGDVVLGKVSPRQRDDDIVIY
FT                   KSVGVGLEDVALAGFAWSRIAGAVELRVA"
FT   gene            359159..359890
FT                   /locus_tag="Reut_B3762"
FT   CDS_pept        359159..359890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3762"
FT                   /product="Coenzyme PQQ synthesis C"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3762"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63120"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63120.1"
FT                   /translation="MAELMNREAFRAALEEAIKGKSANKAPFSVAWASGKLTRAHLARW
FT                   AENHYHYVGPFADYLGYIYARTPDRYTEAKDFLLANMYEEEIGGDRHTDLLIRFAEACG
FT                   TTRERVIDPDNMSPTTRGLQSWCYAVAMREDPIVAVAGLVVGLESQVPSIYRKQTPTLR
FT                   DKYQFTDEEVEFFDLHIVSDEIHGERGYQIVLEHANTPELQQRCLKICEIGAQMRLLYT
FT                   TALYHDYVAHELPLPELEMAA"
FT   gene            359918..361363
FT                   /locus_tag="Reut_B3763"
FT   CDS_pept        359918..361363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3763"
FT                   /product="Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3763"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63121"
FT                   /db_xref="GOA:Q46UR3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63121.1"
FT                   /translation="MNVFLNHIDGEWTACQSGRTFDNVNPADTGDIVGRFQASSAVDAQ
FT                   AAVAAAAAAFAGWKKTPVGKRAAVLNRAADHLEANADSIAAELTREEGKALTLARDEVL
FT                   RSAQTLRFYAVEGQTFTGEVFPNDDPDQLVFSQREPLGVVTVIAPWNFPVSIPARKIAP
FT                   ALVTGNTVVFKPSSEAPLSGYRLAEALIKAGLPKGVLNFITGSAAEIGAAITEAPVVRA
FT                   ISFTGSSRAGEQIHRAVPLTTRTQMELGGKNPLIVMEDADLDRAVDLTIKGGFSLSGQA
FT                   CTGTSRVLVAESVKAAYTERLLAKVATLKVGSGMTAGMDLGPLASQKQMETVLRYIDIG
FT                   KSEATLLCGGERLTGGEFDKGYYVAPTVFTDVTQQMRIAREEIFGPVIAILGFTDYADA
FT                   IAKANDTEYGLAAAIVTSNPRYIHHFANDIEAGTVKINRTTTGNLVNAPFGGLKRSSTS
FT                   TFRESGRTGLEFYTQIKTVYRGA"
FT   gene            361391..361870
FT                   /locus_tag="Reut_B3764"
FT   CDS_pept        361391..361870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3764"
FT                   /product="Protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3764"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63122"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63122.1"
FT                   /translation="MKKAIKLELREARHMVAAAIRRSEEIGVLESICVVDEGGYPLVLE
FT                   RMDGARITGPQIAWNKAFTAAGHKRSTHLFTTPPNGPALPGNEAFGIQWSFEGKFAAFV
FT                   GGFPIVVNDEVIGGIGLSGGNGEQDTQAGVAALQALAELLAPQDLKVLVQADIKK"
FT   gene            361896..362894
FT                   /locus_tag="Reut_B3765"
FT   CDS_pept        361896..362894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3765"
FT                   /product="Ferredoxin:Oxidoreductase
FT                   FAD/NAD(P)-binding:Oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3765"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63123"
FT                   /db_xref="GOA:Q46UR1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63123.1"
FT                   /translation="MSYRIQIAETQQVFFVERGETLLQAAGRADISLPHDCQLGGCGTC
FT                   RIRLLDGQVRYDEEPFGLAPDEAAAGYALACQAQPLADLVISTAREDEACAEPARHQAI
FT                   VRGVRPLSLDVLHVELEVPDAGTLAYRPGQYLKLVTGDGLARSFSMASVPSEGRVDLHV
FT                   RRIPGGAFTDGILPRLKAGDAVDVELPLGTFFYRAKDYRPLLMVATGTGLAPIKAILES
FT                   LMDDPDCPPVSLYWGMRQPEDLYLHADIPAWGERLYDFQYVPVLSRAGDGWQGRRGYVH
FT                   DAALADLGDLSEHAIYLCGSPNMIRDARAAFIARGASPEHLYADSFTFQRD"
FT   gene            362973..363677
FT                   /locus_tag="Reut_B3766"
FT   CDS_pept        362973..363677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3766"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3766"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63124"
FT                   /db_xref="GOA:Q46UR0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63124.1"
FT                   /translation="MALTSPTASTAPTAEPLSLGASHSPLFALVTDKLREGILNGKFAP
FT                   GERLVENKLSAELGVSRIPVREALRALASEGLVLIEPRRGASVASLSPVIAREMVEVRA
FT                   TLEGLNAKLAAQRRDPALVAELETVLRQGMDAAAQGRADELLSLNSRFHEVLGTIAANS
FT                   VLQEMMRSLRERTAVLFGPANVVRARQNWDEHAQILQAVIAGDADLAALLAARHVYSAA
FT                   KAADLPVEGQVA"
FT   gene            364577..364753
FT                   /locus_tag="Reut_B3767"
FT   CDS_pept        364577..364753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3767"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63125"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63125.1"
FT                   /translation="MKSPEQRYLSQPVGQQLLRYYAARDAVRHATPLVPLKLRDIGRFF
FT                   LVLGGHVQRRHHC"
FT   gene            365013..366509
FT                   /locus_tag="Reut_B3768"
FT   CDS_pept        365013..366509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3768"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3768"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63126"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63126.1"
FT                   /translation="MNLPDRSKTGLAPLWKMAQWLADGEVSAVELVQACEAAWHAWHGV
FT                   INALVVSDFDAARAAAQESDRRRSAGQARGVLDGVPFSIKESFDVAGWPTTCGNPALRG
FT                   RVARRDAVVVQRLRDAGAILLGKTNVPLGLRDWQSYNEIYGTTRNPHDPSRTPGGSSGG
FT                   SAAAVCAGLSAFDVGSDIGSSLRNPAHYCGIFSLKPSHGLVPLAGHGTGPARFGEQDIN
FT                   VAGPLARSARDLEPVLRAIAGPYGDQEMAYRLELPACPHRRLADFRVAVLPSHPQAEAD
FT                   SAVATQIEQLGHWLAQQGARVAWHARPDFDAAELWHAYVTLLRAATSLHMDDAAYADAL
FT                   DRAANAAAGDASYSTLQYTGATLSHRDWLRLQAARERFAAAWRQLFADHDVLLCPAATT
FT                   TAFTLNEAGEPWTRMLEVNGQSQPMTTQLFWAGHSGLCGLPSAVAPIGPASNGLPVGVQ
FT                   IVAGRYQDLTALRFATLLEDAGYAFRPPPRPSTLPANLHH"
FT   gene            366539..367840
FT                   /locus_tag="Reut_B3769"
FT   CDS_pept        366539..367840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3769"
FT                   /product="General substrate transporter:Major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3769"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63127"
FT                   /db_xref="GOA:Q46UQ7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63127.1"
FT                   /translation="MFDWFRDLSRMERKGFYGAFLGHAVDVFDFMIYSFLISTLLGQWG
FT                   MSKSTAGAIVTWTLVSSLVGAIGAGILADRYGRVRVLRWTIIVFAIACFLCGLAQSPEQ
FT                   LMLFRMIQGLGFGGESSLCMVLVTEMIRNPAHRGKYSGFTASSYSFGWGAAAIVYALTF
FT                   SMLPAETAWRVCFFLGILPALVVIYLRRNLEEPEVFLKSRAAGRQGTALAGLGRLFRGP
FT                   LLSKTLLCSLLSGGMLGAYYAIATWLPTFLKTERGLSVFGTSSYLAVTIIGSLIGYVAG
FT                   AYATDRWGRRLTYIVFAAGAFVAALVYMVIPVSNTSMLFLGFPLGILMQGVFSGIGATI
FT                   SESFPNDIRATGYGVSYNAGRVIGSLFPLSVGWLSSGHTSLPTAIAIVAGVGYVMVVMA
FT                   ALLLPETTGMDLGQAGGGEEQDSAPLAQPAGTVA"
FT   gene            complement(368071..371775)
FT                   /locus_tag="Reut_B3770"
FT   CDS_pept        complement(368071..371775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3770"
FT                   /product="Outer membrane autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3770"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63128"
FT                   /db_xref="GOA:Q46UQ6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63128.1"
FT                   /translation="MQKNKTKLQHRLVLRPMPRAIRAACHLAGSRHVLYLFVGGMFAGL
FT                   VPEAEGQTPCATVGTGQVSATDTCTVPPSTVIGTTVANPVAVTGTGAPANVTGQALTLN
FT                   LGVANAGGANAQGGASIQLTGGQVMTTSNTAATANGQTGLLASGALSAISANGTTITMT
FT                   PAAGINLTAARAVDGGTVTLTDLAINIGSAGSGRNFNHSLVASGANSNVFATGVNVTAL
FT                   SNFSQAARAELAGTVTVTGGSMTATGTGSAATGPVAAAGAFSGGQLNIRGGTSLNGGAA
FT                   TEAYGLYVKDAGSAATVSDATIKTDVRAIGVLADAGATATLTNSTVQAGTARGVWAKGN
FT                   ATIGLINTNVTSQSYAVTSGEGGGITVNGGTLSGSGQVPTVSAGSTVGIATITTQNTAI
FT                   VSSGSANAGGVYANTGSLITLNGGTVDTFGTLDRGQTPNALAAVNPGAQLVANDVSVRT
FT                   HGERALGVAADDGGTITLNRTTVTTDSLRALGIYAGVDPTKPGAAAVIATASRVETSGQ
FT                   FAHGAQAQARTNLDIPATITLNDNSTVTTHGDGAVGLRAVLKGKIDATQSSVVTEGAAA
FT                   HGMLALGEQSLVTLNGATVTAGGINAHGGIAQDGGIITGTNAAVTANGANAAALFVAGE
FT                   LSPSSAGFTSSTLRNTSGPTIAVGGNGTISLSGSTVSGSGEWLRVGTIADFPSLPAAED
FT                   PIARPQPLPPDDAVPLLATLALSPGVVAMKTPLATAGGAILDVSASTLTGAATTLPGST
FT                   STVTARDGTVWNMTGNSNLTNLTNDASRILFSAPVAGAFKTLTVTRYTGANGGVVGLNT
FT                   VLAADNSPSDTVVIDGGTAGGQTGLRITNAGGAGAVTTANGILVVNTANGGATQPDAFR
FT                   LDGRAVAGPYEYRLFRSSVDGTNADAWYLRSEKTPPPAPPAPPDPLYRPEVAAYLANQR
FT                   LAGQMFVHSLHDRLGEPQYVEDQGFDHEEDKPRSGWLRVVGKWEGSHSKDGNFKVDTDS
FT                   FLLHGGVELAKWKVAREEDRVHLGLMAGYGYARSNAEAAANPARAHGTVEGFSLGAYGT
FT                   WYQNDEHKLGTYVDTWFQYGWFNNKVEGDQLPTVSYHAQGWAISGEVGYAMPTRYDWVI
FT                   EPQAQLIYVSYGEDDITEPNGTHVSGADSNGLITRLGVRVHRTFIREDRRKLQPYVTLN
FT                   WWHTSTDSNISFNQLPLGSLYPSNRYELKLGLNADLGKRWTGWANVAGAWGAQSYHQYA
FT                   ARVGVKYTW"
FT   gene            complement(371953..372723)
FT                   /locus_tag="Reut_B3771"
FT   CDS_pept        complement(371953..372723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3771"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3771"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63129"
FT                   /db_xref="GOA:Q46UQ5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63129.1"
FT                   /translation="MKLELLMPVLGLQALLGAGTYFQTVTGFGLGMIVMGATSGLGLAP
FT                   VATVAAVVSLVTLANSAFALPGKMQHIDWRAVFAAAIGILPSVVAGVLLLDYLSSTAAT
FT                   LLQLLLGAVILYGGLSAALRPEPLPRRSGDGSFLVSGIFGGLLSGMFGVSGPPLIFQFY
FT                   RQPMKPVEIRCALILVFTVTSSVRTLFSAWQGQLDAQICLQAAIAVPVVVLATVLGRRF
FT                   PPPFSPTTTRRIAFGVLMGIGASLMVPALVSQLG"
FT   gene            complement(372720..373757)
FT                   /locus_tag="Reut_B3772"
FT   CDS_pept        complement(372720..373757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3772"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3772"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63130"
FT                   /db_xref="GOA:Q46UQ4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63130.1"
FT                   /translation="MKPILRIIDRARAAPRRIVLCEGEDPRILQAAERAAREGIAQVIL
FT                   VGNAARITDAAANQGIDLPRMTIVDPATSALTPSFAQALYAMRQKKGMTLDQARQAVLD
FT                   PLCFANLMVRQGHADGSVAGAVHTTANVVRNAIQLIGLAPGFRLVSSFFLMMLCEPFHA
FT                   LKGGLIFSDCGLVVDPDAEELSEIAMAASDSARSLLNEDPRVAMLTFSTCGSAKHAAVD
FT                   KVVAATERVRAQRPGLAIDGDVQLDAAIVAEIAERKIPHSQVGGHANVLVFPNLEAGNI
FT                   GYKLAERLGGAKAIGPMLQGLRRPANDLSRGCSAEDVFHVIAVTVVQAQAASAQQPSSG
FT                   EQAAA"
FT   gene            complement(373891..375741)
FT                   /locus_tag="Reut_B3773"
FT   CDS_pept        complement(373891..375741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3773"
FT                   /product="sulfoacetaldehyde acetyltransferase"
FT                   /EC_number="2.3.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3773"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63131"
FT                   /db_xref="GOA:Q46UQ3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017820"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63131.1"
FT                   /translation="MRDLDTTTQPAVSGGSATETQVPAGPQTMTPSEAFVETMVANGVT
FT                   EMFGIMGSAFMDAMDIFAPAGIRLIPVVHEQGAGHMADGYARVSGRHGVVIGQNGPGIS
FT                   NCVTSIAAAYWAHSPVVIVTPEAGTTGIGLGGFQEAKQLPMFQEFTKYQGHVTHPQRMA
FT                   EFTGRCFDRALAEMGPTQLNIPRDYFYGKVNVEIPKPQRLDRGPGGEQSLNEAAELLAQ
FT                   AKFPVIISGGGVVMADAIEECKALAERLGAPVVNSYLHNDSFPASHPLWCGPLGYQGSK
FT                   AAMKLISRADVVIALGSRLGPFGTLPQHGMDYWPKNAKIIQIDADHKMLGLVKKISVGI
FT                   CGDAKAAAIALTQRLANRTLACDSSRDGRATEIANEKAAWEKELDGWTHERDPYSLDMI
FT                   EEQKNERTFNGGTYLHPRQVLRELEKAMPADVMVSTDIGNINSVANSYLRFEKPRSFFA
FT                   AMSWGNCGYAFPTIIGAKVAAPHRPAVSYAGDGAWGMSLMETMTCVRHNIPVTAVVFHN
FT                   RQWGAEKKNQVDFYNRRFVAGELDNQSFAAIAKAMGAEGIVVDRLEDVGPALKRAIDLQ
FT                   MNHGKTTIIEVLCTRELGDPFRRDALSKPVRYLDKYKDYV"
FT   gene            376037..376570
FT                   /locus_tag="Reut_B3774"
FT   CDS_pept        376037..376570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3774"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3774"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63132"
FT                   /db_xref="GOA:Q46UQ2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63132.1"
FT                   /translation="MGPRTKRGAAADDSAPVSAVEPESDPAKELLWARPGFLVRRLHQI
FT                   HVAMFFEECKSPNITPVQYAILTVLSVLPGLDQTSLGQEVGLDRTTTADVVRRLEERGL
FT                   LERRDNPADRRTRHVYLTKEGRSVVTALRADMARAQERMLAPLKPAQREVFMDLLATLV
FT                   EANNQYSRTVLRSM"
FT   gene            complement(376643..377167)
FT                   /locus_tag="Reut_B3775"
FT   CDS_pept        complement(376643..377167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3775"
FT                   /product="Aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3775"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63133"
FT                   /db_xref="GOA:Q46UQ1"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63133.1"
FT                   /translation="MKPMYYAVYRESKLGAARAIELRLEIENFHAEYCAVLDAGLVEQW
FT                   PRFFTEDALYRITARENAELNLPVGLVYAEGIGMMRDRAAAIANTQMFAPRYNLHLVTN
FT                   TRVTDETADGDIVAQSNFLLLQTLVEGPTTMHMAGTYHDRFQRTGNGLLLRERQVIYDT
FT                   TIIANDLVYPV"
FT   gene            complement(377171..378460)
FT                   /locus_tag="Reut_B3776"
FT   CDS_pept        complement(377171..378460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3776"
FT                   /product="ring hydroxylating dioxygenase, alpha
FT                   subunit:Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3776"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63134"
FT                   /db_xref="GOA:Q46UQ0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63134.1"
FT                   /translation="MYQTQAVIQHKLGRKDTELDDCRWPEDGLHFIPDWVYTSQSVYDL
FT                   ELEKIFRGRSWNYVALEAEIPNAGDYKRSYVGATPVVVSRAEDGSINVFENRCAHRGAE
FT                   FCRHSQGNTKEFVCPYHQWSYDLKGNLQGVPFKRGVNRAGGMPKDFRNEDHGLVKLNVA
FT                   TRNGVIFASYADNMESLEEYMTPEILKDFDVVFNGKPLKVLGYYKNELPCNWKMYHENL
FT                   KDPYHATLLHSFLVVFGLLVAGNESAMIADSVHGRHGTMASAKKEDKYAAVSDENKKEM
FT                   RSYHEGMRLEDERFLEYVKEFDSPWSVTMQTIWPNLIVQREMNTLGVRHIVPNGPDSML
FT                   MLWTMFGYEDDTEEMTQHRLRQGNLMGPAGFLGLEDNEAMKFVQEGVRRSTTDVNVLKL
FT                   DANHVGTSNSLISESAIRAMYQYYRGVMGF"
FT   gene            complement(378472..379764)
FT                   /locus_tag="Reut_B3777"
FT   CDS_pept        complement(378472..379764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3777"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase:HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3777"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63135"
FT                   /db_xref="GOA:Q46UP9"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63135.1"
FT                   /translation="MSTQTPILIIGAGQAGAMAAAELRKLGHAERIVMVGGERHAPYER
FT                   PPLSKAVLADASQQGQVGVHPAGFYAERDIELRLCTTVSAIDAARSVATCTDGSEIRFD
FT                   ACLLATGGRARTLPHLPAGTPNVHYLRTLDDAARLREAMQGADEVLVIGGGFLGLETAS
FT                   TAVDLGLKVTILESADRLLARAAPAELSDWLAQRVRARGVDLRLGCRITAIEPQAQGVQ
FT                   VRLADGTTWHIPVLVVAIGLTPNTELAAIAGLALHPGNGGIQIDEQGRTSVPNIYAAGD
FT                   CASQFQPLFGAEMRMESWQSANEQARIAATSMLGLQAALAATPWFWTDQFGCNVQMLGA
FT                   ALPGMRYVWRDMPASGAASPKSMLLGTLDGCLRHAIAVNAGGDLRQLRSLFDLPVNEHL
FT                   ARLCDAALPLRQIVREVQAEISSRTASLTTN"
FT   gene            complement(379776..380081)
FT                   /locus_tag="Reut_B3778"
FT   CDS_pept        complement(379776..380081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3778"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3778"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63136"
FT                   /db_xref="GOA:Q46UP8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63136.1"
FT                   /translation="MAWIEIDNVGTLQNDEVMPLNLGERQLAVYRSDDEYFVTDNVCTH
FT                   QYALLSDGYLEDGCIECPLHQGRFDIRTGKAMCAPASTDIRTYPVKFEDRRVWVEL"
FT   gene            complement(380162..381211)
FT                   /locus_tag="Reut_B3779"
FT   CDS_pept        complement(380162..381211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3779"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3779"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63137"
FT                   /db_xref="GOA:Q46UP7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63137.1"
FT                   /translation="MTARDNRATFAYGLLLAVLVAAPFLGAYPVLVMKLLCFALFACAF
FT                   NLLLGFTGLLSFGHAAFFGGAAYACGYAMKSLHVTPELGLLLGTAFGALLGLAFGALAI
FT                   RRQGIYFAMITLALAQMFYFFCLQAPVTGGEDGLQAVPRGSLFGVVSLEPDMTTYYLVL
FT                   AITAAAFLGIMRIVNSPFGQILRAIKENEPRAISLGYDADRFKLLAFVLSSALAGLAGA
FT                   LKTLVLGFATLTDVHWMMSGAVILMTLVGGMGTLSGPIVGALVIVALENKLGDAGTALA
FT                   SLTGIPWFDSLGESVSMVTGLIFVVCVLTFRRGVMGEIEARWKNRPASRPIVPTTRTVQ
FT                   SGAAGTGQG"
FT   gene            complement(381211..382095)
FT                   /locus_tag="Reut_B3780"
FT   CDS_pept        complement(381211..382095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3780"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3780"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63138"
FT                   /db_xref="GOA:Q46UP6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63138.1"
FT                   /translation="MELFGVPLPALLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFA
FT                   HGALFMLGAVLAWMGMNYLGLNYWLMLLLAPLATGAIGVVLERTMLRHLYRFDHLYGLL
FT                   LTLGICLLLEGLLRSAYGVSGLPYPTPEALTGATSLGFMVLPNYRAWVVLASLAVCFAT
FT                   WYMIEKTRLGSYLRAGTENPRIVEAFGINVPLLVTLTYAFGVGLAALAGVLAAPVMQVS
FT                   PLMGQNLIITVFAVVVIGGMGSILGSIFTGLGLGVFEGLTKVFYPEASATVVFVAMVCV
FT                   LLVRPAGLFGKEA"
FT   gene            complement(382108..382845)
FT                   /locus_tag="Reut_B3781"
FT   CDS_pept        complement(382108..382845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3781"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3781"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63139"
FT                   /db_xref="GOA:Q46UP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63139.1"
FT                   /translation="MTQATIPALEIRDLHAWYGESHILHGVDLTVNAGEVVTLLGRNGA
FT                   GRTTTLRAIMGLVGQRKGSVRVHGQETVTMKTHRIAPLGLGYCPEERAIFSSLSCEENL
FT                   LLPPEFPRSAGAVGLREPMTVGEIYEMFPNLLERRKSQGTRMSGGEQQMLAVARILRTG
FT                   ASVLLLDEISEGLAPVIVQKLAKMITMLRRRGYTIVMVEQNFRFAAPLADRFYVMEHGA
FT                   IVEAFESAELERKMPTLNALLGV"
FT   gene            complement(382842..383633)
FT                   /locus_tag="Reut_B3782"
FT   CDS_pept        complement(382842..383633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3782"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3782"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63140"
FT                   /db_xref="GOA:Q46UP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63140.1"
FT                   /translation="MSDNDVILQTRGLTKSFKGFTAVSDVSLRVRRGSIHALIGPNGAG
FT                   KTTCFNLLTKFHAPSSGSIHFNGTDITALRPAHIARMGVIRSFQISAVFPQLTVLENVR
FT                   VALQHKLGTAYHFWRSKRSLSRLDARAMELLDAVGLASFARLPTAELAYGRKRALEIAT
FT                   TLAMDPELMLLDEPTQGMGHEDVETVTALIKRVSAGRTVLMVEHNMSVVSSIVDRITVL
FT                   QRGAVLAEGSYQEVSNDPQVKEAYMGTTDEADDLHVRAEAA"
FT   gene            complement(383639..384856)
FT                   /locus_tag="Reut_B3783"
FT   CDS_pept        complement(383639..384856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3783"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3783"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63141"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63141.1"
FT                   /translation="MSNTRTVRTIAVSTALLGLAAAAPAWADANGVKIGVITDMSGSYA
FT                   DLSGKGSVLAAQMAVEEFGGKALGKPVTVLSADHQNKADIASSLARRWFDTDGVDMVID
FT                   FPNSSTALAVQEVAKQKQKIDIVSTGGAMALTNQNCSPTGFHWAWDTYSVSYPLVKRMI
FT                   DQGRNSWYYITVDYAFGQSLEADFRKAVDVSGGKNVGSTKHPLNASDFSSPVVAASASK
FT                   AKVVVLANAGNDMINGVKAAGEFGLVKAGQTVITPSTFITDIKSLGLNTAQGLTYVDPF
FT                   RLDLDEKSKDFVERYYKRHKAYPTHGQIGVYSGVLHYLKAVEAAKTVDGPAVADKMRAL
FT                   PVNDAFVHNGKVRADGRMVHDMYLAQAKTPAESKGPWDLVKYIATIPGDEAFRPLSASE
FT                   CALVKK"
FT   gene            complement(385027..386628)
FT                   /locus_tag="Reut_B3784"
FT   CDS_pept        complement(385027..386628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3784"
FT                   /product="General substrate transporter:Major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3784"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63142"
FT                   /db_xref="GOA:Q46UP2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63142.1"
FT                   /translation="MTMSLTRDEARASASGMTAEERKVILASSFGALMEWYDFYIYAAL
FT                   AVYFGALFFPKGNETAAFLASLATFGAGFLIRPVGALLFGRLGDLIGRKYTFLVTILLM
FT                   GIATVGVGVLPTYEQIGIAATVLLVLLRLLQGLALGGEVGGAVTYVAEHSPVSKRGLYT
FT                   SSLQTTATLGLLSSLFVVYLLKTFLTEAEFRAWGWRIPFIVSLVMLVISVYIRGKLHES
FT                   PVFARMKAGNATSKAPIRESFTQWHNLKFVLLLFVVAAGLGAIFGTGHFYTMFFVNKTL
FT                   HVPIETVHMLIAIALVVATPCYLFFGWLSDRIGRKYIMMVACLLAALTIQPIFQGLTHY
FT                   ANPALEHFQKQGSVQVTAGNCKARLFGDPVSDCDKIRGYLTDLGVSYTFVPASDAKAEI
FT                   RIGAQALQGFDRDAIKQALVAAGWPERADPAHINMPMLFLLLLVPILYLAMVYGPMAAF
FT                   MVELFPARVRYTSLSLPFHLGAGWVGGMLSFVVTAMNVSSGDVYYGLWYPVIIAGAAFV
FT                   IGMLFVPETRGRDLST"
FT   gene            387060..388022
FT                   /locus_tag="Reut_B3785"
FT   CDS_pept        387060..388022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3785"
FT                   /product="Amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3785"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63143"
FT                   /db_xref="GOA:Q46UP1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63143.1"
FT                   /translation="MTTVKKIALEEHFMTPGFQAYSKGFTQHIDPAVFADLGRRLADFD
FT                   ELRLAEMDRAGIDITVLSQTGPGVQGEADSELAVARAQQSNDFLAEQIARHPTRFAGFA
FT                   ALPMHDPELAARELERTVRELGFKGSLVNGHTHGRYYDDPAYDAFWERMQSLDVPMYLH
FT                   PTDAFVKPQVLNGHPELDGAAWGWGVETASHALRLLFGGVFDRFPRLKIILGHMGEGLP
FT                   FQRWRFDSRFAVYSHGVRLARAPSEYIGSNIVITTSGVCSHGALAGAIAEMGPEAVMFS
FT                   VDYPYESTEVAAKFIEEAPLDDTTRALVCHGNAQRILKL"
FT   gene            388044..388796
FT                   /locus_tag="Reut_B3786"
FT   CDS_pept        388044..388796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3786"
FT                   /product="Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3786"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63144"
FT                   /db_xref="GOA:Q46UP0"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="InterPro:IPR028615"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63144.1"
FT                   /translation="MQKVFRIGQIVPSSNTTMETEIPAMLTARQQIRPERFTFHSSRMR
FT                   MKKVVKEELAAMDAESDRCAVELSDARVDVLGYACLVAIMAMGHGYHRKSEQRLKAHTT
FT                   ENGGDAPVITSAGALVDALKVIGAKRIAVVAPYMKPLTELVVDYIRNEGYEVVDYRALE
FT                   IPDNLEVGRHDPAKLPAIVAQMNIADVDAIVLSACVQMPSLPAVAKVEAMTGKPVITAA
FT                   IATTYAMLRALDLEPVVPGAGALLSGAY"
FT   gene            388807..389631
FT                   /locus_tag="Reut_B3787"
FT   CDS_pept        388807..389631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3787"
FT                   /product="Alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3787"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63145"
FT                   /db_xref="GOA:Q46UN9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63145.1"
FT                   /translation="MSTFLYGGNVNANGIRQHYLRYGGNDGERASRDAVIIVPGITSPA
FT                   ITWGFVGEQFGQRFDTYVLDVRGRGLSEASDTLDYSLDAQAADVIAFAEALGLQRYAIV
FT                   GHSMGGRIGVRAARQHPAGLTRLVMVDPPVSGPGRRAYPAQLPWYIDSICLARAGIDAE
FT                   GMRRFCPTWTEDQLRLRAEWLHTCDERAILASFNGFHEDDIHADLPHVKVPTLLMTAGR
FT                   GDVVRAEDVEEIRKLVPGILVSHVADAGHMIPWDDEAGFYRAFGDFLSAPLL"
FT   gene            389671..390723
FT                   /locus_tag="Reut_B3788"
FT   CDS_pept        389671..390723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3788"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3788"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63146"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63146.1"
FT                   /translation="MPVSDHQMIEAWTQVLKLSKLERGQTVTILTGAATHPQTLSTALI
FT                   ATQAMGAIVNRLDLPPVNGEKALSRDALAYLGTTPLTGNRAAISALKASDLVLDLMTLL
FT                   FSPEQHDILKGGTKILLAVEPPEVLARMVPTEADRERVKAATERLGRAKAMHVVSAAGT
FT                   SLHCPLGEFPAISEYGFVDEPGRWDHWPSGFVLTWPNEGGASGTIVLDRGDILLPQKTY
FT                   VTEPVTLTVENGFATRIEGGLHAEMLSEYMASFKDPEAYAISHIGWGLQPRAHWATLGL
FT                   YDREATIGMDARAFEGNFLFSLGPNNEAGGQRTTTCHIDIPLRRCTVRLDGEDVVAEGK
FT                   VTDGFQYPKE"
FT   gene            390731..391357
FT                   /locus_tag="Reut_B3789"
FT   CDS_pept        390731..391357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3789"
FT                   /product="Isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3789"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63147"
FT                   /db_xref="GOA:Q46UN7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63147.1"
FT                   /translation="MHKEIGAYQRQGFGNTFELAPPFGLLVIDFVNGFADPAVFGGGNI
FT                   REAIGATVPLLAAARREGWPVAHSRIVYADNGADHNVFSMKVPNMLTLKEHDRNSAIVD
FT                   ELAPAPGELVVRKTVPSAFFGTSLAAWLTQRGVKTLLVAGAVTSGCVRASVVDAMQYGF
FT                   RPLVLSDCVGDRALGPHEANLFDMEQKYAAVMPRSAALAAIGVRD"
FT   gene            391516..393897
FT                   /locus_tag="Reut_B3790"
FT   CDS_pept        391516..393897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3790"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3790"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63148"
FT                   /db_xref="GOA:Q46UN6"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63148.1"
FT                   /translation="MEPNHSEEGRGQGVGARVARKEDARHLHGKGRFVADIAMPDLQEV
FT                   AFLRSPVAHARLLAVTKPQGLAASVIVREDMQEAKDIVADSAFPSYQPSAQPPLASGKV
FT                   RFVGEPVAMAFAPTRAEAEDIAEQVSLELDELTALTEVAQAQQLAGEVRVHEHWRDNNF
FT                   LTLTADKNFEARQREATVVVHRKIDLARQCMVPMEGKAVLAYWDHQFDQLVVYSATQVP
FT                   HMIRTILSHCLGLEQERVRVISPDVGGAFGYKCVLQQEELCIAWLAMTYKRPFRFIEDR
FT                   REHLTAGANSREHHYELTAYADARGRLLALDAKIAIDGGAYSVWPFTIGLEPGQAIGNL
FT                   PGPYAFDAYRCETVCVATNKPGFVPYRGVARTGVCFAMELLIDAIAREVGREPWEVRCE
FT                   NVVPPQAMPYVNVTNKHFDSGDYPASVRKAMEMIDLAGIRARQKAGPEGSRYVGVGFGT
FT                   YTEQSAHGTSVFAAWGTPVIPGFDSATVRITPDGGLEVRVGVHSHGQGMETTFAQIANE
FT                   ILGVDVARIKVVHGDTGLTPFSTGTYASRSLVMSGGAVSRACKALLPRLLKIGAHMLGQ
FT                   PEESARFEAGHVRAGEASIAVNRIADAWYINPHLLPSDVDAQGLETTMGFKPAVDTGSF
FT                   TYATHAVAVEVDVDSGHVEILDYVVVEDCGTMINPMVVEGQTYGGVAQGIGTAMFEEMR
FT                   YDGNGQPLASTLADYMLPGPTEIPSIRIHHFETPSPHTEFGAKGMGEGGAIAPPAAIFN
FT                   AVNDALRDFGVELKETPLTPRKVLEALDAAAAQSESRKAA"
FT   gene            393901..394728
FT                   /locus_tag="Reut_B3791"
FT   CDS_pept        393901..394728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3791"
FT                   /product="Molybdopterin dehydrogenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3791"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63149"
FT                   /db_xref="GOA:Q46UN5"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63149.1"
FT                   /translation="MKAVAFSYQAPGSLADALARLGAGTDVAKTMGGGQSLGPMLNLRL
FT                   TRPDTVVDVSRLAELREVTASSDYVRIGACVTHAQIEDGVFDALRGTMLQAVAGGIAYR
FT                   AIRNRGTVGGSLAHADPAADWVVTMTALGAQVELASAAGTRVVPMDAFMIGAYTTVLEE
FT                   GELIAAVRVPPVTADTRWGYQKLCRKTGEFAEASCAAYFDASRRFARIVLGALDGPPVV
FT                   LRDLTRAVAAQGAAALTAQAVDEAIAVAAPDKDAIDRKLCRTVVTRCVMQMLN"
FT   gene            394737..395909
FT                   /locus_tag="Reut_B3792"
FT   CDS_pept        394737..395909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3792"
FT                   /product="Ferredoxin:(2Fe-2S)-binding:Carbon monoxide
FT                   dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3792"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63150"
FT                   /db_xref="GOA:Q46UN4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63150.1"
FT                   /translation="MQTIAFTVNGRQVSGACTDRTHLGDFLRDTHRLTGTHLGCEHGVC
FT                   GACTVLVDDKPVRSCITFAAGCAGADIVTVEGYEDDAVMADLRAAFNRHHALQCGFCTP
FT                   GMLATARDIVLRLPDADEATIRHELSGNLCRCTGYMGIVAAIRSVLDARRAASGATVPG
FT                   APLAAATKKFTGFTVSDEALGAAPVQAATAANEAGRAADRKGWSRIEGSFAVPYPVDAV
FT                   WAFMADLPAVAGCLPGAVLTEIEGEKVKGHIAIKFGPMSARFEGAARLQRDDSRMRGVL
FT                   KGAGQDSLSNSKAAGDIAYQLTARSASETEVEVDLQYSLQGPLAQFSRSGLVRDFVRRM
FT                   IADFGKSVARRMDPTLSEAERMKTAQLNPVALFFGVLWERVKRVFGAGGR"
FT   gene            complement(395940..396737)
FT                   /locus_tag="Reut_B3793"
FT   CDS_pept        complement(395940..396737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3793"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3793"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63151"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63151.1"
FT                   /translation="MNENRPVQEEDLQAYVDNALDEARRQEIEAYLRDHPDVARRVDGY
FT                   IVQRQRLRAALAPVASEPIPPELNLRHMLAARRAHTAAPWRMAASVIVALCVGGLAGWM
FT                   GRGATEPASGGIAALAREATASYQVFALDLNRPVEISANDRADLVRWVSARLQRPISVP
FT                   DLSQSGYRYMGGRLVATEHGPAGLFMYDDGHGSRVAMLVRPMQIDQDTPMKAHRQAGIA
FT                   GYSWADQGLGYSLVASASTSGLHPLADEMRRQIGAQVRKPAPA"
FT   gene            complement(396734..397300)
FT                   /locus_tag="Reut_B3794"
FT   CDS_pept        complement(396734..397300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3794"
FT                   /product="Sigma-70 region 2:Sigma-70 region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3794"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63152"
FT                   /db_xref="GOA:Q46UN2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63152.1"
FT                   /translation="MDAYPGGLAVKDLLQQVEPMIPALRRYARALLRDAAAADDLVQDC
FT                   LEKVITYWDSRRHHGDTRSWVFAILHNLAMTTLRRHAGTSGLHVDIDDVAESLSTRATQ
FT                   EDALHYQDLMSALDALPAEQRSVLLLVSVEDMSYADTARVLDIPIGTVMSRLSRARDRL
FT                   LRIMESGETATTAGSPRKAALRRVK"
FT   gene            complement(397314..398795)
FT                   /locus_tag="Reut_B3795"
FT   CDS_pept        complement(397314..398795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3795"
FT                   /product="40-residue YVTN beta-propeller repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3795"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63153"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63153.1"
FT                   /translation="MNRNPVQSFKTALTFSLLVGLSGITLAGQAPGPLNAPDVPLSHRD
FT                   RIYAAEQFSNTVSVTDPADNKLLGVIRLGDPAPGNFSPLYRGQVLVHGLGFSPDRRTLA
FT                   VVSIGSNSVSFIDTATNAIQHVTYVGRSPHEAFYTPDGKEVWVTVRGENYISVIDAKTF
FT                   GEKTRITVAAGPGMQIFSPDGKYGYICSSFNPETAVVTVADHKVVARVKQESPFCPNIA
FT                   ATPDGSQVWFTLKDVGKTQVFEARPPFRMIKTIETGPITNHVNFAHTAAGTFAYITIGG
FT                   LNQVKVFRTDDFSQVATIPVGSLPHGLWPSGDGKRIYVGLENADSLAAIDTETNKVVAN
FT                   VPVGQAPQAIVYVPDAVAEGSGTQGLQPIGLAGQTTQLRLLPVVNGKPVASDNAPTSVT
FT                   LFDQGLLQVLQASATGLQPKQAYVLALASQADGSGVLEPLANFMANPAGAAIVNAIGPI
FT                   RQVVQGIAGTETRRYLVIAPTDNGKPTAPVQVQAM"
FT   gene            complement(398811..399266)
FT                   /locus_tag="Reut_B3796"
FT   CDS_pept        complement(398811..399266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3796"
FT                   /product="Protein of unknown function DUF305"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3796"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63154"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63154.1"
FT                   /translation="MALPPRPPRSSASARTVLALTAAFLLPAIAAAQATTDQQKFAAEN
FT                   EAAMTRMMDGMAVKPSGDIDQDFAAMMIPHHQGAIDMAMAELRYGRNEQLRRIAQEIVV
FT                   EQLQEIAAMRLALGQPLPPSAPAPTQPDNSVQPMPQAAGHSRSTHAH"
FT   gene            complement(399452..400441)
FT                   /locus_tag="Reut_B3797"
FT   CDS_pept        complement(399452..400441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3797"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3797"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63155"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63155.1"
FT                   /translation="MTQFDPVRRDVLKLAAALGAGALAPSLARAQAWPAKPIRLVVPFA
FT                   PGGSSEIVARSTAAELTRLLGVSVFVENKPGGAGNVAMGEVARADDQHTLILGHIGTLA
FT                   VNPYIFAKLPYDPNKDFRPVSLLSKVPSLYVIHPDVPAKNLKEFIALAKSKPGKLNYGS
FT                   AGNGSAGHLAFEYLKAASGTFITHVPYRGSGPQITDLLSGRLDAAAVGAPAILPFIKAG
FT                   KLRCIATGTSQRIPQLPDVGTVAEQGYPGFEMTQWYGLLAPASLPQAATDKLADAAIKA
FT                   VKSPASAQRLGADAALVVGSTPEEFARFIAQEQARWKPIIARAQIKPD"
FT   gene            complement(400535..401551)
FT                   /locus_tag="Reut_B3798"
FT   CDS_pept        complement(400535..401551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3798"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3798"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63156"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63156.1"
FT                   /translation="MKKNTDVETSLNPSTTCIAAAVATSLLLSPVLAQATESAAQWPSR
FT                   PITIVVTYPPGGGADLMARMIAPGLGRELGQSVIVENRPGAGGQIGASYVAKAAPDGYT
FT                   LMVDASSYAVNPSLYPRLPYDPAKAFTAIGVLARYPNVLVATPGFPAHSVKDVLALAKQ
FT                   KPGTVAFASSGNGSAQHLSGVLFEQRAGVDLLHVPYKGGGPAMTDVIAGQVPLFFANVA
FT                   SSLQHIKAGKLRPLAVTSHTRTPALPSVPTMEEAGVAGYEVYEWNAAFVPAGTPQPIAS
FT                   KLSEALQKVMNSPDVRKRIAELGGEVVAAPPAEAARYIDNQTRLWAKVIKDGNVKPE"
FT   gene            complement(401555..402310)
FT                   /locus_tag="Reut_B3799"
FT   CDS_pept        complement(401555..402310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3799"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3799"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63157"
FT                   /db_xref="GOA:Q46UM7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63157.1"
FT                   /translation="MQDNAPLHSSATAVGVSRYGRIAAQLQRKIVDGEWPPGAAIPAES
FT                   TLATEFGTALGTIRQAIAVLVQEGLLERVQGKGTFVRNGLTGASMMRFFRFRADAGAAD
FT                   VAIPRSEILSCRAVRLEKSVATLFGLDTGARGLAISRRRWLDDKPRLLESIWLPLPRCE
FT                   PLQRLPKAEWGDLLYPLLASQCGITIHRAVDEVTFRTLDADQAELLDLPDGHPCALVTR
FT                   RAYDLQGNCAEYRLTEGDAYAFRYQADIR"
FT   gene            402410..403255
FT                   /locus_tag="Reut_B3800"
FT   CDS_pept        402410..403255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3800"
FT                   /product="Amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3800"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63158"
FT                   /db_xref="GOA:Q46UM6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63158.1"
FT                   /translation="MTRNAMPLVDCHFHLFDAGTGMPAARYRPAYSARIEDWQSLLAPL
FT                   GDLYGVVVQTSFLGTDNAALLAALRARPGRLRGVAVVDPSVTDGQLAAMQAAGVRGIRL
FT                   NFFGDPEWRRIGTAPWRTLFERIALLGWHVELHTANGQGAALLSELDASLGDCGAPVVL
FT                   DHFGRPGEQGVRDPVFAVAERTLQRRQVWVKFSAPYRLLPGTDWRSLAMAWRRVVGQDR
FT                   LLLGSDWPWTNHESSARAGECAALFQWPCEPTGGEGAGDGGFAESLRWRNATVLYGFGL
FT                   "
FT   gene            403445..403879
FT                   /locus_tag="Reut_B3801"
FT   CDS_pept        403445..403879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3801"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63159"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63159.1"
FT                   /translation="MRFLFLLLTAMCLSLLSYGAVADAHAGVQGNIAAVAAHAITVPDK
FT                   VSDVASLPSVDATGRLVVPGDDGLNDDDIVDEPPPGYCNIWSADLLDPLDLLDEIEESS
FT                   ALFDLPTVKLLLPADDIWQAPAGRTAPPATAFFKPPISLA"
FT   gene            404035..405432
FT                   /locus_tag="Reut_B3802"
FT   CDS_pept        404035..405432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3802"
FT                   /product="Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3802"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63160"
FT                   /db_xref="GOA:Q46UM4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63160.1"
FT                   /translation="MAQAAYGLLSRLMTHTKLTLIASLSLVAFAAVPAQASDDMRPPAA
FT                   VVLAGGNVAPPASAAPVTGPSYGLQQLLALAQSTNKGVEAAQANVDAANAAITSARAYP
FT                   NPQVEVMYGRLQGKQPGVTSGNAPTYAITQKLDYPHQRSLRQDMASRSLEASQAVRQGF
FT                   RAELAARVKTAYFEVLRRESELQAASEDLAMMRQIHSRARLRVEVGEAPRYELIKAETE
FT                   LLATQKSAQTAELRVNQAKAALRQQVGGAMPALFSLDGNLGQVPDVPPLPQLRGTMNAS
FT                   NAELTQRRMELERARLGVDYQRSLRWPEVAVRASTDRQPDNNVSQIGLVVTIPLWDRRS
FT                   GPVGEATAQATQARTALEAREFELTQELEAAYRQYEITQSQVTALESGIVREAESALNV
FT                   AESAYRFGERGILDYLDAQRVLRGARNELIAAQFDLQVAAIQIEKLMSTALGTAPAALP
FT                   SSTIQNR"
FT   gene            405435..406595
FT                   /locus_tag="Reut_B3803"
FT   CDS_pept        405435..406595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3803"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3803"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63161"
FT                   /db_xref="GOA:Q46UM3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63161.1"
FT                   /translation="MRPNFLLSLTATAVMVFALAGCSKEPAQATEAPKLPPGVIKPEPN
FT                   LMQTLKVAPVSTSAFSEMLRVAGRIDFDEQRVSRVGASVTGRVTDLYASLGQEVKAGQV
FT                   LARLHSTELGAAQMAFLKSEAQHELQARNAERAKQLYAADVIGRGELQRRQSELAIASA
FT                   EMRAYRDQLRVLGMSPAAIAELAKNGSINSHSPVYSSLSGTVVERNVAQGQVVQPADAL
FT                   YTVADLSRVWVVAEVPEQQAAQVAEGQSVEIEVPSLANGKGSQTITGKLIYVGRTVNPQ
FT                   SRTVLVRTELENREGRLKPAMLASMLIASKPVDQLVVPASAVVREGNDELVYVEMPGGQ
FT                   FRQTRVKLGAESDGMRVVLSGVKAGDRVVVDGAFHLDNERKRIEQG"
FT   gene            406602..409718
FT                   /locus_tag="Reut_B3804"
FT   CDS_pept        406602..409718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3804"
FT                   /product="Heavy metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3804"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63162"
FT                   /db_xref="GOA:Q46UM2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63162.1"
FT                   /translation="MMKSLVEAAIKQRLVVCVLAVVLFFFGLRAATKLSVDAFPDVTNV
FT                   QVQIATEAAGRSPEEVERFVTVPVEMAMTGLPGLEEMRSLNKAGLSLITLVFTDATDVY
FT                   FARQLVMERLIEVSGRMPEGVTPVLGPVSTGLGEVYQYTLDRPDDGNRELTQEELAERR
FT                   IAQDWVVRPLLRSIPGVAEINSQGGYVRQYQALVNPERMRHYDVSIQQVYQALARNNAN
FT                   SGGGVLPHYAEQYLIRGVGLAKGVDDLGSIVLKEVAGTPVYLRDVATVTIGHEVRQGAL
FT                   VKNGQTEAVGGIVMMMRGGNAKEVVSRVKARVAEINAKGMLPGKLQIVPYYDRSELVDA
FT                   ALWTVTKVLLEGVVLVVIVLFLFLGDVRSSVIVLATLVLTPLLTFIVMNRMGLSANLMS
FT                   LGGLAIAIGLMVDGSVVVVENAFERLGHKEPGLTKTQILVKAVQEVATPVIVGVGIIIL
FT                   VFLPLMTLSGMEGKMFAPLAFTISIALAISLLLSLTLSPVLSSYLLKGGAEHDTKIIAF
FT                   MKRHYLRMLHWALGNSRKTVIGAVGAFVLTLAIVPLLGTSFIPEMKEGSIVPAIDRVPN
FT                   ISLEESIKLEKEANKLVLGVPGVKSVVSGVGRGESPADPQGQNESTPIASLKDRHEWPD
FT                   GWTQDDIANAIREKLKAIPGVQIVMAQPISDRVDEMVSGVRSDVAVKVFGDDLDKLREL
FT                   AGEIARVAGGIQGSQDIRIERVSGQQYLSIEIDRQAIARYGLNVSDIHDVIEIAIGGKR
FT                   ATDIFEGERRFAAAVRLPEDFRNNVQAIRQLLVATPNGTQVPLQSVAKIEVSDGPAQIS
FT                   REMAKRRVVVMINVKDRDLGGFVAELQQAAGAKVKLPEGYYLEWGGQFQNMERAMGHLK
FT                   IIVPVTIAAIFFLLFLLFNSLRFATLIITVLPFASIGGIIGLFVTGEYLSVPASVGFIA
FT                   LWGMAVLNGVVLVSYIRTLRDSGLSVTEAVVQGATQRFRPVMMTATIAMLGLVPFLFSS
FT                   GPGSEVQRPLAVVVIGGLITSTLLTLVMVPTLYRWFDDRKADPTKDVPV"
FT   gene            complement(410145..411371)
FT                   /locus_tag="Reut_B3805"
FT   CDS_pept        complement(410145..411371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3805"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3805"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63163"
FT                   /db_xref="GOA:Q46UM1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63163.1"
FT                   /translation="MTVQSTTGGATASGTRPAQPPQSVPAWVTPLLAAACGVTVANLYF
FT                   AQPLVGPIATALQLSPGAAGLIITLVQAGYCLGLLLLVPLADLVENRRLVCRLLAGNAV
FT                   ALAGAAFATHAATFLLAAWLIGFCSVAVQVLVPFAAHLAPEHARGRAVGNVTSGLLLGI
FT                   MLARPISSLVADLWGWHAIFALSSVVMALLALVLSRRLPQRAPAPGGRYAEMLASMWHL
FT                   LRTQPVLRRRAAYQASMFGAFSLFWTTVPLYLSGPDFGLSQRGIALFALAGVAGAIAAP
FT                   IAGRLADRGRSRRMTAIALLLGAGSMLIGLAGTPGSAIALAMLTVAAIVLDFGVSASLV
FT                   VGQRAIFSLSAEHRGRLNGVFMAVFFVGGALGSALGGWAYAHGGWPLASGIGFALPILA
FT                   LLFFATERR"
FT   gene            complement(411567..414341)
FT                   /locus_tag="Reut_B3806"
FT   CDS_pept        complement(411567..414341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3806"
FT                   /product="Outer membrane autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3806"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63164"
FT                   /db_xref="GOA:Q46UM0"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63164.1"
FT                   /translation="MPHRSSRPPHGTWPATVLAVALGLRPDVALAACDLAAPADGQTAT
FT                   CTPLAPNPATTPIVAQPGSSRVTVTIEPNAELAVAAGSAVVVREQSLVDNGGTLRGTGD
FT                   AAPTVLMQGTGNTLDNRGTIIATGTASHAVFVDGNAPATVRNSGTLLATGTDSSGLQGG
FT                   TALTVTNTAAGRILSDQSNAIFANHGITLDNAGLIHSDATSIIVNNGPSSIDNTGTIES
FT                   LSGNAIGATRAAVVITNRGTISGGFRAIDLDVGNDVVNMLGGTIRGAIVLREGDDRFEM
FT                   SGGQVDAVDMGPGRDTVVISGGQVNGAIALGDDSDAATLRGLTDANLAGMPRLDGGSGL
FT                   DSLTLDQSRLSGVARLVGFEAVNLTNHSTLVMDGDLVLGDPALQAPAALGLQRPLAVTA
FT                   PTAGTLDIDSTSTLQIGPAGNAAIVAAAAGQLAAVNNAGVIDLTTGSTPAASRLQIVGH
FT                   YTGNGGQLLLRSILGADNSPSDRLGISQGTVSGITTIALANAGGNGGLTVVDGIPLVVV
FT                   TDGGTSTPSAFRLAGGQIQAGAYVYVLYRGGVSNGTADSWFLRSSLAPASSVSPAPPSA
FT                   APQPVLSPQPAAGSPALPPAPAADASPVPLYRPAVPVYAAIAGVARQLGVDQIATFHER
FT                   QGEQALVTERGALGAAWARAWGSNGHQSQGGEVHPDFSGTLAGLQVGQDLYAMAGDGPG
FT                   GHRDHFGAYFGYARAAGDIAGFALGFPGYAAGKLDINAYSVGAYWSHIGPGNWYTDTVL
FT                   QYSTLTIDPSTHTGTGATTHGNALALSAEGGMPLQLSPTVTLEPQVQLVWQHLSLNDLQ
FT                   DQVSTVTFRNADSTLARAGVRLQKVLEYRGVRWQPWLRTDILHAFGGTDQTTFAATTSI
FT                   PTSQAYTAARFEAGIAGKAGPRGSVYGTVGYLTSLDGVPRSAWFGNIGARWSW"
FT   gene            complement(414470..414823)
FT                   /locus_tag="Reut_B3807"
FT   CDS_pept        complement(414470..414823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3807"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63165"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63165.1"
FT                   /translation="MFRKTMLTGKPQACTVNAAVPAHEAATPDAVPDQLSRSLKTQGDA
FT                   MVQYGARLLVLREFLAALCAGMSAERRDSVEGAFRKRVDDLLCLTDDRQLPEAFHATLL
FT                   AEINYYLGELKRR"
FT   gene            415156..416865
FT                   /locus_tag="Reut_B3808"
FT   CDS_pept        415156..416865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3808"
FT                   /product="Histidine kinase, HAMP region:Bacterial
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3808"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63166"
FT                   /db_xref="GOA:Q46UL8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63166.1"
FT                   /translation="MSQFIHTIKFRILLVFSVCIALMLAIGLFALQTISSLNENMHDAY
FT                   EQNTVAIGELADVRVAQLHIRRLLWKIQATSEDEGSADMALVREYQAKMKKGWQAYYPT
FT                   RVTSPRERDMADQLDTALARFADLVAQELHLLEAGDRAAAARLQESDLGAAGDKVGELI
FT                   TRGVEVNLNQAGDYHRRSLTEARSALWTTAVLVVLGLLVSLGASHYLLRTITRQLRRSV
FT                   EIADEIAGGRLDQQIEIRSRDEFGLLFGAMARMSSQLAQTVRGIQVSSEAVRVASREIA
FT                   SGNMDLSARTEQQAASLQETAASMTEISQTVRMNADNASQANTLAGSARDLAHAGNAAV
FT                   QAMVQTMARISGSSGRISDITSLIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEV
FT                   RALAQRSSAAAKEIKELIESSADMVQDGSRQAGEVGQTMGEVIRAIQQVSDIMGEISVA
FT                   SGEQSQGVEQVHLAISQIDSGTQQNAALVEQSAAAAKSLEEQANAMADAVSVFRIAGEG
FT                   GSRVQGAPSVSVARGFSGTQPGLQAVRRPPPAAQPARAPRVGDEADNDWHSF"
FT   gene            417147..417857
FT                   /locus_tag="Reut_B3809"
FT   CDS_pept        417147..417857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3809"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3809"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63167"
FT                   /db_xref="GOA:Q46UL7"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63167.1"
FT                   /translation="MRRTLHNAAPERDSGSHPKPPLPCSSSSLLPRCHACHAVMPSHLS
FT                   LYRFPSSRVVRRSVLAAIALSGALISGLLHAEPWFEPVRLGVSAGAGKDAAMARLEARW
FT                   DLKQDLWATSSQSVRLRLGLEVSGGVWNPHGSGGNALGDLGLTPILRLQGAGRSGVFVE
FT                   AGVGVHVLSRTRLSDDKVFSTAFQFGDRVAVGYRFGDTLDSELALRLQHYSNAGIKEPN
FT                   PGINFVLLQYSARF"
FT   gene            417999..419183
FT                   /locus_tag="Reut_B3810"
FT   CDS_pept        417999..419183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3810"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3810"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63168"
FT                   /db_xref="GOA:Q46UL6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63168.1"
FT                   /translation="MQALALFSVQFMLAVTWTLYTAFLPALAAQAGLPAAQVAWILLMD
FT                   QAIFVVMDSLLGIAADRVADALHRVGTWILAASVVSAVAFALLAKSASPQMMLFLTVCW
FT                   AATSSALRAPPMVIIARRLRESAPRFLVGCSMLGVGVASALAPLLTAWMRGQAPALPFL
FT                   LASLGLLAAVLALQWVEAHAGPLPVAASATVRAGGMAMAWLLLAAVFLLAFGFQVHSSV
FT                   NSAPAYLRFVKPGELVRVVPAFWIGFAMGVLLPARLPRGRFLHHGALTAAATLGALVLA
FT                   GIAHAPSLTVLLAAQCAVGLLWGVVFCAAAGAAIDAGHVGREGRLTGILFALAALAACV
FT                   RIAMVASGVARQPALAGLLPWLPSIAWGTAGVLLAAFVLRNMAVLAARPARGDA"
FT   gene            419247..419603
FT                   /locus_tag="Reut_B3811"
FT   CDS_pept        419247..419603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3811"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63169"
FT                   /db_xref="InterPro:IPR021305"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63169.1"
FT                   /translation="MTLALSRRTRAAIAAAGLLLAAGAALADDLEMPRPRGKDEAPGAP
FT                   VACRKAVKTKLPNPDHFKWDGSTYRKVAEDAYSVVADVEYLGTDGAQRKAKIQCDVIRA
FT                   PGDRFVVTKVRLPE"
FT   gene            419719..420201
FT                   /locus_tag="Reut_B3812"
FT   CDS_pept        419719..420201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3812"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3812"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63170"
FT                   /db_xref="InterPro:IPR011473"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63170.1"
FT                   /translation="MHTEALNEHRWLQRLVGEWMATGEALMSADQPPVKWEIPERVGRV
FT                   GDLWVQCVSEGEMPGCGPATTVMTLGYDPSRKHFVGTFIGSMMTYLWTYEGDLDPDGQV
FT                   LTLRAEGPDNTGSGKMAKYRDVICFIDDDHRTLTSHVQGSDGEWTQFMSASYRRVR"
FT   gene            complement(420263..420709)
FT                   /locus_tag="Reut_B3813"
FT   CDS_pept        complement(420263..420709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3813"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3813"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63171"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63171.1"
FT                   /translation="MISDWQGAGAPEEWAVQCGAVTAEPGRRADSSDVATMKRPTRECV
FT                   LALIACLRHAGPMRRDHLASACRLTASELTRALKSARQMGVVEDLPAADDIAQTERLFG
FT                   LTGRALPPARRVPARGAEAGPSFQPLLDAWGIARPSNRRGTHAS"
FT   gene            complement(420950..421132)
FT                   /locus_tag="Reut_B3814"
FT   CDS_pept        complement(420950..421132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3814"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3814"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63172"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63172.1"
FT                   /translation="MPFSLRFSPHDIYPDALEARLAELHEIAEDVQRAQERRWRKYGTL
FT                   LPQGVPSQGNPHTRH"
FT   gene            421459..421635
FT                   /locus_tag="Reut_B3815"
FT   CDS_pept        421459..421635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3815"
FT                   /product="Entericidin EcnAB"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3815"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63173"
FT                   /db_xref="GOA:Q46UL1"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63173.1"
FT                   /translation="MSASTRSKEILMRKLCALFALAGMLVITGCNTIAGAGKDVERGGE
FT                   KMQGAAENTKQKM"
FT   gene            complement(421893..422816)
FT                   /locus_tag="Reut_B3816"
FT   CDS_pept        complement(421893..422816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3816"
FT                   /product="Protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3816"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63174"
FT                   /db_xref="GOA:Q46UL0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63174.1"
FT                   /translation="MRIVPGSREATRLQSEPVHAARPAMPGARVGLLTALAMLAFAGNS
FT                   ILCRLALKGTAIDAASFTLLRIGSAAAALWLILMVRHGPRRLPGGGSWLSALALFVYAA
FT                   AFSFAYLHLSAATGALLLFGAVQATMTGYGLYVGERLRSGQWLGLALALGGLVWLVLPG
FT                   LAAPPPGSSLLMVMAGIAWGVYSLRGRGAADATATTAGNFMRAVLPALALALAWGMHTQ
FT                   RSVDGSGLASALVSGALTSGLGYVVWYAVVPRLRAATAATVQLSVPVIAAVGGIALLGE
FT                   AMSIRLAVSAAAVLGGIALVIAGKTR"
FT   gene            complement(422998..423285)
FT                   /locus_tag="Reut_B3817"
FT   CDS_pept        complement(422998..423285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3817"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3817"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63175"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63175.1"
FT                   /translation="MEHLIRVHNDYDRQVLAWLRVRIGDAALQSAAARLADARKPYLST
FT                   ICRSLGIRPPTRREFARESARESACAHRAVGDHYLARIRAILAASAGAQH"
FT   gene            complement(423583..423990)
FT                   /locus_tag="Reut_B3818"
FT   CDS_pept        complement(423583..423990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3818"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3818"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63176"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63176.1"
FT                   /translation="MTDRELIVPRAMQRIVDRAGYIPAIRLGATVFCAGQVGRTVDLAV
FT                   ISDPEAQFLACWENLRVVLEAAGCTFEDVVDMTTYHVDMAKHMPIFRAVKNRIFPHGTC
FT                   AWTSIGVSELAHPGLLVEIKCVAAKSQPETE"
FT   gene            complement(424060..425016)
FT                   /locus_tag="Reut_B3819"
FT   CDS_pept        complement(424060..425016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3819"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3819"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63177"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63177.1"
FT                   /translation="MLKSVAVVVSIAALSMGVRAETYPSKPIMLVVPFAAGGTVNMMGR
FT                   LVAENMGEKLGQPVVVDNKAGAGGAIGAGFVAKASPDGYTLLLGSMGQAVQPLLTKRLS
FT                   YDPKKLIPVATFATVSNVLAVSGKASAKNVSELISYSKANPGKLNMASAGTGSINHLIG
FT                   ELFMSRTGVDFVHVPYKGAGPAGVDLLAGQVQLMFVNLPNVLPFAKAGKVRLLAVASEK
FT                   RDPAIPDVPTFAEAGVKDAVVESWYGLMAPAGTKPEVVKKLQDTLLGMTKDRRFIAQLA
FT                   EQGARPYPGSSADMAQLIEKEAKRWGEVIDHAKISLD"
FT   gene            complement(425031..426560)
FT                   /locus_tag="Reut_B3820"
FT   CDS_pept        complement(425031..426560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3820"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3820"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63178"
FT                   /db_xref="GOA:Q46UK6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63178.1"
FT                   /translation="MESASLNAMTSSTSHETLLAEARLSSPPASRLTKHYALPGLERER
FT                   RQFHEFVAVDLAHTTMLVEQGIVSTATGRAILEQLLAIRDMEPSDFPVDARKGSFLLQM
FT                   ESYLFSAIGEDVGGQMHTGRSRIDQGATVRRLYKRNRILDVMDRLNEFQDAVAEQARRH
FT                   AHTIMPGYTHMQQAQPWVFGHYLLSFSSRLHDSFERLAQAYGRVNRNPLGTVGLAGTSW
FT                   PLNRERTTELLGFDGLVENSKLGREAFDAADAICALSFIMADLNDLATDLHIWSSTEFG
FT                   LVECDDSYCGTSSIFPQKKNPVALETIRKAAGPAVTWLGAALATFRAEGTGDQAMRTVS
FT                   HIDEAFSTTESMLDLFTGVIETLIVHRDRMAESLKGSWCTASNLADVIVRERGLSFRQV
FT                   HHIVARAVRNCVAQGLSPNELTSARLDEAAFETAGVRLRLSDCAVQEALDPRRFVETRI
FT                   TDGSVGPHQVARLLEHAAQERAADRQWVSMARTHLDRSQRMLIEAVVKLVA"
FT   gene            complement(426726..427631)
FT                   /locus_tag="Reut_B3821"
FT   CDS_pept        complement(426726..427631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3821"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3821"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63179"
FT                   /db_xref="GOA:Q46UK5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63179.1"
FT                   /translation="MQLNPRQLEAFRSVMVAGSMTVAAELLKISQPAVSSLIRELEKRL
FT                   EIRLFRREGNRLIPGAEAQRLFREVDRFYQGMEQIERVAMDLKSARIGTLRVASMHTLG
FT                   LSLLSEGIKEFSLSRPDLAISLDVRNSLGVLELAAAHQIDIGFVQMSGNEFPGVDVFPL
FT                   PSVAAVCVLPRGHALARKRSLKITDLQDEPLISLSRNSPVRMRLEMELEAAGVTCKPSV
FT                   VTSLGHVACSLVAGGLGLTVVDPFTARRVREPGVVWRPLWPVVEFHFSIVLPSHQPKSK
FT                   VVEDFIKVVKALFKANAARP"
FT   gene            complement(428058..428471)
FT                   /locus_tag="Reut_B3822"
FT   CDS_pept        complement(428058..428471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3822"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3822"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63180"
FT                   /db_xref="GOA:Q46UK4"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63180.1"
FT                   /translation="MNKQIFINLPVTDLSRSKAFYEAIGAVNNPAFTDETAACMVISET
FT                   IYAMLLTHDKWRQFTGKRIVDAHTEAQVLLCLSAGGRVEVSDLVQKATDAGGKADPTPV
FT                   QDFGFMYGRSFEDPDGHIWEVMWMDPEAVPPHA"
FT   gene            complement(428689..429660)
FT                   /locus_tag="Reut_B3823"
FT   CDS_pept        complement(428689..429660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3823"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3823"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63181"
FT                   /db_xref="GOA:Q46UK3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63181.1"
FT                   /translation="MPDPRAATAAYRESVPALQRIGAHLDDLLLFIHVVDAGGFSAAER
FT                   QTGIAKSRLSRRVATLERALGVRLLHRSGQVFGLTPVGEAVLAHAREAATHVDKIGALT
FT                   RSAVAEPSGVIHLHTSMLIAETTLPPILAEFARAHPGVQVQLTLSNRFVDLAEERLDLV
FT                   IRAAVVPLASEDVVAVPVATSASIVVAHPSLLEADGPPARLDELAGYPCLAQGTLTNPR
FT                   PWQFIDADDKPIDIAVTPGIAVDNLLAIRELALRGAGMAQLPSYLCQDAIDAGMLVPVL
FT                   QGVRSRPATLYAMYPSRRGMTSAVRVFLDLVRTRWPSDPATA"
FT   gene            complement(429880..431151)
FT                   /locus_tag="Reut_B3824"
FT   CDS_pept        complement(429880..431151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3824"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3824"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63182"
FT                   /db_xref="GOA:Q46UK2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63182.1"
FT                   /translation="MRCWARSRPEREPEVQSQAKPAGALAGLRVIDLTQMLAGPFCTQI
FT                   LADHGADVIKVEAMTGDGTRVTGPFCPDDALRDFGGYFQSVNRNKRSIAVDLKTEAGRA
FT                   VLRALIDKADIVVENFRAGVMERLGFAYETLRQTNPRLIYGTVRGFGDPRSGESPYAQW
FT                   PAYDVVSQAMGGMMGITGPDRCTPTKIGPGVGDTIPALMLCIGILAAVNRVRETGQGQF
FT                   VDVAMTDAVLAMCERIVYQNSYTGEVAAPEGNRHPLLCPFGLFRARDGHVSIACATDAF
FT                   WEKLAVAIGRPDMAQDPDFATNAARVQHQQQVIEAIEAFTSVRTKEEIAIALGGKVPFG
FT                   PVYTSAEIFADRHYAVRDMIVEVEQPGSATPVKIAGVPIKLSETPGAVRTRAPMLGEHT
FT                   EEILFGAGYVEDDIRRLRQEGAVR"
FT   gene            complement(431123..432325)
FT                   /locus_tag="Reut_B3825"
FT   CDS_pept        complement(431123..432325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3825"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3825"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63183"
FT                   /db_xref="GOA:Q46UK1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63183.1"
FT                   /translation="MGNQRPETEGAKVQKLTEERRMIQEAARQFTMERVLPIANKLDPE
FT                   KGKIPRELIDEMAELGYFGILIPEEYGGLGLGAYEYCLVAEQLSRGWMSVGSLIARGNG
FT                   LIGALKGLSPERKAEYLPRMARGEFLGAFSLSEPNAGSDVANISCRAVRDGDDWLITGS
FT                   KYWCTFADEADFILVICRTDPVIDPKARHKGLSAFMVEKPRGELPEGVKGSVIPKIGYH
FT                   GWTTWELAFDGCRVPHSKMVGEEGKAFYLTTAGLETARAHTAARSIGLAQGSLEDSIQY
FT                   AKDRNQFGNPIGNFQAIRFKLADMATQIEASRALLYTVCERIDEGVRADTEASMVKLFA
FT                   SEMCERVTSEGLQIHGGAGYTTHFAAERYWRDARLTKIFEGTSEIQMRIISDAMLGKIA
FT                   A"
FT   gene            432813..436685
FT                   /locus_tag="Reut_B3826"
FT   CDS_pept        432813..436685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3826"
FT                   /product="Glucose-methanol-choline
FT                   oxidoreductase:Beta-lactamase-like:FAD dependent
FT                   oxidoreductase:GMC oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3826"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63184"
FT                   /db_xref="GOA:Q46UK0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63184.1"
FT                   /translation="MRDRRARRARDGVGRHSRFQRETDMQEQYDYIVIGAGSAGCAVAA
FT                   RLADSRAGSVALLEAGGHDFNSAITIPIGIASTVPKPGPFNYGYATEPQPGLNGRVGYQ
FT                   PRGRGLGGSSSINGMIYIRGVPSDYERWAAEGCDGWGWEDVLPYFKRSERNERLGGQAE
FT                   DAWHGGKGPLDVVDTRSINPFDRRFLQAAQCAGLRYNPDFNGAEQEGVGFYQRTQRDGE
FT                   RWNAARAYLHQGNKQSIHGGRDNLAVLTDTQALRIVFEGKRAVGVLVERGGEQVTLRAR
FT                   REVILSGGTFGSAQLLMVSGIGPAAHLRSHGIAVVHDAPGVGQNLQEHPNLKVQERVFS
FT                   TDLYAFSVRGAIRLYGEWRRYKRERFGMFASNIAETGAFIKSDPSLADPDLQLHFSTAL
FT                   SDPNARSVHGYSLHVCVLRPHSRGQVLLASADARQAPRIDQNLLADARDVESMLAGLRV
FT                   VGRILDQQPFRRLGGRPHNYAGVRFDGSDDAAVREFIRARTDIVFHPVGTCRMGSDAAS
FT                   VVDPQLRVRGVEGLRVADASIMPTLIGGNTNATAIMIGEKAADLVRGIERAGDGVFVQP
FT                   RAAASQPAAQSARPEAVAPAARTGHQRLAVLAAGLALAASTQAADALEAAQQKPASAIT
FT                   AAANAAVLQQLPFDDRDDYEAAQRGLVAPFRGQIHDAKGRVVWDTATYDFQQTPWTASG
FT                   AAGSGQNGGLMRVTDQKPQVQANPQAKVPDSVNPSLWRQSQLNNYAGLFRVADRVYQVR
FT                   GFDLANMTIIEGQRGIIVVDTLTSAETAKAALDLYYANRPRKPVVAVVYTHSHADHFGG
FT                   VRGVVDEADVKSGKVAIYAPDGFMHEAASENVFAGNAMFRRARYQAGSGVPRNERGQLD
FT                   TGIGKSGSIGGTLSLIPPTVLITKPYETRRIDGVEVEFQFTPGTEAPAEMNFYLPQMRV
FT                   LCMAENATRTMHNILTPRGALVRDPKAWGKFLDESLVRYGDRADVLVAQHNWPTWGGEN
FT                   IRNLLADQRDMYTYLNDRTLHLLNEGKTPMEISEAMQKLPGNLEKKWYTRGYYGSLSFN
FT                   SRAVYQRYLGFYDGNPAHLNPLPPVEGGKRYVEAMGGADNVVKQMQAAMQKGDYRWAAE
FT                   IGNHLVFADPDNKVARDAQADALEQLGYQAESSLWRNMYLMGASELRNGTRPLPGRNAA
FT                   DMVRALEPSMFFDFLGVRLDSEKAQGHDMTLNWVFSDLKTPFAVTLRNGVLTYREGMRN
FT                   PKADVTVTMTKPTLDRINLRQVDLKTALAQGDVKVEGDGGKLGELMGMMTTFDPSFGIV
FT                   TPSLKR"
FT   gene            complement(437257..439359)
FT                   /locus_tag="Reut_B3827"
FT   CDS_pept        complement(437257..439359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3827"
FT                   /product="6-carboxyhexanoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3827"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63185"
FT                   /db_xref="GOA:Q46UJ9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63185.1"
FT                   /translation="MNTTPTAIPDCLLNPRSVAIIGASDEPTRIGGRPISSMLAKGYAG
FT                   RIMPVNPNRSTVQGLPTYASVADLPEVPDVAIIAVPAQHALQAVKALAERGTKAAILFT
FT                   AGFAEVSEEGAAMQAEMVAIARRGGMRLLGPNTLGMVNMHNGFVGSFSTFSSLGVSRPG
FT                   RVGIVSQSGAYGSHLVSSAMEAGVYPSSIVMTGNEADLNVSDIVRLFAADPMTDVIAVY
FT                   AEGISDGPGLVDALKAAHAAGKPVVMMKVGRSEVGGAAARSHTASIAGDDAVVSAVLDE
FT                   LGVVRVRTTEEMLDILRLASRRVFPADNTLGVVTISGGAGVIISDAAEDLGIPMPEMPA
FT                   AAQARMLEKLPICAPRNPVDVTAQFINDTTLVTPFTEAMMGEGGYGTLLAFFSYAASYH
FT                   TVADTLLQQLADVRKRYPDRLYVMVGRGDPTVLARYEEAGFTVFGDPSRAVAAIAAMGR
FT                   FGRALAGKTTAPAPQVPAVTLPSATPTEAEAKALLAEAGIPSAPERACADEEAAVRAAR
FT                   EIGFPLVLKILSPDILHKSEIGGVLLNVNSEGAVREGFALLLERAHKAVPDARIEGVLV
FT                   AKQLVGGVECIMGINRDPVFGPIAMFGLGGVFVEILKDVVFHRCPFGPDVAEEMIRSIK
FT                   GAPLLLGARGRPVTDIPALARTLSQLSAFAVAAGPRLQSIDLNPVLAMPEGQGAYAVDA
FT                   VIEVGE"
FT   gene            complement(439459..439857)
FT                   /locus_tag="Reut_B3828"
FT   CDS_pept        complement(439459..439857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3828"
FT                   /product="Protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3828"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63186"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63186.1"
FT                   /translation="MSTPFTPQVLTAPEELPDNTEFWNAAREGRLLVRHCNDCGKPHWY
FT                   PRTLCPFCMGETTWKASAGRGTVYSYSVTRRAGPTPFCMAYVTLDEGVTMMTRIVDCDL
FT                   DTVHIGQRVELTFTPTDNGPPVPTFRPL"
FT   gene            complement(439899..441065)
FT                   /locus_tag="Reut_B3829"
FT   CDS_pept        complement(439899..441065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3829"
FT                   /product="acetyl-CoA acetyltransferase (thiolase)"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3829"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63187"
FT                   /db_xref="GOA:Q46UJ7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63187.1"
FT                   /translation="MSIKGKAYIVGAYEHPTRKAPDKSVAQLHAESAKGALEDAGLTLA
FT                   DVDGYFCAGDAPGLGVLNMVDYLGLKLRHVDSTETGGSSYLVHVSHAAQAIAAGKCNVA
FT                   LITLAGRPRSEGSSGTKPRAWGAGVPDQAFEAPFSPMTVNSYAMVAMRHMYEYGTTAEQ
FT                   LAWIKVAASHHAQHNPNAMLRDVVTVEDVLNAPMISDPLRKLDCCVVSDGGGALIVARP
FT                   EIAAKLNRPKIKVLGAGEYVKGQMGGHVDLTWSGAKFSGAAAFAEAGVTPADIKYASIY
FT                   DSFTITVLMQLEDLGFCKKGEGGKFVMDGNLISGVGKLPFNTDGGGLCNNHPANRGGIT
FT                   KVIEAVRQLRGEAHPAVQVKNCDIALAQGTGGLLGSRHGSATLILERE"
FT   gene            complement(441198..441782)
FT                   /locus_tag="Reut_B3830"
FT   CDS_pept        complement(441198..441782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3830"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63188"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63188.1"
FT                   /translation="MTLPNRKPVHTRHITCNGYLRDDGLLDVEAELEDISPDGTDLLFK
FT                   IVPPGGVIHHMRVTVTVSIDDMVIRDVCARTLTGPTDFCREIESAYDALKGLTLRRGFR
FT                   QAVKARVGGVGGCTHLTELLGPLATTAIQSGFAVGRALRNGRRPADEQGPMQKPAVIGT
FT                   CHTYRPESVVVDVLWPPHRRVASEEPTGATG"
FT   gene            complement(441858..442211)
FT                   /locus_tag="Reut_B3831"
FT   CDS_pept        complement(441858..442211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3831"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63189"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63189.1"
FT                   /translation="MPQHSTPPMEGLMDLLHEVRQFSRDLQQSARRSTSGEAYPQALRA
FT                   LVDSRMQAADPHARIVCYASAVELGVPVDLPTEHCRQAMAGGLGFPLRVLFWAAHRRMQ
FT                   GGRQRPGAWPSPN"
FT   gene            442543..446553
FT                   /locus_tag="Reut_B3832"
FT   CDS_pept        442543..446553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3832"
FT                   /product="regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3832"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63190"
FT                   /db_xref="GOA:Q46UJ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63190.1"
FT                   /translation="MRIASRIVLSETERTELEALSAATAGNLRLAQRARMILLAAAGWQ
FT                   NKDIAAQVGVGRVQVARWRDRYAASRLAGIEQDLPRGAPPVRTDVARLVALARDGGPGA
FT                   LSTRQLAAELGVSPASVSRHWRASGLPPRRGVALADKQPASGGVTVRAAEIVGLYIAEP
FT                   EHAIVVALEADPGPAGMAPALDAAARNSATYRRTLAASFMTALKVIHSGTATAFQAGRA
FT                   SGWQGFLHALAEHQPAGRPLLILADNPVSHNDPEVRDVIAGQPWTVSFAAGQAAWMRAV
FT                   QSLLRDADGLPAGIPQVLAVIGEHARGPFQWIRSAGDAGYAQGQGAVPRALTAQAAFAP
FT                   STFAGKSAGRSFEAFTGTEFDSVATLPSAEPGLPRQFSALPAQPFLSLVPALDTRPGPM
FT                   RPLQPVASAKLLPPRHARKLLPREGLMNRLLDARRQRCVVIQGQAGAGKTSTLMAWRKA
FT                   LISLGFDVSWLSLAAEDNEPTRFFDCLLASLAEIDPAMARDAAMQVGGAEDDDAIEQWV
FT                   IALVQALGPRERELVLMIDDLHHITDARIYRALQRLLDYAPPHLHLAFSSRSALSLALE
FT                   ALRAQGLLTEIDMRDLRFTAEESARFLEEQLGTIAPRDAAALHALTDGWVAGLQLFAVD
FT                   LRARRSADYPLTKVRDPRTFAAFFEREVLGLLAPDDLELLTRMSTCHRFCADLCTAMPG
FT                   ETETPSRIGDRLARLEADNLFITQVDTHDRDVWYRIHPLLRETLLARLETDKDDAADAV
FT                   DMSDPDTAETPNDMADASRANDEPCAHGTARELHAAAWRWFDRRGHLDDAVYHAVRAGD
FT                   ADAAATMVEGCGHALLKRGELPQLLGLVRRLPREQLQNRFGLLALVSFLQLYMRDVDGL
FT                   GRSLERLDPLCDRSNAVHQYVVCLLRAGHAVQVDDPDTVLGMLPALWAIPPEADDLWWT
FT                   ARRNVLSWLFILRGEFDEARRLQDDTERRSSVPRSSLFGRYITAMSLVMEGEIERAGRS
FT                   AREVLRESERQGATFLGLTCMAAGLLADILYELNDHEGACQLLEPRIGMLERVSLPDVV
FT                   LRALTLLSNAHWLAGRRTQASACLDRLEAYAARNNLDRLQTEALTLRLRRHLQQAETER
FT                   ANTVFRQVQQLAQRYAGETGTVARHIALAAARAEVEMSLYTQDYATAAARLEALLAREA
FT                   GAKPLRIAALWLQLALARHATGNTRGARPAFLSALRMGHGAGLIRTLLDVTGGAPQVFL
FT                   ELAGEGIDEPVLAFYARRLQAAAVASGAAISRPADEAAPIAVLSEREREILGLLAQAMS
FT                   NKKIASVLNVSPETVKWHLKNIYAKLGVNGRGRAAARLRDIATQERGSVLAA"
FT   gene            446733..447293
FT                   /locus_tag="Reut_B3833"
FT   CDS_pept        446733..447293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3833"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3833"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63191"
FT                   /db_xref="GOA:Q46UJ3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63191.1"
FT                   /translation="MSSHSSLPVHLPAGDSPAACVTGCALFRQLEAQAEAEPDTIATGN
FT                   ATYRDLLDASLALAGYMQQRLGVRAGDHVLLMLEDGESSAIATYAVARCSARAIASAAF
FT                   EDSAEIARQTVVNGVQVAIAPTRALMALAPLLDDGSLYGCIVPGAGQFARPGVHDLAGA
FT                   VAAGIAPVPLPAGHRPCCPDAAL"
FT   gene            447338..448249
FT                   /locus_tag="Reut_B3834"
FT   CDS_pept        447338..448249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3834"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3834"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63192"
FT                   /db_xref="GOA:Q46UJ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63192.1"
FT                   /translation="MSLLEGKVVIVTGAGAGVGKGIAMEAARQGARVIVNDLGVAIDGS
FT                   GGSAGPAQQTVDEIKALGGEAAANTDSVADWESAQKIAQQAMDLYGRIDGVVNNAGNLR
FT                   DVMFHKMSEEEFDSVIRVHLKGTWNVSRAVAPHFKAQESGAYVHMTSTSGLIGNVGQAN
FT                   YAAAKMGIVGLSKSIALDMKKFNVRSNCIAPFAFTRMVGSIPANTPEAVERMKIHMRME
FT                   PGKIAPFTLALLTDQAKDVNGQIFGVRSNEIYLMSQPRPIRTAHNDQGWTVESCLERAI
FT                   PMFRPSLFPLDLSRDAFAWDPV"
FT   gene            448328..449533
FT                   /locus_tag="Reut_B3835"
FT   CDS_pept        448328..449533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3835"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3835"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63193"
FT                   /db_xref="GOA:Q46UJ1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63193.1"
FT                   /translation="MDFQPDLSLEAFRESVRAFLRDKLPADLAGRPRIGTRSPREELSR
FT                   WQRILNEQGWGAPYWPTAHGGTGWNVLERLAFDEECTLAGAPTQDVGAQKLLGPVLNEF
FT                   ATPEQKAEHLPHIFGGTRTWCQGFSEPGSGSDLASLRTAAVRDGDEYVVNGQKIWTSHG
FT                   HRADWIFLLVRTNTEVKKQAGISFLLVDMKTPGITVRSIHTIDGCHHLNETFFDNVRVP
FT                   VKNLVGAEGDGWKITKFLLNNEHAAAADLPMLRRYMRQLGSLARQRDAKGCALIERPHI
FT                   AQQVARFEAELNAIAMLVQRVAALEQAEDHSPAAHALGSMLKVRGTELQQRISSFVVEA
FT                   LGDYGPVAYAAPEGDTSGEPLPMQHVARGMANELFFRRASTIYGGTSEVQRGIIARALF
FT                   QL"
FT   gene            449568..450734
FT                   /locus_tag="Reut_B3836"
FT   CDS_pept        449568..450734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3836"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3836"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63194"
FT                   /db_xref="GOA:Q46UJ0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63194.1"
FT                   /translation="MNFNLTSEQQMLQDSVARFVEKDYDFEARTALVKAGSRCDAKHWN
FT                   TFANNGWLAAALPEEQGGLGGTLLDTVLIAGQLGRGLVIEPYLGCAVAAAQTLLAAATP
FT                   AQRDALLPAVAEGSRKIALAYSEAGSRGLPAPVSTHADAAPGGYVLNGVKTLVLGGTEA
FT                   DAFIVSAMTPIAEPASAHDGGELRLFVVDADAPGVKRRALPLHDGTWAAEVTFDGVAVK
FT                   ADALLGEPGTGLAALQQGLLHGTTALCAEIVGAMEKTIEITSEYLKVRQQFGVPIGSFQ
FT                   ALQHRMADMAAEMEVARSMLYALLAAVETGTPETVQRTMSQAKALIGRAAKYVCGQGIQ
FT                   LHGGIGMTEEYTVGHYFKRAVVADALFGNADLHESLVAQALQQSLTTE"
FT   gene            450743..451198
FT                   /locus_tag="Reut_B3837"
FT   CDS_pept        450743..451198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3837"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3837"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63195"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63195.1"
FT                   /translation="MKVYEKISDLQPLVGEIIGTSDWVSVEQGRINQFADATGDHQWIH
FT                   VDVERAKAGPFGTPIAHGFLTLSLLPEFTNLAYRVNETRSGVNYGLDKVRFPAPVPVNS
FT                   RLRAQFKLLSYEALEGGGAQTKVEMIVEREGGQRPVCIAESIVRRYP"
FT   gene            451399..452217
FT                   /locus_tag="Reut_B3838"
FT   CDS_pept        451399..452217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3838"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3838"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63196"
FT                   /db_xref="GOA:Q46UI8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63196.1"
FT                   /translation="MSMELKDKVAIITGGGQGGGEGIARVLAREGARIAVVDLNVDAAT
FT                   RVASSIDPDGKRAIAIRADISKKADTEAMARQTLEAFGTIDILVNNAGVGGASALACDV
FT                   TEENWDRVMGVNAKGILFCCQAVIPAMKAQGKGKIVNIDSIAGIRMAYFSSVDYTASKH
FT                   AVTGLTQHLAWELADQRINVNAVCPGGILTPAIEAYASAEKREALIRRTVPLGRFCKPE
FT                   EIGEAVSFLASDRADMITGQLLAVDGGTLTGYGEDLRAVLRQRLQEDQAH"
FT   gene            complement(452305..453063)
FT                   /locus_tag="Reut_B3839"
FT   CDS_pept        complement(452305..453063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3839"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3839"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63197"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63197.1"
FT                   /translation="MDLKLKGKRAIVTGGSRGIGKTIALQLAQEGVDVVLAARGKDALE
FT                   ATAAELATLTGRRIVPLTVDTADKASVDAMVEQAIEALGGIDILVNAAALPGGISPATQ
FT                   LDQIVDAQALEDIDIKVIGYLRTARALAPHLASNGWGRIINIGGLAIYHTGRPVATLRN
FT                   VGVAAITKNLADELGPKGINVTVVHPGPTRTEKTDAATEAWAATKSSLGRMVDASEVAC
FT                   VVTFLASPLSVAINGEAIPVGGGTPGIIHY"
FT   gene            complement(453178..454149)
FT                   /locus_tag="Reut_B3840"
FT   CDS_pept        complement(453178..454149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3840"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3840"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63198"
FT                   /db_xref="GOA:Q46UI6"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63198.1"
FT                   /translation="MAKAIRFYETGSADVLKLETVEVGDPGPGQARVRHTYIAVNFIDI
FT                   YFRTGHYPLQLPNGLGSDAVGVVEAVGPGVTDIRVGDRVGYLLGPQGAYSDVRVMPAEV
FT                   LIPLPDGVSDRTASTLIMKGMTAQYLFRQVYPLKGGETILYHAAAGGVGLIACQWARAL
FT                   GVTMIGTVSSDEKAEVARANGCTHTIVTSRENIVERVMEITDGKKVPVVFDSIGKSTLD
FT                   ASLSCLQVRGTLVSNGTTSGPVEIDSRTLAAKGSLWVTRPAMVHYATPRSHMLDMAKEV
FT                   FDMVLAGKITSEPRQSFALADAAEAHRALESRKTSGATVLVP"
FT   gene            complement(454202..455257)
FT                   /locus_tag="Reut_B3841"
FT   CDS_pept        complement(454202..455257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3841"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3841"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63199"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63199.1"
FT                   /translation="MRQAARTAATWLRPGRPPIQSLTESDMSNHPALFAFRKAAAAVIL
FT                   AAAMPAAMAWTSKPVRMLVPAPAGGTMDVIARVLAEQLTVDLGQPVVVDNKPGAGGGIA
FT                   INTLLAAPADGQTILVTLTNVFTEVPQVMKVSFDPVKDVKPVAAVSKVTMVLVGSPDLP
FT                   AKDLPALIRYVKANPGKLSFASPSAGTVGHYAGMIMNQKAGIDLQHVPFAGSPPALTQV
FT                   MGGQIAVMYDGMVTSLPMIKAGKLRPYALAAKQRSPLLPQVPTFAELGYPDIDFSNWGG
FT                   VFVSARVPADVSQKIQAAVYKAASKPHVQERFAALGMEPVPVQGLPELSQALRTEYERN
FT                   AGIVKTYHIQP"
FT   gene            complement(455257..456312)
FT                   /locus_tag="Reut_B3842"
FT   CDS_pept        complement(455257..456312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3842"
FT                   /product="Protein of unknown function DUF849, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3842"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63200"
FT                   /db_xref="GOA:Q46UI4"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63200.1"
FT                   /translation="MQFLDDSLHPENQDKVVITVAPYGPEWMPQDFPEDIPVTMEEQVQ
FT                   KAVDCYNAGATVLHLHVRELDGKGSKRLSKFNELIAGVRAAVPDMIIQVGGSISFAPED
FT                   EGEAAKWLSDDTRHMLAELTPKPDQVTVAINTTQMNIMELLYPEYLKGTSLEQPAYQAA
FT                   YREMTVPAGPGWVEEHLRRLSNAGIQPHFQLTGIHAMETLERLVRAGHYKGPLNLTWIG
FT                   IGGGFDGPNPFNFFNFVHRAPDGCTLTAESLLKNVLPFNMMAMAMGLHPRCGIEDTIID
FT                   QHGNRMTSVQQIEQCVRVANELGREIASGKEAREIYRIGTWYDSAEETLAAHGMAPNRQ
FT                   AGIRNLPLRAA"
FT   gene            complement(456403..457434)
FT                   /locus_tag="Reut_B3843"
FT   CDS_pept        complement(456403..457434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3843"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3843"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63201"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63201.1"
FT                   /translation="MSRPCRDADAITCHHLLVPLDEADACMATVIGAIELARIAAARIT
FT                   FVHVPPQSAVPRASMVRGRELLAKAESVARAQGVPCASAGLLDGDAQAAIPATAREVGC
FT                   DLVFIGPRGQEAMTRSLVQAVLAAGLPVFAMPDHAPAMPESAIRAIRDEHRALSAVLRA
FT                   WLDMLTAANDRDAGADVVVMRDMIRFIETFPLARHHPRKQACLYDRLRRRTARADAELD
FT                   ELERQHERDAQWAGALTEAIERFATGGPLAELLGKVDHYTQFVWARMGREEGVILPAAQ
FT                   RYLTEADWDKVNAAYGSANRCNVPDDEDRAFGPLLAYLADFPDADCVARICAQAEDVSM
FT                   RHS"
FT   gene            457607..460441
FT                   /locus_tag="Reut_B3844"
FT   CDS_pept        457607..460441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3844"
FT                   /product="regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3844"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63202"
FT                   /db_xref="GOA:Q46UI2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63202.1"
FT                   /translation="MRHQIPSQARRPQRQREATDAALPRAQPGTQAPASVAPQPTSTCQ
FT                   MTSVNRGAGAAFSELALKTMPPRAPRHLLARARLSLDSEALRDRPAIVVQAPPGFGKTL
FT                   LLAQWRREYLAHGAAVAWISADTHDDPLHFLQCLVLAVRAGGARPGFGRTLLEGAAAAP
FT                   GSTEGLTAWLAEVAQTSLDLVLIVDEAERLSQDGVAALLYLLHNAPPNLRIVVAARGGF
FT                   DTAVAELTAYGQCAGIGAQALRFRFDETLTLVRNRFGDRVDADRCARLHELTDGWPLGL
FT                   QLVLAAMERGADPRSVVDTMAARPADEGEHLVGGLIAKLTPDDVAFLTRIAVVDHVHPD
FT                   LCRALTGDEQAPGHLARLIRETPIFVSSDGSDWCRLHALARGALQARLAEVPRNEQAEL
FT                   HARALHWLAERGITEEAARHAHAAGQHALAYELAGRSLYDAVMQGRLGTVLEWLERLPD
FT                   AELDRYPGLRLAAAWVLALGERHAEAEALVARMLEGAGDDTVLRYECALILSIAAYYAD
FT                   QPDRCLALLEPWQQQPATHDPRLAQMHANRMAMAAILHGQTGNARRHLQLAPRGDLGEG
FT                   HRYAARWGEFVTGLSYLREGQMMLSEAILRPTLASAEADLGRRHPLSCMLASLLAAAVY
FT                   ENGRVDEAAALLANRLDVLERSGTAETSLLAYLTAARVAALQGVEHRALDLLEALYAVG
FT                   VARRTPRLCMASLADQVRMHAGRFRAETCRALIVRLDELVAGAEADHGPLWRRDVVLMQ
FT                   AVAHANAAIAAQDWSSALDALRRAAPAAEAMKLGRKRIEIMALEAFVRHRAGEDSRTLM
FT                   LEAMNLAQTYGLARTFADAHPALADWARRLVEEETTEPGAGQPLPVARTPRRAERAVTE
FT                   PRAVASTVLTPKEREVLELLARNLSNKEIAQAIGVGEVTAKWHVKNLFGKLSAGTRKHA
FT                   VRRAQLLGLLEGLE"
FT   gene            460572..461765
FT                   /locus_tag="Reut_B3845"
FT   CDS_pept        460572..461765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3845"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3845"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63203"
FT                   /db_xref="GOA:Q46UI1"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63203.1"
FT                   /translation="MTLKRRLYRGRDVRRAQNIAELRAMASARLPNFCLEYLEGGADDE
FT                   LTLHRNRASYDAIAFTPRTLVDVSVRDPGCTLFGQRIEMPAVIAPTGFNGLLTHEGDLA
FT                   LAHAARDAGIPMCQSMVSTVALERVAETGVRHWMQIYPFKDHENLAGIVRRAEAAGSEA
FT                   IVVTTDVPVLGNREWDRRNYRAPMKLDVANLINVALRPKWWWDVLVPHGMPHFRNLGDI
FT                   LPPGQDDARNAATFLSRQMDPSLNWQDVQWLRDLWPRKLILKGIVRPDDALRARALGVD
FT                   ALVITNHGGRQLDSCVAPIEVLPEIRAAVGPDMTLIVDSGLRRGGDFVKARALGADAAM
FT                   SGRATLYGLAAGGRTGVAHALAILRAEIDRTLGLLGCPALTDLGPDCVSRPGAMRGA"
FT   gene            complement(461762..462778)
FT                   /locus_tag="Reut_B3846"
FT   CDS_pept        complement(461762..462778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3846"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3846"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63204"
FT                   /db_xref="GOA:Q46UI0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63204.1"
FT                   /translation="MSTLLQHVNLTEFVDVARQLGLDPYRQLRQAGIRPTALVDPEMRV
FT                   PAKSVMQLLEDSAQLAGLEDLGLRVAEARELTTLGPLWTVMREGATLRNALGAMARYLH
FT                   LLNEALDLRLEEVGDTAVVRLEFLVSVDGSMRQSTEFIICLWFRLFKLLSGDAWKPRSV
FT                   CFTHAAPASLATHRRVFGVPVRFHQDFDGILLSAADLDVAGTTSDTALGRHAREFLDTK
FT                   LAQSDSTMPDKVRKLVFALLPTGECGAEQVARQLGIDRKTMHRHLAAYGQNYLSVVDAV
FT                   RVELVTRYLKNNERPLSDVAILMGFSSLSAFSRWFATRYGCSVSAWRRQRTAPEIRR"
FT   gene            462908..463756
FT                   /locus_tag="Reut_B3847"
FT   CDS_pept        462908..463756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3847"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3847"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63205"
FT                   /db_xref="GOA:Q46UH9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63205.1"
FT                   /translation="MRVEPLTCSIGAELVGVSLADAIHDDGLFAGIREALLKHRVLFVR
FT                   GQDITAGEHVAFARRFGELEDHPVAGSDPEHPGLVRIYKSPEEPTPRYENSWHTDATWR
FT                   EAPPLASILRCRECPPVGGDTMWSNMVLAYENLPQHIKDQIAGLRARHSIEASFGAAMP
FT                   IEKRHALRAQFPDAEHPVVRTHPDTGEKVLFVNGFTTHFTNFHTPEHVRFGQDFNPGAA
FT                   DLLRYLITQAYIPEYQVRWRWTPNSVAIWDNRSTQHYAVMDYPPCHRRMDRATVIGDRP
FT                   F"
FT   gene            463772..464542
FT                   /locus_tag="Reut_B3848"
FT   CDS_pept        463772..464542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3848"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3848"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63206"
FT                   /db_xref="GOA:Q46UH8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63206.1"
FT                   /translation="MLPHCNANQTETLTMSQIDPNLLKDKVAVITGAGRGIGRAIAMAY
FT                   ASAGAAVVCSGRGEADIAQTAAMIREAGGRAIAQTADVADYESVKTLFQRASDAFGGVD
FT                   IVVANAGVALEQRRIADGDPALWRKTIDINLTGAYHTAHAAIAHLRRRGAGKIIMIGSG
FT                   QRKRPAPGFSAYSCSKSGLWMLTQSLATELQEDNISVNELIPGPVRTDMTRDVPVPPGE
FT                   WFKDPADVVPLALFLAGMPDVGPSAQSYSLMRRA"
FT   gene            464601..465659
FT                   /locus_tag="Reut_B3849"
FT   CDS_pept        464601..465659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3849"
FT                   /product="Helix-turn-helix, Fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3849"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63207"
FT                   /db_xref="GOA:Q46UH7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63207.1"
FT                   /translation="MSRLVRSATLSRYTEVARSVGLDPLRILAEVGLPRTCLDAGDNLV
FT                   SANAVCRLLEMSAADSDAEDFGLRMGEGRQLSVLGPLGMAVRDSPTLRDALGAMVRYIT
FT                   LHSEALFLGVEEREGALVIRVSLIVEHAGSTRQADEMVVVSLYRMLQELIGPGWRARRI
FT                   CLSHEAPRSLASHLRVFGRAVDFGCDFNGIVCELKDMDAMPRAARPELAQYAHAYLDSL
FT                   SARATLSMTENVRRMVLSLLPSGNCSVERVASQLGVDRRTVHRKLLQEGASFSSILDEV
FT                   RATLALQYLRHLERPVSYVAVLLGFSMQSAFSRWFRDHFGCSPSAWRSEGMQPARPVPR
FT                   QPLLAASPEQRM"
FT   gene            complement(465671..466363)
FT                   /locus_tag="Reut_B3850"
FT   CDS_pept        complement(465671..466363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3850"
FT                   /product="Ethyl tert-butyl ether degradation EthD"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3850"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63208"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR018566"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63208.1"
FT                   /translation="MIHLIFLSMRRADVDRREYLRDWRDVQAPLVAGLPGVRRYVQSTV
FT                   RAVPGQVARYDTVDEIWVDDAAALDAMLHSADYARSTLAGAGNLVDPEHCVRLQTTDHV
FT                   VHAGASIAREESLPKRMTFFRRKSNLSREDMLRYWRGTHGPLAASVPGLRRYVQSAMLP
FT                   AVDDQGPTHFDGAAQIWFEDDASLQAAVCSPLFRESVKPDEANFIDTDSAVTLSIEAEH
FT                   RIVWPQMA"
FT   gene            complement(466360..467193)
FT                   /locus_tag="Reut_B3851"
FT   CDS_pept        complement(466360..467193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3851"
FT                   /product="Short-chain dehydrogenase/reductase
FT                   SDR:Glucose/ribitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3851"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63209"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63209.1"
FT                   /translation="MTQSDSRPRLQDFEGKTAIITGAASGIGLALAEALAARGADLALA
FT                   DIDARGLDAARKRLAPTGRRICTRVLDVSSDADVRDAAAEFEATLGRIHLVFNNAGIDM
FT                   SGELASLSEQDWTRAFGINVFGVIHGIRHFLPLLRRHGEPAHFVSTASGAGLWVNGDFP
FT                   MGAYAATKYSVVALSEALEQELRGTGIGVSVLCPGPVKTPIAERSNHASESFRAAVATG
FT                   TAPELVASHTLEAMRAGEFYIFTPTRMRPRLEARFARILDALERAPAVTTGMAAT"
FT   gene            complement(467222..468241)
FT                   /locus_tag="Reut_B3852"
FT   CDS_pept        complement(467222..468241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3852"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3852"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63210"
FT                   /db_xref="GOA:Q46UH4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63210.1"
FT                   /translation="MKTMNRRWILRQRPVGDIGDNDLQLVEAPLPRPGDGEILVRNIYL
FT                   MVAPTNRVWMSEIDQYMAPVALGEVMRGVTMGVVTESHHPDFKAGDIVEGGMAWEEYSV
FT                   TKMARRVPVEYGLPLHAYASVLGNSGMTAYFGMLDIARPKAGETIVVSAAAGGVGSIAG
FT                   QIGKILGCRVVGVAGGQNKCRLVREEFGLDACVDYKAGNVLADLRAACPDGIDVDFENV
FT                   GGETMDAVLALINPGARIAMCGMISTYNASGDWWSPKMFRNVIMKRARIEGFLIADYRS
FT                   RFHEAVEVMAKWVRDGQLKYRVDIVEGIEQAPAALNRLFTGKNIGKQLVRLAPESVIG"
FT   gene            complement(468314..469561)
FT                   /locus_tag="Reut_B3853"
FT   CDS_pept        complement(468314..469561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3853"
FT                   /product="Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3853"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63211"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63211.1"
FT                   /translation="MPLTRALEHAASPEQVGLSTRRLQSISSVIHADVDRRKIPGAVVL
FT                   VARKGRIAWSEAFGFEQADTPSRPMQRHSVFRIAAMTRPIVGVAALILMEEGRLSLNDP
FT                   VERYIPEFASLQVGVESVDANTGERRLALEPVRRAMTVHDLFRHTSGLTYGQFGDSLVQ
FT                   RQYRESGLMDPAQTNAEMVAKLAAIPLQCQPGEVFEYGMSTDVLGRIIEIVSGMDLARF
FT                   VAERVTQPLRMHATGFHLIRQDGAGLALQSGASGKSTALFDYDEHHPPRWHSGGAGLLS
FT                   TAGDYARFCQMLLNGGALDGVRLLSRKTVELMLGNHLPQSTRFGGSTTGLGINAPLPDL
FT                   GQGHGLAVGVRTASGLSPVPGSIGDFYWGGALGTYFWADPQEQLIAILMLQENDLATRT
FT                   GYRSLLRNIVYAALED"
FT   gene            complement(469828..470805)
FT                   /locus_tag="Reut_B3854"
FT   CDS_pept        complement(469828..470805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3854"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3854"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63212"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63212.1"
FT                   /translation="MPIRPALTRVHHAAVCAVLALSMPVAMAWTNKPVRVLIPAPAGGT
FT                   MDVLARVLSEALTTELGQPVVVDNKPGAGGGIAINTLLAAPADGQTILVSTTNVLTEIP
FT                   HVMKVSFDPMKDVKPVAAVARSTLVLVGSPSLPAKDLPSLVSYVKAHSGQLSFASYSSG
FT                   TVAHYAGLIMNQKAGMDLQHVPFAGSPPALTQVMGGQIAVMYDGMVTSLPMIKAGKLQA
FT                   YALAAKQRSPLLPQVPTFAELGYPDIDFNNWAGVFVSSKVPADVVQKIQAAVYKAAATP
FT                   KVQERITGLGFETVPPQTPAQLGQALRTEYDRNAAIVKAYNIQP"
FT   gene            complement(471007..472173)
FT                   /locus_tag="Reut_B3855"
FT   CDS_pept        complement(471007..472173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3855"
FT                   /product="Porin, Gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3855"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63213"
FT                   /db_xref="GOA:Q46UH1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63213.1"
FT                   /translation="MKLRSMAVAALLACSGGALAQSSVTLYGVADVNLEYVNHVGAIPS
FT                   AANQFNRGPSNDVYRMNAGGFSGSRWGIRGTEDLGNGLKALFVLENGFNVDTGTLQQGG
FT                   RMFGRQAFVGLQQAGIGQLSLGRQYASMFEALANFAPAAYATQYEPTVLMTGPNFRQDN
FT                   TVKYTGQFGPVTALAHYSFGVGLALPQTVGIATPIGGNGENPGQARRDSAYGAAVAYQG
FT                   GAFGVTVGYDQWNPTIGTSSGTVRKAAVGGSYTFGSLAKIMGGYRWGQNKNAADVVIQR
FT                   DDFYWIGANYQVTPAIGLTLEYNYDNVKSLYGDTHVANPWQIALIANYAFSKRTDLYLS
FT                   TAYAKNAGLMMESLATVYANSLSLGNNYVLANGQSNMLGVSLGIRHKF"
FT   gene            complement(472386..473363)
FT                   /locus_tag="Reut_B3856"
FT   CDS_pept        complement(472386..473363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3856"
FT                   /product="NAD-dependent epimerase/dehydratase:Short-chain
FT                   dehydrogenase/reductase SDR:3-beta hydroxysteroid
FT                   dehydrogenase/isomerase:Polysaccharide biosynthesis protein
FT                   CapD:dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3856"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63214"
FT                   /db_xref="GOA:Q46UH0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63214.1"
FT                   /translation="MADSERFLVTGALGCIGAWTVRRLANEGVPVVAFDADNDVRRLRL
FT                   LMDDAQRSRVEMVRGDITDLSLLEATLDHHRITHVIHLAALIHPRFKSDPPLGARVNVL
FT                   GGVNLFEAVARRVERIPRIVYASSIAVYDNGDAANDAAIQHHTAGHPTTLYGVFKQAEE
FT                   GMARVYYQDRGVSSIGLRPATVFGAGRDYGLTAAPTQAVLAAALGRPFHIPYSGRSQIH
FT                   YADDLARMFIACARSGYRGADVFNMHGSVADMGEIVETIESVIPQARGTITFDGASLGL
FT                   PEDYDATALENVIGPLPRTPLREAVGETFRLFRSRIASGEIRDT"
FT   gene            473934..475133
FT                   /locus_tag="Reut_B3857"
FT   CDS_pept        473934..475133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3857"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3857"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63215"
FT                   /db_xref="GOA:Q46UG9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63215.1"
FT                   /translation="MDFRPDPNLAEFRQQVRDFLREHMPADMPRRAHGMRSPRDTLMQW
FT                   QRVLNTHGWGAPYWAAEHGGTGWTVAQRLAFDEECALAGTPSQDAFAQKLVGPVLNHFG
FT                   TPAQKDEHVGAILRGERLWCQGFSEPGSGSDLASLRTQAVRDGDHYVINGQKIWTSYGH
FT                   QADWIFLLVRTGSGEKKQAGITFILVDMKTPGITVRPIISIDGCHHLNETFFDNVRVPV
FT                   ENLIGEEGGGWKITKFLLNNEHATTADLPTLRRLQRQLRAFAAAPAAGSTLGEQPQFAL
FT                   RLARYEAELEAIAVMVQRVAAMEQAGDHSPAAHALGSMLKIRGTELQQQMGQFAVESMG
FT                   DYGPVSYPSSHDGHAGEPLPMQDVMQDIATEAFFRRATTIYGGTSEIQRGIIAKTKFRL
FT                   "
FT   gene            complement(475187..476608)
FT                   /locus_tag="Reut_B3858"
FT   CDS_pept        complement(475187..476608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3858"
FT                   /product="Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3858"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63216"
FT                   /db_xref="GOA:Q46UG8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63216.1"
FT                   /translation="MKTLDRFYIQGEWVTPAAGSTLVDVINPATEAPVARLAMGTTADA
FT                   DRAVAAARDAFGTWSQSTREERIALLERIAEQYRARVPELAEAVRLEMGAPVTLCNAMQ
FT                   APIGLVHIQNTLEVLRNFAFETTHGKTWLRREPVGVAALITPWNVPLNQIAAKVAPALA
FT                   AGCTVVLKPSEIAPLDAVIFAEIMHAAGTPLGVFNMIFGDGPSVGAALSSHPDVDMVSI
FT                   TGSTRAGVEVAKNAAPTVKRVAQELGGKSPLVVLDDADMKTAVTTAVAQCMVNTGQVCV
FT                   APTRLLVSRTRYDEALAIAAATAGALQVGDPADPATKIGPLSNRAQFEKVQQMIGIGIE
FT                   EGARVIAGGPGRPDGIERGFYVRPTVFADVHNSMTVAREEIFGPVLCVIPYDSEEDAIA
FT                   IANDTVYGLAAYVASGDAERARRVAARLRAGTVRVNFAPADLTAPFGGVKRSGNGREFG
FT                   AEGLVEFLEWKAISL"
FT   gene            complement(476670..477656)
FT                   /locus_tag="Reut_B3859"
FT   CDS_pept        complement(476670..477656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3859"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3859"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63217"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63217.1"
FT                   /translation="MLMFKRRALRLLCPALATLAALAIAAPVKAGDYPERPVKIVSVTS
FT                   AGTGVDDYTRLLAKYLSDKLGQSFVVENRPGGNMVVATDYVSKAAPDGYTLLLSGSGAM
FT                   AANPFLFRRLPYDPMKDFVPVARLSVLPIAVIVPGNSPYHTAGELIAAARANPGKLNFA
FT                   TSSTGYRVILTAFNDAAKIQSVSVPYKAASAMMTDVMGGMVDYGGVEVSAIIPHVQSGK
FT                   LRALAITGPNRLAQLKDVPTLRELGLERYSLNTWVGLFAPAGTPKPIVDKLTRLALQFT
FT                   STPEAMAHYQARGSAAYPADGAELRKNIVADQQGWKQMITVAGIQPE"
FT   gene            complement(478076..479230)
FT                   /locus_tag="Reut_B3860"
FT   CDS_pept        complement(478076..479230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3860"
FT                   /product="putative outer membrane porin signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3860"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63218"
FT                   /db_xref="GOA:Q46UG6"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63218.1"
FT                   /translation="MKHKLCAVAVLGALSAWNGAAHAANNVTLYGVIDAPIEYVNRVAT
FT                   SAASPNTGASRIGMPSIGGLSASRWGMRGTEDLGSGLQATFVLEGAFMPDTGTMPSSGL
FT                   FGRIATVGLKKNDLGQITFGRQTTSLLDGLVNFSPLRFAATYEPGIWWMGVNYRESNMA
FT                   KYTGQFGNVLAVAHYSFGTGVPALSSGNLLANGGAGEDPAHGKDNTAYGASVMYLDNQF
FT                   GLGIGYDQWNPALTPGQTAKVRKASIGGSYATGPFKLSAGYRWNKADFPNGNTFLRDDY
FT                   YWAGVNYQVTPALGLSLAYFYADVKKTAATPTAASSNPPNMQQYTFLADYNFSKRTDVY
FT                   FSVGYARNGSLSFDSAATAYAFNYPSMAGQKGMLGVITGIRHIF"
FT   gene            complement(479627..479971)
FT                   /locus_tag="Reut_B3861"
FT   CDS_pept        complement(479627..479971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3861"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63219"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63219.1"
FT                   /translation="MERLMDLLQEVRQFSRQLQRCARESARATNTPSYVDTLHALLDSR
FT                   MQCDDARMRIVCYACAAELGLPMELEAEHCRQVMSGSLGFPLRVLFWAAHRRMQSARRS
FT                   HGSTWLMPHN"
FT   gene            480404..481423
FT                   /locus_tag="Reut_B3862"
FT   CDS_pept        480404..481423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3862"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3862"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63220"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63220.1"
FT                   /translation="MTTLITQFRTLLAHAAAAGSGLLLTCGTLAALAPAALAAPAYPAK
FT                   PVTLVVPGPPGGITDQIGRLVAAKMTSDYGMRVIVDNRPGAGGNLATEIAARAEPDGYT
FT                   VLLGTQGTMASNQFLYKSLRFDPAKDFIAAQALVSIPNLLVVNGKLPYQSVRELVAYAK
FT                   AHPGKLTVSSAGNGTGSHLAAELFQTLAGVKLVHVPYKGSAPSINDLLAGQVDLTFDYP
FT                   VSTLTQVQAGKLRALAVTGTSRLPALPQVPTISEAGYPGAESTSWIGLFFPARTPAAVV
FT                   AKWEADVGRMVKEPATVEALQKMGGVPLPLSGEAFRAFVQSERTKWKGTIERAGATLD"
FT   gene            complement(481508..481951)
FT                   /locus_tag="Reut_B3863"
FT   CDS_pept        complement(481508..481951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3863"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3863"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63221"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63221.1"
FT                   /translation="MTCQPAPAPRSFHEDARQFLAHTLPTLRRFDAQLHALAGSARAGG
FT                   MTLATRHAFLLRLAGYEADLKAMAGIARTLAATQQHDSPAAQAMGAMLTARGADLHLQM
FT                   EDFLAQSLGDCGMAQDRAARAARAGTRAAMPARDSARAVTAGA"
FT   gene            482436..482993
FT                   /locus_tag="Reut_B3864"
FT   CDS_pept        482436..482993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3864"
FT                   /product="Phasin"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3864"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63222"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63222.1"
FT                   /translation="MFPSTPDQVVAAQESSVGYWFTLTNIAVEGLQRLTELNLQTARTT
FT                   VADSQDNVRALFAGRDLRDVFAVQANLAQPAAEKAIAYARNVYEIASNTQAELTKAVEA
FT                   RYEQHSRNMQSFVDTFVKNAPAGSEAITALLQSSVAAASSTYQSIQSAAKQTAEAAGAR
FT                   FVTTALAASGAAQQAGARAPRQ"
FT   gene            483166..483999
FT                   /locus_tag="Reut_B3865"
FT   CDS_pept        483166..483999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3865"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3865"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63223"
FT                   /db_xref="GOA:Q46UG1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63223.1"
FT                   /translation="MQRELDRDDQGNALIGNPGVFQLYENEAGRMTKKIALVTGGMGGL
FT                   GEAISIKLHDAGHAVVVTHSPGNANAQNWLAEMAAAGREMRAYEVDVSDYDACQACAAK
FT                   IIADVGRVDILVNNAGITRDMAFKKMDKPNWDAVMRTNLDSVFNLTKPLCEGMVERGWG
FT                   RIINISSVNGSKGAFGQTNYAAAKAGMHGFTKSLALEVARKGVTVNTVSPGYLATKMVN
FT                   AVPKEIMDTKILPQIPVGRVGKPEEVAALIAYLCSEDAAYVTGSNIAINGGQHMQ"
FT   gene            complement(484161..484901)
FT                   /locus_tag="Reut_B3866"
FT   CDS_pept        complement(484161..484901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3866"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3866"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63224"
FT                   /db_xref="GOA:Q46UG0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63224.1"
FT                   /translation="MPTMIPAASRAMAVFEVFAREKRELSNSDMARLLSLPESSTSDLL
FT                   HTLHSLGYLMRTTRTRRFYPTGRLSEIARQIAENDPLTTVAQEAIEQVSARTNESVFFG
FT                   VLDGTAVKVMAVQASRLPLRYIIEVGYRAALHASALGKGLLGLLPPEEARETLAKSSLR
FT                   AVTAHTVVDIDTLMAQVAKGRKRGWYEAHEEGSEGVHGLAVTGWLGGQAAGISLAGPAE
FT                   RMKKNHDAYLAALIEVRDALMSEE"
FT   gene            complement(485031..485810)
FT                   /locus_tag="Reut_B3867"
FT   CDS_pept        complement(485031..485810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3867"
FT                   /product="citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3867"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63225"
FT                   /db_xref="GOA:Q46UF9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63225.1"
FT                   /translation="MVTTVKTEIGYTTTDTIMVRGLNLATEIIGKFDFVDMIFFTTLSR
FT                   LPTPREKVMVNALLVTTADHGITPSSLSARLTYIGAPEALQGAVATGLLGAGSVFLGPM
FT                   QNATEMLNEGTRELSDDATDEQLLETARALIKRYKESRQQVYGVGHPIHVDGDPRVPAL
FT                   RELSRQNGYYGLHWRLMEAIVEVLVKEQKRKLPMNVVGAIGAIVAAMGLDPLIARGLAL
FT                   VGRSAGLLAHVLEEKQDPMAREAWQLVLKADPRNVLP"
FT   gene            complement(485804..487939)
FT                   /locus_tag="Reut_B3868"
FT   CDS_pept        complement(485804..487939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3868"
FT                   /product="CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3868"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63226"
FT                   /db_xref="GOA:Q46UF8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63226.1"
FT                   /translation="MSNQGIWFSDLSRLVNPNSIVLVGASEKPDSIGGRTLENLTTFSE
FT                   FKGELLLVNPGRTEIHGRPCVASVKDLKEAPDLAILAVRADMVIQTLRDCGEMGIKFAI
FT                   VFTSGFGETGEDGRAVEAEMREIVASTGMRIYGPNCPGLNNMNARLGLTFSPAWRIDRR
FT                   PGPIGVATQGGGLGRSFIQAMDRGVGVGLWCSGGNEVDLEVSDYIHYMADAPDIEVIVT
FT                   TLEGVRNGPRFMAAALHAARRGKPIVAIKVGKSEYGAKAAQSHTAAIAGSAEINSAVFS
FT                   QLGIIEVDDIDELIDVASLLARRKPTGKEQLAVYSFSGGTAALASDMVGLAGLKLSEFA
FT                   PHTIEALRNALPGFAAFTNPVDVTAEVLVNTEVSYATLKATAADPNTDLVLVPIPVEYG
FT                   KTTAMLADSMVHVQQEETNTPIVPVWMSDRTGEGHRKMIDGGLMPMRAVGNAVLAVQRF
FT                   IEYGRWKAKFEREWCPLADVSTAETTANLSEAKTKALLEQAGVPTPQGVVARSPAEAAQ
FT                   AFRNVGNGKAVMKIVSAAITHKTDIGGVRLGIASEGAAMAAYEEIHANGVKACDAAQID
FT                   GVLVEPMLPSPFVEAVVGIHRDPVFGHVCTFGLGGVSIELFKDVSRRLLPLTPASAREM
FT                   ITETRCYELLKGYRGQPAFDIDALVDMLVKLSDFVGKHAARIEELEINPLAVRPQGQGV
FT                   AALDAVLSFQGMEPSTW"
FT   gene            complement(487936..488436)
FT                   /locus_tag="Reut_B3869"
FT   CDS_pept        complement(487936..488436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3869"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3869"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63227.1"
FT                   /translation="MTQPAILEQVANTTLFWEDLTPGLTYSTSSRTITEADVAAFAALT
FT                   GDFNKVHVDAEYAKGTIFGQRIAHGMLVAAFMAGLTSRSIPNQFFEGSLFSVLENRLKF
FT                   PKPTFIGDTIRVDIEVVEQKTTSRPDRGIIAFMRKAVNQRGEVVAEMAATCLFKRRPTG
FT                   EAQ"
FT   gene            complement(488542..489705)
FT                   /locus_tag="Reut_B3870"
FT   CDS_pept        complement(488542..489705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3870"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region:Acyl-CoA dehydrogenase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3870"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63228"
FT                   /db_xref="GOA:Q46UF6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63228.1"
FT                   /translation="MVDSSIDVDGLDADQRLLRDNIRRYLKETFTPHIRQAERDKRFPH
FT                   ELMTGLIDFGYFGGVLPEADGGLGLDYLTWAVMMEEAGYCWLSLRILINGLNIVSGIIN
FT                   AYGTEVQKERFVRPLLRNERKPFVSISEPDVGSNVAEVKTRADKKGDRYVLNGSKLWVT
FT                   NGMFADFGIVVARTYSETCNGELSLFLVERDVTKYTAEPVDVMFTRSTGTAAFTFENAE
FT                   IPAANLIGVEGQGLRQILIGLNFGRLNVAMGAVGAAQCALDLSVDYVLQRKQFGRQIGS
FT                   FQLIQKHIVDMTMRVQASRSLGYRAARSMQNGTSRTECSIAKLYATEAAFEVSNLALQV
FT                   HGGIGYATEYPIERIFRDTRGGMIPEGTTEIQTLIIAREILGISALT"
FT   gene            complement(489698..490447)
FT                   /locus_tag="Reut_B3871"
FT   CDS_pept        complement(489698..490447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3871"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3871"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63229"
FT                   /db_xref="GOA:Q46UF5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63229.1"
FT                   /translation="MDLGLNGRVAIVTGSARGIGAETARMLAKEGAAVVITDLDLEAAR
FT                   ETASGIEQAGGKAIAVQCDVRHEEQVRNMVGAGKEAFGSIDVLVNNAGLVKDRTILKME
FT                   EADWDLVLDVTLKGSFHTCRAALPFMHEKGWGRIINISSRALFGNPGQANYSTAKAGII
FT                   GFTRALSLEQARKGVTVNAIAPGYIETEYIKSLPNYDTILANVMAKNAVTFPGQTSDIA
FT                   GAVAFMASEHARYITGTTLFVTGGRYG"
FT   gene            complement(490503..491240)
FT                   /locus_tag="Reut_B3872"
FT   CDS_pept        complement(490503..491240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3872"
FT                   /product="regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3872"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63230"
FT                   /db_xref="GOA:Q46UF4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63230.1"
FT                   /translation="MPVQIPAASRAMAVFEVFAREKRDLSNSEMAKLLAVADSSCSDLL
FT                   HTLHSLGYLMRTTRTRRFYPTGRLFETARQIAENDPLTRLAQEAVQRLTDATNESAFFG
FT                   VLEPQAVRVAAVAQSRLPLRYILDVGERVALHASALGKALLGVLPEGEARSRLEAIRRP
FT                   AVTRSTVVDIEPLMAQLARGREQGWYEAHDEGTAGVMALAVPARLDERPVAISLAGPIE
FT                   RIEKNRESYLAALRDVRDGLLAD"
FT   gene            492370..494484
FT                   /locus_tag="Reut_B3873"
FT   CDS_pept        492370..494484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3873"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3873"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63231"
FT                   /db_xref="GOA:Q46UF3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63231.1"
FT                   /translation="MTNEASVVRTARHGDVQVITICNPPVNALGVAVRQGLKQAIEQAE
FT                   ADAGVRAVLVVGEGTAFIAGADIREFGKPPMPPSLPEVCNQIEASNKLVVAAIHGPALG
FT                   GGLEVAMSAHYRLALPAAKLGLPEVNLGLLPGAGGTQRAPRLMGVKAAADLMLSGKHLS
FT                   AKAAQAAGLVDRLAEGDDPVAAGLAYVNELLEQGAPLRRTRDLAIADKAAALAELDTLQ
FT                   AETAKKTRGLFSPQKIVECVRAAVELPFDEGLAKERALFVECLNSPQRAGLVHAFFAER
FT                   ETAKVPEAQGAAPRALNRIAVIGGGTMGAGITVAALDTGLPVVMIERDAESIARGQANV
FT                   EKVYDGLIAKGRMTPEGKAAIMARYTPSTSYESIADVDLVIEAVFEDIEVKKAVFQQLD
FT                   RVCKPGAVLATNTSYLDIDAIAGSISRPQDVIGLHFFSPANIMKLLEIVVPAKVSPDVV
FT                   VTAFELAKRMKKIPVRAGVCDGFIGNRILAVYKQAADYIMEDGASPYEIDEAVRGFGYP
FT                   MGPFQVTDLAGGDIGWATRKRRAATRDPKARYVEVADRICERGWFGQKTGRGFYLYPQG
FT                   ARIGQPDREVLAIVEAERQKKGIAPRKFTAEEIMRRYMAAMVNEGAKVVEEGIALRPLD
FT                   VDVTFLSGYGFPRFRGGPMKYADMVGLPKILEDIRTFAKEDPLFWKPAPLLEKLVAEGK
FT                   DFASLNQAGR"
FT   gene            494581..495831
FT                   /locus_tag="Reut_B3874"
FT   CDS_pept        494581..495831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3874"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3874"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63232"
FT                   /db_xref="GOA:Q46UF2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63232.1"
FT                   /translation="MQTTTEPSQDVDFPLEGVRVLDLSRVFAGPLCGQVLADFGADVVK
FT                   VEHPGRGDDTRDWGMRIGKTETTYFNSMNRNKRSITLDLQSKEGVQIVYDLLPQFDVVI
FT                   HNFKTGGAEKLGLGYEQLKAIKPDLIYCAVSGYNTSGPEAKRPGYDLVIQGEAGLMALN
FT                   GEANTPPLKFGVAVVDLMTGMYAAQAVLAALFRRERKGKGQLIEMALYDCGVMVTGYYG
FT                   LDAMLLGHDPARYGNAHPSIVPYGMFESADGPLIIAVGNNSQFDKFCRQVIERPDIVEN
FT                   PLYATNVERAKHRETLTPLITGLIRSFKRDLLLERMTACGIPCGKVAGLHEALTSERTR
FT                   QGGLLREMPHPVAGSTHVFAPPYRLDGQRLPIRSAPPTLGEGTRAVLQNLLEMSDEQLQ
FT                   DLQARGVLTLPETPGNA"
FT   gene            495952..496929
FT                   /locus_tag="Reut_B3875"
FT   CDS_pept        495952..496929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3875"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3875"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63233"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63233.1"
FT                   /translation="MVHSRRRAILALAAAPMLISSAFAQAWPTKPIKLVVPFPPGGPTD
FT                   TVSRIVGQKLGEALKQPVIVENRAGASGSIAAAQVAKSAPDGYTFMMLATPTLLAPYLY
FT                   KKAGYDTTKDFTPVATVYDLPIVVVVNPALLPTVTDLPKLIAQAKAQPGKLNYTSSGAG
FT                   SFGHLSMELLKQMGGFEMQHVPYKGGVPAISDTIGGQVPIMYADLVAALPHIQAGKLRA
FT                   IAIGSPQRVSMLPDVKTIAEQGFKGYDAVSWGGLLAPPGTPKDIVDRVSTEVGKILADK
FT                   DVQDKVLKAGAIANYQTPAQESQRIRQDYAKWGKVIRDKGIAVE"
FT   gene            complement(497029..498156)
FT                   /locus_tag="Reut_B3876"
FT   CDS_pept        complement(497029..498156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3876"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3876"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63234"
FT                   /db_xref="GOA:Q46UF0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63234.1"
FT                   /translation="MRIVELAGIGPGPMSAMLLADMGATVLRVERRDAADLGVKRPIQY
FT                   NLLLRNRRAIALDLKDPAAVELVLDLVENADALIEGFRPGVTERLGLGPDVCLKRNPRL
FT                   VYGRMTGWGQTGPLASAAGHDINYISLTGTLNAIGRHGQPPSVPLALVGDFGGGAMFLV
FT                   MGLLAAIIEARGSGKGQVVDAAIVDGALALSTAIYGMHAGGLWHPERGSNVLDSGAPYY
FT                   DVYACKDGKYISIGPIEARFYSDLLQRLDLDAAELGNQNDTAAWPRAKEAFARAFLGRT
FT                   RDEWCAELEGTDVCFAPVLSFDEAPQHPHMQARGSFVEVDGVTQPAPAPRFSRTQPAVP
FT                   TAPQAACDATVFQALSGWMDPATVGRWQERGVLGG"
FT   gene            complement(498330..499349)
FT                   /locus_tag="Reut_B3877"
FT   CDS_pept        complement(498330..499349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3877"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3877"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63235"
FT                   /db_xref="GOA:Q46UE9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63235.1"
FT                   /translation="MNRFLAYRLHDDGPDGRVAGRFTELRFDNLPPGDVLIRVAYSGIN
FT                   YKDALAAAGRNAIVRQYPRTGGIDLSGHVAASDDPRFREGDAVVVHGFGIGVDHDGGHA
FT                   QYARVRGDWVMRLPEGLSPLEASTIGVAGYTAALALHWMEHNAMSPEQGPVVVSGATGG
FT                   VGSMAVDILSARGYMVHAMSGKSAEHAYLRSLGAGEILSPEVASQPGKALEKARWAGAI
FT                   DTVGGPVLAWMMRTMQPNGVIASVGNAGGPQLDTTVLPLILRGVRLLGINANSPMALRE
FT                   AVWAKLAADYRPRRLATIGQVIDFDALPDAMDRMLSRATRGRLVVRIDNGSPDLERGL"
FT   gene            complement(499346..499696)
FT                   /pseudo
FT                   /locus_tag="Reut_B3878"
FT   gene            complement(499720..501099)
FT                   /locus_tag="Reut_B3879"
FT   CDS_pept        complement(499720..501099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3879"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3879"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63236"
FT                   /db_xref="GOA:Q46UE8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63236.1"
FT                   /translation="MGRCSFGRRLKSISGRTGSAVRNQDCPRCAGLPLSKPFRLTRSGT
FT                   DMTPPLAQTTFSRNAPQDRGPLAGVRILDMATVVAGPFSATLCGDMGAEVVKLELPDGS
FT                   DPLRSLAPVKDDVPLYWKVTNRGKRGITLDVRTEAGRELFLRMLGEFDVLVENFRTGTL
FT                   ARWGLDLATLHAANPRLIVLRLTGFGQTGPYAARPGFARIFEAMSGLTNLAGTEESGPM
FT                   HMNFPIGDMIAGLFGAFAISTAIAERRANPELRGREIDLAATEALFRLLEPLAVEHEQL
FT                   GVVRQRAGNRATYTAPSNMYRTADGVWMTLVASSDATFRRLAEAMDQPQLPLSPDFAVN
FT                   AARIRNLERLDALIAAWFAARDADAVSAALERCDVPFSKVFTIADVMADAQMQARSAVI
FT                   RMPDPDVGSVPAPCVVPRFGGYQPPAPRTGPATGEHNDEFYTELGLGKDDLARLARDGV
FT                   I"
FT   gene            501117..501923
FT                   /locus_tag="Reut_B3880"
FT   CDS_pept        501117..501923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3880"
FT                   /product="regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3880"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63237"
FT                   /db_xref="GOA:Q46UE7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63237.1"
FT                   /translation="MTSNPLPGLASSDELATDRQFAINLARGLDVLRAFTPARPVLGNQ
FT                   DIVAQTGLPKATVSRLTYTLSLLGFLSRVPNSQKYRLGAGVLSLAYPMLAGLTIRQIAR
FT                   PYMEAIAQQTGCTVNLGMRERLSVVYVDSCRVDTANIYQPDIGSTRPLLGSSIGRAILL
FT                   ACDAKERTAVLNRLSVGDAERFAAEKVMWIADQKHFAAHGYCISHGEWRTEIHAIAAPI
FT                   RQGLHNDPFALNCTVSAMRNTGGYLERDVAPRLVACVKQIELACAR"
FT   gene            502091..503029
FT                   /locus_tag="Reut_B3881"
FT   CDS_pept        502091..503029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3881"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3881"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63238"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63238.1"
FT                   /translation="MPAGAAMAADAAATFPEKPIRVIVPFSAGGVVDSVARITAEYMAN
FT                   DLHQPVIVENRAGAGGAIGTDYVAKAPADGYTLLAVSPSHVVGPMLNAAVKWNAERDFR
FT                   AIAGIGDIPNLIVVPAASPLRDLPSLLAAARTAPGSLTYASPGPGTSNHLSAELLAQSA
FT                   GVKLTNVPYKGQPEALTDLLGNRISMMALTVAIARPQVQSGKLVALATTAARRSAAFPS
FT                   LPTVAESAHLPGFEVSAWFGLVAPRKTPDAAVHRLQKSVTKALADPAVVKRLAELGMDV
FT                   APLSAQQFDARIAAETRKWSGVLRNAGMGGS"
FT   gene            503107..504294
FT                   /locus_tag="Reut_B3882"
FT   CDS_pept        503107..504294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3882"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3882"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63239"
FT                   /db_xref="GOA:Q46UE5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63239.1"
FT                   /translation="MIRDTARLEKILADIRRFVAETCIPLEASIDADDAIPADVVDAMR
FT                   RLGLFGHSIPEAFGGAGLTSEELTLVNIEVSQAATTFRARFGGNTGIASESLVVDGTEA
FT                   QKDRYLPRLASGELTGCFALTEPDAGSDATSLRTTARREGDHYVLDGTKCFITNAPIAD
FT                   LFTVFARSEPGVAGAPGISAFLIERGTPGLTTGPAERKMGQHGSPVGDVYLENCRVPAS
FT                   AIVGGKPGTGFKTAMKALNKQRINLAGLCIGPAVRLVDEMVRYATRRSQFGKPIADYQL
FT                   VQQMIADSNTELHAARALVLETARRRDNGEDVTMEASMCKMFASEMAGRVADRAVQVFG
FT                   GSGYMARTVAERFYRDVRVFRLYEGTTQIHQLNIARRTLAARTEALGIAAEPVGD"
FT   gene            complement(504490..506583)
FT                   /locus_tag="Reut_B3883"
FT   CDS_pept        complement(504490..506583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3883"
FT                   /product="CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3883"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63240"
FT                   /db_xref="GOA:Q46UE4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63240.1"
FT                   /translation="MTAPLQPLLSPRSIAVIGASDNIHKIGGRPIHYMKAHGYAGTLYP
FT                   VNPQRDTIQGLRAYPTLDALPEVPDLAIIIVAGEAAVQAVHDCARLGVAAAIVIASGFG
FT                   EAGAEGRRQQDEMVRAARATGLRLVGPNSQGLANFGSGAIASFSTMFIEVPPQDGPVAV
FT                   VSQSGGVAAMVYGLLRGQGIGVRHMHATGNQADITVSDLALAVAHDPGVRLVLLYLESL
FT                   SDPEVLAEAARVARARNVPIVAVKAGRSQDGQRAAASHTGAIANEDRAVDAFLARHGIW
FT                   RVDDAHALARCAPMYLRGWNASGRRLVVVSNSGASCVMAADAAQSFGLTLAPLSDATQA
FT                   ALAERLPGFAATANPVDVTAALLTNSALFGEVLPVVGQDPSADLFLLDIPVSGMGYDVP
FT                   RFARDAAAFADTAGKPIAVAVWQQPVADAFRQAGVPTYANAAEALSAFSQVVSHQERLR
FT                   QIEAEGEPPVPARPALPVTAGATLSEAASLGRLAAAGMPVVEHYVCRHVDAAVAAWQRI
FT                   GAPVAVKASSPQVPHKSEYGLVALNCNDPESVASAFAAQTRTLEKMGATCEGVVVARMS
FT                   RAQRECMIGAHWDPVFGAVLVVGDGGKYVEVLRDTAVLLAPCREADVARALEGLRIAPL
FT                   LYGVRGELAVDLAALCRLAVQVGEMMHAAGGEIRSMDLNPVMVNAGGVVVVDALVEVAG
FT                   GSL"
FT   gene            complement(506621..507607)
FT                   /locus_tag="Reut_B3884"
FT   CDS_pept        complement(506621..507607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3884"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3884"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63241"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63241.1"
FT                   /translation="MAPNRSRRHALALISCVVLSATALPVAQAQSFPNKPIRVVVPYPP
FT                   GGPTDIVTRVVGQKLSEKLGQPLVVENRPGAGGNIGAEGVAKSAPDGYTLLVATTAHAI
FT                   NMTLFSKPGYDTRKDFAPVSMLTRGPLVLVTAPATPASNVAELIALAKAKPGQVTFASS
FT                   GNGQSTHLAAELFNSMAGIHMTHVPYKGSAPALTDVMGGQATVMFDTMLSAMPFVRDGK
FT                   LKALAITGATRSPAAPDTPTIAQAGLPGYEASAWNALLAPAGTPPAILNTLNGALKAVL
FT                   QDPDVRARFASQGFAAEWTEPAATARIIGQEIDKWARVVKTSGATID"
FT   gene            complement(507677..508030)
FT                   /locus_tag="Reut_B3885"
FT   CDS_pept        complement(507677..508030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3885"
FT                   /product="Protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3885"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63242"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63242.1"
FT                   /translation="MTHPYTDGLDVGVVRYQCCDDCGAWQPMERHACRRCGGLQLRWRD
FT                   AGGLATVHAVTEISRAPDEAFRALAPYTLVLATLDEGPRVMGHAEPGVAIGDRVRAGFL
FT                   RFGERTLLRFQRE"
FT   gene            complement(508027..509172)
FT                   /locus_tag="Reut_B3886"
FT   CDS_pept        complement(508027..509172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3886"
FT                   /product="Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3886"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63243"
FT                   /db_xref="GOA:Q46UE1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63243.1"
FT                   /translation="MAGTSYIRGTGNTRFGRLEGSTPLTLMAQAADAALADSGLARADI
FT                   DGALCGYATTLPHLMLADRFCEYASLTPAYAHGVAAGGATGGVMAMLAHELVRAGRCRH
FT                   VLVVAGENRLSGQSRDQSIQTLAQVGEPHAEVPNGASVPAYYALLASRYLHEAGMDADA
FT                   LSGFAVLMREHAASHPDAHLREPLSLADARAARAIATPLRLSDCCPISDGAVAVVVSAE
FT                   PGVGTPVRIAGAGQAHRHQHLSAIDDVMQTGAADAARRAFAEAGGGVESIDYLAIYDSF
FT                   TITLVMLLEELGLAERGRAQARLRAGDFGRNGPLALNTHGGLLAFGHSGVAGGLMHLAE
FT                   AARQLGGRAGERQAGTRLRALFHADGGVLSSHVSLVLEAMP"
FT   gene            complement(509174..510415)
FT                   /locus_tag="Reut_B3887"
FT   CDS_pept        complement(509174..510415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3887"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3887"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63244"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63244.1"
FT                   /translation="MKRHHSMFRKAAGTLAMAAALACGAAHAQPAAGISDDMVKIGMLL
FT                   DMSGLYADVTGRGSATAAQMAIDDFGGKVLGKKIELVVVDHQNKADIAANKAREWFDTG
FT                   HVDAILDVAASAPALAVLDVAKQKNHIVVFSGPGSERITNDLCTPVSVHYAYDTYALAN
FT                   TTARAMVQRGGKTWFFLTADYAFGHTLQDSATAVINEAGGKVLGAARHPIGASDFASYL
FT                   LQAQASKAQVVGLANAGGDTVNAIKAASEFGLTRNGAQRMAGLLLYINDIHAIGLKTAS
FT                   GLVLTEAFYWDMNDATRAWSRRYFEKVKKMPNMSQAGAYSSVMHYLKAVQAAGTDETAA
FT                   VMKKMKSMPINDFFAKNGRIREDGRMIHDMYLFEVKSPAESKYPWDYYKVLATVPGDQA
FT                   FMPASKSQCPLLKR"
FT   gene            complement(510476..511537)
FT                   /locus_tag="Reut_B3888"
FT   CDS_pept        complement(510476..511537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3888"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3888"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63245"
FT                   /db_xref="GOA:Q46UD9"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63245.1"
FT                   /translation="MRWKQRPQGSNWGDFGPDDQLGRINLIGPEQVVKGAREVQAGLSF
FT                   CLSLPLDYPGGNKLNPRRHPPILRPTFRDDVPYVNFPLAKVDPAATDVISDDQVLMCLQ
FT                   YSTQWDSLAHVGALFDADGDGKPERVYYNGYRANEHIVGPVDYAEDDHFAAHPCDHGHD
FT                   HSAAQALGIENFAVRGMQGRGVLVDLAHTFGMDFRNVGYDDLMRAMDATQAEAEPGDML
FT                   LLRTGFAEVVLSMQREPDEAVLHHSCCALDGRDDKLLQWITDAGIAALIADNYAVERYP
FT                   ARPAPDGDKHHPLLPLHHHCLFKLGLPLGELWYLRELADWLRANGRTRFQLTAPPLRLP
FT                   GAVGSPVTPIATV"
FT   gene            complement(511539..512357)
FT                   /locus_tag="Reut_B3889"
FT   CDS_pept        complement(511539..512357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3889"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3889"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63246"
FT                   /db_xref="GOA:Q46UD8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63246.1"
FT                   /translation="MTTPSTSLQKACRLLRALTDARNSRLTDLANAAGVDKASALRLLE
FT                   TLVAEGMVQRDAATKAFMPGPEWLTLHATTVHRTDLRPLVRPALIRLANAFQDSAILSV
FT                   PSGCESVCIELRLGTFPIRANYLDIGSRRPLGIGAGSLALLSALPDAEVEAVIEGIAPA
FT                   MRRYPRFSKSMLLGHVQATRERGYAVLLDVVVERMGGIAIALPGPDGYPLGAISIAALN
FT                   ERITEREAAMARALRREADAICQNWRPRSGATPDTEQERPAARPRTREEA"
FT   gene            complement(512503..514236)
FT                   /locus_tag="Reut_B3890"
FT   CDS_pept        complement(512503..514236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3890"
FT                   /product="Helix-turn-helix, Fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3890"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63247"
FT                   /db_xref="GOA:Q46UD7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63247.1"
FT                   /translation="MSSSTTQGPTPPALGAVIRSREGKRLSAIGVCADPSTAEAAEAAC
FT                   AGAADRTAGRRLFPVEAGGHRYVGLCLEDAAQQIILLHRADTHTVLFDFLGTVPFASAI
FT                   LNHFLTDPYQAITVADRQGRMRFMSPVHEKFLGLDTGEGIGRPAADVIPNSRLAQVVAS
FT                   GKAEIGQLQPMNGVTRVVNRIPIRQDGEVVGAIGQIMFKGPEDMVRMHDELSELRSQVA
FT                   RYQRELDGLREGQPPLGLIGDSAPMQRLRREIQTVARLDVPVLILGESGTGKELVANAI
FT                   HHAGREPVSERPLLSLNLAALPATLIESELFGHAPGAFTGSQRHGRAGKLELAAGGTVF
FT                   LDEVADIPMEMQVKLLRVLEDHMVERLGSRRAQHVDFRLISATNRDIPALIDAGRFRLD
FT                   LYYRLSGVVLRIPALRQRREDIPALLQHFVNAFCARNGVPVPKVDHDVARHLAGQPWPG
FT                   NVRQLRQRIEEALVFCDGRMLRATDFARGESARGLVGLESEPVVHPLARAYSHEEVETD
FT                   SRASNAALPVSEPAAGMSELAYAAVVDAIARHGGNKKRAAEQLRISRSHLYKILERGPG
FT                   G"
FT   gene            514356..515957
FT                   /locus_tag="Reut_B3891"
FT   CDS_pept        514356..515957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3891"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3891"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63248"
FT                   /db_xref="GOA:Q46UD6"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63248.1"
FT                   /translation="MACAVLDPMHERELRRHTVTWQPEIDELAYRRRLAERMGGEEKVA
FT                   RHREAGKLTVRDRVAGIADPGSFREVGGLSGSGRYDSNGRLVDLVPSNLVMGRAKMGGR
FT                   PVVLVGDDFTVRGGANDGAVGDKLVHAEKMAHDLRLPMVRLVDGTGGGGSVRNIEIKGH
FT                   TLIPTMKVWQHVVENMSVVPVVSLALGSVAGMGAARVAASHYSVMVKETSQLFTEGPPV
FT                   VAHIGQQLSKNELGGSHIHTRNGVVDDEVATERDAFEHARRFLSYLPASVHELPPRTEP
FT                   SDDPARRDEWLLSAIPRDSRAVYKIRPIVQALVDDGSFFEIGRQWGCAIVTGLARLDGW
FT                   PVAVIASDPYFHGGGWDSATAEKFTRFVDLAQTFHLPVVNLVDTAGFLIGQEAEQAATM
FT                   RHGVRALAAVYQATVPWCSVILRRAYGMSAAAHQHMGRFNCRYAWPSANWGAMPIEGGL
FT                   EVAYKAEIEGADDPVQKRAEIEQRVRSLTSPFRSAEAFVIEDIIDPRETRTLLCEFANL
FT                   AAPLREAGISRFGIRP"
FT   gene            516030..519347
FT                   /locus_tag="Reut_B3892"
FT   CDS_pept        516030..519347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3892"
FT                   /product="Pyruvate carboxylase., Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3892"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63249"
FT                   /db_xref="GOA:Q46UD5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63249.1"
FT                   /translation="MNKLLIANRGEIALRVLRAARDLDIATVAVYSQDDASSRHRMLAD
FT                   EAIALDGSGPAAYIDIAGIITAAKASGCDAIHPGYGFLSERADFAQACADAGIRFIGPT
FT                   VEQLALFGDKGRALELAMESDVRVMPATRGGASLEDITSFFDKQGDAGVVIKAVGGGGG
FT                   RGMRVVRRREDLAEAYARCRSEAASAFGVDALYAERLVSRARHIEVQIAGDGTHVVALG
FT                   ERDCTLQRRFQKLVEIAPSPVLRPQLRDEIIKSALRLARCVNYRSLGTFEFLVEETESG
FT                   EQKDFVFIEANPRLQVEHTITEQVTGVDLVALQIGLAAGRTLADLGLDPASPPQPKGFA
FT                   IQVRINAESTDAQGLARPAYGRLERFDPPSGPDVRVDSHGYTGYEPSPNFDTLLAKLIV
FT                   SSAAPKFEAAVRRLQRSLAEFRIVGVPTNINLLRALVQRDDFLTQDVHTRHFEAILPAL
FT                   AASAEAVAEAGRAQEALLGDASRSPAAHASRSHEAEEEVEDGLVAIRAPLTGRVVEIAV
FT                   GLDEIVKPGQTVAVLDAMKMEHAITAECGGRVVDLRLEKGALAAEGQILIVVEQVEAEG
FT                   VAVDAAQKADPNAIRADLQRVLDRHAFLDDAARPDAVARRRSRGQRTARENLADLCDAD
FT                   TFVEYGGLALAAQSSRRTKDDLIVNTPADGLITGIGNINGALVGKDRARSAVMAYDATV
FT                   LAGTQGKRNHIKTDRIVEVALRDELPLVLFAEGGGGRPGDVDFPSVSGLYQPSFAAFAE
FT                   LSGEVPVVGIVSGRCFAGNAAFLGCCDVIIADKSANIGMAGPAMIEGGGLGIYRPEEVG
FT                   PAPVQFANGVIDVLVENEAEAVQVAKHYLSMFQGRVEHWSAPDPLALRHVVPENRLRVY
FT                   DTRKAIEGIADAGSVLMLRGGFGAGIHTALARVEGQAVGIMANNPYHLGGAIDADAADK
FT                   ASRFMQLCDAHGLPIVSLIDTPGFMVGPECEAQAQVRHVSRMFLTAAKLRVALLAVTLR
FT                   KGYGLGAMAMAGGGFRSASFTVSWPTGEFGPMGLEGAVRLGFKKELEAVPDGPERKALF
FT                   DQLVGQSYERGHAINTAAAVEIDAVIDPAQTRKWIAQGIASAELRSRRARRGFVDAW"
FT   gene            519391..521853
FT                   /locus_tag="Reut_B3893"
FT   CDS_pept        519391..521853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3893"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3893"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63250"
FT                   /db_xref="GOA:Q46UD4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63250.1"
FT                   /translation="MIRNGPDPAQLALRGLRVLEIGTGPALAYAGKLCADFGAEVIKVE
FT                   SPAGDAWRQMPPMVDVPGAEPESALFAWLNTNKRSVTANADNAEDIAWIAQLARTCDVV
FT                   LDARALTEGPGVLASSVWSGAAQPPHEPIEVALTWFGESGPYSEYAGAESVCRGLAGAI
FT                   HGSGPVAGPPHMPHDVQTAIAVGLQVFSSAVAALIGSGQGSRRYVLSAHEAVFGMVEME
FT                   AGMVPDKRHPLRRLGVNRFCGTHPAGIFETAQGWIGIFTHTLPQWKALCEAIGRPELGN
FT                   DPRYANGQERMARADEIDDLLIPALRTRTAQEWFDILCDKKHPAVIVPTMEQLLRQDVH
FT                   RQRNAFVPVEIGGVAFEGPVVPLRLDAAGPLLGGPAPAKGAHDAFYRAAGLDHHPRRQL
FT                   RQTASPQLPLQGIRVVDLTMGWAGPLASRTLADFGAEIIKVESTGYPDWWRGANFTEEF
FT                   YRERLYEKNTNFHLMNRNKLGITLDLTQPEGKQLLLDLVARADAVIENYSAEVLPKLGL
FT                   DYEALRAVNERLVMVSMPAFGLGNAWSNTRAYGGTLEQASGLPLHTGHPDGPPAMTSYA
FT                   YGDPVGGFNAGAAMLLALFAQQATGKGRHLNLSQVEAMLPMAAPFIIEQSVSGTVAPRR
FT                   GNRHPVNVPHGCFRCAGDDAWVVLTVPDAHWPALCRAIGREDLAADVQLAHAAGRRTQQ
FT                   DRIDAAITAWSAGRDPETAMQSLQQAGIAAGVVRPMSQVLQDKHLHARGFWQRVDRAHS
FT                   GPYTASTAWCRTGIEPVPVRHASPTLGEHTDEVLTRVLGLSAQRLAELERLGITGKAAK
FT                   PKASGKAA"
FT   gene            521901..522884
FT                   /locus_tag="Reut_B3894"
FT   CDS_pept        521901..522884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3894"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3894"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63251"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63251.1"
FT                   /translation="MQKFNMAGAALIALACTVAGPAVAESGSWPNKPIRMIVPFPAGSF
FT                   TDTVARVVSEQLSKSLGQPVIVDNKGGANGLIGVGEAARAAPDGYTLLLTNSSSITINH
FT                   QVYKKSNYKPKDFAPVTLVLEAPFILVTNPEWSQKHAVGSVPDLVKFAAQNPGKISYGS
FT                   AGPGNIAHLSFAMLNNRTKIQTTHIPYKSAAQAELAVMSGELEAAFDPWTALPQIKVGK
FT                   LKPLAVSSSKRMTQLPDVPTLEELGITPFNVTFWIGMLAPAGTPPQIVQRLNAITRGLL
FT                   EDSKAKAALGQQGDVVMIDSATFAKRIEKEDAAWGAVIQREGITLD"
FT   gene            complement(522871..524526)
FT                   /locus_tag="Reut_B3895"
FT   CDS_pept        complement(522871..524526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3895"
FT                   /product="DNA ligase (ATP)"
FT                   /EC_number="6.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3895"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63252"
FT                   /db_xref="GOA:Q46UD2"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63252.1"
FT                   /translation="MKAFADLYAALDGTTSTKARLAALVDYLRAAPPQDAAWAVYFLAG
FT                   GKPRQIVPVSLLRDMARQAADLPDWLFEESYQAVGDLAETIALLLPDPMDSDHAGLAEW
FT                   VEQRLLPLRGLPPDELMPRLDALWRPLDAHGRLVLFKLITGAFRVGVSRLLVTRALGEV
FT                   AGIDPKRVAERMVGYTDLSARPDATRFQALLAPESEDDRELRANGQPFPFFLAHPLQVP
FT                   LEQFDAVLGDPDNWQVEWKWDGIRAQLVCRGNQTWLWSRGEELITERFPEIVEAAAPLP
FT                   DGTVLDGEIVIWQQGRVQPFALLQQRIGRKTLNAKLLRDAPAILMAYDLLEWRGEDWRT
FT                   RPQAERRTRLEQLVASHVHPALELSPLVQAGDWAHFARLREASREMGVEGFMLKAASAA
FT                   YGAGRTKDVGIWWKWKIDPFSVDAVLVYAQRGHGRRASLYTDFTFAVWNAPPGTPNRAL
FT                   VPFAKAYSGLTDEEMRAVDAIVRRTTVEKFGPVRSVEPTQVFELGFEGIARSGRHKSGI
FT                   AVRFPRMLRWRTDKPIDEADTLATLEAMLPVSPA"
FT   gene            complement(524523..525629)
FT                   /locus_tag="Reut_B3896"
FT   CDS_pept        complement(524523..525629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3896"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3896"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63253"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63253.1"
FT                   /translation="MDHPRPPTSESRHAHDLIIARPEGLYCPPGDFYIDPWRPVDRAVI
FT                   THAHSDHARFGHAHYLCAEPGRGVLLARLPGIQLDTLPYGQRITHHGVTLSLHPAGHVL
FT                   GSAQVRLEFGGQVWVASGDYKLESDGTCDPFEPVPCDTFITESTFGLPIYRWPPQAALM
FT                   AEVFHWWQANAQAGRASIVYAYTFGKAQRILHGLLRHAGDDGLPGPVIAHGALTTLNGA
FT                   YAEAGVALPPMMLATELPPRSPLLRQALVVAPPSAQRSPWLRRFGDASDAFASGWMQLR
FT                   GTRRRRGVDRGFALSDHADWPGLLKAIEATGAGRVIVTHGNVPVMVRYLSERGWQAQAF
FT                   DTEYGDDDESARADEQAEPAAASEDTAP"
FT   gene            525909..526655
FT                   /locus_tag="Reut_B3897"
FT   CDS_pept        525909..526655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3897"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3897"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63254"
FT                   /db_xref="GOA:Q46UD0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63254.1"
FT                   /translation="MPRIRTLSSLVAEASHPAGRPPPAEAAAPAAAQQSETAMRMLEIA
FT                   ERLFAEHGIEQVPLRQIVVEAGQRNRSALHYHFGSREALVAHLLNLRLAHVNVLRNAYL
FT                   DEVEAAGKAGDVRAIVHASISALADTVVDTAWGGNYLQVAAQTMFSPTLFNAELLDKDA
FT                   MTGLVRTRRMVMAALPDVPAKVMDYRLMWFNHGTVFSLADWYQRTRAEHGAPPVDELAD
FT                   YCTAGLTGPVTRTTSAPRRAGKARKG"
FT   gene            complement(526711..528039)
FT                   /locus_tag="Reut_B3898"
FT   CDS_pept        complement(526711..528039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3898"
FT                   /product="Protein of unknown function DUF1214:Protein of
FT                   unknown function DUF1254"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3898"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63255"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63255.1"
FT                   /translation="MNAPRTPASDQAALLRDAVVYTYPLYEMARMRAATCPRRRADGTF
FT                   AGDTPDTTLRWVNQLFHSRALLGPQHRQVVTPNNDTLYTNAWLDLSEGPVCISVPDTAG
FT                   RYYVLGLLDAYTNPFGGIGSRTTGTGAGRYLLHGPRWQGEIPSGMQAVPCPTHAIWMIG
FT                   RWLVDGEADLPAVHRLQDAVSLTRPDGTPAAHAFDVGMQPGERAGDPVRFATVVNRMLR
FT                   DNPPPAEQAAHVARFAAVGIGADCDAGTMDDAQRKALSAALAALDAELAAPIPSDLGGG
FT                   WSLPVELLSTFGERYLERALVARNYIGALGMEEAMYLIADCDGDGQPLDGRASYELVFP
FT                   ADGLPQVDAFWSLTLYRKSDCMLVENPLCRYSLGDRSPALQYESDGSLRLLLGSRAPAA
FT                   ASLQRNWLPAPDEPFYVALRLYVPRKAHLDKTFAYPPIRRVGA"
FT   gene            528255..529280
FT                   /locus_tag="Reut_B3899"
FT   CDS_pept        528255..529280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3899"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3899"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63256"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63256.1"
FT                   /translation="MTVHSPVRAARRWTLSISMRALGAAALALSLVPGVGQSAETYPVK
FT                   PVRMVVPYPPGGLTDTLARTVADGLSRRLGQPVVVENRAGAGGGIGTDYVAKSAPDGYT
FT                   LLMTIPGPLTANIALYKRLPYDPRTDLRPISDVAVARTVMAVNASVPVKTVAELIAYAK
FT                   KQPGKLVMGSWGPGTQPHTIQAYMDKTYGIDMLHVPYRGEGPMITDLLGGQVNLTVGSI
FT                   TALKQHIADGRLRALAVVGPSRARAMPDVPTFAESGYKDTPFALVGPVSLLAPAKTPDA
FT                   VVERLGREVSALVKTPAVSQKIEDMGAEPLGNLPGEAVAAYKAYLPVVLKLTADTGVSL
FT                   E"
FT   gene            complement(529341..530846)
FT                   /locus_tag="Reut_B3900"
FT   CDS_pept        complement(529341..530846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3900"
FT                   /product="Sodium/sulphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3900"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63257"
FT                   /db_xref="GOA:Q46UC7"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63257.1"
FT                   /translation="MLAQIAAMYRYFMSVVPFRLTPAIISTVVLVTLLLLPAPEGLKPE
FT                   AWHLVAIFLTTIVAIILKVMPIGVMAMMAIVIVSLAQVTSNSSKGAIADALSSFDNPLI
FT                   WLIVVAILISRGLKKTGLGSRIGLIFISLLGKRTVGIGYGLAICELVLAPFTPSNTARG
FT                   GGIVHPIMKSIAGAFDSDPAKDTQGKVGTYLALVNYHANPITSAMFVTATAPNPLVVDY
FT                   VAKASGGALNLSWTTWALCMLVPGLLCLLVMPLIIYVLQPPELKATPNAIDYARGELER
FT                   MGPLSGQERVMMGVFAVMLVLWANLPAMIFGPGLTLDPTVVAFLGLFALIITGTIDWDD
FT                   VLSEKSAWDTLIWFGALVMLAEQLNKLGVITWFAADMRDAIEASGMGWLATAAVLVLAF
FT                   VFSHYLFASTTAHISAMMLAFLTVGVHLIPQPYVPVFMLMMTAGSAIMMTLTHYATGTS
FT                   PIIFGSGYVTLGQWWRVGAVMCVFELIVFAVVGGIWWKILGFW"
FT   gene            complement(531118..532218)
FT                   /locus_tag="Reut_B3901"
FT   CDS_pept        complement(531118..532218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3901"
FT                   /product="Helix-turn-helix, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3901"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63258"
FT                   /db_xref="GOA:Q46UC6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63258.1"
FT                   /translation="MSRTTVLRSAESDLTLHGRDAMGTLMRTGTLTNFLKVAQQLDFDP
FT                   QPLLRKLGLTKEMLADPECLIPGSASVTLLKESARLTQCPTFGLRVAERWQLSDLGVIS
FT                   VLLTHQSTLRDAVGTLIQYRHLLNEFLVIRMEDVGRKVIVREELVADEAGTSIQSTELV
FT                   LGSLSRLCSTLMGATWHPLSVHFTHDPPPDLRLHRRVFGGKLEFASSFNGMICRAADMD
FT                   FPNPIADPVMARHARRLLEGLPGAKEPSIVLEVRKAIYLLLPLGRATIEQVAQGLGMNV
FT                   RMLQRQLESAGMVFSDMVNGVRRDLVIHYMDNKSYTLGRIAQSLGYSAYGSFVRWFAAQ
FT                   FGMTPTRWQSLRQQKEDGRSPIQIHC"
FT   gene            532354..533412
FT                   /locus_tag="Reut_B3902"
FT   CDS_pept        532354..533412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3902"
FT                   /product="Protein of unknown function DUF849, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3902"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63259"
FT                   /db_xref="GOA:Q46UC5"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63259.1"
FT                   /translation="MNFLDGHLFPENQQPLIITAAPYAPSWMPSDFPEDIAVTMEDQIQ
FT                   KAVDCYNAGATVLHLHVRELDGKGSKRLSKFNELIAGVRARVPEMIIQVGGSISFAPES
FT                   EGAAAKWLSDDTRHMLAELEPTPDQVTVTVNTSQMNILEQFDHRDIVGSSMEDPEVFNA
FT                   YKEMTVPAQPGWVEEHVRRLTAAGIQSAFQCYNLNSFESVERLMRRGIYKGPLVLNWVA
FT                   IGGGMDSPSVYSLANFVRAVPDGAVLTVESSVCNVLPVNTMGIAMGLHVRCGTEDTLWN
FT                   QTRTKKMGTVAQIEQLVRISEEMSRPIATARQAREMCRIGEFYDTVDETLQANGFAPNR
FT                   NGGQQGFLRKVA"
FT   gene            complement(533503..533856)
FT                   /locus_tag="Reut_B3903"
FT   CDS_pept        complement(533503..533856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3903"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3903"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63260"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63260.1"
FT                   /translation="MTLKNHVTVTKPQEVTAMPATRIEMCDGDGDGVLAIRDDGAEFSG
FT                   VALDLSNTFGEDVVADLDKHQLLDWCERVAAHLRAQGVTPSAGAAGSYVNKTSQSHAKE
FT                   QPGVDDLVQSAAS"
FT   gene            complement(533956..534606)
FT                   /locus_tag="Reut_B3904"
FT   CDS_pept        complement(533956..534606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3904"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3904"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63261"
FT                   /db_xref="InterPro:IPR021549"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63261.1"
FT                   /translation="MADDAMQDTLMAWRESGADRVDPVRFRLIEAMARRAAAHSGDARR
FT                   LLDDRLAELVRAYGDAVGDAECPSDTASGAPRTPLPVRGALADVVDYIASRVQEPDAMP
FT                   ARSAATPRNTPRVEPGLIDYFRDTWTRVSAGQQLQQSLERVPEHAGPLNSSHLVHRSLT
FT                   LMREMSPEYFEQFLSYVDALTWLEQMSSGGAVASKEAPRAGVVKKATRARTRK"
FT   gene            complement(534599..535246)
FT                   /locus_tag="Reut_B3905"
FT   CDS_pept        complement(534599..535246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3905"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3905"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63262"
FT                   /db_xref="GOA:Q46UC2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63262.1"
FT                   /translation="MRDDIDAGVEPSVPAWAVFGDLMTVVLGAFVLILLGVIGAQMELT
FT                   ARLEKEAKQRQEEMQRRESLEKALAAPLAAGRVTLVNGRIGINGSVLFAINSDQLQPQG
FT                   RDVLKSLAGPLSAYLRSRDEILMVSGFTDDQQVRERNRRFADNWELSAQRALTVTRALI
FT                   DAGIPAASVFSAAFGAEQPVTSNADEAGRARNRRVEIAPVPRVSMGTAKPHG"
FT   gene            complement(535243..538380)
FT                   /locus_tag="Reut_B3906"
FT   CDS_pept        complement(535243..538380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3906"
FT                   /product="Protein of unknown function DUF802"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3906"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63263"
FT                   /db_xref="GOA:Q46UC1"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63263.1"
FT                   /translation="MTRPITHIVVFLAGLAVVGWIGAGYAGTNALALAVTLLIGGFYLA
FT                   GAFELKRYRQATSSLAQAIGGLTESPARLAGWIEPLHPSLRNAVRLRVEGERTALPGPA
FT                   MTPYLVGLLVLLGMFGTFLGMVATLRGTGIALEGAADLDAIRASLAAPVKGLGFAFGTS
FT                   VAGVATSAMLGLLSALCRRERIETAQALDARIATTLRPFSRAHQRDEAFQLLQRQADVM
FT                   PTLVDRLQAMMTTMEQQHQAMSDRLAASQAAFHDRTDAAYGRLADAVQQSLTQSIADST
FT                   RTASAAIQPAVEATMAGIARETAALHTTVTDAVKQQLDGLSTRFEATTATVADLWQQAL
FT                   AGHQRTSEAQASDLRATLDGFAQTFDQRSAGLLESVATRLDATAASAAGAWNDALARQA
FT                   SLGEKMAGDNRQAVANAAAAFEQQAASLVQAVARTHADLKQELSAQDAQRLQTWADTLG
FT                   AVAATLRSELEQASARSASHQQETAATLAQTARDISAEARTHASSTIAEIDRLVQAAEL
FT                   APKAAVALQEELASRDQQRLTAWTEALAGMAATLRAQMEQANASAAGHQQQITETLAQT
FT                   ARDMSAEARTHASTTIAEIDRLVQAAELAPKAAVALQEELASRDQQRLTAWTEALAAMA
FT                   ATLRTQMEQAGTNAAEQQQRITETLAQTARDMSAEARTHASTTIAEIDRLVQAAELAPK
FT                   AAVALQEELASRDQQRFTAWTEALATMAATLRTQMEQAGEQSSDRHQAITEALAQTARD
FT                   ISNEARTHASSTIAEIDRLVQAAELAPKAAVALQAEIVAREEQRMAAWTETLSAMASSL
FT                   RQEWEQTTAQTVSRQQDICDTLAQTTRDISAQTHAQASHTIAEVSRLVQAATEAPKAAA
FT                   EVIAELRQKLTDSMARDNAMLEERSRLLETLGTLLDAVNHASTEQRVAVDSLVTTTAGL
FT                   LDRVGTRFHEQVESETGKLATVAAQVTGSAVEVASLGEALGVAVQVFSESNDKLMAHLE
FT                   RIETALDKSMTRSDEQLAYYVAQAREVVDLSMRSQKQVLEDLQQLAGQQASNAEAA"
FT   gene            complement(538391..539122)
FT                   /locus_tag="Reut_B3907"
FT   CDS_pept        complement(538391..539122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3907"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3907"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63264"
FT                   /db_xref="InterPro:IPR021783"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63264.1"
FT                   /translation="MLQAPRRAGFSGPTLIRLLVRLTGDDAPESGQSLSDQLGQWLGWT
FT                   DAIALSAALNGNPPAAAGARAGGTEQADCARIRAALTAAIADDKAGSNRQRGRPRPAAP
FT                   EPAEAVVDYAAFRQRYVTLQQTMETEIGSLRGRLRTTLAARGAGMTRLSMVDAVMERVL
FT                   GAREQALLATVPGMLEAHFTRLRQAEEAALANAQTAGKPAPVSSGAWLTVFQNDMQSVL
FT                   RAELDIRFQPVEALLAALRDS"
FT   gene            complement(539278..541074)
FT                   /locus_tag="Reut_B3908"
FT   CDS_pept        complement(539278..541074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3908"
FT                   /product="Cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3908"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63265"
FT                   /db_xref="GOA:Q46UB9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63265.1"
FT                   /translation="MTLLILAYLGGALTILSPCILPVLPFVLSRTGQPFLRGRLPMLAG
FT                   MALTFAVVASLASAGGAWAVRANAYGRIGALALLALFGLSLLLPKVADTLARPAVALGN
FT                   RLAGRAGSNGEASASPWGSLLLGIATGMLWAPCAGPILGLVLTGAALNGASVSTSLALA
FT                   AYAAGAATSLAAALGLGGRVFAAMKRSLGASEWLRRGLGAGVLGSVVIIGLGADTGLLA
FT                   RWSASGPARLEQALVDALHKDRPAPQAANEVPAPGNGMLLAANDTRVGFPTPLPALPVE
FT                   GRLPALDGAVQWLNSPPLSREQLQGKVTLVYFWTYSCINCIRTLPYLRAWADKYKDQGL
FT                   TVVGVHTPEFAFERSTDNVRRAVADFRIGFPVAVDSDYRIWRAFHNSYWPAAYFVDARG
FT                   NIRHHQFGEGDYAKSERVIQTLLTEAGSRAVAGDVVSPDAAGAQAAPDLHNVRSEETYI
FT                   GYSQATNFASPGEVRPDASRQYTVGKLLLNEWGLSGQWTVGPEQATLDRADGTIRYRFH
FT                   ARDLHLVLGPAANGQAVRFVVTIDGKPPGKSHGADTDAGGNGAVTQTRLYQLVRQAGEV
FT                   GEHTFEIRFLDAGAQAYAFTFG"
FT   gene            541271..542014
FT                   /locus_tag="Reut_B3909"
FT   CDS_pept        541271..542014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3909"
FT                   /product="Response regulator receiver:Transcriptional
FT                   regulatory protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3909"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63266"
FT                   /db_xref="GOA:Q46UB8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63266.1"
FT                   /translation="MDAHVDHILIVDDDREIRELVSTYLTKNGLRTTVAPDGRHMRAFL
FT                   EANTVDLIVLDVMMPGDDGLVLCRELRAGKHKATPILMLTARDDETDRIIGLEMGADDY
FT                   LAKPFAARELLARIKAVLRRTRMLPPNLQITEAAQVLAFGDWELDTTARHLIDRDGTIV
FT                   ALSGAEYRLLRVFVDHPQRVLNRDQLLNLTQGREAEMFERSVDLLVSRLRQRLNDDARE
FT                   PKHIKTVRNEGYVFSMPVEIREARQ"
FT   gene            542011..543318
FT                   /locus_tag="Reut_B3910"
FT   CDS_pept        542011..543318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3910"
FT                   /product="ATP-binding region, ATPase-like:Histidine kinase,
FT                   HAMP region:Histidine kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3910"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63267"
FT                   /db_xref="GOA:Q46UB7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63267.1"
FT                   /translation="MTLTLPRWEWPRTLGARLFLILLAGLVVAHGLSFGVLFAERYISA
FT                   RQVMLGTLETDVATSVAILDRLPASERPQWLPRLNRGNYQYILGPGLPGVPEMTQRGQD
FT                   IADRIMGAGGGRFAVRVESIPGDGKRLQAHLTLSDGSPLTIDVHPRMTPIAQWLPYVLV
FT                   IQLLLLVVCCWFAVRLAIRPLVKLADAADALDPNAKTPPLEENGPTELARAARAFNAMR
FT                   ERIARFVEERVQILAAISHDLQTPITRMKLRAEMADDSEEKRKMVNDLAEIETLVKEGL
FT                   AYARSAHGGGEKMLRIDLCSFVESLVYDYQDTGKDVTVQQSVGCAIETRPQALRRILTN
FT                   LIDNAIKFGGAAELNVRRDQDAVVIEVLDRGAGIPEDKLESVLQPFVRLENSRSRETGG
FT                   TGLGLAIAQQLAVAMGGSLRLRNREGGGLAAEVRLG"
FT   gene            543508..544077
FT                   /locus_tag="Reut_B3911"
FT   CDS_pept        543508..544077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3911"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63268"
FT                   /db_xref="GOA:Q46UB6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63268.1"
FT                   /translation="MRTLFRAALAAALLVTVYLFGTGFSAYSSPAVGDQGKAPEFTEID
FT                   HWLNSPPLTMQSLRGKVVLVDFWTYSCINCINTLPYVKQWHEKYKDQGLVVVGVHTPEF
FT                   PYEKSTANVQEAIRRFDIRYPVAQDNAYGTWSAFHNRYWPATYLIDADGRIVYQHYGEG
FT                   RYAETEAAIQKLLAQRKSQPEQPKSK"
FT   gene            544449..545465
FT                   /locus_tag="Reut_B3912"
FT   CDS_pept        544449..545465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3912"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3912"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63269"
FT                   /db_xref="GOA:Q46UB5"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63269.1"
FT                   /translation="MKAIGLTRYLPISDPDSLVDIELETPAASGHDLLVKVEAIAVNPV
FT                   DTKVRAPKPQVEPNPRVLGWDAAGTVVAVGPDVSLFKVGDPVYYAGSITRPGANAEYHL
FT                   VDERIAGHKPASLDFAHAAALPLTAITAWEALFDRLGVSPKGDDAGKSVLIIGGAGGVG
FT                   SIGIQLAKTLAGLTVIATAARPESQAWCRRLGADHTVDHRSDMAAQLKALGFAQVDYIL
FT                   CFNDTDGHFPVMADLIAPQGKICTIVENAAPLPVERLKSKSAAFVWEFMFTRAMFGTPD
FT                   MIAQHRLLNEVARLVDAGRLQTTVGEHLGAINAANLRRAHAMLEGGKTIGKLVLEGF"
FT   gene            complement(545548..545841)
FT                   /locus_tag="Reut_B3913"
FT   CDS_pept        complement(545548..545841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3913"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3913"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63270"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63270.1"
FT                   /translation="MTRYLVLANFTDQGIRSVKDTTKRAAAVREMGAQLGVQMKEIYWT
FT                   LGAYDLALVVEAQDDDAMTAFGLTVGALGNVRTQTLRAFNADEMQGILGKMR"
FT   gene            complement(546132..546644)
FT                   /locus_tag="Reut_B3914"
FT   CDS_pept        complement(546132..546644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3914"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3914"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63271"
FT                   /db_xref="GOA:Q46UB3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63271.1"
FT                   /translation="MVNPEFGDDIAPNARMELANRLFFRLYQCANMLHKTGSRAVEAEG
FT                   LTTQQWAVLGALSRPEAANGMSVGDLAHYLMVSRQNLSGLVSRMERDGHVSLAPDARDR
FT                   RSRLVRMSETGREVWLHQAQPKIRDYYERALEGFSTNDLTHTLHYLLKLLDNMRALDTG
FT                   AADSESD"
FT   gene            546781..547548
FT                   /locus_tag="Reut_B3915"
FT   CDS_pept        546781..547548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3915"
FT                   /product="2-hydroxycyclohexane-1-carbonyl-CoA
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3915"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63272"
FT                   /db_xref="GOA:Q46UB2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR017619"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63272.1"
FT                   /translation="MQGLKGKTVIVTGGGGGIGGATCLRFAREGAAVAVLDLSAEAARK
FT                   VADRIAETGGKALAIACDITDRASVDLAVAAVREGLGPVDVLVNNAGWDVFRPFTKTEP
FT                   AQWERLIAINLTGALHMHHAVLPGMVERKQGRIVNIASDAARVGSSGEAVYAACKGGLV
FT                   SFSKTIAREHARHGITVNVVCPGPTQTALFEDYKQGAGNPEKLMEAFTRSIPLGRIGQP
FT                   DDLPGAITFFASDDAAFITGQVLSVSGGLTMNG"
FT   gene            547597..548379
FT                   /locus_tag="Reut_B3916"
FT   CDS_pept        547597..548379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3916"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3916"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63273"
FT                   /db_xref="GOA:Q46UB1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR017623"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63273.1"
FT                   /translation="MQYEDILYEVRNGAAWITINRAEKMNAFRGRTCDELIHAINRAGY
FT                   DREIGTIVLAGAGDKAFCTGGDQSAHEGQYDGRGTIGLPMEELHNAIRDVPKPVIARVQ
FT                   GYAIGGGNVLCTICDFTIASEKAVFGQVGPKVGSVDPGYGTAYLARVVGEKKAREIWYL
FT                   CRRYPAAEALAMGLVNAVVPHEQLDAEVQKWCDEILEKSPTAVAIAKRSFNMDTAHQSG
FT                   IAGMGMYALKLYYDTEESREGVKAFQEKRKPEFRKYAK"
FT   gene            548409..549560
FT                   /locus_tag="Reut_B3917"
FT   CDS_pept        548409..549560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3917"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region:Acyl-CoA dehydrogenase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3917"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63274"
FT                   /db_xref="GOA:Q46UB0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR017620"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63274.1"
FT                   /translation="MNPYLNEDLQALAEHARRFADACIAPGFLERDKTRVLDRSLMRQM
FT                   GEMGFIGPELPEAYGGQGMGCLAAGVIHEAVARADLSMSYVNLLASLNGQILAQHALPE
FT                   VGRPWLQRLTRGEALFAIALTEPRGGSDAGSLRLRMERVGDSYVLNGEKTSISAADQAD
FT                   AAVVFARTGSVEDGARGISAVLVPMDLPGVTRNRFDCHGQRAIGRGSIFFENVRVPADH
FT                   LLGTEGQGFVQVMQGFDFSRALIGLQVLAVAQAALDETWEYVAERQAFGKPLSAFQGVS
FT                   HPLADFETQVTAARLLCLQTLWLKDHGLPHTSEAAMCKWWAPKLAYDVVHQCLLSFGHG
FT                   GYDRGVMEQRLRDVLGFQIGDGTAQIMKTIIARHRAGRAAVPA"
FT   gene            549609..551258
FT                   /locus_tag="Reut_B3918"
FT   CDS_pept        549609..551258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3918"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3918"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63275"
FT                   /db_xref="GOA:Q46UA9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR017621"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63275.1"
FT                   /translation="MDFDAVLIAPRRAASVAAGLWRDRTINDYFDATVARAPDGPALTS
FT                   LQVESGAVRHFTWRQLDAMVTRIAVGLRRLGIERNDVVSCQLPNGWEVTALYLACARIG
FT                   AVLNPLMPIFRERELSFMLAHADSKVVVVPQRFRGFDHAGMLAGLRDSLPALRHVVITG
FT                   SDGPDGFEAMLCGADRDSDPDAAAILRRDRPSPDDVTQLIYTSGTTGEPKGVMHTANTL
FT                   LSNILPYAERLRLGAGDVVLMASPMAHQTGFMYGLMMPVVLGAHAVLQDIWNPVQAARL
FT                   IRETGVTFTMGSTPFLTDLARTVEESGQPVPSLRTFLCAGAPIPGALVERARTALGASI
FT                   VSAWGMSENGAVTTTLPDDSEERASTTDGLPLPGVEVKVVDAQDASVLAGEVGRLLVRA
FT                   CSNFGGYLKRPQLNATDAEGWFDTGDLAKLDAEGYVRIAGRSKDVIIRGGENIPVVEIE
FT                   TLLYRHPAVAQVAIVAYPDERLGERACAVVVPRQGQGFDKPAMVDFLKAQKVALQYIPE
FT                   RLIVQDALPATPAGKIQKFRLREMLREQAAER"
FT   gene            complement(551340..551663)
FT                   /locus_tag="Reut_B3919"
FT   CDS_pept        complement(551340..551663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3919"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3919"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63276"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63276.1"
FT                   /translation="MFLVSNDMTATLPARTSLRVVADPGERVAVRCTDGELWLIRDGDP
FT                   KDTSLAASESFTLAEASRVELYAVTAATLRVTRCRSGGATIRGWRGWYRRALNLVYPMQ
FT                   SSG"
FT   gene            complement(551680..552648)
FT                   /locus_tag="Reut_B3920"
FT   CDS_pept        complement(551680..552648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3920"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63277"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63277.1"
FT                   /translation="MRQGLSSSSPGTAVKRTAPALGALAALARLRWQAGSLINPAGTAR
FT                   ALERLWFGPPRGTPNGAALRLLDRARADWALVVGHGPSRRVRVYRWGNSGPVVLLAHGW
FT                   GGHAGQWHAVVDGLLAAGMRVVAFDALSHGASDAGVRGSTQTSVLEMSRSLLATAWHAG
FT                   PVHAVVAHSLGSAATALAIREGLPARAAVMIGPPADMHAACATMAWNLGIGPRVLARMQ
FT                   RDSEQWLGMPWSAFNVPDVGRARPVPPTLVIHDRHDREVRWEDGAAIAGAWPQAQLLTT
FT                   EGLGHRRILQDAGVIARIADFIGPAAARPLPGLALPDMALQ"
FT   gene            complement(552789..553394)
FT                   /locus_tag="Reut_B3921"
FT   CDS_pept        complement(552789..553394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3921"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3921"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63278"
FT                   /db_xref="GOA:Q46UA6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63278.1"
FT                   /translation="MQKGQLTRNAIIEQALDTAAKVGFEQLSLASLAADTNMSKSGLYA
FT                   HFKSKEALQQAVLELATDRFATMVVRPAMRQPRGVARMEALFEGYLEWLGGTVTQGRCL
FT                   FMALGQEYRDKPGAIRDQVVQSLKDWHSTIARVVADGIEEGEFAPDVDARQFAFDMVGI
FT                   GMSFQQSFKLLGRADAETMARRAFAGLLNRARQRAAAN"
FT   gene            553707..554063
FT                   /locus_tag="Reut_B3922"
FT   CDS_pept        553707..554063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3922"
FT                   /product="Helix-turn-helix motif protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3922"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63279"
FT                   /db_xref="GOA:Q46UA5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63279.1"
FT                   /translation="MPRGASEPFRQLRALRRARKLKQEDVARKAGISREAYLRAESGQA
FT                   DPRMSTFLAACEALGLEVVLAPQHLAADVNAFIASRNGGVTAASMAGQAAPSAPATAAS
FT                   PATGSFGSGTGEGH"
FT   gene            554382..555788
FT                   /locus_tag="Reut_B3923"
FT   CDS_pept        554382..555788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3923"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3923"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63280"
FT                   /db_xref="GOA:Q46UA4"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46UA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63280.1"
FT                   /translation="MHYAIRNSTFVLRISSSDRKLLTPDADPTMNLTHTQLAEHGYMSG
FT                   FANEFATEALPGALPVGQNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLYRIRPGAVH
FT                   KPFTLVEQSRFLSRFDEVPPSPNQMRWSPPAMPTTPTDFIDGIVTMAGNGGPDAMTGCG
FT                   IHLYLANQSMQDRFFYNADGEMLIVPQQGRVRFVTEMGRLDVEPQEIVVIPRGVRFRVE
FT                   LPDGEARGYICENYGALFKLPDLGVIGSNGLANPRDFMTPVAAYEDREGDFELVAKFQG
FT                   NLWRADIGHSPLDVVAWHGNFAPYKYDLRRFNTIGSISFDHPDPSIFLVLQSPSDTPGV
FT                   DTIDFVIFGPRWLAMENSFRPPWFHRNIASEFMGLITGVYDAKADGFAPGGASLHNCMS
FT                   GHGPDADTFAKATSADTSTPHHITDTMAFMFETPGVIRPTPYAARSASLQQDYYTCWQG
FT                   LKKHFNPNVR"
FT   gene            555867..557135
FT                   /locus_tag="Reut_B3924"
FT   CDS_pept        555867..557135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3924"
FT                   /product="fumarylacetoacetate hydrolase"
FT                   /EC_number="3.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3924"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63281"
FT                   /db_xref="GOA:Q46UA3"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63281.1"
FT                   /translation="MTAPITSWIESANDGKTHFPLQNLPYGIFSVKGQAARVGVAIGNA
FT                   VLDLAALDEAGLLPVAAKGTFAAASLNRFIALGKPVWSETRQRLTALLSGADAALRDNA
FT                   ALRDRALVPMDQVMLHLPVEIPGYTDFYSSKEHATNVGRMFRDPDNALLPNWLEIPIGY
FT                   NGRASSVVVSGTDLRRPNGQIKLPNEARPIFSACRKLDFELEVGFIVGKESALGEPVST
FT                   ADAPNYMFGMVLLNDWSARDIQQWEYVPLGPFNSKGFGTSISPWIVTMEALEPFRRDNP
FT                   EQSPQPLPYLQQQSKNAYDIALEVALRPQGAAAATTICRTNFKAMYWTMAQQLAHHTVS
FT                   GCNVRVGDLMGSGTISGTTPDSYGSLLELTRNGAEPLKLADGSSRAFLEDGDEVVMSGF
FT                   AAGDGYVVGFGAVSGKILPAPKA"
FT   gene            complement(557142..557537)
FT                   /locus_tag="Reut_B3925"
FT   CDS_pept        complement(557142..557537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3925"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3925"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63282"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63282.1"
FT                   /translation="MCLLDSVLDWDADFIRCQATSHRSVDNPLRAHGRLAAVCGVEYAA
FT                   QAMAVHGAVLQQGGERPRMGYLASVRKLALDVERLDDIDGPLTIEAHRVSGEGSNVLYA
FT                   FEVSGGGKRLLSGRAAVILDVAPPGAA"
FT   gene            complement(557605..558432)
FT                   /locus_tag="Reut_B3926"
FT   CDS_pept        complement(557605..558432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3926"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3926"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63283"
FT                   /db_xref="GOA:Q46UA1"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63283.1"
FT                   /translation="MTMRTPLIAFIDGIGVLGPGLSGWAQANEVLAGRQPYEPAATELA
FT                   PPDILPPAERRRSGTAVRLALGIGQQAVAASGMEAADLPTVFTSSSADGHNFHAICEAL
FT                   AQPEPLMSPTRFHNSVHNVAAGYWSIATRAMRPANVLSALDASFSAGLLEAAAQVSADQ
FT                   EPCLLIAYDSDYPEPLRTLRPIAAPFGVAMLLSPHRSGRSLAQIEVGLAQAPATPMDDA
FT                   ALEHLRRSVPTARALPLLHAVAVQSTGTVVLDYLEDLQLQVTVQPQTQRGTGE"
FT   gene            complement(558429..559679)
FT                   /locus_tag="Reut_B3927"
FT   CDS_pept        complement(558429..559679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3927"
FT                   /product="Beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3927"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63284"
FT                   /db_xref="GOA:Q46UA0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q46UA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63284.1"
FT                   /translation="MRLDTMAAPRVSHSTHSVSPLHLSHFTATSCIGTGLDDTVSALRE
FT                   QRGGLAPCQFGDIRLDTWVGEVPGVDSVTLPPGLADFACRNNSLALLALEQDGFADRVR
FT                   EAVARYGADRIGVFLGTSTAGVLQTELAYRQRDPQTGALPAGLSYAGTHSPYSLPGFVR
FT                   AYFGLQGPANAVSSACSSGAKVFTSARRLIEAGLIDAAVVGGVDSLCHTTLYGFGSLEL
FT                   LSNQPCRPFDADRNGISIGEAAAFVLVERTPDPAPDGAILLLGIGESSDAHHMSAPHPE
FT                   GLGASMAMEQALTRAGVSPEQVDYVNLHGTATRANDATEARAISALLPGTPCSSTKGAT
FT                   GHTLGAAGALEAVISALALRHGLLPAGINTTQIDPALAVDYCLATREQPLRHVLSNAFG
FT                   FGGSNCSLLLGRATGAQ"
FT   gene            complement(559669..560538)
FT                   /locus_tag="Reut_B3928"
FT   CDS_pept        complement(559669..560538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3928"
FT                   /product="Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3928"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63285"
FT                   /db_xref="GOA:Q46U99"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63285.1"
FT                   /translation="MKTSDMNPTAQHGPMPPAARRWRPGMLLYGAGVVHAGAAAAVLAN
FT                   PATLGLAAASVGATHAALATVGLWPRSTWLGPNVLRLPANAGNSVALTFDDGPHPDMTP
FT                   RVLDMLDRHGARATFFCIGERAARYPDLVREIARRGHTVENHSMHHRLDFSLFGPWRMR
FT                   REIRAAQQLLTEITGQPPRYFRAPAGLRNLFLEPVLCAEGLQLAAWTRRGYDTRNGDHA
FT                   ARVAQRLMRNLAAGDILLLHDGNSGVDTAGKPHCTTVLPKLLATITDAGLRCVTLRAGM
FT                   AAWDLHAA"
FT   gene            complement(560525..562963)
FT                   /locus_tag="Reut_B3929"
FT   CDS_pept        complement(560525..562963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3929"
FT                   /product="Phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3929"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63286"
FT                   /db_xref="GOA:Q46U98"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63286.1"
FT                   /translation="MMPAPRGGSRTTALPWARLAVALWLAWLLACAAVVARTGFTADLS
FT                   AFLPRMPSAEQQLLVDQLREGLVSRLILVGVEGGDADGRAAVSRTMAARLRQDARFSAI
FT                   TNGEPVNQAADQRYVYNHRYLLSPTVTPERFSQQGLSAAVGETFDLLASPAGLFTKSLL
FT                   PRDPTGEVMSMMGQLDAQQRVPMHAGAWVSHDGKRAVLLAQTASAGSDTDGQARAIDAI
FT                   HGAFADAAKAGPYRLVMTGPGVFSVKARDTIRHDVERLSAIGIAIIITLLLVVYRSVPL
FT                   LVLGLVPVLSGALAGIAAVSLGFGGTVHGLTLGFGTTLIGEAVDYSIYLFVQSAQYTRN
FT                   GQRDNRAWIAGFWPTVRLGVLTSVCGFASLLLSGFPGLAQLGLYSIAGLATAALVTRFV
FT                   LPHLVPANLHLRDVTPLGHRLAALLARASRLRWLVAVAAIAACAVLWARHDSLWGRELS
FT                   ALSPVAASEQALDASLRADLGAPDVRYLVVLSGPDQESVLRDAERVARELDPLVASDVI
FT                   GGYESPARYLPSAATQRARQASLPPPEELSQRLRTAISQQPVRPELFAPFLAEANQART
FT                   APLLQRQDLKGTSMALAIDALLTQRGDHWNATLPLRAPANAKSTDVLDSQPIRAALARA
FT                   GAGHALFVDLKRESDQLYGGYMREALHLSLGGVVAILVLLSVALRSPRRVLATVLPLAA
FT                   AALAVMGGLAALGQPLTLLHLVGLLLLVAVGSNYALFFNGAAGSGPATAISAHTLVSLL
FT                   LANMTTVAAFGLLALSDLPLLKAFGLTVGPGAVLALCFSAILAPTPANASGSSWNDEDV
FT                   "
FT   gene            complement(562960..563568)
FT                   /locus_tag="Reut_B3930"
FT   CDS_pept        complement(562960..563568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3930"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3930"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63287"
FT                   /db_xref="GOA:Q46U97"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63287.1"
FT                   /translation="MRRIRLILPALLLAAAMLPGMAGQALAADSGSSAWGVDQLMSALA
FT                   QRKSGRVQFTETKYLAILDRPVESSGELVFTAPDHLEKRTVTPKPENLVLDGDMMTVER
FT                   GGKRFTMPLQNYPEIAAFIESIRGTLAGNRTTLERYYKLGLQGRASRWTLTLTPADSRM
FT                   AAMVTQVRIEGAHDGLDSVEIRQADGDRSVMKIRPAGKP"
FT   gene            complement(563572..564543)
FT                   /locus_tag="Reut_B3931"
FT   CDS_pept        complement(563572..564543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3931"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3931"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63288"
FT                   /db_xref="GOA:Q46U96"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63288.1"
FT                   /translation="MLTWLRKPQPLDTDWSSRQERSNVTLMRVMTWISLALGRPAGRVV
FT                   LRLIAAYFTLFSPTARHASRAYMDRALGREAGWMDGFRHVFTFASTIHDRIYLLNGRFD
FT                   LFDIRLHGEKQLEQTIARGQGAFLMGAHLGSFEVIRAMGRKHPDMRVAITMYEENAHKL
FT                   NDVLQSINPAMRRDMITLGKVDAMLRVRDYLDRGYMIGMLADRTLSQRATDPVQQCDFL
FT                   GAPTGFPTGPLRMAAMLRRPVFFITGLYRGGNRYDVHFVPLADFSQVARGRREAEVQAA
FT                   LQRYVALLEQFCRSAPYNWFNFYDFWHAGPPLSEQPPPGNEP"
FT   gene            complement(564537..566249)
FT                   /locus_tag="Reut_B3932"
FT   CDS_pept        complement(564537..566249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3932"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3932"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63289"
FT                   /db_xref="GOA:Q46U95"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63289.1"
FT                   /translation="MTSTFALLSHPDPDSVVAWRGSQPVTASRFLADVHALAARLPPGD
FT                   HVFNACADRYRFAVGLCASLLCGKVSLLPSAQTPETVRQLAAFAPDVFCLYDDADGSVA
FT                   LPRFFYDASEPEPSAPLPVPDIPAERLMAYVFTSGTTGQPVAHAKTWGAMVRGARATAQ
FT                   RLGLADGRAWTLVGTLPPQHMFGLEATVMLALQGSAALASVRAFYPADIRAALRDVPQP
FT                   RALVTSPVHLRALLQSDSDLPAADLVLSATAPMSRAMARQAQAGLAAPLLEIYGSTETG
FT                   AMATRKTADTDEWTLLPGITLESRSDHAGDGESEPAIRVRGGHIDEPVALGDAIAPLDA
FT                   GRFVLHGRKADMIKIAGKRTSLAYLNQQLTAIDGVQDGTFYVPDDVHEVEAAGRVVRLV
FT                   ALAVAPGVPAARILQELRERIDAAFLPRPLCLVDRLPRNAAGKLPREALAPLVAAQLAQ
FT                   RHAPGFVIDAGHPAIAGHFPGNPVVPGVVLLDHAILQIGAALGQPLAVAQVGTVKFLSP
FT                   VRPGERVEVAHQLHGDHAGTASIRFTLRAGGRDVASGTLSTRATLASREASPC"
FT   gene            complement(566263..566973)
FT                   /locus_tag="Reut_B3933"
FT   CDS_pept        complement(566263..566973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3933"
FT                   /product="probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3933"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63290"
FT                   /db_xref="GOA:Q46U94"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63290.1"
FT                   /translation="MPSSQPSHPVVPSSAATPLLQRAGWVAAPVGFLAYESALHHAAHT
FT                   PGSEVPALMLGLAPFVLIALAAAWRATWRLPWLVLVTACGVALWVARIPLAAHFGWTYF
FT                   LQHFGANTALAAMFGRTLRAGATPLCSEFAAAIHGPLTPDMQRYTQRVTQAWTLFFGAT
FT                   ALASLVLFAVAPMSTWSTFANLGTPILIALMFVAEAACRRALLPAAKDTGVLDAVRGYR
FT                   TVMTERASRAGASR"
FT   gene            567155..567487
FT                   /locus_tag="Reut_B3934"
FT   CDS_pept        567155..567487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3934"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3934"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63291"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63291.1"
FT                   /translation="MPGFGSIASPSSGVTYERKKTFTTMNELDTELASLIIGELDIADL
FT                   KLEDVSADTPLYGDGFGLDSIDILEIALLVSRKYGVELRSDNPDNKTIFASLGSLAAYV
FT                   AANRTR"
FT   gene            567539..568288
FT                   /locus_tag="Reut_B3935"
FT   CDS_pept        567539..568288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3935"
FT                   /product="NAD-dependent epimerase/dehydratase:Short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3935"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63292"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63292.1"
FT                   /translation="MAQQGRPQATRRLALVTGASGAIGSAISHALAAAGNEVWVHANRN
FT                   LAQAEAVAATIRAAGGASTAIAFDVTDADATEAALQRVLQHGTVQILVNNAGIHDDAPL
FT                   LGMSRDQWRRVIDVSLHGFFHVTQPLLMPMMRTRWGRIINMASVAGVMGNRGQANYAAA
FT                   KAGLIGATRSLAIEMASRGVTVNAVAPGVIESPMTELAFPAERIRQIVPAGRAGTPDDV
FT                   AGMVAYLASDAAAYVTGQVLSVNGGMA"
FT   gene            568304..569104
FT                   /locus_tag="Reut_B3936"
FT   CDS_pept        568304..569104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3936"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3936"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63293"
FT                   /db_xref="GOA:Q46U91"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63293.1"
FT                   /translation="MAPQPSPTHLLLIPSYNPGAKLRETLRAARAAWCPVWVVVDGSTD
FT                   DSTQWLQQQAREDSGLRVLVLPENQGKGAAVLHGIEAAAAEGFTHALVMDSDGQHPAQL
FT                   IAQFMAASMREPDAMVLGRPIFDASAPVERVYWRRVSNFWTDVETLWAGIGDSLYGFRV
FT                   YPIEPLRAVMRESRWMRRFDFDPEVAVRLCWRGVRPVNLDAPVRYFDPRAGGVSHFRYL
FT                   RDNLLLGWMHLRLVTGWLVRLPRLLWRRLHAAADGNSRPPNRAT"
FT   gene            569268..569771
FT                   /locus_tag="Reut_B3937"
FT   CDS_pept        569268..569771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3937"
FT                   /product="Cupin region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3937"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63294"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR028013"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63294.1"
FT                   /translation="MKAHSSEHAARQAWLAAAILALLAAAGPANAQEPAAAGMEMINPD
FT                   AVKWGDAPASLPKGAKLAVLYGDPGKDVPFVIRLKTPAGYKVPAHWHTQAENLTVISGT
FT                   LYLGAGDKMDMAHAHALKTGGFHYLPAKAHHYAFSKTETVVQIHGTGPLDIHYLDPKDD
FT                   PSAK"
FT   gene            570052..571422
FT                   /locus_tag="Reut_B3938"
FT   CDS_pept        570052..571422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3938"
FT                   /product="General substrate transporter:Major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3938"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63295"
FT                   /db_xref="GOA:Q46U89"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63295.1"
FT                   /translation="MRQIDVYAVADGATFNRFHAGVLFWCALIIIFDGYDLAVAGIALP
FT                   AIMKDMGVSATHAGFMVSSALFGMMFGAIFLGTIADRIGRRKAIAICILLFSVFTAAAG
FT                   MTSDPMLFAASRFLAGLGIGGVMPNVVAQMTEYSPRRIRGTLVTLMFSGYSVGGMLAAL
FT                   LGKQLLEQYGWQSVFLAAGAPALLVPLILSKLPDSMPFLLRTGQNDTVRKILRAIDPAN
FT                   PCKDGDRLVLPDASTGGQAAVGELFREGRGFSTLMFWLAFFMCLFMVYALSSWLTKLMA
FT                   SAGYSLGSALTFVLVLNIGGMLGAIGGGWLADRFSIKYVLMGMYALAAVSIALLGYKVP
FT                   TPVLFLLVGLAGASTIGTQIVTYAYAGQFYPVAARSTGIGWASGVGRAGAILAPIVIGV
FT                   LVGMALPLEQNFLAIAVPAVVAVLAVGGIDHRRAASVGAVPSEQVAPKVYAASRAEG"
FT   gene            complement(571429..572877)
FT                   /locus_tag="Reut_B3939"
FT   CDS_pept        complement(571429..572877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3939"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3939"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63296"
FT                   /db_xref="GOA:Q46U88"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63296.1"
FT                   /translation="MTGAPRPMTRYEELAEDIAQSIHAGVLRLGDRLPSVRQASTGRGV
FT                   SQSTVFQAYYLLEARGLIRARERSGYYVATGSRQLAPEAETPSAPVQESGPVDVSELVF
FT                   KVLESTMRRDVVPFGSAFPSPLLFPMQRLAKTMATTVQKLDPWSSVDDLTPGNANLRRQ
FT                   IALRYLADGLTVQADEIVVTNGALEALNLCLMAVTRPGDAVVIESPTFYAALQALERCG
FT                   LSAIEVPTHPREGIELGALEQALERHRPKACWLMTNFQNPLGSLMPDAKKQALVELLAR
FT                   YEVPLIEDDVYGELYFGTRRPTPAKAFDKAGLVMHCASFSKCLAPGYRVGWAAPGRFAR
FT                   DVARLKLTTTLAGSAPAQVAIAAYLEKGGYDRHLRQLRHALMLRQDAVAQAVARHFPPG
FT                   TRATRPAGGYFLWIELPEDTDTLALQQLALSHGISIAPGPIFSARHSFRNCLRLNYGHE
FT                   WDKRAETALATLGRLAGAVAGTRS"
FT   gene            complement(573063..574769)
FT                   /locus_tag="Reut_B3940"
FT   CDS_pept        complement(573063..574769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3940"
FT                   /product="Nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin-like:Nitrite and sulphite
FT                   reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3940"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63297"
FT                   /db_xref="GOA:Q46U87"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63297.1"
FT                   /translation="MYLYDSTDQQLVDERVTQFTDQTARFLSGDLTEDEFRILRLQNGL
FT                   YIQRHAPMLRVAIPYGMLVSRQLRKLAEISRRWDRGYGHFSTRQNMQFNWPRLEDAPAI
FT                   LAELATVQMHAIQTSGNCIRNTTTDHFAGIAPDEVVNPLVWCEIIRQWSMLHPEFAFLP
FT                   RKFKIAVSGATTDRAAVGVHDIGLQAVERDGETGFRVWVGGGMGRTPMVGKEISGFVHW
FT                   SDLLTYLQAILRVYNLHGRRDNKYKARIKILVKDLTPEVFAQQVHEHWQPIRGGPDTVD
FT                   ADFVRDIATRFTTPDYDAAAAQDHDPNPALAAANPRFARWLRSNVHAHRVPGYAAVTVS
FT                   LKATGTPPGDITADQMEAAADLADHYGFGELRVSHEQNLIIADVRRTRLHELWQQLQTW
FT                   NLATPNIGLLTNIIACPGGDFCSLANAVSIPLAEAIQQRFDDLDYLYEIGELDLNISGC
FT                   INSCGHHHVGHIGILGVDKAGEEWYQVTLGGRQGGPSGAAIGRIIGPSFARDEIPEVVE
FT                   ELIKRYIAMRDSEAERFIDVVERVGIEPFKVAVYQNPVIAKRRLEAEAARV"
FT   gene            complement(574909..575472)
FT                   /locus_tag="Reut_B3941"
FT   CDS_pept        complement(574909..575472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3941"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3941"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63298"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63298.1"
FT                   /translation="MKHTRTPSRRRFLQHTGGLAIGAGLAALSPQLALANVSGARSLSF
FT                   DHTHTGEHLQLVYALGDQVLPQAQTTLNHFLRDHYSGQVGVIDPQLFGLLFELRRTLGS
FT                   ESPFQVISGYRSPVTNARLRLTGGGGVAKHSLHMDGKAIDIRLPGVALADLRDAAMSLG
FT                   VGGVGFYAREDFVHVDTGRVRHWG"
FT   gene            complement(575469..577142)
FT                   /locus_tag="Reut_B3942"
FT   CDS_pept        complement(575469..577142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3942"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3942"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63299"
FT                   /db_xref="GOA:Q46U85"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63299.1"
FT                   /translation="MTPATTPDTRLSATPASHARHWIGGTLAAWLLACAASAAAQPLWF
FT                   ASGRPTPDAQQAVSALASAQTDGLVPQDYDADGLKRALAEAATGPQPAQDAIDKLDNTL
FT                   SDAMRRYLSDLHSGRVDPRKVHANFTAPPSTAFEPDSYLRAAVAGHRLPEAIREAAPSF
FT                   PLYGTLRDALAHYRTLAAQPGWDRTLPALPGGKLTSGQAYSGLAEMARRLQALGDMPAD
FT                   APAPKRYSGAVVDGVKAFQARHGLEADGVIGAGTLAQLNTTPAARVRQIELTMERLRWT
FT                   PLTDSPRMIVVNIPEFMLRAYDYNGGKLDIKLEMKVIVGKALDTRTPLFKEDMRYIEFS
FT                   PYWNVPPSIARSETIPRLRRDPAYFTQQGFEFVSNGKAVTTLSDANLDAVLNGRMRIRQ
FT                   RPGPMNALGDIKFVFPNNQNIYLHHTPTPQLFKRDRRDFSHGCIRVEEPVALAKFVLQD
FT                   MPGWTEERIRQAMTKGQSNTVALQQPLPVVLAYGTAIARADGRVYFLPDIYGQDKLLDQ
FT                   ALSQKTARRPASVPASAPAAPATPATPDALARPAPTQNPT"
FT   gene            complement(577360..577536)
FT                   /locus_tag="Reut_B3943"
FT   CDS_pept        complement(577360..577536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3943"
FT                   /product="Rickettsia 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3943"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63300"
FT                   /db_xref="GOA:Q46U84"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63300.1"
FT                   /translation="MWKIAVALLVSAGMGLAGCTAAGAVAGGVAGHELSHGSTAGTVGG
FT                   AVVGGVVGHELGK"
FT   gene            complement(577681..578556)
FT                   /locus_tag="Reut_B3944"
FT   CDS_pept        complement(577681..578556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3944"
FT                   /product="NADP oxidoreductase, coenzyme
FT                   F420-dependent:6-phosphogluconate dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3944"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63301"
FT                   /db_xref="GOA:Q46U83"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63301.1"
FT                   /translation="MRVAFLGLGVMGFHMAGHLAAKGHEVTVYNRTAAKAQAWVEKFGG
FT                   KAADTPAQAVRQADVVCSCVGNDDDLRSVLTGPDGAFFAAPTGCIFVDHTTASANVARE
FT                   LYAAARERGLHFVDGPVSGGEVGAEKGILTIMCGGDADVYARVEPVIAAYARAVTRIGE
FT                   AGAGQLAKMVNQISIAGLIQGLSEAIAFGERAGLDMKLVLDVISKGAAGSWQLENRGPT
FT                   MIENKFDFGFAVDWMRKDLGLCLDEARRNGASLPVTATVDQFYADLQQMGCGRSDTSSL
FT                   IKRLRRFSQN"
FT   gene            complement(578708..579283)
FT                   /locus_tag="Reut_B3945"
FT   CDS_pept        complement(578708..579283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3945"
FT                   /product="regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3945"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63302"
FT                   /db_xref="GOA:Q46U82"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63302.1"
FT                   /translation="MYSHLANLEEAFSSFDEAICLVGPTGAVMRVSPLAREIFAGPMFA
FT                   ERHGTIWHADPPMRAMLLQSVAMTCQTGVRQSMTIPAETGVTVTVDMVVGGPSLRVAGE
FT                   RCVLMRMQRRNSGDTQPDPDHLAAVFRITPAEARVLAALVTGQTAAAYAASAGVSVNTV
FT                   RKQIAMLMAKMQCNRQSELVRKAILGQG"
FT   gene            579583..579858
FT                   /locus_tag="Reut_B3946"
FT   CDS_pept        579583..579858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3946"
FT                   /product="Helix-turn-helix motif protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3946"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63303"
FT                   /db_xref="GOA:Q46U81"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63303.1"
FT                   /translation="MGKSGRKANHMKQVLSTPLQVRQVLQGARKAAGLNQSETAARLNI
FT                   SQSRMSHMELNPGSISVDQLLALIGVLGLELVVQEKRGGVDAEAGW"
FT   gene            579861..581201
FT                   /locus_tag="Reut_B3947"
FT   CDS_pept        579861..581201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3947"
FT                   /product="HipA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3947"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63304"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63304.1"
FT                   /translation="MAIRKTRTPALSVWANGQRVGTWRNPGSAATEFEYDTAWMHSDTG
FT                   RPLSLSLDYALGTRKVIRGEPVHHYFDNLLPDSEPIRRRLAMRFGTGSTDAFALLSAIG
FT                   RDCVGAVQLLGEDEIPAGHDRIEGEPLSDQQIEQWLRDTVSTPAPGHDQDDDFRISIAG
FT                   AQEKTALLRHAGQWLRPHGATPTTHILKLPLGLVGNRRADLSASVENEWLCLNILGAYG
FT                   LPVAHSEMLTFGEQKVLSVSRFDRQMHASGNWLLRLPQEDFCQVFGLSSLQKYEADGGP
FT                   GMERIATVLRNSETPTQDLETLFSAQLLFWLLAAPDGHAKNFSIRLLAGGRYRMTPLYD
FT                   VMSVWPVIGDGPNQFSWHRTKLAMAVAGKSRHYALRDIQRRHFNAMASQCFLGTNAEPV
FT                   IERLIARTPAVIDTVGAMLPPGFPQRVADTILNGLRTSVERLASMQP"
FT   gene            581242..581511
FT                   /pseudo
FT                   /locus_tag="Reut_B3948"
FT   gene            complement(581676..582695)
FT                   /locus_tag="Reut_B3949"
FT   CDS_pept        complement(581676..582695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3949"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3949"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63305"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63305.1"
FT                   /translation="MSGISRMPGRGIRAPRRALLLSSLACTTLLLAPSLAAASDYPNKP
FT                   IRLVVPYPPGGATDVIGRTLAQHLSATLGQQVVVDNRAGAAGNIGADLVAKAAPDGYTL
FT                   LMGALTSHAINAALYKSRVPYDIEKSFAPVAIVGTVPLVFVVNPSVNASTLPQLVSLAR
FT                   SKPGTITYGSAGNGSPQHLAGELFKRMAGVDMLHVPYKGSGPAMTDLIGGQVLSMVETV
FT                   PAAQAYVKGGKIRALAVTSSQRVSALPDVPTAAEAGLKDFEVSSMFGIVAPAGTPAPVI
FT                   DRLSADLKKILAEPDVKEALLKQGAIATWTTPAQTSARIKSELARWNTVIRDAGVKPE"
FT   gene            582950..584713
FT                   /locus_tag="Reut_B3950"
FT   CDS_pept        582950..584713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3950"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3950"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63306"
FT                   /db_xref="GOA:Q46U78"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63306.1"
FT                   /translation="MPYADDPKLPQDGAAPTEGLAKGLTNYGDTGFSLFLRKAFIKGAG
FT                   FTDDALSRPVIGIVNTGSSYNPCHGNAPQLVEAVKRGVMLAGGLPVDFPTISVHESFSA
FT                   PTSMYLRNLMSMDTEEMIRAQPMDAVVLIGGCDKTVPAQLMGAASAGVPAIQLVTGSML
FT                   TGSHRSERVGACTDCRRYWGRYRAEEIDSAEIADVNNQLVASVGTCSVMGTASTMACVA
FT                   EALGMMVSGGASAPAVTADRVRVAERTGTTAVGMAAARLTPDRILTGKAFENALRVLLA
FT                   IGGSTNGIVHLTAIAGRLGIDIDLAGLDRMSRETPVLVDLKPSGQHYMEDFHKAGGMLT
FT                   LLRELRPLLHLDTLTVSGRTLGEELDAAPPLFPQDVIRSAGNPIYPAGGLAVLRGNLAP
FT                   GGAIIKQSAANPALMEHEGRAVVFENAEDMAQRIDDESLDVKADDILVLKRIGPTGAPG
FT                   MPEAGYMPIPKKLARAGVKDMVRVSDGRMSGTAAGTIVLHVTPEAAIGGPLALVQSGDR
FT                   IRLSVANREIALLVDDAELARRAAAQPVERPRAERGYRKLFLETVTQADQGVDFDFLRA
FT                   AQTVDTVPKQG"
FT   gene            584717..585397
FT                   /locus_tag="Reut_B3951"
FT   CDS_pept        584717..585397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3951"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3951"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63307"
FT                   /db_xref="GOA:Q46U77"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63307.1"
FT                   /translation="MTATTATVTAIDGGDAMEQALDTLEEDIVFGRLHPRERLTEDALM
FT                   ARFGLKRHVVRQVLAELEQMGVVERRRNVGAVVRAFDAHEVVELYGLREVLECHAAALI
FT                   ALPVPPARLQALIDIQQRHDAAVAAEDARAVFRINQAFHRELFALTDNAVLQQAIGEYA
FT                   RRTHPIRFGTLAVAAYRERARQEHWAMIEALREGRRDDLVALCRRHLLPSRDAYLAAEK
FT                   ARGQ"
FT   gene            complement(585413..586393)
FT                   /locus_tag="Reut_B3952"
FT   CDS_pept        complement(585413..586393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3952"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3952"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63308"
FT                   /db_xref="GOA:Q46U76"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63308.1"
FT                   /translation="MPTAYFLMLPGIHMLDLAGPLQILSTVAELDIGPLAVRCVGPHSS
FT                   VQAFQGIELGRVGPLPARLLPGDLVLAIGSKMTDTLFRSPAWRDTADWLRGVAADAKER
FT                   PTIAAVCTGAYLLGEAGLLDGRLCTTHYAHVGRLRAKHPGATVVDNRIFVSDGNIWTSA
FT                   GVASGIDMALQLVADTFGDDAAIRVARENVVPFRRFSSDPELASKFRSRSHGNALVHAV
FT                   QDAISADLSVSVSDPSFAQTFATSVRHLSRVFARETGLTPKQYQLALRMDKACRLLEAS
FT                   SLPIEEIAEQCGFASVQAFRACWNKAQPMTPGEFRQAHPGERIVH"
FT   gene            586598..587830
FT                   /locus_tag="Reut_B3953"
FT   CDS_pept        586598..587830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3953"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3953"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63309"
FT                   /db_xref="GOA:Q46U75"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63309.1"
FT                   /translation="MQSPPISRSVTLLLVATGFAVMFASTAVKGVYQVYFVQLASHFGQ
FT                   GRAQFAWSGALFMLATGLMSPVVGALSDRVGPLRTSAIGALAAGLAYASAALWNQSLVW
FT                   FSLAFGMAGAFGLAAMTFVPMGVLVDRLFEARRKGLAYAVVTNGTAIGFIVLSPFWMWL
FT                   QPKAAWTTVFGAVGMVFAVPVAAVLWLLSRWEPPAPAAATTQASASAWSIVRRDPVFYV
FT                   LAAGFFGCGATMAFIDVHLLAHWQDRGVARMEMGYALSALGVLELVSGIASGALALRFD
FT                   KHRLLAAFYAMRCIAMLLLLVPQAGVLPFALVFGSSYLGTVILTSMFCFERYGGQVKGR
FT                   VFGLLFLVHQAGAFLSVQLGARSFESTGSYVQTIVALGVATGFAAICSWLGLRRGVTAP
FT                   PTVPAGAGAQG"
FT   gene            complement(588070..590247)
FT                   /locus_tag="Reut_B3954"
FT   CDS_pept        complement(588070..590247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3954"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3954"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63310"
FT                   /db_xref="GOA:Q46U74"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63310.1"
FT                   /translation="MSIIVDVLVLAGVLLAIVAVVQVAAARLVLPESTLLSAIGIAIGA
FT                   GYVAIDAAHPAFAQHFLHPLIDPELPPEAYLWIFLPPLLFHAALTADVRSMLPDAAPIL
FT                   LLAVVAVIVATGVIGVATSAASGMPLAACLLLGAVVATTDPAAVIAIFRDVGAPARLIR
FT                   LVEGESLLNDAAAIAIVGVLVAMLTGHSAQATLGAGVRELAWSFIGGVLCGALAGRLVA
FT                   EVLPRLSGLAMAESALTLALPYPLYLLADQLLDVSGVVAVVCAGLMVSALGPTRLTPAN
FT                   WRHLRMIWEQFAGIAGAVVFLLAAVRVPSLLAGVTPHHGWLLLVLVAAALGARLLTLFG
FT                   LLPVLSWLRLSAPISGAFKLAIAWGGLRGAVTLVLALGIAENTALPLQVRHFIAILATG
FT                   FVLVSLLLNGTTLRALIHRLGLNQLSPQERALQQQAIRLSTEEVEAMLGRVAETFDLPP
FT                   AAAREVAQHYRRGIELGSVEFDFDSALSERDRLTIGLVTLATRERELIPEYGDGVISVA
FT                   NLDAMMRNTSHMIDAAREQGRIGYKRAARAILQYHLGYRIAFFLHKWLGLDRPLARALA
FT                   DRFELLICRQTVLDRLRRYNRSLLTPVFGARMTTVLDGVLEERFHSAGEGLAQMREQFG
FT                   DYTVALERRLLMLFALRKGQRSLATMREEAVISKEAFNQIDQIMQHAWQANLVRPPLRA
FT                   APDRWARWHKPPQTETRTPEETMPEPPRERR"
FT   gene            complement(590244..591185)
FT                   /locus_tag="Reut_B3955"
FT   CDS_pept        complement(590244..591185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3955"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3955"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63311"
FT                   /db_xref="GOA:Q46U73"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63311.1"
FT                   /translation="MKINLSMRDIETTLVLARTLNFRQAASQLHLSQSALSTQILRIEE
FT                   SLGVRLFDRTTRTVRLTAAGAVFMQQAALLQAAFRGAIDAVTGIASAERGQVAVAALPS
FT                   LAARMLPRVLMAYHRARPEVALKVFDTLSGPAFDMVRAGEVDFALTAADPQQADLHYEP
FT                   LLSDRFVLLIPAAHAMARGSGPLRWADTASAPHVSMTNPSSVRQYTEWAFLQNRIRFQP
FT                   VFEAEHLATIAAMVECGFGVAALPEIAAGTVRQPGIVERLLTAPVTERSIGLVTPRNRS
FT                   LSPAAAELADAVRVHLAQFREQPEAAGAGVGA"
FT   gene            591365..592333
FT                   /locus_tag="Reut_B3956"
FT   CDS_pept        591365..592333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3956"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3956"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63312"
FT                   /db_xref="GOA:Q46U72"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63312.1"
FT                   /translation="MQNSATPVPLDRPGSAHAVVVGGGTMGADVAVVLTRALCRTTVIE
FT                   PDAGRAAAMPGRVAANLEAIGRSEGADRLAVVPDLDALDWSTVDLVIECIPERLDLKQA
FT                   LFADLAARARPDAVLASNSSSFPISAIDDGLSGHGRMLGLHFFMPAHLVPLVEVVMGIG
FT                   SDEACADALIAFMRRCGMVPVKVKQDLPGFLANRLQHALSREAFSLIDRGIASAEDVDA
FT                   AVRFGFGFRFLAAGPVLQRDHAGIDVHAAAGATMYPTFCNDDHPARCLAERAADGRHGM
FT                   KRGEGFYAWTPETIAAERARYDRLLRAGLDLIAPELPEIQP"
FT   gene            592330..593190
FT                   /locus_tag="Reut_B3957"
FT   CDS_pept        592330..593190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3957"
FT                   /product="Protein of unknown function DUF849, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3957"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63313"
FT                   /db_xref="GOA:Q46U71"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63313.1"
FT                   /translation="MTQATQIPSQQPLASSPLIITVAPNGAYKRASDHAAVPLTAAALA
FT                   ADARACLDAGAAMMHMHVRDAEGRHSLDVETYRDALATVKQAVGDALLVQVTSEAAGVY
FT                   KAPQQMAMVRELRPEAVSVGLREIAVPEVSETELADFLGWLARERIMTQVILYDAADVQ
FT                   RWQAMRERGMVPPGAWSVLYVLGRYSAGQVSSPRDLLPFLQVADNTLPWSICAFGREEN
FT                   ACVTAAAAFGGHVRVGFENNLYLRDGSLAPGNASLVEQAAHGALTLGRPLATAADARRI
FT                   YGEVR"
FT   gene            complement(593202..593441)
FT                   /locus_tag="Reut_B3958"
FT   CDS_pept        complement(593202..593441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3958"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3958"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63314"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63314.1"
FT                   /translation="MQLLRHTLMATAMAATLAGMATAASAAGTRDPYLDGSRSIHSPRD
FT                   VFTDGARSGPRTPDPYTDGSRSGPRTPDAYTDGA"
FT   gene            593709..594035
FT                   /locus_tag="Reut_B3959"
FT   CDS_pept        593709..594035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3959"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3959"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63315"
FT                   /db_xref="GOA:Q46U69"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63315.1"
FT                   /translation="MPESDSAKLAAIAWIREQMDNYALTLDDLIAAGCFDGEPSHGDVE
FT                   AGEMPGAPDVPAVMAATAAPQPPKKGPIYRNALGQSWDGTGEYPDWLQRAVNAGQSIDF
FT                   YRVD"
FT   gene            complement(594147..594551)
FT                   /locus_tag="Reut_B3960"
FT   CDS_pept        complement(594147..594551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3960"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63316"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63316.1"
FT                   /translation="MKRLPIRFFLLCLPLLALSGPAGAASHAPACGAVQAAGLSLAERH
FT                   AAAKASAEAALDPAHQCAEGAVRVMAGPDSEGRPLKLHERREDADDEPVQSGALPELPV
FT                   SALAHYAHAAAMVSPATTFAGPFSGFPFLP"
FT   gene            594724..595413
FT                   /locus_tag="Reut_B3961"
FT   CDS_pept        594724..595413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3961"
FT                   /product="Heavy metal response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3961"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63317"
FT                   /db_xref="GOA:Q46U67"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63317.1"
FT                   /translation="MRILIVEDEPKAGDYLLKGLTESGFVVDLARDGVDGLAHAREQPY
FT                   DLIVLDVMLPGMDGWSVLRELRRERDTPVLFLTARDELQDRLKGLELGADDYMVKPFAF
FT                   AELVMRIRTILRRGPLRESEFIEVADLQIDAIRRRVSRSGQKIDLTSKEFALLYLLARR
FT                   RGEVLSRSLIASQVWDVNFDSNTNVVDVSIRRLRAKVDDPFDHKLIHTRRGMGYVLDDG
FT                   EPGLGDA"
FT   gene            595413..596855
FT                   /locus_tag="Reut_B3962"
FT   CDS_pept        595413..596855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3962"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3962"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63318"
FT                   /db_xref="GOA:Q46U66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63318.1"
FT                   /translation="MRLPSSLTARLTLAYGLATAAILAGVAAYLSSALSAQLQGRDESE
FT                   LVSEVLLVRHLLREVRNEDEVRADTHRFADIAMGHEGLILVVRTPQGDPLVTLNPRNEA
FT                   IPPLHVLPVTTQPHKSMLEAWRPKSGAQSPAIAALGQLGDTGRSVEIVVLRDAGYRVAL
FT                   MREYRHRLLAATLCGAAVAAALGFVLARRGLRPLRRMAADAAAVTTSRLATRLDAGSAP
FT                   AELRELARELNGMLARLQDSFSRLSAFSADLAHDFRTPISNLVGQTEVTLAQSRSVAEY
FT                   EALLESNLEEYERLSRMIENMLFLARADHAQVAMGVRGLDARAELDKVAEYFEAVAADR
FT                   NVRLSVAGDASIHADQTLLRRAVTNLLDNALRHAPAGSTVRVDIARRAGEVGEAGDGTC
FT                   IRVVNAGPAIAPEVLPHIFGRFYRADPSRRNSAASTGLGLAIVDSIMRLHGGRALVSSS
FT                   DGETVFSLLFPAGGDPRPHAVA"
FT   gene            596963..597370
FT                   /locus_tag="Reut_B3963"
FT   CDS_pept        596963..597370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3963"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase:3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3963"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63319"
FT                   /db_xref="GOA:Q46U65"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63319.1"
FT                   /translation="MQVQPYLDFGGRFDEAVAFYGKAVGATVTFVMRYKDAPPDQPVDP
FT                   AWREKVMHANIQIGETQIMASDGRPGIPAPAFSGFSLSVGAVSEAEGAQIFQALSEGGQ
FT                   VVLPYQKTFWAAGFGMLVDRFGMSWMVNCEH"
FT   gene            complement(597444..598391)
FT                   /locus_tag="Reut_B3964"
FT   CDS_pept        complement(597444..598391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3964"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3964"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63320"
FT                   /db_xref="GOA:Q46U64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63320.1"
FT                   /translation="MSIASDKLVHRVISRLRLRHMPLLLALEQQRSVSRVAAEMNLSQP
FT                   AVTKMLREIEDIFTVPLFTRTRQGLEPTPTGLSVLAHARLALADADALSRELAVIEAGL
FT                   SGRLRLGVIPYIARPVLDAACTFGLGRSPRISVLVREGTTDELVAALRAHELDCVIART
FT                   FYVPGEDIAQRPLYREEPVLVVPSKVATRLSGSALDWGRLAERDWILPPPNTPIRRTIN
FT                   TMFAVAGVAQPTPIVETYSIKTMATVMRSHLGAITIVPRGVAAELVEAEGATMLPHPLS
FT                   WDLPPVGVMWRRESGEDEKIAALVASVAAVGGRV"
FT   gene            598507..600336
FT                   /locus_tag="Reut_B3965"
FT   CDS_pept        598507..600336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3965"
FT                   /product="gamma-glutamyltransferase 2, Threonine peptidase,
FT                   MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3965"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63321"
FT                   /db_xref="GOA:Q46U63"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63321.1"
FT                   /translation="MFTTRPEIVGTFGVAASTHWLATQTAMGVLERGGNAFDAAAAAGF
FT                   VLQVVEPHLNGPGGEVPILYWSERERRVRSVCGQGAAPALADPAQLRAMGLEMMPGIGL
FT                   MPATVPGAFGAWLTMLREHGTWSLADVLAPAIGYARDGFPLVPRISRAILAVQALFRDE
FT                   WHSSAETWLPGGKVPRPGSLHTLPVLAATYTRIVEEAQQRSQTREGQIDAAMDCWYRGF
FT                   VAREIDNYCRNTPVRDTTGDKHAGLLRYEDMAAWQPDVEAPVTLDFGRYTVAKCDIWSQ
FT                   GPVFLQQLGMLRQAQLEQHAPDSAEFVHRIAEACKLAMADRLAWYGDPRFGASPLAALL
FT                   DGDYLAGRAQRIGERASRAIDAGMPGGATPRLPDLEAAVRTLQRADVRFGVGEPTFAEL
FT                   PPVSEWAERELFVGDTCHVDVIDRHGNMVAATPSGGWLSSSPTIPALGFALNTRLQMTW
FT                   LEPGLPNSLEPGKRPCTTLSPSLALRDGEPYMVFGTPGGDQQDQWSLAFFLRHAVHGMN
FT                   LQEAIDAPAWHIDHFPGSFWPRQTVLNRITMESRFPEATLAALRDRGHDVRVGDPWSEG
FT                   RMSACTRERDAHGRLVLRAGANARGMQGYAVGR"
FT   gene            600320..601390
FT                   /locus_tag="Reut_B3966"
FT   CDS_pept        600320..601390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3966"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3966"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63322"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63322.1"
FT                   /translation="MPSGAESGHSSTEKGAGSCTLARARLRIEESKTMKSIVKRLLCGV
FT                   AALALCATAHAADPYPQKPVTLIVPWAAGGSTDILARVLSEHLTRSLGQPVIVDNKPGA
FT                   SGNIGSAMVARAKPDGYTLLVGSMSTHAMNPALMANMPFRGVEDFTPLGLLAYVTNTMV
FT                   VHPSVPAKNVKELIAYAKANPGKLAYASAGPGSTNHLSAVLFERMAGVQMLHVPYKGGA
FT                   PAVVDTVAGQTQLLFSAGTQTLPHVKAGKLRLLAVTEAKRSPLLPDTPTVAETVPGYEL
FT                   AVWYGAFGPKGMPAELVARLNREINAVMSLPEVKSKMNAIGVETATSTPQQFGTILRKD
FT                   ADRYGKLIRELGIQAE"
FT   gene            601387..601890
FT                   /locus_tag="Reut_B3967"
FT   CDS_pept        601387..601890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3967"
FT                   /product="GAF"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3967"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63323"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63323.1"
FT                   /translation="MMSAAIDHIAEVLVATNGLCDDLERAASPLETLDAVGQATLRLLG
FT                   PGLLTINAWHAGTAEIERIWSSNPAAYPPGGKKSKPDSPWRRQLLEAGEVFVGEGDAAL
FT                   AAVFDDVALIRSLGCTAVVNVPMCRAGRVFGTFNYLSDRAAWDAREIATLRVLANVALP
FT                   AVRA"
FT   gene            complement(601887..605114)
FT                   /locus_tag="Reut_B3968"
FT   CDS_pept        complement(601887..605114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3968"
FT                   /product="Heavy metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3968"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63324"
FT                   /db_xref="GOA:Q46U60"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63324.1"
FT                   /translation="MFERIIRFAIEQRWLVLLAVLGIALLGLYSYSRLPIDAVPDITNV
FT                   QVQINTEAPGYSPLETEQRVTYPIETAMAGLPGLEQTRSLSRYGLSQVTVIFKDGTDIY
FT                   FARQLVNQRVQEAREKLPQGMTPQLGPISTGLGEIYLWTVEAEDSARKPDGTRYTPTDL
FT                   REIQDWIIKPQLRTVAGVTEINTIGGFAREYLVAPSPERMASYGLSLQDVVLALEKNNS
FT                   NVGAGYIERRGEQYLVRAPGQVTSMDDIRDVIVGTAQGQPIRIRDLAEVGVGRELRTGA
FT                   ATDNGREVVLGTVFMLIGENSRAVSRAVDVRMAEINRTLPEGVRAVTVYDRTILVDKAI
FT                   ATVKKNLLEGAALVVAVLFLLLGNIRAAVITALVIPLSMLFTFTGMATYRISANLMSLG
FT                   ALDFGIIVDGAVVIVENCVRRLAHGQQHHGRPLTRSERLHEVFAAAREARRPLVFGQLI
FT                   IMIVYVPILALSGVEGKMFHPMAITVVLALAGAMLLSVTFVPAAVALFIGDRVAEKENR
FT                   LMEWARKLYAPALARSVANTPVVLTFAAVAVVLSGLVSTRLGSEFIPNLNEGDIAVQAL
FT                   RIPGTSLSQSVAMQQQIETRLKEKFPEIERVFSRTGTAEIAADPMPPNASDAYIMLRPR
FT                   GEWPDPRKTRDELLVQMQAELEKIPGNRYEFSQPIQLRFNELISGVRSDVAVKLFGDDN
FT                   AMLEATAQKIASALQSVPGAAEVKVEQTTGLPVLTVAIDRARAARYGLNMTDVQDTVAI
FT                   AIGGRDAGTLFEGDRRFRIAVRLPEDVRADVDALRRLPIPLPPDARRPAAANGVRTTSS
FT                   DTAPRTSYIPLGEIATLDIAPGPNQVSRENGKRRIVISANVRGRDVGSFVPEAQSAIAE
FT                   RVTIPTGYWIAWGGTFEQLQSATDRLQIVVPLALLMVFVLLFAMFGNLKDGLLVFTGIP
FT                   FALTGGILALWLRGIPLSISAAVGFIALSGVAVLNGLVMLSFIRSLREEGLALDDAVQT
FT                   GALSRLRPVLMTALVASLGFIPMAIATGTGAEVQRPLATVVIGGIVSSTALTLLVLPVL
FT                   YRLAHRRDEPMAPGEDVREALAQEPLR"
FT   gene            complement(605131..606354)
FT                   /locus_tag="Reut_B3969"
FT   CDS_pept        complement(605131..606354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3969"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3969"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63325"
FT                   /db_xref="GOA:Q46U59"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63325.1"
FT                   /translation="MAITKTQRNAIVAIIGVGVLAGAALLFSGRGPGDDHDHGEHAAEP
FT                   SSNESGKEDKATASANDAHAADRIAMTPEQIRSAGLELHTAGPGRVQAAVQFPGEIRFN
FT                   EDRTAHVVPRVVGVAESVPAVLGQRVKKGELLAVLASTQLSDQRSELLAAQKRLELART
FT                   TYTREKRLWEDKISAEQDFLAARTALQEAEIAVRNATQKLTAIGARPASAGLNKFELRA
FT                   PFDGIVVEKHLALGEAVAADTTVFTISDLATVWAEFVIAPKDLSQVRLGEKVSIASTAF
FT                   DGTATGTVSYVGSLLGQQTRTATARVTLSNPDMAWRPGLFVTVSVAGQETEVPVVVESE
FT                   AVQTESSQPMVYVEVPGGFEARPVATGRSDGKRIEIVKGLEPGARYVARNSFVLKAEQG
FT                   KAGAEHAH"
FT   gene            complement(606374..607654)
FT                   /locus_tag="Reut_B3970"
FT   CDS_pept        complement(606374..607654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3970"
FT                   /product="Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3970"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63326"
FT                   /db_xref="GOA:Q46U58"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63326.1"
FT                   /translation="MKHVVIPLGLAFVLLGPVAHAATDAAMPPALQDQRPAQPHDAAET
FT                   RAVLTLDTALALAIARSPTLSAARRELDATEGGITQARTIPNPSVGYEMEDTRRASRTT
FT                   TAQVSVPIELGGKRSARIGAAQKARELASAQFSNAESDLRATVIGAFFQVLVAQERVSL
FT                   AESSVGIATRGTQAAARRVAAGKVSPVEQTRAEVEQANAELELAEARATLDAARQQLAA
FT                   QWGSQLPVFASASGDLEALPSRPLPNVLDEALDTAPEMRASQSEMARRQAIVNVERSRQ
FT                   YPDVTVSVGAKREYSSDRGYYPVLGISLPLPLFDRNQGNLYTAIRQADKAADESRATRV
FT                   RLASDLRQASNQLALSRNSALTLRQTVLPAAQRAYQAASQGFEAGKFAYLEVLDAQRTL
FT                   LQARVRYLGAVAATYQAATAIDRMLGR"
FT   gene            complement(607826..608197)
FT                   /locus_tag="Reut_B3971"
FT   CDS_pept        complement(607826..608197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3971"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3971"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63327"
FT                   /db_xref="InterPro:IPR020487"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63327.1"
FT                   /translation="MRRLLILLFAVMLPLQFTWASAAAYCEHGREQQRQQETGAAPVWH
FT                   FGHHTHEHEAGAAHGKSGTKLPDADCAVCHFAGSQVMLPAETQPASYHFITVRYRVLPV
FT                   HYASVTARTPDRPQWLPLA"
FT   gene            608349..610700
FT                   /locus_tag="Reut_B3972"
FT   CDS_pept        608349..610700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3972"
FT                   /product="ATPase, E1-E2 type:Heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase:Heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3972"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63328"
FT                   /db_xref="GOA:Q46U56"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63328.1"
FT                   /translation="MARTTPEHALPHEHVRSEGCGHDHARTRDDHGHHHGHDHDHGHDH
FT                   HDHAPRAPACCGSACSTTISVAPAASVAIPAGAGSASYRIDAMDCPTEETLIRNKLGGM
FT                   AGVAALDFNLMQRVLTVHHTLASTESVVNAIASLGMKAEPLVPEQAAPLPAAEHKPWWP
FT                   LALAGVAAIGAEVTEWAGLGNPWLPALLAIAAVALGGLTTYRKGWIALRNANLNINALM
FT                   SIAVTGALVLREWPEAAMVMVLFALAERIEAASLDRARNAIRGLMAMAPEQATVRQLDG
FT                   TWAGVPAAGVAVGAVVRLRPGERVALDGRVVRGQSALDQAPITGESVPVDKGVGDALFA
FT                   GSINQSGEIEYEVTAPANDSTLARIIHAVEAAQASRAPTQRFVDQFARIYTPTVFAIAL
FT                   AVAVVPPLVTGASWVDWIYKALVLLVIACPCALVISTPVTIVSGLAAAARRGILIKGGV
FT                   YLEQGKDLSWVALDKTGTITHGKPAQTDYAMLVEDAPHARAIAASLAARSDHPVSKAVA
FT                   TAAQADGIALLDVTAFEALAGRGTRGRIDGDDYCLGNHRLIHDMGACSPALEDRLEALE
FT                   RQGKTVVLLARLGKDGAAAALAMFAVADTVRDTSRQAIAELHALGVKTIMLSGDNPHTA
FT                   QAIGAQVGIDEARGNQLPQDKADAIGTLAADTHAARGRVGMVGDGINDAPALARADIGF
FT                   AMGAAGTDTAIETADVALMDDDLRKIPAFVRLSRSTSRILWQNITLALGIKAVFLALTL
FT                   AGMGTMWMAVFADMGASLLVVFNGLRLARR"
FT   gene            complement(610753..611646)
FT                   /locus_tag="Reut_B3973"
FT   CDS_pept        complement(610753..611646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3973"
FT                   /product="Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3973"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63329"
FT                   /db_xref="GOA:Q46U55"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63329.1"
FT                   /translation="MARIALKVDVDTLRGTREGVPTLLSMLDAVQAQATFLYSLGPDHT
FT                   GWALRRVFRPGFLKKVSRTSVVSNYGLRTLMYGVLLPGPDIGRKAAAEMRAARTAGHEC
FT                   GIHTWDHVYWQDNVRQRDPAWTRRQMQNAFDRYVDIFGEAPPTHGAAGWQMNDEAFRQI
FT                   DDWGMAYASDGRGTAPYIPTVGGVACRHVQMPTTLPTLDEMIGVDGLTEDNVHEAVLRL
FT                   TEATVGDHVFTLHTELEGGKLAPVFRRLLQGWRAQGHELVSMATYYRHIDRDTLPTLPV
FT                   TWGSIEGRSGELIIQP"
FT   gene            complement(611657..612709)
FT                   /locus_tag="Reut_B3974"
FT   CDS_pept        complement(611657..612709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3974"
FT                   /product="NAD-dependent epimerase/dehydratase:3-beta
FT                   hydroxysteroid
FT                   dehydrogenase/isomerase:dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3974"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63330"
FT                   /db_xref="GOA:Q46U54"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63330.1"
FT                   /translation="MKKVLILGVNGFIGHHLTRRILETTSWEVYGMDMSSDRLGDLVDH
FT                   PRMHFFEGDITINKEWIEYNIRKCDVVLPLVAIATPATYVRQPLRVFELDFEANLPIVR
FT                   AAVKYGKHLVFPSTSEVYGMCADDEFDPESSPLIYGPINKPRWIYACSKQLMDRVIHAY
FT                   GMEQGLNYTLFRPFNWIGAGLDSIFESKEGSSRVVTQFLGHIVRGEPIKLVDGGEQKRA
FT                   FADISDGISALMRIIENPNGIATGKIFNIGNPSNIHSVRELAEMMLKMAADYPEYAEEA
FT                   RKTQIVETSSGDFYGKGYQDVQHRVPKIDNTMQELGWKPEVTMEQALRRIFEAYREKVV
FT                   EARTLVDGDN"
FT   gene            complement(612706..613641)
FT                   /locus_tag="Reut_B3975"
FT   CDS_pept        complement(612706..613641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3975"
FT                   /product="Formyl transferase, N-terminal:Formyl
FT                   transferase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3975"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63331"
FT                   /db_xref="GOA:Q46U53"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63331.1"
FT                   /translation="MRAVVFGYHNVGDRCLRVLHARGVDVALVVTHRDRADENIWFRRV
FT                   ADTATELGIPFIYGEDPADPAIAQAVRDASPDVIFSFYYRSMIPASVLALAPQGAFNMH
FT                   GSLLPKYRGRVPVNWAVLHGETETGATLHAMEAKPDAGYIVDQTAVPILPDDTAGEVFE
FT                   KVTVAAEQTLWRALPAMMAGNTPQHPNVLAQGSYFSGRRPEDGRIDWSRPAAEVYNLIR
FT                   AVAPPYPGAFTDIAGQRFVVAQARRPLSAPALPTGWRPGLHVSQGQIIGLCGDGGQVRI
FT                   DTLLNAATSAPVTAQALAPILTEQSNEENR"
FT   gene            complement(613641..614618)
FT                   /locus_tag="Reut_B3976"
FT   CDS_pept        complement(613641..614618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3976"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3976"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63332"
FT                   /db_xref="GOA:Q46U52"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63332.1"
FT                   /translation="MQTSLQMSPVEVSVVIPVYNEEDGLQALFDRLYPALDGLGDSYEV
FT                   IFINDGSVDRSAAMLAAQFHKRPDVTRVVLFNGNFGQHMAILAGFEHTRGKIVITLDAD
FT                   LQNPPEEIPRLVQTMREGHDYVGTIRRQRNDTAFRRYASRAMNGLRERITKIRMTDQGC
FT                   MLRAYDRNVVDTINACREVNTFIPALAYTFASSPVEIEVGHEQRHAGESKYSLYQLIRL
FT                   NFDLVTGFSIVPLQWFSAIGTVLSLLSGVLFVVLLMRRFLFGSEVQGVFTLFAMNFFLI
FT                   GILLFGLGLLGEYVGRIYQEVRDRPRYRIKAVLEAEPSRHRTEA"
FT   gene            complement(614597..615772)
FT                   /locus_tag="Reut_B3977"
FT   CDS_pept        complement(614597..615772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3977"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase:Aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3977"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63333"
FT                   /db_xref="GOA:Q46U51"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63333.1"
FT                   /translation="MTATAASEFLPFVRPEIDADTIAEVGKVLASGWITSGPKMQAFED
FT                   ALSQLFGGRPVRTFANGSATMEIALRIADIGPGDEVITTPITWVATANVVLAVGAKPVF
FT                   VDIDPRTRNIDLDAVEAAITPRTRAIMPVYLSGLPVDMDRLYAIATKYNLRVIEDAAQA
FT                   IDSRWQGKRIGAFGDLVSFSFQANKNITSVEGGCLVMNTPEEAVRAERLRLQGVIRSGM
FT                   DGMDVEEPGGKFNLTDVNAAIGLAQLAKLDAITARRAALAETYFRCAADAGLAELGIEL
FT                   PQPLDPQQATTNWHMFQVVLPTERLEGGPQQARQNVMQAMRERGIGTGVHYPPIHLFTY
FT                   YRSLGWRAGMLPHAERIGRGIVTLPLFPAMQAADVERVCATLSETCKRLSK"
FT   gene            complement(615816..616187)
FT                   /locus_tag="Reut_B3978"
FT   CDS_pept        complement(615816..616187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3978"
FT                   /product="putative small multidrug resistance transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3978"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63334"
FT                   /db_xref="GOA:Q46U50"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63334.1"
FT                   /translation="MTLSTFAFIFTGVLLNAAAQLLLKAGVNAVGAITIERSTLLLTAL
FT                   RVLTQWPVLAGLTLYVVSVGVWIVGLSRVDVSIAYPMLSLGYVVNALAAWWLFGEMIGP
FT                   LRVFGILLILAGVFLIARS"
FT   gene            complement(616198..617919)
FT                   /locus_tag="Reut_B3979"
FT   CDS_pept        complement(616198..617919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3979"
FT                   /product="Glycosyl transferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3979"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63335"
FT                   /db_xref="GOA:Q46U49"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="InterPro:IPR040845"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63335.1"
FT                   /translation="MRSSSTSRYAGLSVGVIALISLGILLVWFGTLDMRHLLRSDEGRY
FT                   AEIAREMFVTGDWVTIRYQALKYFEKPPFHLWATALSYTLFGIGDWQARLCVALSGAIG
FT                   LLVSVLAAHRWFGARAAVLTGFVMVAAPMWNVAAHFNSLDMTLSGAMACVLAFMLLAQH
FT                   PHATLAARRNWMLACWVAMGVAVLTKGLVGIALPGLVLVVYTLVTRDFGLWLRLHLVSG
FT                   IVLMLVVTVPWFWLVSERNPEFLNFFFIHEHWQRYTSTVHSRKGPLWFFVPLLVAGFLP
FT                   WLGAFPGMWQAVRERAGVERGSVARPFQPALLAAIWAIAIFVFFSLSGSKLPGYIVPIF
FT                   PALGILAGVALDTATERSWRRQVNFMLVLGVLGLLATPYVATLDKPSTPNVVYREFALW
FT                   VGLAFACMLAGALLARHLLRTRGVFASVVAYAVAMFLCATLAFRGHEAMGRPASGADLV
FT                   PAINAVLTPDMPIYSVRLLDHTLPFYLRRTVILVEHPDELEFGVGQEPQKWIPTVDAFA
FT                   ERWRQGPHAIAMMSAETFADLTARGVPMFTIGQDKRRIVVANFPLPATARPQSSKD"
FT   gene            complement(618340..618900)
FT                   /locus_tag="Reut_B3980"
FT   CDS_pept        complement(618340..618900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3980"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3980"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63336"
FT                   /db_xref="GOA:Q46U48"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63336.1"
FT                   /translation="MLQYYAKLWWVIALRGMLALVFGICAFFAPIATLAALILIFGAFA
FT                   AADGLMALLMAISGKERETSDRWVLALQGLLGLGVGALTLLSPTITALSLLIYIAAWSL
FT                   ATGVLQIVAAVRLRKEIPNEWWLILAGLVSIAFAFLVLWKPLAGALAVLWMIGSWAIVC
FT                   GILLLGVALRLRSAKPVTVTQPA"
FT   gene            619063..619944
FT                   /locus_tag="Reut_B3981"
FT   CDS_pept        619063..619944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3981"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3981"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63337"
FT                   /db_xref="GOA:Q46U47"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63337.1"
FT                   /translation="MKTKAQHYLRNAPVAALALLASGVVWGEEPAESRQGTAAPAASRA
FT                   MPAGAVICDAPWFRSGSQVQMEGDGALPMSITMTLRNVGRSPSGCRAQLEVMSKSAMSA
FT                   LMGPPVVMDQVHMVNIDRRTPAEETSIESQHAIINARARYARMYGEAAFKGKGVFNYAG
FT                   LNLREGSTLDGETFESSLSLKIYPLGSDQVVGTMRALHASINISSRQVGRRQMIDTVLG
FT                   RRECLPITYEKRTSLGPLLVGEEVVQVEPSVMQITDWYCPAEAFVLRTEVKQDGKVQRI
FT                   DVTAMELDTKAP"
FT   gene            complement(620023..620325)
FT                   /locus_tag="Reut_B3982"
FT   CDS_pept        complement(620023..620325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3982"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3982"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63338"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63338.1"
FT                   /translation="MNKFVAIAIALALGTAAVAAQAQTGGKKFDPYTQGAKSGQKFDPY
FT                   SEGAKSGDKFDPYSQGANKSTRSDLTDASAPEAKKSTKSKSKKSKKKAASAPAAS"
FT   gene            complement(620520..621455)
FT                   /locus_tag="Reut_B3983"
FT   CDS_pept        complement(620520..621455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3983"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3983"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63339"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63339.1"
FT                   /translation="MTPRPFPMPSFRLTASNLFRPLTALLLAVATLSPLGARAQSPVLD
FT                   KIRDSGTIVLGYRESALPFSFADDKGQPAGYAVDLCLRVAEAARQKLGLKDIKVRWLPL
FT                   TPQNRFPAVVNGLVDLDCAPNTNSLERQKQVAFSVSHYVSTVRMLVRADSGIQSFEDLR
FT                   GKTVVTSAGSTGDRHVRRLKQQYGYRDVYAKDHGESFLLLESGRAQAFVMDDVLLAGLR
FT                   ARAKDPSQFVIVGPALSTEQNALMMSKADPEWKRFVDQTLAGTFAGTGITTLQKHWFQQ
FT                   PIGSRKINLALLPSNQVRDAWKHPSDVASE"
FT   gene            621707..622798
FT                   /locus_tag="Reut_B3984"
FT   CDS_pept        621707..622798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3984"
FT                   /product="Acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3984"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63340"
FT                   /db_xref="GOA:Q46U44"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63340.1"
FT                   /translation="MSPRPSRLACIDALKAVSSQLIVLHHLAFYGPMSDAAYSLAPDML
FT                   DWLSQYARIAVQVFLVVSGFLAARSLAPQGRLTIRQHPLVAVWRRYQKLVTPYAAAILI
FT                   SIAGAAIARTWMVHESIPAPPHLMQFLAHVLLLHNVLDVDALSAGVWYVAIDLQLFALL
FT                   VTALWLARSVSGQGARAGIVLVSALAIASLFWFNRDASWDIWAVYFFGAYGMGTLAYWA
FT                   SNPERSAIPLLLLGAMGLAALIIDFRLRIAVALATAVLLAVARREGWLEGWPRAAVVGF
FT                   FGRISYSVFLVHFPICLVVNAVVSHLAPGRPVINALGMLLAWVASNVAGSLFHRYVEST
FT                   SPFAALRGMLAGGRRRTAGESTT"
FT   gene            623075..624313
FT                   /locus_tag="Reut_B3985"
FT   CDS_pept        623075..624313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3985"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3985"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63341"
FT                   /db_xref="GOA:Q46U43"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63341.1"
FT                   /translation="MSDHIVLTSHARRDKPAEPINWGAPTAAERGPVIASLTDPARRNV
FT                   IGTHSGAYAIYRALAVASGRLQRDHRPDLTDTAPAEAIGPHAQWGDPDKIVSLDPWGHL
FT                   VSSAFADRIAAGVDIRPTIAVTRAHINMPELASAIAAGRLKPDGDILHANGDVRVTKAA
FT                   VDPVWYLPGLARRFEIKETVLRRSLFEQTSGMFPELVTRPDLKVFLPPIGGMTLYFFGD
FT                   IAKLGKPETHVACRVHDECNGSDVFGSDICTCRPYLAHGIEVCIEMAQQGGVGLVVYNR
FT                   KEGRALGEVTKFLVYNARKRQVGGDRAETYFARTECVAGVQDMRFQELMPDVFHWLGIR
FT                   RIDRWASMSNMKHGALVAQGIEVVEQVAIPEELIPADARVEIDAKVAAGYFTHYTPPDA
FT                   NELALAKGRGLNE"
FT   gene            624310..625614
FT                   /locus_tag="Reut_B3986"
FT   CDS_pept        624310..625614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3986"
FT                   /product="Protein of unknown function DUF1688"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3986"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63342"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63342.1"
FT                   /translation="MNTYPEADRPEGPADGLGSGWYSPVPAGHPAAALLCAEAVRTHCA
FT                   AVTEHVAAGQSELFTWHPDRVHAIADYVASTIRQRYPDLRVPYHSRWRHFESGGSGERL
FT                   DRWHILCERAALSGPEHREDRARIGIDLVIPSVLLDAGAGPDWRYRDPASDLILTRSEG
FT                   LGVASFDLFARGGFSAEPGDPLRADAERLMRIDASSIATAFQVAQHNPLVGLEGRAGLL
FT                   RRLGEVMQATPAVFGTPARLGNLFDYLKANAVNERIEASFILKTLLVALGPVWPGRIVL
FT                   DGVSLGDTWRHAAAPGGLVPFHKLTQWLTYSLLEPLEDAGLVVTGLEALTGLPEYRNGG
FT                   LLFDFELMVPRDPAFAEVAHEVQEPVIVEWRALTVTGLDLVADGVRQALGLSEADFPLA
FT                   RVLEGGTWAAGRRIAAKRRPGGPPPFAINSDGTVF"
FT   gene            625709..626392
FT                   /locus_tag="Reut_B3987"
FT   CDS_pept        625709..626392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3987"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3987"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63343"
FT                   /db_xref="GOA:Q46U41"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63343.1"
FT                   /translation="MNDMSAVPVAPAEAANAPAASVLVVDHPLVQHKVTLARSEETTTD
FT                   NFRRLVREISQLLTYEATRDLPMETIAIKTPIAPTQSPVLAGKKLCLVSILRAGNGFLD
FT                   GMLELLPAARVGHIGLYRDPETLEPVEYYFKMPEDIQERIVIVVDPMLATGNSAIAALN
FT                   RLKESGVSMLKYVCLIASRPGLKALQAAHPDVAIVTAAIDEELNEHGYIVPGLGDAGDR
FT                   LYGTR"
FT   gene            626392..627093
FT                   /locus_tag="Reut_B3988"
FT   CDS_pept        626392..627093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3988"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3988"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63344"
FT                   /db_xref="GOA:Q46U40"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63344.1"
FT                   /translation="MDGPAVAAARRLPLARDASVGRIRQENEAMILRAAEHVFARAGFA
FT                   GATMAEIAVRAGVPKSNLHYYFRTKQALYRAVLAHTLQLWLSETEAIRAELPPEVALEQ
FT                   YIRAKMRLSASHPDASRVFANELLHGAPEIGEVLRHALRELVEHKSDVIRHWIATGQMA
FT                   SVDPQHLFFTIWAATQTYADFESQICAVLGVSRLGRRDFELATEHLVALLLRGCGLLPV
FT                   SAQLAQDITTP"
FT   gene            627133..628140
FT                   /locus_tag="Reut_B3989"
FT   CDS_pept        627133..628140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3989"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3989"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63345"
FT                   /db_xref="GOA:Q46U39"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63345.1"
FT                   /translation="MNAGRNRRTWLKLAAAGAAVAAIGAMPMAHAQAKLKVAAVYTVPV
FT                   EQQWVSRIHKALNEAKGRGEVDYVFSESVSNADYERVLRQYAEQGAALIVGESFAVESA
FT                   ARKVAKDYPKTAFLMGSSGKPQAPNFSVFDNYIQEPSYLTGMIAGGMTKTNHIGMVGGY
FT                   AIPEVNRLMHAFMEGARSVNPKVKFTVSFIGSWFDPPKAKEAAFAMIDKGADVLYAERF
FT                   GVSDAAKERGKLAIGNVINTQPQYPATVVASALWNMEPTIGAALSKVKAGQFKNEDYGQ
FT                   YSLMKYKGAELAPLGTFEGKVPADLMVKVRAKEKAILDGKDTVKVVETEPKSTP"
FT   gene            628188..629780
FT                   /locus_tag="Reut_B3990"
FT   CDS_pept        628188..629780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3990"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3990"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63346"
FT                   /db_xref="GOA:Q46U38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63346.1"
FT                   /translation="MSLPTSPPVLRMAGIRKRFGASLANDDITLELARGEVPALLGENG
FT                   AGKSTLVNILFGHYVADAGSVEIDGVALPPGNPRAALAAGIGMVHQHFTLADNLSVLDN
FT                   ILIGTEPLWRWRQGRRAARARVEELSRRFGLAVQPNARVGALSVGERQRVEIIKALYRG
FT                   ARVLILDEPTAVLTPQEADSLFATLAQLIADGMSVIFISHKLDEVLRVSHRVAVLRGGR
FT                   LVATRNASATSRAELAELMVGRAVQMPARTRSDARDAAELLAELVQVSVPALAGHVALH
FT                   DVSLTLRSGEIVGIAGVAGNGQVTLAEVMSGMLAPASGTVTIAGHAMPADPQRWIAAGV
FT                   ARVPEDRHAQGAVGELAVWENAIAEQLGQPGFTRAGVIRRGASRRFARELVSRFDVRGG
FT                   GIDAPTRTLSGGNMQKLILGRALSVAGDGRVPRVVVASQPTWGLDIGAVAYVHRQLLDA
FT                   AEAGAAVLLISEDLDELMTLADRIAVMHRGRLTEARPAQAWTLATLGLAMAGSDAATAG
FT                   AAAPGGTEVCDAA"
FT   gene            629770..630861
FT                   /locus_tag="Reut_B3991"
FT   CDS_pept        629770..630861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3991"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3991"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63347"
FT                   /db_xref="GOA:Q46U37"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63347.1"
FT                   /translation="MRLEARPTVSRVALVAAPVGAVAATLLICALLVTWAGAPVGRAYL
FT                   SLLQGGFGSRFAWSETLTRATPLMLTGLAVAVAFRARLFNIGAEGQLYLGALAAVAVGG
FT                   QVDGGAAPWAAQLPAGLLFVLMVAAGMLAGALLLLGPAWLKLRLGVDEVVTTLLLNFIV
FT                   LLLVSWMLDGPMKDPLAMGWPQSVALLPEMELSRLMERSRVHSGLLAACALAVAVWAMN
FT                   RYTVFGLQMRAVGANARAAAFAGMPVGRVTLLAALLSGALAGLAGVVEVAGRTSYLTLD
FT                   MSPGYGYAGVVIAMLAGLNPLGVVAASVFVAGVLVGADGMSRAVGVPNAIADVIVAVAL
FT                   LTMLVATMLTRYRIRLDRVRGVA"
FT   gene            630861..631823
FT                   /locus_tag="Reut_B3992"
FT   CDS_pept        630861..631823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3992"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3992"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63348"
FT                   /db_xref="GOA:Q46U36"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63348.1"
FT                   /translation="MELLDIIAAAPFWVAVLRVATPLIFGTLGVLLCERAGVLNLGIEG
FT                   IMVAGAFSGWLAVYHGAPLWGGVAVAAGVGLVFGLLHGWLTVTLALSQHVAGLGVTMLA
FT                   TSLSYYAYRIGFASVSSPPTITPFAPMRWLDGVPVLGPILGPVLGAQTSLTLLALLLAP
FT                   VIAWLLYRTPLGLAVRMVGENPAAAEGQGIRVGAVRIGAVMVGSALMAVGGAFLTLSAF
FT                   NAFFFNMINGRGWICVALVVFASWRPGRALLGAVLFAAFDALQLRLQQGGASLPGLPPL
FT                   PYQLYLMLPYVLSILALILVARRATYPQALMKPYRRGER"
FT   gene            631851..633149
FT                   /locus_tag="Reut_B3993"
FT   CDS_pept        631851..633149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3993"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3993"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63349"
FT                   /db_xref="GOA:Q46U35"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63349.1"
FT                   /translation="MLELILRHCTLPDGRTGIDIGIENGRIVAVEPALAAQAANEIDAA
FT                   GQLVTPPFVDAHFHMDSTLSYGLPRVNQSGTLLEGIALWGELKPLLTQEALVERALAYC
FT                   DWAVARGLLAIRSHVDVCDPRLLAVEALLHVRERVRPYLDLQLVAFPQDGVLRAPGALE
FT                   NLRRALDMGVEVVGGIPHFERTMADGAASVRLLCELAAERGLRVDMHCDESDDPMSRHI
FT                   ETLASETVRLGLYGRVAGSHLTSMHSMDNYYVSKLLPLMREARVAAIANPLINITLQGR
FT                   HDTYPKRRGMTRVPELLAAGVPVAFGHDCVMDPWYSLGSGDMLEVAHMGLHVGQMTGQD
FT                   AMRNCFAAVTTTPAQILGLEGYGISPGCRADLILLQARDPVEAIRLRATRLKVLRAGKT
FT                   IASTPAATATLQLPGRPTQVDFMVSRDGTQRGD"
FT   gene            633245..633331
FT                   /locus_tag="Reut_BR0075"
FT   tRNA            633245..633331
FT                   /locus_tag="Reut_BR0075"
FT                   /product="tRNA-Leu"
FT   gene            complement(633431..634324)
FT                   /locus_tag="Reut_B3994"
FT   CDS_pept        complement(633431..634324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3994"
FT                   /product="GGDEF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3994"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63350"
FT                   /db_xref="GOA:Q46U34"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63350.1"
FT                   /translation="MSPTEFTNRYVPTLEPLERLRSEFLNEVIAHFEADRQHALRVLVT
FT                   AGSATALILLVLGYVLVFAQRSVFLPLLDARDAVIALAEGRSRPSFTLPASGREMRRLF
FT                   DALDILRRKLRERASLTEQLEHQARTDSLTGLLNRRALERIAAQPADPAGPSTTSLILM
FT                   DVDRFKQINDRHGHPAGDQVLRAVADLMRDMVDPDHALARFGGEEFAVLVPGASADEAA
FT                   SLAQALCAAICAEPIRLADGTRLPVTASFGVATGLSGAPHWPRLFAAADAAMYRAKAEG
FT                   RNCVRRADAPAEAVDH"
FT   gene            complement(634321..634752)
FT                   /locus_tag="Reut_B3995"
FT   CDS_pept        complement(634321..634752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3995"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63351"
FT                   /db_xref="GOA:Q46U33"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63351.1"
FT                   /translation="MAFWRRSCQAGNPLATGRSQSLKRKLAAATTVVGACTVGLASMLM
FT                   ARAYGDFDAARQNLYDISEYRVLLEAANVLSAERGPANSVLGEPPAENSAARDKLHQFR
FT                   ARSDAALARLLVPPPTPTGLHHHHLPPLMDKAACPGITR"
FT   gene            635017..635925
FT                   /locus_tag="Reut_B3996"
FT   CDS_pept        635017..635925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3996"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3996"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63352"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63352.1"
FT                   /translation="MTEVLSSSSREREAGAYPVWHGCAVTPHGARHHHLQYCCVLAMLM
FT                   CAVARADDSAPGTNAILGWQQVHASDLAGMDSQVLARGTALSPVEHNAPPPGYFVRGAA
FT                   TAGPGPDDDAPGLADVDRETERMRYGPRRFLVHVDDATTANGFVDSRVRTMAVALDAVV
FT                   PRAGGLTIQPRVQIAYQPGNAPTGSPTQTQTPDMLGDSSATGFGVRLYGAQPTRLAGVY
FT                   PFVEADWWQDSRKQTININGTKIDTDLLRGLFSFNIGAHGNTASGVKLWFRSRRDAMQA
FT                   VPWVRVIAGSCRGFTGPTGAS"
FT   gene            635985..636061
FT                   /locus_tag="Reut_BR0076"
FT   tRNA            635985..636061
FT                   /locus_tag="Reut_BR0076"
FT                   /product="tRNA-Arg"
FT   gene            636248..636829
FT                   /locus_tag="Reut_B3997"
FT   CDS_pept        636248..636829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3997"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3997"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63353"
FT                   /db_xref="GOA:Q46U31"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63353.1"
FT                   /translation="MTAPKPPSFSPARLTLRDGRRILLREICEQDRAGLLAAFARLSPD
FT                   ARYTRFMAPLRELPESMVEQATHPEPGHECALVAVSEADGQDGSGRLVGGARFVAPPDS
FT                   DVCEFAITLDDDWHGVGLARILMTALIELAGARGYQRMEGFVLAMNTPMRRLARRLGFT
FT                   DVACPDDATVRIVTLPLGTQGTPENAGAAG"
FT   gene            636873..637127
FT                   /locus_tag="Reut_B3998"
FT   CDS_pept        636873..637127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3998"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3998"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63354"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63354.1"
FT                   /translation="MSVLLLGNIEPGTTDDEIRAFLVKYGLPEFDAAEHVPGDGSNPAV
FT                   MLTFRALDPATLRKLITRINGMFWKRRRLSAQVMAERYI"
FT   gene            complement(637172..638023)
FT                   /locus_tag="Reut_B3999"
FT   CDS_pept        complement(637172..638023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B3999"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B3999"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63355"
FT                   /db_xref="GOA:Q46U29"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63355.1"
FT                   /translation="MTLELLSEHGCHGGVQRFYRHASATIGLPMRFSVYLPPQALAGGG
FT                   KLPALFYLAGLTCTEETFMIKAGAQRFAAEHGLVLVAPDTSPRGAGVPGEADAWDFGVG
FT                   AGFYVDATEAPWNTHWGMESYVTQELFDLVSRELPVDPDRVGIFGHSMGGHGALVLAQR
FT                   HPQRFRSVSAFAPIAAPTRCPWGQKAFTGYLGTDRSRWDEYDASALMAAQKVAPFPAGI
FT                   LVDQGLSDQFLQNQLHPEALEAACAAVGQPLTLRRHTGYDHGYFFISTFIADHIRHHAG
FT                   QL"
FT   gene            complement(638034..639140)
FT                   /locus_tag="Reut_B4000"
FT   CDS_pept        complement(638034..639140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4000"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4000"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63356"
FT                   /db_xref="GOA:Q46U28"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63356.1"
FT                   /translation="MKTKAAIAWKAGAPLTIEDVDLEGPRAGEVLVEIKATGICHTDYY
FT                   TLSGADPEGIFPAILGHEGAGIVTDVGPGVTSLKPGDHVIPLYTPECRQCKFCLSRKTN
FT                   LCQAIRATQGKGLMPDGTSRFSIDGKPIFHYMGTSTFANHIVVPEIALAKIRPDAPFDK
FT                   VCYIGCGVTTGVGAVIFTAKVEAGANVVVFGLGGIGLNVIQGAKMVGADKIIGVDLNPE
FT                   REAMARKFGMTHFINPKDVGNVVDHIIQLTDGGADYSFECIGNTQVMRQALECCHKGWG
FT                   KSIIIGVAEAGAEISTRPFQLVTGREWKGSAFGGARGRTDVPKIVDWYMDGKLNIDDLI
FT                   THTLPLDRINEGFELMRRGESIRSVVLY"
FT   gene            639397..641154
FT                   /locus_tag="Reut_B4001"
FT   CDS_pept        639397..641154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4001"
FT                   /product="Histidine kinase, HAMP region:Bacterial
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4001"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63357"
FT                   /db_xref="GOA:Q46U27"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63357.1"
FT                   /translation="MKTLTLNQRLWIPFGLIWIAMLGICTYEAFVTRAEMFAGRQREIQ
FT                   SVAEASVSLVAAIEKEAASEGLSVEEAQKLAKERLRPLRFGTDGYVSITDFSGRSLMHP
FT                   FKPENEGKNLSTMKDPNGVLIYVEIAKIASGQGAGFLNYMWPKPGASQPLPKVSYVKAF
FT                   KTWEWTVTTGAYVDDIEAAFRQALLHSILTLVILGGAATVLAAWLLRGVRRDLGGEPAY
FT                   AASVANSIADGDFTRDIDVRPGDTSSLLFAMQRMQRKLGGTVSGIRASVDSVATATAQI
FT                   AAGNSDLSSRTEQQAASLQETAASMEELTTTVQHNADSARQASGLADNASEIANRGGEV
FT                   MEQVITTMTQIADSSSQIADIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGE
FT                   VRSLAQRSAGAAKEIRTLISTSVDRVRSGSDLVERAGSTMTEITQSIRRVTDIMGEIAA
FT                   ASVEQRTGIEQVNQAVAQMDQVTQQNAALVEEATAAAHSLEEQAAALRQSVAAFRVAQH
FT                   GGGGAAVVHQPAPAPRRPAAPKAEPVLPQVPKAPKAPKAPKALKALKAQPARAARTESA
FT                   DAGDNWEQF"
FT   gene            complement(641165..642556)
FT                   /locus_tag="Reut_B4002"
FT   CDS_pept        complement(641165..642556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4002"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4002"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63358"
FT                   /db_xref="GOA:Q46U26"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63358.1"
FT                   /translation="MDNDPAQAGTGPFPRLRHGFGIRPGESGAVVAGFLFFFCLFASYF
FT                   MLRPVRETMGIAGGVKNLQWLFTATFVVMLAAIPIYGACCAWLPRRRFVPWVYAFFVAN
FT                   LVGFALATRAAPDNVWLARVFYVWLSVFNLFVVSVAWSLMADVFRPEQARRLFAMLAAG
FT                   ASAGGLAGPVMGGWLVVHIGLTGLMLLSAALLAATLPGAGWLFGWRSRAGAGVAVAGDS
FT                   TARTGANMDPSHPVGGGLWAGLALVMRSRYLLGISLFVILLATASTFLYFEQARLVAEA
FT                   FPERARQTQVFSALDAIVQALTIIIQLFFSGRIARRYGVSALLTAVPLAVVAGFLLLAM
FT                   FPTFGVLAGVMILRRVGEYALLRPGREMLFTVVDPETKYKAKNVIDTAVYRAGDAVSAW
FT                   VKTGIDAISGHAATVALAGAAMALLWAVLGWWLGRRHELQLMPSVAAAAGETPDTPASS
FT                   ATQPR"
FT   gene            complement(642560..643375)
FT                   /locus_tag="Reut_B4003"
FT   CDS_pept        complement(642560..643375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4003"
FT                   /product="Aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4003"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63359"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63359.1"
FT                   /translation="MRRTIPGTTEALPVVGMGTADTFNVGTGADERAPLAEVLGLLLRN
FT                   QGSVVDTAPSYGSAEAVTGDLLRNAGARAKVFLATKVSAPAGASAQAQWARSLADLHTD
FT                   KVDLLQVHNLIDWRENLRWMRELKEQGKIRYLGITHYREDAQDAVAQIVRSERVDFVQI
FT                   NYSLAERGAERTLLPLCQSRGVAVLINRPFQDGRMFRAVKNRPLPPWAGEIDCNSWGQL
FT                   FLKFVVSHPAVTAAIPATSKPKNMADNLGAALGRMPDAGQRERIAALLA"
FT   gene            643718..645088
FT                   /locus_tag="Reut_B4004"
FT   CDS_pept        643718..645088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4004"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4004"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63360"
FT                   /db_xref="GOA:Q46U24"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63360.1"
FT                   /translation="MDPSAKLNADSLGIVESVIMGIAGTAPAYSIEITTSTIIGTAGTL
FT                   SPASILVCGLIMFGIAFAFINLNRALASAGTSYAWVSMVFGRAFGFLAGWALLVLCCVF
FT                   MVSAMIPAANATLLVFDRPKMNNVHYVTLIAAAWLTFVSAVIVKGIKLTSYLQVLMTVI
FT                   EGAILLVIIIASFLTFPHAPQHPFSLAWFWPFAFSPGMFANCALIAIFFFYGWDVTLNL
FT                   SEETRDPNRIPGRAAFWSMVFLMTFFLVFIVITLLGLSDAEIQHYNTNVIFAIAEKLFG
FT                   PTWGYVAIIAVLLSTVGTVETQMLQFTRTLFATSRDGALHHRYARLHPRWRTPHFAIFF
FT                   IWIAGLVLLFASSYLPTINVILQDSITAIGFQICFYLGLTGLACGWYYRSMLAQGPWHA
FT                   VSHVIWPVGSGLFLFFIAIYSIPTFDWVTNVVGLGGIACGAVPLALNRRKIWASPAA"
FT   gene            645168..645806
FT                   /locus_tag="Reut_B4005"
FT   CDS_pept        645168..645806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4005"
FT                   /product="DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4005"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63361"
FT                   /db_xref="GOA:Q46U23"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63361.1"
FT                   /translation="MDSISMWQLLLHFDQHLGAAIAHYGPLVYAILFAVVFAEIGVLPL
FT                   FFLPGDPLLFICGAFCASGYLSLWVLMPLLFVAALGGSLLNYGVGRAIGMKVLGRQLRW
FT                   IDQAALERTHRFYAEHGDVTFLLSPFIAVVRTFAPFVGGIAGMGAARFLLAAAAGALLW
FT                   SVSLPVLGYFFGNVPQVRDHMGAIVLSGIVMGVGALVVANVWRRLRVGR"
FT   gene            645961..647148
FT                   /locus_tag="Reut_B4006"
FT   CDS_pept        645961..647148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4006"
FT                   /product="Aromatic-ring hydroxylase"
FT                   /EC_number="1.14.13.2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4006"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63362"
FT                   /db_xref="GOA:Q46U22"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63362.1"
FT                   /translation="MRTRVAIIGAGPAGLLLGHLLQRAGIDSVILEDCTQAHVEARIRA
FT                   GVLEQGTVDLLEEAGVAARLREQGMVHHGIDLLFDGQRHRIDLSGLTGGRAITVYGQHE
FT                   VVRDLIAARQACGAPLLFEVSQVALHGLDTQSPSLSFEHGGQRHVLACDFIAGCDGSHG
FT                   VSRHAVPAGALQVFERSYPFAWLGILASAAPAAQELIYASHARGFALFSMRSPEITRLY
FT                   LQCRPDEDLAGWTDRRIWDELHARLETGDGWHLNEGPVLQKGITPMRSLVTEPMQYGRL
FT                   FLAGDAAHIVPPTGAKGMNLAVADVRNLAHALVTHYRHGRDDLLAGYSSACLARVWRAE
FT                   HFSWWMTSLLHRFDDHTPFTARLQHAELAYVCASQAASRMLAENYVGLPFAPLPA"
FT   gene            647200..648063
FT                   /locus_tag="Reut_B4007"
FT   CDS_pept        647200..648063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4007"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4007"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63363"
FT                   /db_xref="GOA:Q46U21"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63363.1"
FT                   /translation="MTSLLGVLFDGLAYGSLLFLISVGLSVTMGLMNFVNLAHGAFAML
FT                   GGYVAVVLMNRAGVPFLLSLLIAFAGAAAAGWVLERTLYRRLYQASHLDQVLFSIGLTF
FT                   MAMAGANYLFGPGQQPVELPAALRGQVRVGGVDLGVYRLFLIGVVVAITATLGWLVART
FT                   RFGAQVRAAVDNQQAARGLGINVDRVFSLTFALGSGLAGLGGGLGVDMLGLDPAFPLKY
FT                   MVYFLLVVAVGGAGSIRGPLLAALVLGVADVAGKYYVPAVGAFVIYAMMVLLLVLFPAG
FT                   LYGRRA"
FT   gene            648060..649118
FT                   /locus_tag="Reut_B4008"
FT   CDS_pept        648060..649118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4008"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4008"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63364"
FT                   /db_xref="GOA:Q46U20"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63364.1"
FT                   /translation="MKTLMRAMRPAASSGEAAGAPAPARRKLPDGRWHPAEFLFWLLPV
FT                   AAFFALPDYLILGSQILISGLFALSLDLILGYAGIVSLGHAAFFGLGAYTAGLLAAHGW
FT                   GEPLSGLLAAAAMAAVAGWLCSFLVVRGGDLTRLMVTLGIGLMLFEAANKAAFVTGGVD
FT                   GLSGVAMDRLLGVFEFDLIGKTAYVYSLAATFALFLLLRRLTQSPFGLSLRGIREGGRR
FT                   MPALGADVPRRLRTTFTLSAAIAGVAGALLAQTTQFVGMDVLGFPRSAELLVMLVLGGT
FT                   GRLYGALAGAALYMIAQDVLAGMNPVYWQFWIGLLLVLVVLFARGGVMGAMDAARSRLT
FT                   RRTGTRLEGGAP"
FT   gene            649115..649867
FT                   /locus_tag="Reut_B4009"
FT   CDS_pept        649115..649867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4009"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4009"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63365"
FT                   /db_xref="GOA:Q46U19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63365.1"
FT                   /translation="MTAVLRTEGLSRQWGAFVANSDISLNFAPGTRHALIGPNGAGKTT
FT                   FINLLTGALAPTSGRIWLGTQEITKLPQHARVRLGMTRTFQINTLFPGLTVLESVVLAV
FT                   AERTGAARIWSRTVASQRALVDEAMAVLASLRIDGEADVETRCLPYGKQRLLEIALALA
FT                   TRPSILLLDEPAAGIPSAESAELFDVIAALPREITIVFIEHDMDLVFRFAERITVLVGG
FT                   KVLTEGAPAEIAADLRVKEVYLGEAVHG"
FT   gene            649860..650561
FT                   /locus_tag="Reut_B4010"
FT   CDS_pept        649860..650561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4010"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4010"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63366"
FT                   /db_xref="GOA:Q46U18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63366.1"
FT                   /translation="MGELLRIDGLSAGYGDAVVIDGIDLALGSGDSLALLGRNGVGKTT
FT                   LLATLMGFTRVRRGTLCWQGRDLARLPSHQRAQAGIGWVPQERWVFPSLTVEENLSAVA
FT                   RPGHWTLARVYELFPRLQERRRNLGNQLSGGEQQMLAIARALMLNPALLLLDEPMEGLA
FT                   PIIIQELQRVIGNLIGQGGMAVIVVEQHARLALAMTAQAMVLDRGRVVHASDSASLLAD
FT                   KRRLDRLMGIG"
FT   gene            650744..651373
FT                   /locus_tag="Reut_B4011"
FT   CDS_pept        650744..651373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4011"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4011"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63367"
FT                   /db_xref="GOA:Q46U17"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63367.1"
FT                   /translation="MTLYQIKPKFQALLRPTVQRLAASGVTANQVTLAAAAGSLVVGAL
FT                   AGGLAWLPAVFLLMPLWLFVRMALNAIDGMLAREHGQQSVLGAYLNELGDIVSDLALTI
FT                   PFAWAMPSSGGEVILFAILAVVAECAGLIGPLAGASRRYDGPLGKSDRALVLGALGFWV
FT                   GCGQGLGGFGHWFWILLSLLTVLTIINRVRRGVQEARESQARRSTF"
FT   gene            651391..653166
FT                   /locus_tag="Reut_B4012"
FT   CDS_pept        651391..653166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4012"
FT                   /product="Alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4012"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63368"
FT                   /db_xref="GOA:Q46U16"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR022744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63368.1"
FT                   /translation="MERTPIESSFATHDGQELFYRHWPAASRQPRGAVLLFHRGHEHSG
FT                   RVAHLVDELDLPDHAFFAWDARGHGRSPGERGYSPGLACSVRDIQTFVDHIATMHGIGV
FT                   DRIAVVAQSVGAVLAATWVHDYAPRIRCLVVASPAFKVKLYVPFARPGLKLMQQMRGKF
FT                   FVNSYVKAKFLTHDPQRVASYNADPLITRPIAVNMLLDLYDAGERIVADAAAITVPTQL
FT                   LISGADWVVHRGPQDAFFDRLGARVKERIVLDGFYHDTLGERDRASAVAAARRFIVREF
FT                   DTPSEPVSLLGADRRGPFKDEADRLAVPLSAGSPAGLYWGMVRGGLRFGGMLSEGVRLG
FT                   HQTGFDSGSTLDYVYRNKATGRFGIGQAVDRNYLDAIGWRGIRQRKLHVEELIGEAIRR
FT                   LQAMGEPVRIVDIAAGHGRYVLEALTSQSGNIDGNAVESILLRDYSDLNVEQGRNLIRR
FT                   KGLDPIARFEKGDAFDGDSLAALNPAPTLAIVSGLYELFGDNEMVGCSLRGLAQAVRPG
FT                   GYLVYTGQPWHPQLEFIARALTSHRAGSAWVMRRRSQAEMDELVRHAGFEKLAQRIDPW
FT                   GIFTVSLARRKGEGA"
FT   gene            653166..654560
FT                   /locus_tag="Reut_B4013"
FT   CDS_pept        653166..654560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4013"
FT                   /product="dual specificity protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4013"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63369"
FT                   /db_xref="GOA:Q46U15"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63369.1"
FT                   /translation="MQRDGAAYGSATLGGNPAPGRPWRLALGLLAIMGALFFSSYGLAN
FT                   WLASQRADVPYFHFGWERGIPFVPWSIVPYWSIDLLYGISFFLWATRADLLAHVKRLLA
FT                   AQVISVACFIAFPLRFAFARPPAEGLPGQLFTLLGGFDKPFNQAPSLHISLLVILWVAY
FT                   AAHLRGVWRWLLHIWFALIGVSVLTTYQHHFIDIPTGWLVGWLCVFAFPMALPRPAVGP
FT                   DASTPDPRLARSYALAAGLLGLACVAVVSVSVLAAFLLTSAAISLGCVAMIYRAGKPGA
FT                   FQKRADGTLSMAAWWVLWPYLLGAFANSRWWTRRQPAVSRLTDGVWIGRLPAEVELRES
FT                   GADAVLDLTAELPRLVTGVLYRCVPVLDLTVPSQTQIRAGVEVIERWQQDGRTVLVSCA
FT                   LGYSRSALIAAAWLGLHARLRDPQQVLALLRQSRPAVVLGPQSVDALAHYLQASVADPQ
FT                   GAAHAD"
FT   gene            654550..654996
FT                   /locus_tag="Reut_B4014"
FT   CDS_pept        654550..654996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4014"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63370"
FT                   /db_xref="GOA:Q46U14"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63370.1"
FT                   /translation="MPTEAHPLPASDAWVARIAAGAMHAAARLNGAGLVLAMVNLLLAG
FT                   YFAPASLVYLILGLVAAVVGAAELWLLARVELDRRLFDALAESGDAAELDALDQALSVF
FT                   GWLAPGRKGRSVVERSRGALRFLKLAGALTFAQLVLALLLLLLK"
FT   gene            655004..655639
FT                   /locus_tag="Reut_B4015"
FT   CDS_pept        655004..655639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4015"
FT                   /product="Phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4015"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63371"
FT                   /db_xref="GOA:Q46U13"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63371.1"
FT                   /translation="MTWLSRLVARAIILFAQMLTGMQARWNGCLPEAIQRVYFANHSSH
FT                   GDFVLIWGCLPPDLRAATRPVAGADYWEASPMRRFIGRDVFRALLIDRTAGRDGAGPDP
FT                   IAQMEQALQGGASLIIFPEGTRNTTDDPLLPFKSGVFHLARACPDIEFVPVWIDNLNRV
FT                   MPKGEVIPVPLLCTVTFGTPLRLQPEELKESFLSRCREQLLALAPALE"
FT   gene            655644..656600
FT                   /locus_tag="Reut_B4016"
FT   CDS_pept        655644..656600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4016"
FT                   /product="Phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4016"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63372"
FT                   /db_xref="GOA:Q46U12"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63372.1"
FT                   /translation="MSSIQAIHDTRVLFGGVLCVLLLASLMTALLRWRVAGGAPHAVID
FT                   NLAARVSAWWWMVAVLGIAFAMGRTAIIVLFGLLSFYALREFITITTTRRGDHRAMVAA
FT                   FFVFLPCQYILVYIGWYGLFSIFIPVYAFLILPILSALSSETTRFLERCAGVQWAVMIC
FT                   VFCISHVPALLTLPIPGYEDRNLLLIAFLVIVVQGSDVLQYVWGKLFGKRKIAPLLSPS
FT                   KTVEGFVGGVASATALGASLWWITPYGSPWMAGAIALVIALMGFFGGLVMSAIKRDRGI
FT                   KDWGHMIQGHGGMLDRLDSVVFAAPVFFHLTRYWWVP"
FT   gene            complement(656635..657810)
FT                   /locus_tag="Reut_B4017"
FT   CDS_pept        complement(656635..657810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4017"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4017"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63373"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63373.1"
FT                   /translation="MTFTLLQRAIVACGALALLSAAAHAADPIKIGLIAPFSGSFADYG
FT                   KQMEAGVKAYQSLHGDTVAGRKVQVIMKDTTGPVPDVAKRLAQELVVRDKVDILAGFGL
FT                   TPEALAVAPVAEQAKKAMVIFNAASSVITTKSNYIARVSMTLPQISAPMATWAVKNNVR
FT                   KVVTLVADYAPGIDAETAFKTNFIGGGGQIIESIRVPLRNPEFAPFIQRIKDAKPEAVF
FT                   LFLPAGEQGVAFMKGFRERGLAEAGIRVIATGDLTDDHVLPAMGDSTLGVITSFHYSMA
FT                   HDSRENKAFLSAYSAANPGAGRPNFMTVAAYDGMAAIYEALKKTNGATDGDKIIGALKG
FT                   MKIMSPRGPIMIDPATRDVIQTVYIRKVEKRGSELYNIEFDKFADVKDSGK"
FT   gene            complement(657932..659293)
FT                   /locus_tag="Reut_B4018"
FT   CDS_pept        complement(657932..659293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4018"
FT                   /product="gluconate permease GntT"
FT                   /note="TC 2.A.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4018"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63374"
FT                   /db_xref="GOA:Q46U10"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63374.1"
FT                   /translation="MGAVTGTTLLVYALIAVIALVILIARFKLNPFITLVVVSVLLGFA
FT                   VGMPMGDIIKSFEAGVGGTLGHIALVVGLGTMLGKMMAESGGAERIARTLIDFFGEKNV
FT                   HWAMVTIAFIVGLPVFFEVGFVLLVPIAFNVAKRTGTSMVLVGIPMVAGLSVVHGLIPP
FT                   HPAALLAVTAYGADIGRTIMYALIVGIPTAAIAGPLFAKLMDRYVKLPDVNPLAAQFTE
FT                   EDEKVKESHDLPGFGITVFTILLPVLLMLIGSWADLFTTPKTFANDFLKLIGNSVMALL
FT                   IAALVSFYTFGKARGFNRDAILKFTNECVAPTAIITLVVGAGGGFGRILRDSGISNAIV
FT                   DVATNAHVSVLVLGWLVAVMIRIATGSATVAMTTAAGIVAPIAASVPGTRPELLVLTTG
FT                   AGSLILSHVNDGGFWLVKEYFNMTVTQTFKTWSVCETLISVVALLLTLALATVV"
FT   gene            complement(659436..659828)
FT                   /locus_tag="Reut_B4019"
FT   CDS_pept        complement(659436..659828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4019"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4019"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63375"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63375.1"
FT                   /translation="MDIKRFGVEGGTGQGGQHMPFARAVAADGWLYVSGQVPMVNGELV
FT                   DGGIVPQTHQAIKNVLAILAEAGYGPEHVVRCGVWLDDARDFASFNKIFKEYFGANPPA
FT                   RACVQSSMVVDCKVEVDCIAYKKPAA"
FT   gene            complement(659869..661332)
FT                   /locus_tag="Reut_B4020"
FT   CDS_pept        complement(659869..661332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4020"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4020"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63376"
FT                   /db_xref="GOA:Q46U08"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63376.1"
FT                   /translation="MPHLFDTLIRCVMLIDGSGAAARMADVALRDGRIASIDDAGAIDA
FT                   DSAAHVVEGHGLVLSPGFIDVHTHDDTNVVRQPEMTPKLSQGVTTVIVGNCGISAAPVV
FT                   LSGDPPDPMNLLGHADAFRYPDFRSYVQAVDAAQPSVNVAALVGHTALRSNHMDRFDRA
FT                   ATPAEIAAMRAQLEEALQHGALGLSTGLAYANAFSAPTEEVLALAEPLAHAGALYATHL
FT                   RSEFAEILDAMDEAFRIGRHARVPVVISHLKCAGVPNWGRSTEVLDALDAAQRWQPVGC
FT                   DCYPYTASSSTLDLKQVTSDFDIMVTWSEGAPEMGGRLLAEIAAEWQVDLHEAARRLMP
FT                   AGAVYHCMEDADVDRILSHPATVVGSDGLPNDPLPHPRLWGAFPRVLGHYARDRELFPL
FT                   AVAVNKMTGMSAERFGLTERGFVREGYWADLVLFDANTIRDAASFTDPMQPAEGIAAVW
FT                   VNGELSWQQRQPTGVRAGRFLPRGAQPAA"
FT   gene            complement(661336..662256)
FT                   /locus_tag="Reut_B4021"
FT   CDS_pept        complement(661336..662256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4021"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4021"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63377"
FT                   /db_xref="GOA:Q46U07"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63377.1"
FT                   /translation="MTAPFDILTRIAERGPALRLAEQKVAQVVLEDLAGAAAASINELA
FT                   RKAGVSEASVTRFAKAIGCRDVRDLKLRLAQATAVGMRFLDPDGVPAPADAPATVADRI
FT                   HADVLTALEVNRKLIDTDRMEQAARLLLGARMVYAFGMGGGSSIMADEARHRLARLGQP
FT                   VASYQDGLLQKMVAATLSRDDVVLAFSASGSVPEMLASCDIAREYGAKLVAVTALGSPL
FT                   AARADVLLPVRTLETDFIFKPSASRYAMLLVLDVLATQCALLQQDQSKERLRRLKYVLD
FT                   AHRGPAGERGPDSGAGPDGRQPLGD"
FT   gene            662452..663720
FT                   /locus_tag="Reut_B4022"
FT   CDS_pept        662452..663720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4022"
FT                   /product="dsd, RSp1185; probable D-serine deaminase
FT                   (d-serine dehydratase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4022"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63378"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63378.1"
FT                   /translation="MREIKYQAGTIDPLNKALGRLEAPIAPENAGQTGWNLLREELSLP
FT                   AAVLYEDRLAHNLEWMNRFMGEYGVQLAPHGKTTMAPKLFARQLGAGAWGITLATAHQT
FT                   AAAYAHGVRRVLMANQLVGRRNMEIIADLLRDPGFEFFSLVDSADLVDQLGAYFRERGQ
FT                   KLQVLLELGVEGGRTGVRDAAQQADVLAALARWPDALSLAGVEIYEGVLKEEADIRRFL
FT                   QRTVAVTREIAQEGRFGRSPVVMSGAGSAWYDVVAEEFARTEIGTPIEIVLRPGCYLTH
FT                   DVGIYKAAQERILASNPVAQKMREGLLPALQLWAYVQSVPEPERAIIGMGKRDAAFDAG
FT                   MPTPAAIYRPGSDAPLAVPAHWEVTGMMDQHAYLQIRAGDDIRVGDMIAFDISHPCLTF
FT                   DKWRHIPVLDGDMRVIDIVQTFF"
FT   gene            663733..664668
FT                   /locus_tag="Reut_B4023"
FT   CDS_pept        663733..664668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4023"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4023"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63379"
FT                   /db_xref="GOA:Q46U05"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63379.1"
FT                   /translation="MSIDILAYGEPLVEFNQQPDDPTRYLQGFGGDTSNFCIAAARQSA
FT                   TTGYISAVGADSFGERLMALWTRERVDTRHVRVDPVAPTGVYFVSHDNHGHRFDYLREG
FT                   SAASRYQHEHLPLGAIAQASFLHLSGISLAISTSACDAGLAAMEHARKAGTKVSLDTNL
FT                   RLRLWSLARARGIMREAFSLTDVCLPSWDDITVLTGLDDRDAIVDYLLGCGIGLVALKL
FT                   GEEGAYVATPESRTLVQPFAVKPVDATGAGDCFGGSFIARLAAGADPFEAARYANVAAA
FT                   LSTTGYGAVAPIPSAETVLARLAQSVSVIA"
FT   gene            664709..665350
FT                   /locus_tag="Reut_B4024"
FT   CDS_pept        664709..665350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4024"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4024"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63380"
FT                   /db_xref="GOA:Q46U04"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63380.1"
FT                   /translation="MQLQPSPLLARLANVPVIPVLEFGSVDEALHVSEALVAGGLPLLE
FT                   ITLRTPVAMDAMRAVAAKIPGACVGAGTVLTVEQLHAVRDAGAQFAVSPGLTPTLAAGA
FT                   QDAGISLLPGVATASEAMAALESGFTFLKFFPAQAAGGVPMLKSLYGPLAQLRFCPTGG
FT                   IDAALAPSYLALPNVVCVGGSWVVPKDAVAAGDWGRIRKLAEDAAALRRG"
FT   gene            complement(665702..667207)
FT                   /locus_tag="Reut_B4025"
FT   CDS_pept        complement(665702..667207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4025"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4025"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63381"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63381.1"
FT                   /translation="MPTALSCRPACRMIVVAPHRTPRYCLHGNVQSQWQNTITTTERGS
FT                   VDSSRHLAGLACKRDCMHQDDADDSAGQRAGNAYDMVQPAAFVAALGNCRATFAGAPLV
FT                   ILVIRLDRFASACESAGPRRAAHLRQLVQARLARLLLPEARMYWLGPADLAVVTPLPAA
FT                   TQDPARLGQRMADELGRPFTLDGFELFLSCSIGMSLDHPDVAAERSLQHAFDAMLRICR
FT                   QGGDGLASAMRAGTPAADQMLAALPQALERGELSLHLQPRADFAGARISGYSVRLRWRH
FT                   PALGRVAPQDFLPALEGLGLMGPVGNWLLGSLAPLARAAEDVGPLQFTLLASSAQLHQL
FT                   EMVDALARTLDAGAVAPERLCIEVPSTNLPDDPELIGSFEALRQRGLQLSLSDFDGRPE
FT                   SLETFAWLRPDRVTLDVRSLGHADQPANAAAGLRDACTVARKAGVMVCAKGVETRKQLE
FT                   QVHAWGCHSIQGYLLAQPFPANWLAQTHWAIQQRARELLGPAG"
FT   gene            complement(667290..668603)
FT                   /locus_tag="Reut_B4026"
FT   CDS_pept        complement(667290..668603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4026"
FT                   /product="CBS:Protein of unknown function
FT                   DUF21:Transporter-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4026"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63382"
FT                   /db_xref="GOA:Q46U02"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63382.1"
FT                   /translation="MEIAILLALILLNGLFAMSEIALVTARRARLQRQVEEGDRGAIEA
FT                   IKLGEDPTRFLSTVQIGITSIGVLNGVVGESTLAQPLGVWLQGLGLPQTTAGYVATAIV
FT                   VAGLTYFSIVLGELVPKRLGQMAPETIARLAARPISWLAVASTPFVKLLSGSTRLVLRL
FT                   LGVNTNRGPGVTEEEIHALLVEGSEAGIIEQHEHTMVRNVFRLDDRQLASLMVPRGDVV
FT                   YLDVEVPLDENLKRIEESDHSRFPVVRGGMHDIVGVVSARQLLARRLRGEEADLMAAVQ
FT                   PAVFVPESVTGMELLENFRGSGGQIAFVIDEYGEVLGLVTLQDLIEAITGEFKPDSADE
FT                   EWAIQREDGSWLLDGLIPIPELKDRIGLRQVPEEEKERYHTLSGMLLLLLGRLPQTADS
FT                   VQWGDWRFEILDMDGKRIDKVLASRVAASEGPEDETTG"
FT   gene            668771..669655
FT                   /locus_tag="Reut_B4027"
FT   CDS_pept        668771..669655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4027"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4027"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63383"
FT                   /db_xref="GOA:Q46U01"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63383.1"
FT                   /translation="METLTPGSETALDFPDLLRYWRGRRGYSQLALSLAAGVSQRHISF
FT                   LESGRSRPSREMVLALAERLGVPLRQRNRMLLAGGFAPAYSEYKLVSPPLQMVQQAISL
FT                   ILAKQEPFPAVVLDRFWNLVDANAAYRRMLEVLLDDGRVPVALGDGGGRINLMLTVFDP
FT                   NGLWPVIENARQVGRYLLRRVWQELQVQANDEIAREIFARIAVWHPDMVGAGGVLLPDD
FT                   EATDGPPPPVLPVTLRAGAFRASLFSTITTLGIPQDVTLQEMRIECFFPADDATREVFE
FT                   ALAHDPSPAPQKR"
FT   gene            complement(669643..670269)
FT                   /locus_tag="Reut_B4028"
FT   CDS_pept        complement(669643..670269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4028"
FT                   /product="probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4028"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63384"
FT                   /db_xref="GOA:Q46U00"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q46U00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63384.1"
FT                   /translation="MRPMPEDRPGCSAQRTMRRKRCRGMGIRQAALATVLSAATFGPSL
FT                   AQAAPPIPAVQIGYGIDTSHDIQKVDVAFLWDSGYAWGNPEGWLLDLQWEVNVARWHST
FT                   SSNNPRNPWEFGASPVVRLAWRRYSWVPFLELSVGVRLISETRTSDDHNYSTAFQFSDM
FT                   AGLGVAFGKAQQFTVGYRYQHISNAGIKQPNPGTAFSTVYVRYRF"
FT   gene            670802..671473
FT                   /locus_tag="Reut_B4029"
FT   CDS_pept        670802..671473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4029"
FT                   /product="3,4-Dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4029"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63385"
FT                   /db_xref="GOA:Q46TZ9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46TZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63385.1"
FT                   /translation="MPSLSHESDSITLAADADERPLALRIAQALDAMREGRPVVLLDDD
FT                   DRENEADLILAAECLTPSNMAMMIRECSGIVCLCLTTDKVRQLGLRPMVENNRSQYGTA
FT                   FTVSIEAREGVTTGVSAVDRITTIRAAIAKDAGTDAVVSPGHVFPLVAVDGGVLVRRGH
FT                   TEGSVELARMAGLSPAAVLCELMNPDGTMARRPEALSFAEMYRLPILTIADLVAWREIH
FT                   G"
FT   gene            671555..672109
FT                   /locus_tag="Reut_B4030"
FT   CDS_pept        671555..672109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4030"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4030"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63386"
FT                   /db_xref="GOA:Q46TZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63386.1"
FT                   /translation="MLFRIFRCAAVLYGCAISVAAHAEPVAGFDNRPAAAAGLYECQQP
FT                   SGTTVFRSTPREGCAVLAAPDPAAPDPQRWLPLMGANGVISYFDQVAVKRAGPEVGVVV
FT                   MRNAPSGVIRTTSGEPIRSSLKRMVLNCASSMVAVVEQTLYTKRFGKGEALYTIRSPQL
FT                   SRFHPAASGSVAAELLRRLCR"
FT   gene            complement(672125..672535)
FT                   /locus_tag="Reut_B4031"
FT   CDS_pept        complement(672125..672535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4031"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63387"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63387.1"
FT                   /translation="MLSRQARRLSTVALASALGATLMFAVTTPARAYFDSYLSGTIIGK
FT                   MSKDEAASFAKSVRKALNDTADGQSVSWEFPATGKRLPVDGTLTPVTTKTDQGQSCRRL
FT                   KTDLKRGSAEEHWSGWFCKQKDGQWKSRQVAD"
FT   gene            672818..673189
FT                   /locus_tag="Reut_B4032"
FT   CDS_pept        672818..673189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4032"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4032"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63388.1"
FT                   /translation="MKLRHLTLGLALAAAFGVVHAQSPAKGGKFDPYTDGAKAGKFDTY
FT                   TDGAKTGKFDPYTEGAKSDNMTSLAPGARTDQLEPIQGAQRVGKSDPYTDGAKAGKFDT
FT                   YTDGAKQGKFDTYTDGAKQ"
FT   gene            673545..675146
FT                   /locus_tag="Reut_B4033"
FT   CDS_pept        673545..675146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4033"
FT                   /product="Periplasmic glucan biosynthesis protein, MdoG"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4033"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63389"
FT                   /db_xref="GOA:Q46TZ5"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63389.1"
FT                   /translation="MSSNTSPRLSEPSPARSFVRVRSQGVSGTARVRMARWLGGGALAV
FT                   LAMAAHAFDFDTVAARARQLAASPYKAPAQNLPRELRELSFEQYREIEYKPERFAWRNA
FT                   RLPFELSFFHEGMVFDQPVRIHEVVSGNVREFRFDPAAFNYGPHKVDAARLKNLGFAGF
FT                   RVLYPLNQGKRKDELASFLGASYFRALGKDQWYGLSARGLAVDTALNSGEEFPRFVEYW
FT                   IERPSASDKQLTIYALMDSRRVSGAYRFVIKPGEETSMEVKSRLFLRENVTKLGLAPLT
FT                   SMYLFGENQPSTDADFRPEVHDSDGLSIHLGTGEWVWRPLVNPKRLLVTSFAATNPQGF
FT                   GLMQRDRSFNNYQEIGAWYERRPSGWVEPRGNWGSGRVELVQIPTPDETNDNIVAYWVP
FT                   DNPPKPKQPFDYEYRLMWQKDGEQMPPLSWVTQTRMGQGVTRNKEDTSFSLVVDFEGPA
FT                   FRKLPADVRIDPVVSADANAELLKTSVQRNDATGGWRMTMVMRRKDANKPVELRGYLRN
FT                   GNTTLSETWSYILPPG"
FT   gene            675119..677704
FT                   /locus_tag="Reut_B4034"
FT   CDS_pept        675119..677704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4034"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4034"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63390"
FT                   /db_xref="GOA:Q46TZ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46TZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63390.1"
FT                   /translation="MELHLTPRLKQRPAQAAACERYVDRLPVSSELRSELLADPSMPAS
FT                   AGISIDPRDAQAAIEQLQSRLSAREPAKGETPEPGGSTYGSVGRRFSLAYGNPQVAGEP
FT                   LLKRRPDGTVHVDTGPEPQRSSMVPRQWPPHIVTGWVRNTWRRMLGRPPVPETWDTLHD
FT                   GPDAEGKWHPAGSHRRWFLLGLVVAQTTLATYFMTKVLPYHGADLLEIAILVLFAVLFS
FT                   WVSAGFWTAMMGFLVLAKGGDRHLISRSAAPDAPLAPDARTAVIMPICNEDVTRVFAGL
FT                   RATYESLGRTGHLANFDFIVLSDSGNPDLRTAEVDAWMEVCRAVGGFGRIFYRWRRHRV
FT                   KRKTGNVADFCRRWGSKYRYMVVLDADSVMSGDCLATLVRLMEANPGAGIIQTSPLAVG
FT                   RETLYARVQQFATRVYGPLFTAGLHYWQLGESHYWGHNAIIRVKPFMEHCALAPLPGRG
FT                   PLSGEILSHDFVEAALMRRAGWGVWIAYDLHGSYEELPPNLLDEVKRDRRWCQGNLMNF
FT                   RLWLKQGFHMVHRAVFLTGIMAYLSAPLWFLFLLLSTAMLARHALVPPEYFTQPYQLFP
FT                   TWPEWHPEKALALFSATATLLFLPKVASILLLVRQARQYGGLPRLVMSMLIEVVLSALL
FT                   APTRMLFHTKFVIAAYSGWGISWKSPPREDAETTWGEAVRRHGSHTLLGLAWGALVYWL
FT                   NPSFVLWLLPIVGSLALSIPLSVMLSRVSFGRASREAGLFMIPEEALPPREIVETQQHV
FT                   EQATETPNFVDAVVDPVTNALMCATASARVVQPASAKERHAALVQHALTGGPRALTASQ
FT                   RHILLGDPFALSKLHELVWGSPLADAGWKNIRLLVRRAPNVLPLRPRVA"
FT   gene            complement(677755..678399)
FT                   /locus_tag="Reut_B4035"
FT   CDS_pept        complement(677755..678399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4035"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63391"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63391.1"
FT                   /translation="MRQTDGRAEMGDRFAPATLSCMRIRHTPLTASLGSAALAAALLLP
FT                   WPVQSAPAPMRPPPASAPAPVFDEADAMSRMLKGAATGQNTGAAGVPELLRSTNRPDGV
FT                   LARACRLLNDALPIEIDGETRLRRCQSTPGKHVLFQLELTNYRGPMLDLASFEVNYAAP
FT                   LQRNICANRDVEILTKLGVSMMFRYMTRNDRGERRVGDVYINAPICTSALR"
FT   gene            678720..679940
FT                   /locus_tag="Reut_B4036"
FT   CDS_pept        678720..679940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4036"
FT                   /product="Drug resistance transporter Bcr/CflA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4036"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63392"
FT                   /db_xref="GOA:Q46TZ2"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63392.1"
FT                   /translation="MPQSSRSQKAARFPAWLLICASLTAIAPLSIDMYLPSFPALAADM
FT                   RVDIGQIQLTLGTFLVGLALGQAFYGPISDRFGRKRPLYVGLGLYALAAAGCAMARSAE
FT                   SLMLWRFLQALGGCAGMVMARAVIRDRLDAHESARAFSSMMLVMGLAPILAPIIGGAIL
FT                   SASGWRAIFWLLTLAGLLILALVHFRMEESLPRERAAPLHPGAIVASYTGLLRDREFLG
FT                   YSLSAGFGQAGMFAYISGSPFVLIELNGIDPSHYGFVFGANALGLIGMSQLNARLVHGR
FT                   TLDSVLRRAVLAPCAAGLILAAAALAGVLVLPVLLAGFFVFIGSLGCITPNASALALTH
FT                   QGHRAGTASALMGTLQFSLGTVAGAAVSLWHDGTALPLAVVMAACGMGAVALRAWACAG
FT                   SSARAAA"
FT   gene            complement(679945..680772)
FT                   /locus_tag="Reut_B4037"
FT   CDS_pept        complement(679945..680772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4037"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4037"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63393"
FT                   /db_xref="GOA:Q46TZ1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63393.1"
FT                   /translation="MDASTLEKLQVVVIAYATEFGVKILAALAFWIIGRWLIHVVVRMV
FT                   QNALGRQQVDPTLLRYVGSIVTVALNVVLVIGILGYFGIQTTTFAALIAAAGVAIGMAW
FT                   SGLMANFAAGAFLVVLRPFKVGEFVTIGGITGTVREIGLFATTLDTPDNVLTVIGNNKI
FT                   FSDTIQNFSANPFRRVDLKAQLAGSTDASAAVTLLKERIAAIPNVLADPPVDVEILEFT
FT                   LVGPVLAVRPYCHNDHYWQVYFDTNRIIRESFGQAGYAAPMPAQMVVVKNAAA"
FT   gene            complement(680963..682165)
FT                   /locus_tag="Reut_B4038"
FT   CDS_pept        complement(680963..682165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4038"
FT                   /product="ammonium transporter"
FT                   /note="TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4038"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63394"
FT                   /db_xref="GOA:Q46TZ0"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63394.1"
FT                   /translation="MDNWKTGTDAMFILLGAIMVLAMHAGFAFLELGTVRKKNQVNALV
FT                   KILVDFAVSTIAYFFIGYTVAYGVQFMSGADTLAQKSGYELVKFFFLATFAAAIPAIIS
FT                   GGIAERSRFNPQLCATFVLVGFVYPFFEGIAWNQRFGIQDWITHLTGAPFHDFAGSVVV
FT                   HAVGGWIALPAVLLLGARRGRYQKDGRISAHPPSNIPFLALGAWVLAVGWFGFNVMSAQ
FT                   TVDKISGLVAINSLMAMAGGTLAAWWAGRNDPGFAYNGPLAGLVAVCAGSDLMHPVGAL
FT                   VTGAVAGVLFVHLFTLAQNKWHIDDVLGVWPLHGLCGAWGGIAAGIFGSHALGGIGGVS
FT                   LGAQLIGTLLGIVIAVAGGTIVYGTLKKLVGIRLDAEAEFNGADLTLHRISATPERETN
FT                   W"
FT   gene            682686..682967
FT                   /locus_tag="Reut_B4039"
FT   CDS_pept        682686..682967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4039"
FT                   /product="HU family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4039"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63395"
FT                   /db_xref="GOA:Q46TY9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63395.1"
FT                   /translation="MNKGELVSAIAAEAELSNAAAERALNAALDSIKKAVAKGDSVTLV
FT                   GFGSFSSGKRAARTGRNPRTGETIKIPAAKTVKFSAGQGFKDAVNKKK"
FT   gene            683148..683633
FT                   /locus_tag="Reut_B4040"
FT   CDS_pept        683148..683633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4040"
FT                   /product="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4040"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63396"
FT                   /db_xref="GOA:Q46TY8"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63396.1"
FT                   /translation="MNDQSHQLSMTVLMTPDMANFSGNVHGGTILKYLDMVAYACASRY
FT                   AGRYVVTLSVDQVVFRQPIHVGELVTFLAAVNYTGRSSMEIGIKVVTENIRSKLVRHTN
FT                   SCYFTMVAVDDNGAPAEVPPLEPRDEVERQRFASAQQRRALRQEMEKRHDAIKSSGN"
FT   gene            683641..684114
FT                   /locus_tag="Reut_B4041"
FT   CDS_pept        683641..684114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4041"
FT                   /product="CreA"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4041"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63397"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63397.1"
FT                   /translation="MARFLSLLAGACLAVAGTHALAEEIGSVNTNFRMTGSDKVVIEAY
FT                   DDPMVQGVTCYVSRARTGGIKGTLGMAEDPPEASIACRQVGPISFKGPLRQQEDVFSER
FT                   MSIMFKTLHVIRAIDRKRNTLVYLTYSDRIVSGSPQNSVTAVPVPGGTTIPVK"
FT   gene            complement(684145..685893)
FT                   /locus_tag="Reut_B4042"
FT   CDS_pept        complement(684145..685893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4042"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4042"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63398"
FT                   /db_xref="GOA:Q46TY6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63398.1"
FT                   /translation="MSSNFQPASNWPALSLAEAHARLTAPGAPFETETRMIRGIPTTVW
FT                   KNAPPTLRDLFQATQAFGERTFVVYEDERVTYAAFRRAALHVAHALVRDGIRPGDRVAL
FT                   AMRNLPEWPVAFYGALLAGAIVTPLNAWWTGAELEYGLNDSGSRVAIVDAERLDRLASH
FT                   LTACPALERVYVSRAGAVDGEAKVVSLESVTGASPAWAILPDLALPDVAIDPEDDATIF
FT                   YTSGTTGKPKGALGTHRNATTVAVASLFGPLRNLLRRGEPIPAPDPAAPQKAALLSVPF
FT                   FHVTGCMAVLNSALANGGKIVLMHRWDALRALELIERERCTTAGGVPTIAWQLLEHPER
FT                   DRFNLSSLESMSYGGAPASPELVRRIGETIPQSAPGIGWGMTETSATFTSHSAEEYVLR
FT                   PDSSGPALPIGEMKIVDGRGQSLPVGETGELMVRGANVVRGYWNKPEATSQTFADGWLR
FT                   TGDIGRLDDEGHLYIVDRMKDMLIRGGENIYCIEVESTLYEHPAVMDAALVGIPHKTLG
FT                   EEPGAVVSLKPGMQATEDELRGFVAERLAAFKVPVRIVVLPDLLPRNANGKILKSNLRK
FT                   LFEPAA"
FT   gene            complement(686028..686792)
FT                   /locus_tag="Reut_B4043"
FT   CDS_pept        complement(686028..686792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4043"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4043"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63399"
FT                   /db_xref="GOA:Q46TY5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63399.1"
FT                   /translation="MSLFDLSGKVAIVTGSSRGIGRAIAEQMAVQGAKVVISSRKLEAC
FT                   QEVVDAINARHGAGTAIAVPANISSRDDLQRLVDETNRTFGKVDVLVCNAASNPYYGPM
FT                   SGVSDDQFRKVLDNNVISNHWLIQMVAPQMIERKEGSIIIVSSIGGLRGSPTIGVYNIS
FT                   KAADFQLARNLAVEFGPHNVRVNCIAPGLIKTDFARALWEDPERYKQSTQGAPLRRIGE
FT                   PIEIAGAAVYLASAASSFMTGQAMVVDGGVTI"
FT   gene            complement(687008..687853)
FT                   /locus_tag="Reut_B4044"
FT   CDS_pept        complement(687008..687853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4044"
FT                   /product="N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4044"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63400"
FT                   /db_xref="GOA:Q46TY4"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63400.1"
FT                   /translation="MITLDAPRLDAYLARLGLDAPPSPTLESLDALIAAQLARIPFENI
FT                   DPLLGRPVRIDIDAVFDKLVTRGRGGYCFELNTLLAAALTALGYTVTPLAARVRWGVAN
FT                   DVQTMASHMLLRVEVAHRSYLADVGFGGPSPFRSLPLSAPAASAFPYRLVPAPDDTTAS
FT                   TFHGQDLEVRGDEGWLKVYRFDLTPQPWIDFIARNWYICTHPDSPFTQRLMVARTDGDL
FT                   RLTLANGELAARAADGTVHRQPLSTAGDVIDVLADRFHVALDADSRAGLERVLPALLGA
FT                   "
FT   gene            complement(687868..688650)
FT                   /locus_tag="Reut_B4045"
FT   CDS_pept        complement(687868..688650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4045"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4045"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63401"
FT                   /db_xref="GOA:Q46TY3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63401.1"
FT                   /translation="MGMAQPPGSGARGPSGIPRGTPGGNAAPSRAEAAATLQASAWFSQ
FT                   LPGPLREALLDDGTWRHLAAGEALFARGDAFDGLYCVASGTMQVDAAGESGKAALLGLL
FT                   EAGAWFGEICLFDGLPRTHDARAVHAARLWHVPRASLERRLAQHPAWWREFGLLLAAKT
FT                   RLVFDYVEEMQLLPPAARTARRLAAIARGYGNPAHGTDDATPAVQAVRIPQEQLAQILG
FT                   LSRQTVNQALRELESRGLLRLRYGSIELLDLTALEMLN"
FT   gene            688829..689326
FT                   /locus_tag="Reut_B4046"
FT   CDS_pept        688829..689326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4046"
FT                   /product="Protein of unknown function DUF962"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4046"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63402"
FT                   /db_xref="GOA:Q46TY2"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63402.1"
FT                   /translation="MNTLVEHLANYAAYHRNPRNVATHFIGIPMIVLAVTTLLGRPVMP
FT                   LGDGDAYLTPAMVVYALSCLFYLRLSAGFGVAMAIVLALFLYAGAHLAALPTGGWLAAG
FT                   IGLFVAGWVIQFVGHYYEGRKPAFVDDLVGLLIGPLFLVAETAFACGLAAGTRDAMMAR
FT                   VS"
FT   gene            complement(689338..690291)
FT                   /locus_tag="Reut_B4047"
FT   CDS_pept        complement(689338..690291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4047"
FT                   /product="ATP-binding region, ATPase-like:Histidine kinase,
FT                   HAMP region:Histidine kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4047"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63403"
FT                   /db_xref="GOA:Q46TY1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63403.1"
FT                   /translation="MVSRSIVLASSDTPVSVSVALDRTELRAARRAFNTMLGWSLGALG
FT                   MGLMLAVAAQVRFGLAPLKRLRQALGAMQARRESRLGGNWPTEVEPLISQINTLLDHNA
FT                   QALERSRQQAADLAHAVKTPLAVLANEASSLPSPAADAVSRQVDAMRRQVDRHLARARA
FT                   AGAAAARGQRIEAGPAVRELTRALTRLHGARQLDIGVESEGHFAGDRQDLVEMLGNLLD
FT                   NACQWARSQVRIHLREDTAAALLEVLVEDDGPGMPPEARELATTRFGRLDEAAAGSGLG
FT                   LAIVTEIAAMYEGSLELGNSALGGLAAHLRLPAGMA"
FT   gene            complement(690325..690639)
FT                   /locus_tag="Reut_B4048"
FT   CDS_pept        complement(690325..690639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4048"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4048"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63404"
FT                   /db_xref="GOA:Q46TY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63404.1"
FT                   /translation="MAAIWLAAALGASWWLLSTLFERHVNDTYVRQLEHQFTSLTAALD
FT                   WSPDGRLLLTRAPADPRYELPYSGAYWQARAPGALLRSRSLWDTEMPEKAAHKVAGTPA
FT                   "
FT   gene            complement(690674..691369)
FT                   /locus_tag="Reut_B4049"
FT   CDS_pept        complement(690674..691369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4049"
FT                   /product="Response regulator receiver:Transcriptional
FT                   regulatory protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4049"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63405"
FT                   /db_xref="GOA:Q46TX9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63405.1"
FT                   /translation="MTQTSGHEDISRPPPCPASPRKPPCFRARAGRCCARACAWHRRAG
FT                   TCRQGRRSRPRGGAVRGNPAAVPHSRSGFAAHVNVPVLILTARDSWTEKVEGIDAGADD
FT                   YLAKPFRMEELQARIRALIRRAHGMPAPELSCGSVQLNPRAGTVTVDGAAVVLTAHEFK
FT                   VLDYLMHHPGAIVSKSTLTEHIYAQDFDRDSNTIEVFVGRLRRKLGVDVIETVRGQGYR
FT                   LRPPPATGN"
FT   gene            691429..691716
FT                   /locus_tag="Reut_B4050"
FT   CDS_pept        691429..691716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4050"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63406"
FT                   /db_xref="GOA:Q46TX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63406.1"
FT                   /translation="MLANRIRSPAMSHHPSTASLSQSVSPSPQHRSPDRRAAFLAAGAL
FT                   FSVLCVSSVFWIHVDLIALLREWSRADANLPLIALGTMAVGSLIAAWLGE"
FT   gene            692016..692480
FT                   /locus_tag="Reut_B4051"
FT   CDS_pept        692016..692480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4051"
FT                   /product="Histone-like bacterial DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4051"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63407"
FT                   /db_xref="GOA:Q46TX7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63407.1"
FT                   /translation="MATKAKPTAKTTATKPAAKKAAATKAPVKAAAKKAAPAKKAAPAA
FT                   AVTPRPLKDTFNKSSLVAHLVAQTQMEPKAVKTVLAHLENTIVGALNKKGAGEFTLPGL
FT                   LKVTAQQVPAKKKRFGKDPFTGEERWFPAKPASVKVKVRPLKKLKDAAAA"
FT   gene            complement(692771..693142)
FT                   /locus_tag="Reut_B4052"
FT   CDS_pept        complement(692771..693142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4052"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4052"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63408"
FT                   /db_xref="GOA:Q46TX6"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63408.1"
FT                   /translation="MPHLVIEITENTRLNCSPEELLDEANAALLASGEFGEADIKSRCI
FT                   MLSTFRQGVEAAERAFVHARLSILDGRELAVRRALGQAVCDVIAEAVRPATAEGQSVQI
FT                   SVEVREMERASYAKQIVGG"
FT   gene            693293..693814
FT                   /locus_tag="Reut_B4053"
FT   CDS_pept        693293..693814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4053"
FT                   /product="MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4053"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63409"
FT                   /db_xref="GOA:Q46TX5"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63409.1"
FT                   /translation="METISFEIFLRLFCGLVAGAAIGLDRNLRGKAAGMRTLGLVSLGA
FT                   ATAVCLVTQYGPQMDAVSRVLQGLLTGIGFLGVGVIARHGSHQRPQGLTTAAAIWLSAI
FT                   LGAAAGAGYYAVGGLALVLGMLLLWMGGRLEMRLHRVLDPINGDKHNHRDNGEAGKQAK
FT                   GNEPDDDVWP"
FT   gene            693950..694864
FT                   /locus_tag="Reut_B4054"
FT   CDS_pept        693950..694864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4054"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4054"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63410"
FT                   /db_xref="GOA:Q46TX4"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63410.1"
FT                   /translation="MKPITLFGAPTDVGASTRGCTMGPEALRIADIVPALARMGLDVSD
FT                   AGNIAGPVNPLAPPVQGLRHLDEVVAWNRGVFEASTRILQAGRMPVLLGGDHCLAVGSV
FT                   SAVARHCREAGRKLVVLWLDAHADANIGTSTPTGNMHGMPVACLCGDGPTPLTTLGGQP
FT                   PAVRPEEIRQVGIRSVDAQEKLRLHALGLKVFDMRYIDEYGMRQTMEQALAGVDDDTHL
FT                   HVSFDVDFIDSAIAPGVGTTVLGGPTYRETQLCMEMIADTGRLSSLDVMELNPACDVRN
FT                   ETARLVVDFLESLFGKSTLLRAR"
FT   gene            complement(694933..695526)
FT                   /locus_tag="Reut_B4055"
FT   CDS_pept        complement(694933..695526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4055"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63411"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63411.1"
FT                   /translation="MSERLIMLDVPGVLYSDRSQARLGGVPDSGTLRDVRFFDPIALGY
FT                   IRRLFGLAGARVVVSDAWRRGTPAAIFQQLDLQVEGMTPAVAGGHGAEIAAYFAGRAMP
FT                   STYVILSCAPADSMSDAQREHLVSVDPAQGLTVENFRRALDILGVACPSTLMPPPRLDA
FT                   GLRAKLAQLQRLAREEPARFTAPAESTAAAALHA"
FT   gene            complement(695736..696563)
FT                   /locus_tag="Reut_B4056"
FT   CDS_pept        complement(695736..696563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4056"
FT                   /product="Response regulator receiver:Transcriptional
FT                   regulatory protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4056"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63412"
FT                   /db_xref="GOA:Q46TX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63412.1"
FT                   /translation="MPDPMNIALLSGQSAHLKAVPELLARAGFRCNVFASTRALIQGVS
FT                   LASYDMLLIHDELPDTAAIDVIRTVRCARSRDLPIMMLGGNGSEEALVEALDAGADDYL
FT                   SGPQSTRVLLARMAALRRRATGDRQRQGLLARAGPYQLNSVGRFATLHGERITLTPKEF
FT                   DLAMLLFTNAGRVLANRRIEQAIWHHELPPLSRALAGLMSRLRKTLRLSPENGISITVV
FT                   YAHGYRLDIHEDSPTHPRKHGNPALAQQQPDLHTGLLADDRAHGVRPVTDSAC"
FT   gene            696713..698269
FT                   /locus_tag="Reut_B4057"
FT   CDS_pept        696713..698269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4057"
FT                   /product="Phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4057"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63413"
FT                   /db_xref="GOA:Q46TX1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030840"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63413.1"
FT                   /translation="MPQKAFVATQQRPGAAPRISLCQNKNHRDPVPRGGHLGSLHMLSP
FT                   SVVATVILIFHVIGVLAALHAVMTVRTAPGAIAWAGSLVMMPYLTLVPYLIFGRSRFAG
FT                   YVNARRFNDDRLREIRHGMTPEDRDARSACVVHAPEPACMRALPRLTGMPCLANNDVRL
FT                   LVNGTTTFEAIFAAVAAARQVVIVQFFIVHDDVLGRRLQALLCERAQAGVKVYFLYDSI
FT                   GCHALPRGYVKTLMAAGVEARAFSTHRGFVNRFQLNFRNHRKLVVVDGSQAFVGGHNVG
FT                   VEYLGERPPLAPWRDTHISVRGSAVLDLQMAFAEDWYWAAREVPYLLMPPPDVGGRMTC
FT                   QVVPTGPADAQETCSLFFVEAIQAARHRVWITSPYFVPDEAVFAVLRLAVLRGVDVRIL
FT                   IPARPDHLVVFAASTLYAHQAVAAGIKLYRYQPGFLHQKVILVDDDAAAVGTANLDNRS
FT                   FRLNFELMVMTADREFASQVADMLEADFAQARRIGVDEFLRAPAPLRVAMHVAKLFAPI
FT                   L"
FT   gene            698361..699017
FT                   /locus_tag="Reut_B4058"
FT   CDS_pept        698361..699017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4058"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4058"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63414"
FT                   /db_xref="GOA:Q46TX0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63414.1"
FT                   /translation="MSRTASTMPARTTYRHGDLRRALLEAGIDLAREGGPDAIVLREAT
FT                   RRAGVVPNAAYRHFSSRQDLLRAVRAAALSALAIAMEAELGGLRPASSAATLARASLRA
FT                   VGTGYLRFALSEPGLFRTAFSVPDQVEDDADPAKAGHSGLNPFQLLSAALDRMVEAGIL
FT                   PAAHRQGAEYLAWSAVHGLAMLVLDGPLRGREPGEAAALGQRLLDMVERGLQSAT"
FT   gene            699302..699655
FT                   /locus_tag="Reut_B4059"
FT   CDS_pept        699302..699655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4059"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4059"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63415"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63415.1"
FT                   /translation="MRYAVGSVFTMAALLAGCAVYPDYYGADYLGYPAYPVGSPYYSGY
FT                   PVTPGYPYYGPGYGGYYGSFAYVYGGGRCCWYGGHRGWHGSGGWHGSGGWYGGGRSGGR
FT                   GSGGGRGGGGHGR"
FT   gene            699655..699915
FT                   /locus_tag="Reut_B4060"
FT   CDS_pept        699655..699915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4060"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63416"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63416.1"
FT                   /translation="MPYGEGLWSPSQRGGYLFTPQNCQQRSLAMRKPLPEKAPKGGRQQ
FT                   PKSAPADERIERELDEALKETFPASDPIAVDPDKPRPSKTS"
FT   gene            complement(699932..700369)
FT                   /locus_tag="Reut_B4061"
FT   CDS_pept        complement(699932..700369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4061"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63417.1"
FT                   /translation="MNMEKGMPNEQFLATQETRRSGLQALRAALLQVHKEVIGYDRGQY
FT                   ERLNGPIPAGLFVQLVTEDDFFRWMDPLSRLIIEIDEELESPEYHDETCRAVARATERL
FT                   FSDKGDGAFRKRYQEALQDESGVIVAHGRLMSVIGQLRQLP"
FT   gene            701159..701908
FT                   /locus_tag="Reut_B4062"
FT   CDS_pept        701159..701908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4062"
FT                   /product="Metal-dependent phosphohydrolase, HD subdomain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4062"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63418"
FT                   /db_xref="GOA:Q46TW6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63418.1"
FT                   /translation="MAGEIAARMNYRSIITLASLALAGCSRYPDASGHFIRTAFIADRL
FT                   AGLMEMDRLTQDHIRLSTPVHDLGKLLIPDRVLLKPGKLTPAERSIMERHSGMGADLLS
FT                   TSADPLHQFAAGIARHHHERFDGSGYPDRLAARRIPLAARIVAVVDAFDAMTETRCYRP
FT                   RMADEEARAIIASGSGSHFDPEVVEVFQEGFPDLLSARATANELLSLGNDTAVIAGFYG
FT                   LSRTDFRSAARLVTKVVATPLHFEALV"
FT   gene            702197..703045
FT                   /locus_tag="Reut_B4063"
FT   CDS_pept        702197..703045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4063"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63419"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63419.1"
FT                   /translation="MNPAKRAQHDAWILSQEKAKAGATANAGQRARPASTASGTSADPA
FT                   SRSGSGARQAPPADSRTSRKNADSGSAVNPAGASTASKALFVLVVAGAAIYLIIPTSHQ
FT                   SADGSRQAEGWTPSVSTIAAMTGEPRAAAATPTKLPAPLPQYVRQPTAPNGQAWPAWTS
FT                   YIPGYPIRKTGGLSSLTVDNSRNSSDVFLKVFSLGGGDTIPVRFALIKAGTSFEFSNIE
FT                   HGSFDVRYMDLDTGKIAKSNPFELEEIAEGNATRYSRMSLTLYPVRNGNTQAPEIEESE
FT                   F"
FT   gene            complement(703138..704268)
FT                   /locus_tag="Reut_B4064"
FT   CDS_pept        complement(703138..704268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4064"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4064"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63420"
FT                   /db_xref="GOA:Q46TW4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63420.1"
FT                   /translation="MALAVVPKHCCALLPPIRKYARPDLMPTLFDPIRIGDLDLPNRVI
FT                   MAPLTRSRAVGGKRVPNALMAEYYVQRASAGLIISEATAVTPQGVGYADTPGIWTDEQV
FT                   AGWKHVTDAVHAAGGRIFMQLWHVGRISDPIFLDGELPVAPSAIAAQGHVSLVRPKRAY
FT                   VTPRALETEEIAGVIAAYRHGAENAKKAGFDGVEIHGANGYLLDQFLQDSTNQRTDAYG
FT                   GPIENRARLLLEITDACIDVWGADRVGVHLSPRGDVHSMGDSDLAATFGYVARELGKRR
FT                   IAFICAREALGDNRLGPALKAAFGGVYIANEKMTKQTAEHVLAAGEADAVAFGQLFIAN
FT                   PDLPRRLALDASLNEPRPETFYHPGAEGYTDYPALV"
FT   gene            complement(704281..704634)
FT                   /locus_tag="Reut_B4065"
FT   CDS_pept        complement(704281..704634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4065"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4065"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63421"
FT                   /db_xref="GOA:Q46TW3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63421.1"
FT                   /translation="MVRESPKQRAPDSASAKPELDVDAIHKALANPMRRKILAWLRTPE
FT                   AYFSAQEHPLDMGVCAGLIDTHCGLSQSTVSAHLATLQRAGLIRARRIGQWVFFKRDEE
FT                   TIQAFLDHIHQDL"
FT   gene            complement(704970..705296)
FT                   /locus_tag="Reut_B4066"
FT   CDS_pept        complement(704970..705296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4066"
FT                   /product="fatty acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4066"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63422"
FT                   /db_xref="GOA:Q46TW2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63422.1"
FT                   /translation="MTDGLTLGDTLSWPARYLPRKTALVTGTGTARRAWTYAELDTEVN
FT                   QHANALLSVGIGKGDVVAAFLYNTPAFVFTLLACARIGAVFNPVNYRLAAQELASGSAT
FT                   ASTT"
FT   gene            705637..705960
FT                   /locus_tag="Reut_B4067"
FT   CDS_pept        705637..705960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4067"
FT                   /product="probable thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4067"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63423"
FT                   /db_xref="GOA:Q46TW1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63423.1"
FT                   /translation="MPTKDHYLSDAPPREEIDTLQGPALLEFGTDWCGYCQRAQPALAQ
FT                   AFASYPGVRHIKVEDGSGRPLGRSFRVKLWPTLVFLRDGREVSRLVRPSDAAPILEAMA
FT                   AIA"
FT   gene            706172..707305
FT                   /locus_tag="Reut_B4068"
FT   CDS_pept        706172..707305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4068"
FT                   /product="Response regulator receiver:Metal-dependent
FT                   phosphohydrolase, HD subdomain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4068"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63424"
FT                   /db_xref="GOA:Q46TW0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63424.1"
FT                   /translation="MSADSPEQRPTVLVVDDIPENIAAMVAMLQDQYRVRVATRGAKAL
FT                   QLAASSAPDLILLDVSMPEMDGYETCRHLKANPATAHVPVIFLTARTDELDEARGFEVG
FT                   AVDYIMKPVSPPVARARIASQLALKQAHDFLRDRSAYLEAEVQRRTREITQIEDATIIA
FT                   LAALAETRDNETGNHIRRTQHYVRALARALRDDPRFSAQLDDRTIDLLFKSAPLHDIGK
FT                   VGIPDRILLKPGKLTAEEFEIMKSHTMLGRDAIADAEAQCGTRNSFLRYAREIAHYHHE
FT                   KWDGTGYPEGLAGDDIPVAARLMALADVYDALISRRVYKPAFSHEESVRIIMEGRGRHF
FT                   DPGMVDAFHSIADEFHAIALRFADPEHEPQRDLLPAI"
FT   gene            707306..711160
FT                   /locus_tag="Reut_B4069"
FT   CDS_pept        707306..711160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4069"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4069"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63425"
FT                   /db_xref="GOA:Q46TV9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63425.1"
FT                   /translation="MISKPNPPAGFWLRSSLLAYGALLILAVWLVAFAAMSMVRQNEQV
FT                   SVGARLGATVNTTARQLETWASEQRRRAVSMSTLDDTVRLARPLLANGADPSPERVQEF
FT                   VNWITPLYRSNGYIGYGLISMDNRIIVSDLVERNGQPLQPEAAAAALRARENGASLSAP
FT                   YPGPVLADGPVGPVDRSPFQIVCSRLWDNDRVVGALCLRIDPYAVMLQILKAARFGNTG
FT                   ELYVIDRDGRLNSPSRFDESLVGQGLLSPGDASMFNLRVRVPHDLGDGRWRVDDDAPLT
FT                   RMAQQVLHSETLQVSFGYQDYRGKRVAGAGLWIPALGSALILEQDMEEALSSYLSTRTV
FT                   VASMAAAIMLLIGVAAWALRKSQHRLAQSEERLRALLDHSPAIMHLKDRNHAFLQLNPS
FT                   MEKLLGLTRDQVLGKTDRELAVMPDGTRERWEIEARVMATGRAEEQIYAMEAPEGSRQL
FT                   RVIRFPVHDPTSNAVVGVGAVGIDITDQERANRELKEMSQTLEHKVWERTRELAVANAE
FT                   LAKAKHEAESAAQAKASFLANMSHEIRTPMNAVIGMAHLALSTQLDPQQRDYVEKIQRS
FT                   GQHLLGILNDILDLSKIEAGKLEIEQIDFSLERLLRTVGDLVSERAAAKQLELVVDVQP
FT                   DVPDSLRGDPLRIRQVLINFTTNAVKFTERGEIVIRVARCAGEHAESRVRLHFEVRDTG
FT                   IGIDADAIPRLFRSFEQADSSTTRRYGGSGLGLAISHRLVTLTGGTIGVQSELGKGSTF
FT                   WFELSLLPGTRRAPALLVQPELAGRRLLVVDDHGYARQVIGSMLRGFGFRADEVESGEK
FT                   ALSAIQHADAIADPYHAVFIDWRMPGLDGIQTVRKLAAMSLQSQRPRPLMITANGREEV
FT                   VREGERNGFETTLHKPVSPSVLFDATMRVLASEPGRMADKGAPRSVTGPSWTLPHARVL
FT                   LVEDNEINREVATHLLQQAGITPDTAENGAIALELLAVQDYDLVLMDMQMPVMDGFEAT
FT                   RHIRANPRLASMPVVAMTANALPEDRNRCLAAGMDDHIAKPISPATFFTTLHRWLTGAP
FT                   ARTGGNLHDAAWHENVANPVAEIIEVVEPEAEEEEAAPDWMRALAGTGLLDVDGAVARV
FT                   GGRIDTFRQLLGRLLSGYAQTPQQIGALLQAGERVEAARLAHALAGLAGNLGARQVAGA
FT                   AASLECTLMGMAADDASALLNGLEQAHASLCMALRQHLPAETPEPAAPVATQVTSMTDV
FT                   LDRLRRQLADGASEASLTFAANRQRLADMLAGDRFRRLCEAVENYDYESAVEVLADSAG
FT                   "
FT   gene            complement(711238..711675)
FT                   /locus_tag="Reut_B4070"
FT   CDS_pept        complement(711238..711675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4070"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4070"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63426"
FT                   /db_xref="GOA:Q46TV8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63426.1"
FT                   /translation="MPNPAILWGTFARIQKECRMPQPTDLRAYAYVLAVPDLPRSAAYF
FT                   ENALGFSTDWQDGDNWRALSRGSVRVMLGHCPDALPPSQTGDHSYFAYFHVDDIDALHA
FT                   ELASRGAIIAQPPADKPWGMREMALATPDGHRMMVGQELVR"
FT   gene            complement(711969..712352)
FT                   /locus_tag="Reut_B4071"
FT   CDS_pept        complement(711969..712352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4071"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63427"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63427.1"
FT                   /translation="MIPKGNAASNQSEEAADMHNKILKALLLTVATVGASAMAGHAAAQ
FT                   GMQDRGISGDRYGYIMRQGNPDPYTDGGNVLGKRDPYTDGGNALGKRDPFTDGANHPAT
FT                   TLNIAGMDQRGVSASPAHTGANA"
FT   gene            712655..713647
FT                   /locus_tag="Reut_B4072"
FT   CDS_pept        712655..713647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4072"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4072"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63428"
FT                   /db_xref="GOA:Q46TV6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63428.1"
FT                   /translation="MNQAPTPSSPSPQEPAPARTLRHIVADEAQAAAAELDGWQQRYQQ
FT                   LTPGVFRAEVSQVTYGDVHVFRELTSQSLLEEGEAARGYVSLALPDVQCQGGWFSGYAM
FT                   DGQTLLCAGNGRALAMRTPLQLDLAGLTVPMPALQRAMALAGGETLRLERMAPVRQVTK
FT                   GASREFRAVLLSVLATAAIDAEVFSNRFVESAMRDALLLAAATALVGEGIDGNEPLPTI
FT                   PARRRLVADAYQMIRSAPDQPWSILSLCERLGVSRRTLQYSFNEVTGLSPLDFVRAVRM
FT                   NGVRQALRTGAAESVGGAAASFGFQHLPRFAAQYRAFFGELPSATLARR"
FT   gene            complement(713663..715333)
FT                   /locus_tag="Reut_B4073"
FT   CDS_pept        complement(713663..715333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4073"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4073"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63429"
FT                   /db_xref="GOA:Q46TV5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63429.1"
FT                   /translation="MTRQTMNDTAPSSSTPQPTPQPGRRQWLSHLAGAAVTTVAAAAMT
FT                   SRTASAAPAGTAPAASGPGTAGGGTPDPIVLMPAWQLSREIRGGRLSCRQVMNAYLAHI
FT                   DRVNPVTNAIVALRDRDALMQEAAAADEAFAARKVAGWMHGVPQAPKDLALTRGIRTTF
FT                   GSPIFKDNVPTSDAIIVERVRKSGAILLGKTNTPEFGLGSQTFNPVYGPTRNPYDSTRT
FT                   AGGSSGGAAAALAMRLLPVADGSDFGGSLRNPAGFCNVYGFRPSAGRVPYGPTPEVFIQ
FT                   QLGYEGPMGRTVADVALLLATQAGPDPRTPQALAPDPVLATLTPDNVMAALSTNLKGKR
FT                   VAWLGDWDGYLPMEDGILQLCEQALQAFPAFGVGVDKIKPPFSPERLWKTWLVHRHFLV
FT                   GNGMLPFYRDEAKRALLKPEAIWEIEGALKLSGADIYAASADRSAWYQAVEGVFAKFDY
FT                   IAVPTAQVFPFDVRQPWPKEIAGRQMDTYHRWMEVVFPWTLSGCPAISVPVGFGKNGLP
FT                   MGMQLIGRPRDDLSVLRLARAYEQERDWVGRHLPRAVMA"
FT   gene            complement(715364..716863)
FT                   /locus_tag="Reut_B4074"
FT   CDS_pept        complement(715364..716863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4074"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4074"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63430"
FT                   /db_xref="GOA:Q46TV4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63430.1"
FT                   /translation="MDTRTELLSAATRAFLQRPKRMLIDGQWCAATDGAVFTTEDPASE
FT                   TTLAEVPAAGPADVDAAVQAARAAFEQGPWNAMRPSDRERLLLRLADLVEANAEELAQI
FT                   EALDNGKPATMARAIDVAGAAGFLRYMAGWATKLHGESLDVSVPLVREREFVAFTRQEA
FT                   VGVVGAIIPWNFPLLMAAWKLGPALACGCTVVLKPAEETPLSALRLGELVMEAGYPAGV
FT                   VNIVTGDGARCGAALAGHPQVDKIAFTGSTEVGKLVGGAAMERLARVTLELGGKSPVIM
FT                   LDDMSPEAAATGAAQAIFFNQGQVCTAGSRLYLPRSKFDATVQALADIANSLRLGPGLE
FT                   PDTGMGPLVSRRQHKRVAGYVQAGVDAGAQLICGGNADLPRGHFFKPTVLARAPETSSV
FT                   VQEEIFGPVVVALPYDDIDEVVGRANGTPFGLAASVWSNDLSRVHRLVPRIKAGTVWVN
FT                   CHNLLDNAMPFGGFKQSGLGREMGRAVFDHYTETKSVMIAV"
FT   gene            complement(716898..717317)
FT                   /locus_tag="Reut_B4075"
FT   CDS_pept        complement(716898..717317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4075"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4075"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63431"
FT                   /db_xref="GOA:Q46TV3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63431.1"
FT                   /translation="MQRAAIRLVLAWLVTAVVAGAAQAEGRLERGHANYVLHCSGCHLP
FT                   DGSGKPAAGIPDMRATVPQLLATAAGRAFLIQVPGTSGSSLTNAEVAELMNWMLPALTG
FT                   RQDIAPFTTEEVTRYRNDRLDDVAAHRAAILGTSR"
FT   gene            complement(717319..717774)
FT                   /locus_tag="Reut_B4076"
FT   CDS_pept        complement(717319..717774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4076"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4076"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63432"
FT                   /db_xref="GOA:Q46TV2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63432.1"
FT                   /translation="MKFRSHPMWLALLLAGAAATASAADLVAQGKEVFAANCAACHNND
FT                   ASGIPGVAPPLANALRERLGSAAGRTYLANVLVHGVAGPIESQSQSFNGVMPAFGTLPD
FT                   ESLAAVLAWLGTQNGQATATVGPDALAQARAQRKTPGAVRKLRDAAN"
FT   gene            complement(717771..718286)
FT                   /locus_tag="Reut_B4077"
FT   CDS_pept        complement(717771..718286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4077"
FT                   /product="Amine dehydrogenase"
FT                   /EC_number="1.4.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4077"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63433"
FT                   /db_xref="GOA:Q46TV1"
FT                   /db_xref="InterPro:IPR013504"
FT                   /db_xref="InterPro:IPR016008"
FT                   /db_xref="InterPro:IPR036560"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63433.1"
FT                   /translation="MWFDKLFERQTRRAAQRTGRRSMLATLGKAMVGTVALPVLPFDRS
FT                   AHAAAAHGAKTGKAVDETSCDYWKYCAVDGFLCSCCGGSSTTCPPGTEPSRVSWVGTCR
FT                   NPADGKDYMVSYNDCCGKTTCGRCECNTNERERPGYKLGVHNDVNWCMSNSSTMFHCTT
FT                   SIILGVQE"
FT   gene            complement(718306..718893)
FT                   /locus_tag="Reut_B4078"
FT   CDS_pept        complement(718306..718893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4078"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63434"
FT                   /db_xref="GOA:Q46TV0"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013478"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63434.1"
FT                   /translation="MTALVIANIVLWIAVLALLFGLYALARQVGILYERVAPMGALMID
FT                   AGPRVGQPLQPFALQDVRGTSVTVGGHQAASTLLFFLSPTCPVCKKLLPVLKSIRASEG
FT                   NWLRIVLASDGEQPEHLAFLRQAGLGDFDYVLSRELGMHLQIGKLPYAVLLDEHGTLRA
FT                   KGLVNSREQLESLFTAMDLNVASVQQFLETHA"
FT   gene            complement(718928..719491)
FT                   /locus_tag="Reut_B4079"
FT   CDS_pept        complement(718928..719491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4079"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63435"
FT                   /db_xref="GOA:Q46TU9"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63435.1"
FT                   /translation="MTAYDLIGDPVVTAACSAAAALVLLLSVAPKLREPDRFHGAVDAY
FT                   RLVPTAWSRVVAIGFIGAEVLAVLLLALMPLQAASALAAMGVTGLATGAVAINLMRGRR
FT                   DIRCGCGGADDSMPLSAGLLGRNAVLLAVLSVAAASAAVGNGRDMSALDYAAAGFIALA
FT                   LLLMWLGATQLLVNAGRVRGPVRA"
FT   gene            complement(719488..720693)
FT                   /locus_tag="Reut_B4080"
FT   CDS_pept        complement(719488..720693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4080"
FT                   /product="Amine dehydrogenase"
FT                   /EC_number="1.4.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4080"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63436"
FT                   /db_xref="GOA:Q46TU8"
FT                   /db_xref="InterPro:IPR009451"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63436.1"
FT                   /translation="MNNASSAPRRAPREAGRRSRRLIPLLLAAVLGAGAGAAVAEDLPP
FT                   ETLTVAPLAPADENRLYISDVAFRHMVDGRLHIVDGRKMKYLGLLPTGFGGQSVLSPDK
FT                   RSIYVVSTYYPRLTRGERTDVVSIYDADTLAYRSEIVIPPRHAQSLNYRGIIAVSADGR
FT                   FLYVQNATPATSVSIIDLQAGKFVAETQTPGCWGIFPTAASSQRFRTLCSDGAMLTVSH
FT                   DAQGQPTGQKRSTRMFDPDADPVFLHSERIGDTLYFMSFNGNVYTADLSADAPAFGKPW
FT                   PILSAADARGGWKPGGYQLFTLHAATQRLYVGMHPRSREGSHKTPAAEIWTVDLAQHKR
FT                   VARAPGQNALALTITQSSQPVLYALDAAKSGVVALDPARNLKQVARMDNVSENSVQVEA
FT                   HQ"
FT   gene            complement(720860..722413)
FT                   /locus_tag="Reut_B4081"
FT   CDS_pept        complement(720860..722413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Reut_B4081"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Reut_B4081"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ63437"
FT                   /db_xref="GOA:Q46TU7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q46TU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ63437.1"
FT                   /translation="MRIWLWIWLMPLVPALFACTTVGPDYHLPDTAAVRAPEANGKLLG
FT                   SANPAVSIGPVPDAWWQLYNDPRLDRLVREALAANTDIRVASANLRRATAALHEVEAEN
FT                   LPQGGISASVSRAQLSGQSYLQTTKPPVFNLGDFGPGVSYLIDFFGKLARADEAALANM
FT                   QASEAALDAARVGVAAQTVRAYVQGCAASHELEVARHQIALQERAVDATRRLASAGRAE
FT                   PTDTVRAQARVEALRAALPPLAAAREAAGFRLALVLGKPPAALPAEDIECHEEPPLTQP
FT                   LPVGDGAALLKRRPDIRQAERELAAATAKIGVATADLYPSIRIGASAGLTGLLSDLGSG
FT